F495183

General Info

Members Datasets Scaffolds Average Seq Length
1646 630 1383 218

Family's Representative Sequence

Representative Sequence 3300003751|Ga0055538_1000229|Ga0055538_100022917
Length 244
Sequence MEATAGAGGQPGSTRQGTHDIMAYQFDFLSTFDYSDVIVKGVLTTIELIAIGGVLGVAVGIFGAWARSQGPGWLKPIVSGYVEIIRNTPFLVQLFFIFFGLPSLDIHISEIAAAILAMVINLGAYSTEIIRAGVQAIPRGQIEAAQSLSMSRMQIFRHIILRPALQKIWPALSSQVVIVMLGSAVCSQIAVEELSFAANFIQGRNFRAFEAYIVATLIYLVLAVLLRQVLRLIGHYFITARRTA

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2511231003 Herbaspirillum sp. CF444 Isolate Rhizosphere
4 2511231004 Pseudomonas sp. GM102 Isolate Nodule
5 2511231006 Pseudomonas sp. GM17 Isolate Nodule
6 2511231007 Pseudomonas sp. GM18 Isolate Nodule
7 2511231008 Pseudomonas sp. GM21 Isolate Nodule
8 2511231010 Pseudomonas sp. GM25 Isolate Nodule
9 2511231011 Pseudomonas sp. GM30 Isolate Nodule
10 2511231012 Pseudomonas sp. GM33 Isolate Nodule
11 2511231014 Pseudomonas sp. GM48 Isolate Nodule
12 2511231015 Pseudomonas sp. GM49 Isolate Nodule
13 2511231016 Pseudomonas sp. GM50 Isolate Nodule
14 2511231017 Pseudomonas sp. GM55 Isolate Nodule
15 2511231018 Pseudomonas sp. GM60 Isolate Nodule
16 2511231019 Pseudomonas sp. GM67 Isolate Nodule
17 2511231020 Pseudomonas sp. GM74 Isolate Nodule
18 2511231021 Pseudomonas sp. GM78 Isolate Nodule
19 2511231022 Pseudomonas sp. GM79 Isolate Nodule
20 2511231023 Pseudomonas sp. GM80 Isolate Nodule
21 2511231026 Herbaspirillum sp. YR522 Isolate Rhizosphere
22 2511231031 Pseudomonas sp. GM16 Isolate Nodule
23 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
24 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
25 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
26 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
27 2521172590 Herbaspirillum sp. GW103 Isolate Rhizosphere
28 2548876994 Herbaspirillum lusitanum P6-12 Isolate Nodule
29 2551306416 Herbaspirillum seropedicae Os34 Isolate Unclassified
30 2574179768 Azoarcus communis DSM 12120 Isolate Unclassified
31 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
32 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
33 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
34 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
35 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
36 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
37 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
38 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
39 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
40 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
41 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
42 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
43 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
44 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
45 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
46 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
47 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
48 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
49 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
50 2599185292 Achromobacter sp. NFACC18-2 Isolate Rhizoplane
51 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
52 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
53 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
54 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
55 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
56 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
57 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
58 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
59 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
60 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
61 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
62 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
63 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
64 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
65 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
66 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
67 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
68 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
69 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
70 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
71 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
72 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
73 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
74 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
75 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
76 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
77 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
78 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
79 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
80 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
81 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
82 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
83 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
84 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
85 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
86 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
87 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
88 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
89 2643221569 Achromobacter sp. Root565 Isolate Unclassified
90 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
91 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
92 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
93 2643221603 Noviherbaspirillum sp. Root189 Isolate Unclassified
94 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
95 2643221644 Rhizobacter sp. Root1221 Isolate Unclassified
96 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
97 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
98 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
99 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
100 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
101 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
102 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
103 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
104 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
105 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
106 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
107 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
108 2721755763 Pandoraea thiooxydans ATSB16 Isolate Rhizosphere
109 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
110 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
111 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
112 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
113 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
114 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
115 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
116 2738543013 Variovorax sp. BT01 Isolate Unclassified
117 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
118 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
119 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
120 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
121 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
122 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
123 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
124 2765235838 Herbaspirillum robiniae AA6 Isolate Unclassified
125 2773857670 Pseudomonas sp. 478 Isolate Unclassified
126 2773857673 Pseudomonas sp. 443 Isolate Unclassified
127 2784132063 Pseudomonas sp. 424 Isolate Unclassified
128 2784132072 Pseudomonas sp. 460 Isolate Unclassified
129 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
130 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
131 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
132 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
133 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
134 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
135 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
136 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
137 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
138 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
139 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
140 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
141 2808606386 Herbaspirillum sp. SJZ099 Isolate Rhizosphere
142 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
143 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
144 2808606395 Achromobacter sp. SLBN-14 Isolate Unclassified
145 2808606415 Herbaspirillum sp. SJZ130 Isolate Rhizosphere
146 2808606419 Herbaspirillum sp. SJZ106 Isolate Rhizosphere
147 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
148 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
149 2818991436 Collimonas arenae 515 Isolate Unclassified
150 2818991445 Herbaspirillum hiltneri 3195 Isolate Unclassified
151 2818991449 Herbaspirillum huttiense 1147 Isolate Unclassified
152 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
153 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
154 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
155 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
156 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
157 2839094727 Herbaspirillum robiniae HZ10 Isolate Nodule
158 2842733646 Variovorax sp. R-72446 Isolate Unclassified
159 2842747753 Variovorax sp. R-72060 Isolate Unclassified
160 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
161 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
162 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
163 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
164 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
165 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
166 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
167 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
168 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
169 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
170 2852618963 Herbaspirillum sp. SJZ102 Isolate Rhizosphere
171 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
172 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
173 2855730933 Achromobacter sp. HZ28 Isolate Nodule
174 2855767633 Achromobacter sp. HZ34 Isolate Nodule
175 2857547612 Janthinobacterium sp. R-74502 Isolate Unclassified
176 2857576091 Pigmentiphaga sp. R-72090 Isolate Unclassified
177 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
178 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
179 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
180 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
181 2881412998 Achromobacter aloeverae AVA-1 Isolate Unclassified
182 2884811622 Herbaspirillum sp. 3C11 Isolate Unclassified
183 2884836552 Herbaspirillum sp. 3R-11 Isolate Unclassified
184 2884852848 Herbaspirillum sp. 3R11 Isolate Unclassified
185 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
186 2891633521 Azoarcus rhizosphaerae CC-YHH848 Isolate Rhizosphere
187 2896154374 Herbaspirillum sp. 3R-3a1 Isolate Nodule
188 2897803580 Azospirillum doebereinerae GSF71 Isolate Unclassified
189 2904434214 Robbsia andropogonis 1567 Isolate Rhizosphere
190 2904439833 Herbaspirillum sp. 1589 Isolate Rhizosphere
191 2904479285 Comamonas sediminis 4487 Isolate Rhizosphere
192 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
193 2904530477 Herbaspirillum huttiense 611 Isolate Unclassified
194 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
195 2904584206 Herbaspirillum sp. 1050 Isolate Unclassified
196 2904589729 Herbaspirillum sp. 1130 Isolate Unclassified
197 2904601388 Herbaspirillum sp. 1273 Isolate Rhizosphere
198 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
199 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
200 2919046199 Herbaspirillum frisingense 596 Isolate Unclassified
201 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
202 2919079590 Herbaspirillum sp. 1173 Isolate Unclassified
203 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
204 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
205 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
206 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
207 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
208 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
209 2923510766 Herbaspirillum rubrisubalbicans SLBN-127 Isolate Rhizosphere
210 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
211 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
212 2928130867 Herbaspirillum seropedicae 1977 Isolate Unclassified
213 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
214 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
215 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
216 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
217 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
218 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
219 2941479691
220 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
221 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
222 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
223 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
224 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
225 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
226 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
227 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
228 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
229 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
230 2998344455 Vogesella urethralis SLBN-145 Isolate Rhizosphere
231 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
232 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
233 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
234 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
235 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
236 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
237 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
238 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
239 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
240 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
241 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
242 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
243 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
244 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
245 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
246 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
247 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
248 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
249 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
250 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
251 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
252 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
253 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
254 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
255 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
256 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
257 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
258 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
259 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
260 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
261 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
262 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
263 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
264 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
265 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
266 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
267 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
268 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
269 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
270 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
271 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
272 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
273 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
274 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
275 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
276 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
277 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
278 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
279 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
280 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
281 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
282 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
283 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
284 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
285 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
286 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
287 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
288 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
289 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
290 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
291 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
292 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
293 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
294 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
295 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
296 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
297 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
298 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
299 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
300 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
301 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
302 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
303 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
304 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
305 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
306 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
307 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
308 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
309 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
310 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
311 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
312 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
313 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
314 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
315 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
316 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
317 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
318 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
319 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
320 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
321 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
322 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
323 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
324 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
325 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
326 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
327 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
328 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
329 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
330 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
331 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
332 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
333 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
334 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
335 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
336 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
337 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
338 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
339 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
340 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
341 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
342 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
343 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
344 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
345 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
346 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
347 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
348 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
349 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
350 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
351 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
352 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
353 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
354 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
355 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
356 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
357 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
358 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
359 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
360 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
361 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
362 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
363 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
364 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
365 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
366 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
367 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
368 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
369 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
370 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
371 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
372 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
373 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
374 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
375 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
376 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
377 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
378 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
379 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
380 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
381 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
382 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
383 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
384 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
385 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
386 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
387 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
388 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
389 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
390 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
391 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
392 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
393 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
394 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
395 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
396 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
397 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
398 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
399 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
400 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
401 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
402 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
403 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
404 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
405 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
406 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
407 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
408 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
409 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
410 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
411 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
412 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
413 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
414 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
415 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
416 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
417 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
418 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
419 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
420 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
421 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
422 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
423 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
424 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
425 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
426 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
427 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
428 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
429 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
430 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
431 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
432 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
433 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
434 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
435 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
436 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
437 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
438 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
439 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
440 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
441 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
442 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
443 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
444 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
445 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
446 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
447 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
448 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
449 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
450 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
451 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
452 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
453 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
454 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
455 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
456 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
457 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
458 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
459 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
460 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
461 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
462 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
463 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
464 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
465 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
466 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
467 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
468 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
469 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
470 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
471 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
472 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
473 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
474 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
475 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
476 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
477 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
478 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
479 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
480 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
481 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
482 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
483 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
484 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
485 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
486 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
487 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
488 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
489 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
490 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
491 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
492 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
493 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
494 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
495 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
496 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
497 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
498 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
499 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
500 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
501 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
502 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
503 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
504 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
505 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
506 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
507 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
508 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
509 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
510 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
511 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
512 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
513 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
514 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
515 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
516 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
517 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
518 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
519 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
520 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
521 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
522 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
523 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
524 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
525 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
526 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
527 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
528 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
529 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
530 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
531 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
532 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
533 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
534 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
535 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
536 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
537 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
538 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
539 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
540 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
541 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
542 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
543 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
544 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
545 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
546 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
547 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
548 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
549 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
550 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
551 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
552 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
553 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
554 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
555 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
556 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
557 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
558 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
559 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
560 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
561 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
562 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
563 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
564 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
565 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
566 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
567 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
568 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
569 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
570 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
571 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
572 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
573 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
574 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
575 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
576 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
577 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
578 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
579 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
580 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
581 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
582 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
583 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
584 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
585 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
586 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
587 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
588 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
589 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
590 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
591 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
592 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
593 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
594 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
595 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
596 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
597 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
598 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
599 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
600 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
601 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
602 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
603 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
604 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
605 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
606 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
607 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
608 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
609 639633007 Azoarcus olearius BH72 Isolate Unclassified
610 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
611 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
612 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
613 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
614 8054002106 Azospirillum lipoferum 59b Isolate Unclassified
615 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
616 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
617 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
618 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
619 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
620 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
621 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
622 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
623 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
624 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
625 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
626 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
627 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
628 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
629 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
630 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 84.02
Metatranscriptomes 0
Isolates 15.98

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.84
Nodule 2.49
Rhizoplane 4.25
Rhizosphere 69.99
Stem 0
Stem Tuber 0
Unclassified 13.43

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_718 2124908027 Bacteria 55855
2 SwRhRL2b_contig_3259057 2162886007 Bacteria 954
3 JGI24741J21665_1006777 3300001915 Bacteria 2272
4 JGI25155J39150_1000370 3300002704 Bacteria 13442
5 JGI25155J39150_1000428 3300002704 Bacteria 11253
6 JGI25155J39150_1000795 3300002704 Bacteria 5027
7 JGI25155J39150_1001260 3300002704 Bacteria 2038
8 JGI25156J39149_1000117 3300002705 Bacteria 57700
9 JGI25156J39149_1000989 3300002705 Bacteria 13442
10 JGI25156J39149_1002357 3300002705 Bacteria 6870
11 JGI25162J39368_1000001 3300002737 Bacteria 740113
12 JGI25162J39368_1000378 3300002737 Bacteria 37854
13 JGI25162J39368_1004300 3300002737 Bacteria 3396
14 JGI25162J39368_1004556 3300002737 Bacteria 3157
15 JGI25154J39366_1000107 3300002738 Bacteria 73482
16 JGI25154J39366_1000249 3300002738 Bacteria 34973
17 JGI25154J39366_1000826 3300002738 Bacteria 13442
18 JGI25154J39366_1004380 3300002738 Bacteria 2555
19 JGI25157J39369_1000966 3300002741 Bacteria 13433
20 JGI25157J39369_1001016 3300002741 Bacteria 13010
21 JGI25163J39215_1001139 3300002771 Bacteria 5240
22 JGI25164J39214_1000273 3300002772 Bacteria 37854
23 JGI25151J46595_10001598 3300003187 Bacteria 15033
24 JGI25151J46595_10001939 3300003187 Bacteria 13112
25 JGI25165J46597_1000001 3300003214 Bacteria 1111887
26 JGI25165J46597_1000498 3300003214 Bacteria 37854
27 rootH2_10020080 3300003320 Bacteria 1260
28 rootL2_10082487 3300003322 Bacteria 5783
29 Ga0055538_1000001 3300003751 Bacteria 1111887
30 Ga0055538_1000032 3300003751 Bacteria 199718
31 Ga0055538_1000229 3300003751 Bacteria 31274
32 Ga0055539_1000001 3300003752 Bacteria 1111887
33 Ga0055539_1000043 3300003752 Bacteria 199718
34 Ga0055539_1000269 3300003752 Bacteria 31274
35 Ga0055533_1000003 3300003756 Bacteria 1111887
36 Ga0055533_1000052 3300003756 Bacteria 199718
37 Ga0055533_1000258 3300003756 Bacteria 31274
38 Ga0055532_1000044 3300003758 Bacteria 191110
39 Ga0055532_1000047 3300003758 Bacteria 179201
40 Ga0055532_1000647 3300003758 Bacteria 13442
41 Ga0055525_1000003 3300003759 Bacteria 962094
42 Ga0055525_1000062 3300003759 Bacteria 199718
43 Ga0055525_1000359 3300003759 Bacteria 31274
44 Ga0055535_1002174 3300003761 Bacteria 7556
45 Ga0055535_1006556 3300003761 Bacteria 2336
46 Ga0055529_1008064 3300003763 Bacteria 1409
47 Ga0055526_1002434 3300003771 Bacteria 12611
48 Ga0055524_1000061 3300003775 Bacteria 135241
49 Ga0055536_1000081 3300003781 Bacteria 81966
50 Ga0055536_1000201 3300003781 Bacteria 48808
51 Ga0055536_1000704 3300003781 Bacteria 22401
52 Ga0055536_1011459 3300003781 Bacteria 3399
53 Ga0055534_1000104 3300003784 Bacteria 64767
54 Ga0055534_1000470 3300003784 Bacteria 22861
55 Ga0055530_10000324 3300003791 Bacteria 43140
56 Ga0055530_10000800 3300003791 Bacteria 26158
57 Ga0055530_10001011 3300003791 Bacteria 22475
58 Ga0055530_10001044 3300003791 Bacteria 22066
59 Ga0055530_10003143 3300003791 Bacteria 9737
60 Ga0055540_1000026 3300003792 Bacteria 189071
61 Ga0055540_1000745 3300003792 Bacteria 22100
62 Ga0055540_1003757 3300003792 Bacteria 7161
63 Ga0055540_1003950 3300003792 Bacteria 6924
64 Ga0055531_10000404 3300003794 Bacteria 41520
65 Ga0055531_10001242 3300003794 Bacteria 19363
66 Ga0055531_10006377 3300003794 Bacteria 6709
67 Ga0055541_1000001 3300003841 Bacteria 1111887
68 Ga0055541_1000030 3300003841 Bacteria 199616
69 Ga0055541_1000168 3300003841 Bacteria 31274
70 Ga0065714_10000115 3300005288 Bacteria 10449
71 Ga0065714_10007511 3300005288 Bacteria 3527
72 Ga0065714_10009964 3300005288 Bacteria 3262
73 Ga0065714_10015263 3300005288 Bacteria 1723
74 Ga0065714_10016786 3300005288 Bacteria 1373
75 Ga0065714_10018929 3300005288 Bacteria 1393
76 Ga0065714_10040903 3300005288 Bacteria 1013
77 Ga0065714_10065087 3300005288 Bacteria 13133
78 Ga0065714_10065569 3300005288 Bacteria 9352
79 Ga0065714_10072683 3300005288 Bacteria 3320
80 Ga0065714_10078533 3300005288 Bacteria 2591
81 Ga0065714_10092492 3300005288 Bacteria 1876
82 Ga0065714_10129168 3300005288 Bacteria 1267
83 Ga0065714_10135547 3300005288 Bacteria 1213
84 Ga0065704_10008310 3300005289 Bacteria 4618
85 Ga0065704_10024159 3300005289 Bacteria 1633
86 Ga0065704_10073325 3300005289 Bacteria 7307
87 Ga0065704_10076165 3300005289 Bacteria 5230
88 Ga0065704_10080568 3300005289 Bacteria 3921
89 Ga0065712_10067900 3300005290 Bacteria 22102
90 Ga0065712_10068537 3300005290 Bacteria 10000
91 Ga0065715_10117248 3300005293 Bacteria 2348
92 Ga0070670_100001343 3300005331 Bacteria 19676
93 Ga0070670_100005930 3300005331 Bacteria 10333
94 Ga0070670_100024674 3300005331 Bacteria 5171
95 Ga0070666_10044566 3300005335 Bacteria 2972
96 Ga0070660_100439878 3300005339 Bacteria 1081
97 Ga0070660_100663137 3300005339 Bacteria 874
98 Ga0070661_100000126 3300005344 Bacteria 63357
99 Ga0070661_100568593 3300005344 Bacteria 914
100 Ga0070669_100000764 3300005353 Bacteria 23404
101 Ga0070669_100002215 3300005353 Bacteria 14088
102 Ga0070669_100010461 3300005353 Bacteria 6588
103 Ga0070673_100336409 3300005364 Bacteria 1337
104 Ga0070667_100025826 3300005367 Bacteria 4885
105 Ga0070714_100523115 3300005435 Bacteria 1133
106 Ga0070663_100590763 3300005455 Bacteria 933
107 Ga0070662_100000426 3300005457 Bacteria 24961
108 Ga0070662_100025623 3300005457 Bacteria 4074
109 Ga0068853_100002460 3300005539 Bacteria 13865
110 Ga0068853_100167212 3300005539 Bacteria 1988
111 Ga0068853_100247147 3300005539 Bacteria 1636
112 Ga0070665_100045202 3300005548 Bacteria 4422
113 Ga0070665_100055165 3300005548 Bacteria 3985
114 Ga0070665_100244070 3300005548 Bacteria 1796
115 Ga0070665_100289486 3300005548 Bacteria 1640
116 Ga0070665_100719054 3300005548 Bacteria 1012
117 Ga0070665_101406873 3300005548 Bacteria 706
118 Ga0068855_100000083 3300005563 Bacteria 114159
119 Ga0068855_100075954 3300005563 Bacteria 3900
120 Ga0068855_100156925 3300005563 Bacteria 2585
121 Ga0068855_100230745 3300005563 Bacteria 2073
122 Ga0070664_100002791 3300005564 Bacteria 14105
123 Ga0070664_100385963 3300005564 Bacteria 1279
124 Ga0068854_100009626 3300005578 Bacteria 6240
125 Ga0068854_100042852 3300005578 Bacteria 3205
126 Ga0068856_100045478 3300005614 Bacteria 4323
127 Ga0068856_100062089 3300005614 Bacteria 3691
128 Ga0068852_100010440 3300005616 Bacteria 6942
129 Ga0068851_10000007 3300005834 Bacteria 244101
130 Ga0075365_10085235 3300006038 Bacteria 2146
131 Ga0075365_10145557 3300006038 Bacteria 1646
132 Ga0075364_10129569 3300006051 Bacteria 1692
133 Ga0075364_10373248 3300006051 Bacteria 973
134 Ga0075432_10011631 3300006058 Bacteria 2990
135 Ga0075432_10028200 3300006058 Bacteria 1936
136 Ga0075432_10032413 3300006058 Bacteria 1810
137 Ga0075432_10074428 3300006058 Bacteria 1223
138 Ga0070716_100037343 3300006173 Bacteria 2684
139 Ga0075362_10034210 3300006177 Bacteria 2214
140 Ga0075362_10037732 3300006177 Bacteria 2120
141 Ga0075362_10108739 3300006177 Bacteria 1303
142 Ga0075366_10005256 3300006195 Bacteria 7011
143 Ga0075366_10024685 3300006195 Bacteria 3506
144 Ga0075370_10004516 3300006353 Bacteria 6774
145 Ga0075436_100042606 3300006914 Bacteria 3131
146 Ga0075436_100176405 3300006914 Bacteria 1509
147 Ga0075436_100235249 3300006914 Bacteria 1302
148 Ga0075436_100269535 3300006914 Bacteria 1216
149 Ga0075436_100494052 3300006914 Bacteria 895
150 Ga0075436_100536753 3300006914 Bacteria 858
151 Ga0079104_1000093 3300006946 Bacteria 130633
152 Ga0079104_1000518 3300006946 Bacteria 41295
153 Ga0079104_1000754 3300006946 Bacteria 27883
154 Ga0079104_1001469 3300006946 Bacteria 15717
155 Ga0079104_1010922 3300006946 Bacteria 2953
156 Ga0099826_10000039 3300006948 Bacteria 99286
157 Ga0099826_10004941 3300006948 Bacteria 9450
158 Ga0105251_10000009 3300009011 Bacteria 192384
159 Ga0105251_10000133 3300009011 Bacteria 74942
160 Ga0105251_10004529 3300009011 Bacteria 9422
161 Ga0105251_10006398 3300009011 Bacteria 7511
162 Ga0105251_10008326 3300009011 Bacteria 6260
163 Ga0105251_10009680 3300009011 Bacteria 5664
164 Ga0105251_10014310 3300009011 Bacteria 4394
165 Ga0105251_10016733 3300009011 Bacteria 3952
166 Ga0105251_10017668 3300009011 Bacteria 3816
167 Ga0105251_10034134 3300009011 Bacteria 2520
168 Ga0105251_10037689 3300009011 Bacteria 2370
169 Ga0105251_10044660 3300009011 Bacteria 2139
170 Ga0105251_10162951 3300009011 Bacteria 1005
171 Ga0105251_10175120 3300009011 Bacteria 967
172 Ga0105244_10000008 3300009036 Bacteria 302297
173 Ga0105244_10001453 3300009036 Bacteria 19179
174 Ga0105244_10003377 3300009036 Bacteria 11430
175 Ga0105244_10008099 3300009036 Bacteria 6601
176 Ga0105244_10034271 3300009036 Bacteria 2674
177 Ga0105244_10061120 3300009036 Bacteria 1897
178 Ga0105244_10067665 3300009036 Bacteria 1786
179 Ga0105244_10076791 3300009036 Bacteria 1658
180 Ga0105244_10097516 3300009036 Bacteria 1440
181 Ga0105244_10098580 3300009036 Bacteria 1431
182 Ga0105244_10276542 3300009036 Bacteria 779
183 Ga0105250_10000605 3300009092 Bacteria 23408
184 Ga0105250_10002587 3300009092 Bacteria 9012
185 Ga0105250_10003447 3300009092 Bacteria 7496
186 Ga0105250_10003816 3300009092 Bacteria 7075
187 Ga0105250_10004205 3300009092 Bacteria 6671
188 Ga0105250_10011988 3300009092 Bacteria 3589
189 Ga0105250_10030034 3300009092 Bacteria 2186
190 Ga0105250_10032680 3300009092 Bacteria 2089
191 Ga0105250_10057968 3300009092 Bacteria 1554
192 Ga0105250_10101348 3300009092 Bacteria 1175
193 Ga0105240_10003351 3300009093 Bacteria 24930
194 Ga0105240_10028663 3300009093 Bacteria 7266
195 Ga0105240_10118802 3300009093 Bacteria 3186
196 Ga0105243_10007062 3300009148 Bacteria 8635
197 Ga0105243_10007538 3300009148 Bacteria 8366
198 Ga0105243_10013877 3300009148 Bacteria 6099
199 Ga0105243_10053584 3300009148 Bacteria 3200
200 Ga0105243_10170509 3300009148 Bacteria 1884
201 Ga0105242_10004917 3300009176 Bacteria 10346
202 Ga0105242_10033598 3300009176 Bacteria 4109
203 Ga0105242_10164967 3300009176 Bacteria 1942
204 Ga0105242_10440437 3300009176 Bacteria 1226
205 Ga0105237_10005994 3300009545 Bacteria 13608
206 Ga0105237_10093575 3300009545 Bacteria 2995
207 Ga0105237_10149362 3300009545 Bacteria 2333
208 Ga0105237_10268524 3300009545 Bacteria 1709
209 Ga0105237_10340359 3300009545 Bacteria 1505
210 Ga0105238_10000037 3300009551 Bacteria 163954
211 Ga0105238_10080399 3300009551 Bacteria 3249
212 Ga0105239_10013749 3300010375 Bacteria 8985
213 Ga0105239_10092298 3300010375 Bacteria 3342
214 Ga0105246_10000162 3300011119 Bacteria 32137
215 Ga0105246_10000432 3300011119 Bacteria 22385
216 Ga0105246_10019035 3300011119 Bacteria 4380
217 Ga0105246_10025124 3300011119 Bacteria 3881
218 Ga0105246_10111801 3300011119 Bacteria 2008
219 Ga0105246_10169006 3300011119 Bacteria 1673
220 Ga0157345_1000059 3300012498 Bacteria 23613
221 Ga0157373_10003992 3300013100 Bacteria 11124
222 Ga0157373_10007482 3300013100 Bacteria 8124
223 Ga0157373_10011402 3300013100 Bacteria 6538
224 Ga0157373_10043148 3300013100 Bacteria 3222
225 Ga0157373_10043917 3300013100 Bacteria 3191
226 Ga0157373_10085841 3300013100 Bacteria 2218
227 Ga0157373_10129501 3300013100 Bacteria 1774
228 Ga0157373_10152386 3300013100 Bacteria 1626
229 Ga0157373_10178942 3300013100 Bacteria 1493
230 Ga0157371_10000039 3300013102 Bacteria 207724
231 Ga0157371_10011165 3300013102 Bacteria 6947
232 Ga0157371_10025849 3300013102 Bacteria 4273
233 Ga0157371_10115285 3300013102 Bacteria 1908
234 Ga0157371_10163806 3300013102 Bacteria 1588
235 Ga0157371_10227328 3300013102 Bacteria 1340
236 Ga0157370_10000070 3300013104 Bacteria 112014
237 Ga0157370_10011932 3300013104 Bacteria 9060
238 Ga0157370_10039117 3300013104 Bacteria 4584
239 Ga0157370_10052578 3300013104 Bacteria 3889
240 Ga0157370_10072242 3300013104 Bacteria 3256
241 Ga0157370_10105658 3300013104 Bacteria 2635
242 Ga0157370_10141128 3300013104 Bacteria 2245
243 Ga0157370_10386291 3300013104 Bacteria 1289
244 Ga0157369_10039350 3300013105 Bacteria 5168
245 Ga0157369_10052988 3300013105 Bacteria 4387
246 Ga0157369_10086792 3300013105 Bacteria 3341
247 Ga0157369_10094667 3300013105 Bacteria 3188
248 Ga0157369_10095256 3300013105 Bacteria 3177
249 Ga0157369_10133358 3300013105 Bacteria 2631
250 Ga0157369_10138981 3300013105 Bacteria 2571
251 Ga0163162_10048268 3300013306 Bacteria 4265
252 Ga0163162_10770004 3300013306 Bacteria 1081
253 Ga0163162_11101635 3300013306 Bacteria 900
254 Ga0157372_10109402 3300013307 Bacteria 3165
255 Ga0157372_10131463 3300013307 Bacteria 2880
256 Ga0157375_10086735 3300013308 Bacteria 3182
257 Ga0157375_10090932 3300013308 Bacteria 3112
258 Ga0157375_10249140 3300013308 Bacteria 1937
259 Ga0157375_10382958 3300013308 Bacteria 1573
260 Ga0157375_10911217 3300013308 Bacteria 1023
261 Ga0157380_10410785 3300014326 Bacteria 1287
262 Ga0182008_10000662 3300014497 Bacteria 24971
263 Ga0182008_10003064 3300014497 Bacteria 10267
264 Ga0182008_10005030 3300014497 Bacteria 7604
265 Ga0182008_10013293 3300014497 Bacteria 4328
266 Ga0182008_10013647 3300014497 Bacteria 4269
267 Ga0182008_10024543 3300014497 Bacteria 3068
268 Ga0182008_10025165 3300014497 Bacteria 3025
269 Ga0182008_10026256 3300014497 Bacteria 2954
270 Ga0182008_10052314 3300014497 Bacteria 2025
271 Ga0182008_10097056 3300014497 Bacteria 1455
272 Ga0182008_10153588 3300014497 Bacteria 1155
273 Ga0157376_10340397 3300014969 Bacteria 1432
274 Ga0182006_1006448 3300015261 Bacteria 5451
275 Ga0182006_1010871 3300015261 Bacteria 4027
276 Ga0182006_1014777 3300015261 Bacteria 3358
277 Ga0182006_1016147 3300015261 Bacteria 3189
278 Ga0182006_1020055 3300015261 Bacteria 2805
279 Ga0182006_1020526 3300015261 Bacteria 2767
280 Ga0182006_1023930 3300015261 Bacteria 2525
281 Ga0182006_1028676 3300015261 Bacteria 2262
282 Ga0182006_1044379 3300015261 Bacteria 1734
283 Ga0182006_1050795 3300015261 Bacteria 1597
284 Ga0182006_1068441 3300015261 Bacteria 1322
285 Ga0182006_1148228 3300015261 Bacteria 797
286 Ga0182007_10001352 3300015262 Bacteria 13221
287 Ga0182007_10001934 3300015262 Bacteria 10718
288 Ga0182007_10006630 3300015262 Bacteria 4956
289 Ga0182007_10017947 3300015262 Bacteria 2575
290 Ga0182007_10019671 3300015262 Bacteria 2424
291 Ga0182007_10025132 3300015262 Bacteria 2077
292 Ga0182007_10026086 3300015262 Bacteria 2029
293 Ga0182005_1000183 3300015265 Bacteria 42914
294 Ga0182005_1007397 3300015265 Bacteria 3296
295 Ga0182005_1010616 3300015265 Bacteria 2644
296 Ga0182005_1021610 3300015265 Bacteria 1765
297 Ga0182005_1035003 3300015265 Bacteria 1366
298 Ga0183362_10001 3300015683 Bacteria 2046624
299 Ga0183361_10004 3300016635 Bacteria 484183
300 Ga0163161_10046855 3300017792 Bacteria 3120
301 Ga0163161_10101646 3300017792 Bacteria 2140
302 Ga0163161_10124933 3300017792 Bacteria 1936
303 Ga0163161_10167083 3300017792 Bacteria 1680
304 Ga0163161_10173430 3300017792 Bacteria 1650
305 Ga0163161_10181486 3300017792 Bacteria 1614
306 Ga0163161_10215667 3300017792 Bacteria 1484
307 Ga0163161_10239651 3300017792 Bacteria 1410
308 Ga0163161_10258045 3300017792 Bacteria 1360
309 Ga0163161_10279826 3300017792 Bacteria 1308
310 Ga0163161_10287576 3300017792 Bacteria 1291
311 Ga0163161_10325029 3300017792 Bacteria 1217
312 Ga0209435_100004 3300025206 Bacteria 633417
313 Ga0209435_100046 3300025206 Bacteria 95081
314 Ga0209435_100377 3300025206 Bacteria 9928
315 Ga0209435_100768 3300025206 Bacteria 5258
316 Ga0209760_100027 3300025207 Bacteria 153290
317 Ga0209760_101344 3300025207 Bacteria 2647
318 Ga0209784_100004 3300025224 Bacteria 1378156
319 Ga0209784_100007 3300025224 Bacteria 747715
320 Ga0209784_100009 3300025224 Bacteria 688031
321 Ga0209566_100004 3300025225 Bacteria 1531866
322 Ga0209566_100007 3300025225 Bacteria 688031
323 Ga0209566_100009 3300025225 Bacteria 554018
324 Ga0209674_100006 3300025226 Bacteria 1531866
325 Ga0209674_100018 3300025226 Bacteria 688031
326 Ga0209674_100021 3300025226 Bacteria 629811
327 Ga0209147_100009 3300025229 Bacteria 747409
328 Ga0209147_100011 3300025229 Bacteria 702140
329 Ga0209147_100157 3300025229 Bacteria 92005
330 Ga0209563_100009 3300025230 Bacteria 1378156
331 Ga0209563_100018 3300025230 Bacteria 747850
332 Ga0209563_100020 3300025230 Bacteria 688031
333 Ga0209563_100268 3300025230 Bacteria 22421
334 Ga0207427_100006 3300025231 Bacteria 785415
335 Ga0207427_100149 3300025231 Bacteria 78920
336 Ga0209437_100004 3300025233 Bacteria 1378156
337 Ga0209437_100013 3300025233 Bacteria 785457
338 Ga0209437_100207 3300025233 Bacteria 112147
339 Ga0209437_100939 3300025233 Bacteria 10959
340 Ga0209258_100851 3300025242 Bacteria 16447
341 Ga0209258_100913 3300025242 Bacteria 14949
342 Ga0209258_101397 3300025242 Bacteria 8633
343 Ga0209646_1000141 3300025246 Bacteria 107030
344 Ga0209646_1000149 3300025246 Bacteria 100004
345 Ga0209646_1000156 3300025246 Bacteria 95083
346 Ga0209646_1000184 3300025246 Bacteria 78423
347 Ga0209646_1000233 3300025246 Bacteria 57776
348 Ga0209646_1000524 3300025246 Bacteria 16813
349 Ga0209026_1000066 3300025250 Bacteria 207691
350 Ga0209026_1000776 3300025250 Bacteria 17734
351 Ga0209677_100005 3300025253 Bacteria 1378156
352 Ga0209677_100010 3300025253 Bacteria 688031
353 Ga0209677_100012 3300025253 Bacteria 554018
354 Ga0209148_1012493 3300025254 Bacteria 1550
355 Ga0209148_1015404 3300025254 Bacteria 1336
356 Ga0209759_1000072 3300025256 Bacteria 178206
357 Ga0209759_1000182 3300025256 Bacteria 102836
358 Ga0209759_1001083 3300025256 Bacteria 17734
359 Ga0209759_1001715 3300025256 Bacteria 11322
360 Ga0209233_1000005 3300025261 Bacteria 1531866
361 Ga0209233_1000022 3300025261 Bacteria 785415
362 Ga0209565_1001951 3300025263 Bacteria 8088
363 Ga0209455_1001032 3300025272 Bacteria 13865
364 Ga0209455_1002502 3300025272 Bacteria 7057
365 Ga0209673_1011314 3300025273 Bacteria 3686
366 Ga0209130_1010307 3300025284 Bacteria 2586
367 Ga0209130_1032862 3300025284 Bacteria 1054
368 Ga0209675_1000078 3300025291 Bacteria 156111
369 Ga0209675_1000573 3300025291 Bacteria 26547
370 Ga0209675_1001701 3300025291 Bacteria 12170
371 Ga0209675_1003212 3300025291 Bacteria 7917
372 Ga0209675_1004183 3300025291 Bacteria 6528
373 Ga0209676_1000015 3300025292 Bacteria 784458
374 Ga0209676_1000030 3300025292 Bacteria 506421
375 Ga0209676_1000041 3300025292 Bacteria 424583
376 Ga0209676_1000121 3300025292 Bacteria 198920
377 Ga0209676_1007094 3300025292 Bacteria 5363
378 Ga0209676_1026401 3300025292 Bacteria 1845
379 Ga0209025_1000019 3300025294 Bacteria 631548
380 Ga0209025_1000051 3300025294 Bacteria 330080
381 Ga0209025_1003638 3300025294 Bacteria 14313
382 Ga0209025_1034026 3300025294 Bacteria 2339
383 Ga0209564_1000133 3300025295 Bacteria 189140
384 Ga0209564_1020032 3300025295 Bacteria 2471
385 Ga0209050_1000024 3300025298 Bacteria 533389
386 Ga0209050_1000030 3300025298 Bacteria 463381
387 Ga0209050_1000228 3300025298 Bacteria 123537
388 Ga0209050_1000332 3300025298 Bacteria 94224
389 Ga0209050_1001473 3300025298 Bacteria 25146
390 Ga0209050_1011157 3300025298 Bacteria 4303
391 Ga0209050_1022072 3300025298 Bacteria 2294
392 Ga0209050_1035225 3300025298 Bacteria 1483
393 Ga0209256_1000030 3300025299 Bacteria 414828
394 Ga0209256_1000699 3300025299 Bacteria 44604
395 Ga0209051_1000004 3300025303 Bacteria 1155596
396 Ga0209051_1000012 3300025303 Bacteria 595474
397 Ga0209051_1000023 3300025303 Bacteria 437371
398 Ga0209051_1000367 3300025303 Bacteria 65677
399 Ga0209051_1001294 3300025303 Bacteria 22056
400 Ga0209051_1007252 3300025303 Bacteria 6093
401 Ga0209051_1009205 3300025303 Bacteria 5115
402 Ga0209257_1000012 3300025304 Bacteria 1111138
403 Ga0209257_1000063 3300025304 Bacteria 359089
404 Ga0209257_1000262 3300025304 Bacteria 121021
405 Ga0209257_1022106 3300025304 Bacteria 2281
406 Ga0207656_10000006 3300025321 Bacteria 395044
407 Ga0207696_1000020 3300025711 Bacteria 434998
408 Ga0207696_1000031 3300025711 Bacteria 384169
409 Ga0207696_1001215 3300025711 Bacteria 14643
410 Ga0207696_1003799 3300025711 Bacteria 6726
411 Ga0207696_1005266 3300025711 Bacteria 5393
412 Ga0207696_1024464 3300025711 Bacteria 1893
413 Ga0207696_1041534 3300025711 Bacteria 1343
414 Ga0207655_1000033 3300025728 Bacteria 377066
415 Ga0207655_1000083 3300025728 Bacteria 213295
416 Ga0207655_1000703 3300025728 Bacteria 38823
417 Ga0207655_1002748 3300025728 Bacteria 13718
418 Ga0207655_1005392 3300025728 Bacteria 8711
419 Ga0207655_1005543 3300025728 Bacteria 8557
420 Ga0207655_1005590 3300025728 Bacteria 8511
421 Ga0207655_1007307 3300025728 Bacteria 7180
422 Ga0207655_1012751 3300025728 Bacteria 4878
423 Ga0207655_1012880 3300025728 Bacteria 4844
424 Ga0207655_1013705 3300025728 Bacteria 4633
425 Ga0207655_1015570 3300025728 Bacteria 4215
426 Ga0207655_1020094 3300025728 Bacteria 3455
427 Ga0207655_1041823 3300025728 Bacteria 1959
428 Ga0207655_1142231 3300025728 Bacteria 769
429 Ga0207713_1000032 3300025735 Bacteria 276465
430 Ga0207713_1000079 3300025735 Bacteria 172274
431 Ga0207713_1000659 3300025735 Bacteria 32880
432 Ga0207713_1000750 3300025735 Bacteria 30221
433 Ga0207713_1000837 3300025735 Bacteria 28361
434 Ga0207713_1001056 3300025735 Bacteria 23875
435 Ga0207713_1002266 3300025735 Bacteria 14188
436 Ga0207713_1002477 3300025735 Bacteria 13429
437 Ga0207713_1006015 3300025735 Bacteria 7480
438 Ga0207713_1007842 3300025735 Bacteria 6225
439 Ga0207713_1007888 3300025735 Bacteria 6204
440 Ga0207713_1008313 3300025735 Bacteria 5993
441 Ga0207713_1011258 3300025735 Bacteria 4878
442 Ga0207713_1021313 3300025735 Bacteria 3109
443 Ga0207713_1022601 3300025735 Bacteria 2980
444 Ga0207688_10362594 3300025901 Bacteria 894
445 Ga0207645_10307425 3300025907 Bacteria 1056
446 Ga0207695_10000748 3300025913 Bacteria 62583
447 Ga0207695_10000979 3300025913 Bacteria 50790
448 Ga0207695_10085612 3300025913 Bacteria 3180
449 Ga0207671_10000131 3300025914 Bacteria 116866
450 Ga0207671_10027798 3300025914 Bacteria 4228
451 Ga0207671_10312044 3300025914 Bacteria 1243
452 Ga0207657_10210920 3300025919 Bacteria 1559
453 Ga0207649_10000012 3300025920 Bacteria 265674
454 Ga0207649_10194479 3300025920 Bacteria 1429
455 Ga0207681_10000381 3300025923 Bacteria 31124
456 Ga0207681_10000482 3300025923 Bacteria 27925
457 Ga0207681_10009066 3300025923 Bacteria 6077
458 Ga0207694_10000069 3300025924 Bacteria 124500
459 Ga0207694_10033085 3300025924 Bacteria 3960
460 Ga0207694_10340000 3300025924 Bacteria 1241
461 Ga0207650_10000338 3300025925 Bacteria 45436
462 Ga0207650_10000564 3300025925 Bacteria 30060
463 Ga0207650_10176277 3300025925 Bacteria 1702
464 Ga0207659_10173289 3300025926 Bacteria 1703
465 Ga0207664_10665713 3300025929 Bacteria 936
466 Ga0207644_10289078 3300025931 Bacteria 1318
467 Ga0207706_10001424 3300025933 Bacteria 23939
468 Ga0207706_10042839 3300025933 Bacteria 4011
469 Ga0207686_10000663 3300025934 Bacteria 21277
470 Ga0207686_10241547 3300025934 Bacteria 1315
471 Ga0207686_10271493 3300025934 Bacteria 1248
472 Ga0207709_10000248 3300025935 Bacteria 66465
473 Ga0207709_10003176 3300025935 Bacteria 9870
474 Ga0207709_10181605 3300025935 Bacteria 1486
475 Ga0207709_10203623 3300025935 Bacteria 1415
476 Ga0207669_10759510 3300025937 Bacteria 801
477 Ga0207665_10052433 3300025939 Bacteria 2748
478 Ga0207679_10000015 3300025945 Bacteria 265674
479 Ga0207667_10000043 3300025949 Bacteria 261426
480 Ga0207667_10030089 3300025949 Bacteria 5877
481 Ga0207667_10223683 3300025949 Bacteria 1928
482 Ga0207667_10398203 3300025949 Bacteria 1402
483 Ga0207651_10280762 3300025960 Bacteria 1376
484 Ga0207640_10015014 3300025981 Bacteria 4473
485 Ga0207677_10102893 3300026023 Bacteria 2107
486 Ga0207639_10000286 3300026041 Bacteria 36062
487 Ga0207702_10027104 3300026078 Bacteria 4758
488 Ga0207702_10333543 3300026078 Bacteria 1447
489 Ga0207648_10239465 3300026089 Bacteria 1615
490 Ga0207674_10246713 3300026116 Bacteria 1733
491 Ga0207675_101211330 3300026118 Bacteria 775
492 Ga0207683_10472243 3300026121 Bacteria 1157
493 Ga0207698_10000966 3300026142 Bacteria 16711
494 Ga0209281_1000016 3300027111 Bacteria 588107
495 Ga0209281_1000019 3300027111 Bacteria 576164
496 Ga0209281_1000084 3300027111 Bacteria 254215
497 Ga0209281_1005170 3300027111 Bacteria 3685
498 Ga0209281_1007590 3300027111 Bacteria 2710
499 Ga0209371_1000871 3300027312 Bacteria 24307
500 Ga0209282_1000058 3300027666 Bacteria 99152
501 Ga0207428_10007071 3300027907 Bacteria 10273
502 Ga0207428_10072024 3300027907 Bacteria 2714
503 Ga0207428_10076055 3300027907 Bacteria 2630
504 Ga0207428_10085395 3300027907 Bacteria 2458
505 Ga0207428_10093304 3300027907 Bacteria 2335
506 Ga0268266_10004944 3300028379 Bacteria 12615
507 Ga0268266_10040199 3300028379 Bacteria 3985
508 Ga0268266_10290161 3300028379 Bacteria 1523
509 Ga0268266_10622091 3300028379 Bacteria 1038
510 Ga0268266_10834620 3300028379 Bacteria 890
511 Ga0307517_10186905 3300028786 Bacteria 1324
512 Ga0307515_10000215 3300028794 Bacteria 142594
513 Ga0268256_1000771 3300030500 Bacteria 23304
514 Ga0307511_10003163 3300030521 Bacteria 16949
515 Ga0307511_10046070 3300030521 Bacteria 3593
516 Ga0307511_10105971 3300030521 Bacteria 1817
517 Ga0316178_1051183 3300030735 Bacteria 40899
518 Ga0316183_1079327 3300030742 Bacteria 2695
519 Ga0316181_1054368 3300030744 Bacteria 10190
520 Ga0265332_10002934 3300031238 Bacteria 8389
521 Ga0265329_10028102 3300031242 Bacteria 1845
522 Ga0265340_10001308 3300031247 Bacteria 14259
523 Ga0265331_10011421 3300031250 Bacteria 4864
524 Ga0265327_10036761 3300031251 Bacteria 2688
525 Ga0265327_10058111 3300031251 Bacteria 1987
526 Ga0265316_10053295 3300031344 Bacteria 3170
527 Ga0265316_10199969 3300031344 Bacteria 1482
528 Ga0307513_10146120 3300031456 Bacteria 2282
529 Ga0307509_10141275 3300031507 Bacteria 2342
530 Ga0307509_10373778 3300031507 Bacteria 1141
531 Ga0307408_100000002 3300031548 Bacteria 827227
532 Ga0307408_100018437 3300031548 Bacteria 4685
533 Ga0307408_100030557 3300031548 Bacteria 3741
534 Ga0307408_100135174 3300031548 Bacteria 1928
535 Ga0307408_100368944 3300031548 Bacteria 1223
536 Ga0307408_100839944 3300031548 Bacteria 836
537 Ga0265314_10038167 3300031711 Bacteria 3474
538 Ga0265342_10002113 3300031712 Bacteria 17530
539 Ga0307516_10329423 3300031730 Bacteria 1196
540 Ga0307405_10021286 3300031731 Bacteria 3641
541 Ga0307405_10030612 3300031731 Bacteria 3157
542 Ga0307405_10118288 3300031731 Bacteria 1808
543 Ga0307405_10219610 3300031731 Bacteria 1393
544 Ga0307405_10445495 3300031731 Bacteria 1025
545 Ga0307413_10467860 3300031824 Bacteria 1004
546 Ga0307406_10031651 3300031901 Bacteria 3222
547 Ga0307406_10064864 3300031901 Bacteria 2371
548 Ga0307406_10422248 3300031901 Bacteria 1063
549 Ga0307412_10000401 3300031911 Bacteria 26384
550 Ga0307412_10014881 3300031911 Bacteria 4598
551 Ga0307412_10027454 3300031911 Bacteria 3549
552 Ga0307412_10114444 3300031911 Bacteria 1931
553 Ga0307412_10128873 3300031911 Bacteria 1834
554 Ga0307412_10143622 3300031911 Bacteria 1751
555 Ga0307412_10229525 3300031911 Bacteria 1428
556 Ga0307409_100114929 3300031995 Bacteria 2265
557 Ga0307416_100168469 3300032002 Bacteria 2035
558 Ga0307416_100235127 3300032002 Bacteria 1770
559 Ga0307416_100313562 3300032002 Bacteria 1566
560 Ga0307416_101373701 3300032002 Bacteria 812
561 Ga0307414_10018847 3300032004 Bacteria 4261
562 Ga0307414_10351963 3300032004 Bacteria 1264
563 Ga0307414_10529026 3300032004 Bacteria 1047
564 Ga0307414_11003013 3300032004 Bacteria 768
565 Ga0307411_10021537 3300032005 Bacteria 3774
566 Ga0307411_10044282 3300032005 Bacteria 2853
567 Ga0307411_10069287 3300032005 Bacteria 2381
568 Ga0307510_10081644 3300033180 Bacteria 3132
569 Ga0395899_0000478 3300037312 Bacteria 44762
570 Ga0395899_0002559 3300037312 Bacteria 14713
571 Ga0395899_0003641 3300037312 Bacteria 12200
572 Ga0395899_0010527 3300037312 Bacteria 7084
573 Ga0395899_0021543 3300037312 Bacteria 4887
574 Ga0395900_0000689 3300037418 Bacteria 45109
575 Ga0395900_0009793 3300037418 Bacteria 9820
576 Ga0395900_0054673 3300037418 Bacteria 4111
577 Ga0395900_0067915 3300037418 Bacteria 3662
578 Ga0395898_0006853 3300037466 Bacteria 12116
579 Ga0395898_0012935 3300037466 Bacteria 8609
580 Ga0395898_0542779 3300037466 Bacteria 1104
581 Ga0395905_0001455 3300037471 Bacteria 28407
582 Ga0395905_0006806 3300037471 Bacteria 11449
583 Ga0395905_0040143 3300037471 Bacteria 4390
584 Ga0395905_0131624 3300037471 Bacteria 2353
585 Ga0395901_0000448 3300038443 Bacteria 47911
586 Ga0395901_0013926 3300038443 Bacteria 8184
587 Ga0395901_0021143 3300038443 Bacteria 6666
588 Ga0395901_0707761 3300038443 Bacteria 1004
589 Ga0237819_00552 3300038705 Bacteria 12558
590 Ga0436361_0383577 3300039447 Bacteria 3194
591 Ga0439436_0002185 3300041404 Bacteria 5852
592 Ga0439436_0014730 3300041404 Bacteria 2355
593 Ga0439436_0031731 3300041404 Bacteria 1533
594 Ga0439438_003027 3300041405 Bacteria 6923
595 Ga0439438_008131 3300041405 Bacteria 3515
596 Ga0439438_009379 3300041405 Bacteria 3171
597 Ga0439438_029762 3300041405 Bacteria 1460
598 Ga0439438_056012 3300041405 Bacteria 993
599 Ga0439447_002518 3300041407 Bacteria 6665
600 Ga0439447_003011 3300041407 Bacteria 6030
601 Ga0439447_005933 3300041407 Bacteria 4012
602 Ga0439447_008182 3300041407 Bacteria 3257
603 Ga0439447_041380 3300041407 Bacteria 1121
604 Ga0439447_048871 3300041407 Bacteria 1014
605 Ga0439453_0033084 3300041408 Bacteria 987
606 Ga0439461_0060740 3300041410 Bacteria 858
607 Ga0439466_0002249 3300041411 Bacteria 7564
608 Ga0439466_0002406 3300041411 Bacteria 7338
609 Ga0439466_0002488 3300041411 Bacteria 7216
610 Ga0439466_0005445 3300041411 Bacteria 4865
611 Ga0439466_0007824 3300041411 Bacteria 4036
612 Ga0439466_0011931 3300041411 Bacteria 3209
613 Ga0439466_0022629 3300041411 Bacteria 2216
614 Ga0439466_0072787 3300041411 Bacteria 1092
615 Ga0439465_0002411 3300041413 Bacteria 6124
616 Ga0439431_0000362 3300041997 Bacteria 9558
617 Ga0439433_0000386 3300041999 Bacteria 7896
618 Ga0439442_003449 3300042002 Bacteria 3128
619 Ga0439445_0000121 3300042004 Bacteria 13329
620 Ga0439448_0000259 3300042005 Bacteria 11457
621 Ga0439432_000513 3300042006 Bacteria 14429
622 Ga0439432_001999 3300042006 Bacteria 7720
623 Ga0439432_012071 3300042006 Bacteria 2964
624 Ga0439432_015834 3300042006 Bacteria 2540
625 Ga0439432_032113 3300042006 Bacteria 1695
626 Ga0439432_059886 3300042006 Bacteria 1175
627 Ga0439449_0001222 3300042007 Bacteria 10081
628 Ga0439449_0052621 3300042007 Bacteria 1505
629 Ga0439450_003664 3300042008 Bacteria 2561
630 Ga0439451_000646 3300042009 Bacteria 6609
631 Ga0439451_003347 3300042009 Bacteria 3247
632 Ga0439451_004400 3300042009 Bacteria 2862
633 Ga0439451_008272 3300042009 Bacteria 2109
634 Ga0439451_048696 3300042009 Bacteria 848
635 Ga0439451_051306 3300042009 Bacteria 826
636 Ga0439452_002368 3300042010 Bacteria 7001
637 Ga0439452_002759 3300042010 Bacteria 6347
638 Ga0439452_008262 3300042010 Bacteria 3144
639 Ga0439452_008471 3300042010 Bacteria 3093
640 Ga0439452_022738 3300042010 Bacteria 1619
641 Ga0439452_048695 3300042010 Bacteria 976
642 Ga0439455_0023343 3300042012 Bacteria 1488
643 Ga0439456_001671 3300042013 Bacteria 4478
644 Ga0439456_004150 3300042013 Bacteria 2935
645 Ga0439456_042724 3300042013 Bacteria 984
646 Ga0439462_0011605 3300042015 Bacteria 2245
647 Ga0439463_001315 3300042016 Bacteria 6617
648 Ga0439463_001732 3300042016 Bacteria 5691
649 Ga0439463_003054 3300042016 Bacteria 4251
650 Ga0439463_029998 3300042016 Bacteria 1370
651 Ga0450911_001308 3300042115 Bacteria 5904
652 Ga0450911_007537 3300042115 Bacteria 1573
653 Ga0450919_001489 3300042121 Bacteria 3058
654 Ga0450919_003601 3300042121 Bacteria 1922
655 Ga0450920_001631 3300042122 Bacteria 3745
656 Ga0450923_015979 3300042125 Bacteria 1409
657 Ga0450890_003335 3300042127 Bacteria 2141
658 Ga0450900_001223 3300042136 Bacteria 2437
659 Ga0450902_004412 3300042137 Bacteria 2093
660 Ga0450902_016447 3300042137 Bacteria 1206
661 Ga0450903_001035 3300042138 Bacteria 5309
662 Ga0450903_009052 3300042138 Bacteria 1625
663 Ga0450903_015548 3300042138 Bacteria 1198
664 Ga0450905_001395 3300042142 Bacteria 3075
665 Ga0450906_001441 3300042145 Bacteria 5178
666 Ga0450906_004512 3300042145 Bacteria 2914
667 Ga0450907_001403 3300042146 Bacteria 5255
668 Ga0450907_001502 3300042146 Bacteria 4994
669 Ga0450907_001564 3300042146 Bacteria 4871
670 Ga0450910_001446 3300042147 Bacteria 2990
671 Ga0439446_0017528 3300042156 Bacteria 2002
672 Ga0439446_0021589 3300042156 Bacteria 1821
673 Ga0450908_011990 3300042184 Bacteria 1578
674 Ga0450908_022912 3300042184 Bacteria 1094
675 Ga0450908_042764 3300042184 Bacteria 785
676 Ga0450909_002330 3300042185 Bacteria 2692
677 Ga0450909_007436 3300042185 Bacteria 1586
678 Ga0439434_0034102 3300042435 Bacteria 1553
679 Ga0439434_0104232 3300042435 Bacteria 915
680 Ga0439464_0002118 3300042439 Bacteria 4838
681 Ga0439460_0000913 3300042461 Bacteria 6754
682 Ga0439460_0027876 3300042461 Bacteria 1589
683 Ga0450918_000196 3300042531 Bacteria 13608
684 Ga0450918_004059 3300042531 Bacteria 2689
685 Ga0450901_000243 3300042533 Bacteria 6617
686 Ga0439440_0011461 3300042993 Bacteria 1869
687 Ga0466969_0002577 3300044656 Bacteria 9685
688 Ga0466972_0003793 3300044658 Bacteria 7513
689 Ga0466972_0029120 3300044658 Bacteria 2720
690 Ga0466972_0184092 3300044658 Bacteria 979
691 Ga0466965_0004441 3300044683 Bacteria 6237
692 Ga0466965_0015148 3300044683 Bacteria 3661
693 Ga0466965_0038432 3300044683 Bacteria 2351
694 Ga0466965_0161174 3300044683 Bacteria 1176
695 Ga0466966_0052393 3300044684 Bacteria 2592
696 Ga0466966_0080819 3300044684 Bacteria 2024
697 Ga0466961_0017656 3300044693 Bacteria 4583
698 Ga0466964_0001947 3300044706 Bacteria 7239
699 Ga0466964_0017499 3300044706 Bacteria 2743
700 Ga0466964_0026220 3300044706 Bacteria 2280
701 Ga0466964_0214650 3300044706 Bacteria 931
702 Ga0466968_0007003 3300044735 Bacteria 4274
703 Ga0466968_0007529 3300044735 Bacteria 4144
704 Ga0466968_0008302 3300044735 Bacteria 3973
705 Ga0466957_0020683 3300044842 Bacteria 3873
706 Ga0466960_0127563 3300044901 Bacteria 1339
707 Ga0466960_0140472 3300044901 Bacteria 1282
708 Ga0466960_0325598 3300044901 Bacteria 871
709 Ga0466959_0014864 3300045049 Bacteria 5667
710 Ga0466959_0045215 3300045049 Bacteria 3243
711 Ga0466959_0365778 3300045049 Bacteria 982
712 Ga0466958_0077912 3300045836 Bacteria 2036
713 Ga0466967_0010798 3300045976 Bacteria 6872
714 Ga0495617_008515 3300046452 Bacteria 3534
715 Ga0495617_011744 3300046452 Bacteria 2986
716 Ga0495617_015578 3300046452 Bacteria 2574
717 Ga0495627_000083 3300046453 Bacteria 113227
718 Ga0495627_003909 3300046453 Bacteria 6377
719 Ga0495627_005462 3300046453 Bacteria 5119
720 Ga0495627_006280 3300046453 Bacteria 4668
721 Ga0495627_008624 3300046453 Bacteria 3803
722 Ga0495627_009171 3300046453 Bacteria 3650
723 Ga0495627_024339 3300046453 Bacteria 1974
724 Ga0495627_041276 3300046453 Bacteria 1417
725 Ga0495592_0064774 3300046454 Bacteria 2677
726 Ga0495603_0004335 3300046455 Bacteria 8462
727 Ga0495603_0080815 3300046455 Bacteria 1905
728 Ga0495603_0102798 3300046455 Bacteria 1668
729 Ga0495590_0012084 3300046457 Bacteria 3212
730 Ga0495590_0014464 3300046457 Bacteria 2877
731 Ga0495590_0025283 3300046457 Bacteria 2088
732 Ga0495590_0073097 3300046457 Bacteria 1205
733 Ga0495590_0074436 3300046457 Bacteria 1194
734 Ga0495590_0138886 3300046457 Bacteria 876
735 Ga0495591_000002 3300046458 Bacteria 455013
736 Ga0495591_000113 3300046458 Bacteria 93452
737 Ga0495591_003516 3300046458 Bacteria 8047
738 Ga0495591_003651 3300046458 Bacteria 7833
739 Ga0495591_004074 3300046458 Bacteria 7281
740 Ga0495591_008694 3300046458 Bacteria 4130
741 Ga0495591_009701 3300046458 Bacteria 3799
742 Ga0495591_009752 3300046458 Bacteria 3784
743 Ga0495591_013527 3300046458 Bacteria 2976
744 Ga0495591_014025 3300046458 Bacteria 2900
745 Ga0495591_015116 3300046458 Bacteria 2738
746 Ga0495591_022913 3300046458 Bacteria 2010
747 Ga0495591_034834 3300046458 Bacteria 1478
748 Ga0495591_036110 3300046458 Bacteria 1441
749 Ga0495591_044438 3300046458 Bacteria 1244
750 Ga0495591_051672 3300046458 Bacteria 1120
751 Ga0495591_073907 3300046458 Bacteria 880
752 Ga0495638_0031008 3300046460 Bacteria 3437
753 Ga0495638_0103993 3300046460 Bacteria 1694
754 Ga0495638_0192496 3300046460 Bacteria 1156
755 Ga0495638_0207299 3300046460 Bacteria 1103
756 Ga0495638_0238693 3300046460 Bacteria 1007
757 Ga0495651_0017632 3300046462 Bacteria 5525
758 Ga0495651_0126203 3300046462 Bacteria 1873
759 Ga0495651_0154753 3300046462 Bacteria 1649
760 Ga0495651_0187053 3300046462 Bacteria 1461
761 Ga0495653_0013706 3300046463 Bacteria 6606
762 Ga0495653_0019246 3300046463 Bacteria 5536
763 Ga0495653_0026743 3300046463 Bacteria 4624
764 Ga0495653_0107228 3300046463 Bacteria 2013
765 Ga0495653_0409177 3300046463 Bacteria 860
766 Ga0495650_0000623 3300046471 Bacteria 47691
767 Ga0495650_0002491 3300046471 Bacteria 14791
768 Ga0495650_0003593 3300046471 Bacteria 11187
769 Ga0495650_0067092 3300046471 Bacteria 1418
770 Ga0495650_0073259 3300046471 Bacteria 1338
771 Ga0495650_0089405 3300046471 Bacteria 1174
772 Ga0495580_0002103 3300046472 Bacteria 17475
773 Ga0495605_0000048 3300046474 Bacteria 170182
774 Ga0495605_0000100 3300046474 Bacteria 109002
775 Ga0495605_0000122 3300046474 Bacteria 101994
776 Ga0495605_0000157 3300046474 Bacteria 86897
777 Ga0495605_0000339 3300046474 Bacteria 46440
778 Ga0495605_0001304 3300046474 Bacteria 16517
779 Ga0495605_0003104 3300046474 Bacteria 10020
780 Ga0495605_0007095 3300046474 Bacteria 6382
781 Ga0495605_0008405 3300046474 Bacteria 5836
782 Ga0495605_0009534 3300046474 Bacteria 5450
783 Ga0495605_0024062 3300046474 Bacteria 3191
784 Ga0495605_0040719 3300046474 Bacteria 2318
785 Ga0495605_0041933 3300046474 Bacteria 2277
786 Ga0495605_0060194 3300046474 Bacteria 1820
787 Ga0495605_0062160 3300046474 Bacteria 1784
788 Ga0495605_0072134 3300046474 Bacteria 1629
789 Ga0495605_0131142 3300046474 Bacteria 1130
790 Ga0495639_0003059 3300046475 Bacteria 7279
791 Ga0495639_0003490 3300046475 Bacteria 6800
792 Ga0495639_0143286 3300046475 Bacteria 1150
793 Ga0495584_0002441 3300046491 Bacteria 10538
794 Ga0495584_0007556 3300046491 Bacteria 5665
795 Ga0495584_0008229 3300046491 Bacteria 5406
796 Ga0495584_0017198 3300046491 Bacteria 3684
797 Ga0495584_0022541 3300046491 Bacteria 3194
798 Ga0495584_0026803 3300046491 Bacteria 2920
799 Ga0495584_0073146 3300046491 Bacteria 1723
800 Ga0495584_0106135 3300046491 Bacteria 1420
801 Ga0495584_0124228 3300046491 Bacteria 1307
802 Ga0495584_0166746 3300046491 Bacteria 1119
803 Ga0495585_0010646 3300046492 Bacteria 5464
804 Ga0495585_0025718 3300046492 Bacteria 3367
805 Ga0495585_0036941 3300046492 Bacteria 2752
806 Ga0495585_0058636 3300046492 Bacteria 2123
807 Ga0495585_0116298 3300046492 Bacteria 1418
808 Ga0495594_0026034 3300046499 Bacteria 3145
809 Ga0495594_0028474 3300046499 Bacteria 3015
810 Ga0495596_0000060 3300046500 Bacteria 79429
811 Ga0495596_0008186 3300046500 Bacteria 4666
812 Ga0495596_0088404 3300046500 Bacteria 1202
813 Ga0495607_0000025 3300046501 Bacteria 159379
814 Ga0495607_0000700 3300046501 Bacteria 32278
815 Ga0495607_0004307 3300046501 Bacteria 10503
816 Ga0495607_0009429 3300046501 Bacteria 6608
817 Ga0495607_0010126 3300046501 Bacteria 6345
818 Ga0495607_0013887 3300046501 Bacteria 5262
819 Ga0495607_0020703 3300046501 Bacteria 4151
820 Ga0495607_0023824 3300046501 Bacteria 3825
821 Ga0495607_0027473 3300046501 Bacteria 3517
822 Ga0495607_0027597 3300046501 Bacteria 3507
823 Ga0495607_0032656 3300046501 Bacteria 3174
824 Ga0495607_0036551 3300046501 Bacteria 2957
825 Ga0495607_0047097 3300046501 Bacteria 2527
826 Ga0495607_0052257 3300046501 Bacteria 2367
827 Ga0495607_0071229 3300046501 Bacteria 1938
828 Ga0495607_0087140 3300046501 Bacteria 1700
829 Ga0495607_0105796 3300046501 Bacteria 1499
830 Ga0495607_0113072 3300046501 Bacteria 1436
831 Ga0495607_0124743 3300046501 Bacteria 1347
832 Ga0495607_0229300 3300046501 Bacteria 904
833 Ga0495583_0000096 3300046506 Bacteria 151090
834 Ga0495583_0000174 3300046506 Bacteria 109079
835 Ga0495583_0002655 3300046506 Bacteria 14891
836 Ga0495583_0005999 3300046506 Bacteria 8060
837 Ga0495583_0006439 3300046506 Bacteria 7678
838 Ga0495583_0007722 3300046506 Bacteria 6698
839 Ga0495583_0007740 3300046506 Bacteria 6687
840 Ga0495583_0017638 3300046506 Bacteria 3783
841 Ga0495583_0021365 3300046506 Bacteria 3331
842 Ga0495583_0056286 3300046506 Bacteria 1774
843 Ga0495606_0002388 3300046507 Bacteria 22020
844 Ga0495606_0007622 3300046507 Bacteria 9623
845 Ga0495606_0008130 3300046507 Bacteria 9189
846 Ga0495606_0011278 3300046507 Bacteria 7308
847 Ga0495606_0013494 3300046507 Bacteria 6445
848 Ga0495606_0014237 3300046507 Bacteria 6221
849 Ga0495606_0025647 3300046507 Bacteria 4216
850 Ga0495606_0035068 3300046507 Bacteria 3434
851 Ga0495606_0062812 3300046507 Bacteria 2369
852 Ga0495606_0067153 3300046507 Bacteria 2271
853 Ga0495606_0154542 3300046507 Bacteria 1343
854 Ga0495606_0157725 3300046507 Bacteria 1326
855 Ga0495606_0339071 3300046507 Bacteria 801
856 Ga0495606_0345354 3300046507 Bacteria 791
857 Ga0495608_0008033 3300046511 Bacteria 7416
858 Ga0495610_0000793 3300046512 Bacteria 29614
859 Ga0495610_0011986 3300046512 Bacteria 5252
860 Ga0495610_0019717 3300046512 Bacteria 3763
861 Ga0495610_0021338 3300046512 Bacteria 3564
862 Ga0495610_0023286 3300046512 Bacteria 3371
863 Ga0495610_0025576 3300046512 Bacteria 3164
864 Ga0495610_0027599 3300046512 Bacteria 3014
865 Ga0495610_0036476 3300046512 Bacteria 2512
866 Ga0495610_0063291 3300046512 Bacteria 1752
867 Ga0495610_0065205 3300046512 Bacteria 1719
868 Ga0495610_0085897 3300046512 Bacteria 1434
869 Ga0495610_0115229 3300046512 Bacteria 1185
870 Ga0495610_0115843 3300046512 Bacteria 1181
871 Ga0495610_0127871 3300046512 Bacteria 1106
872 Ga0495616_0011878 3300046513 Bacteria 4963
873 Ga0495616_0015111 3300046513 Bacteria 4296
874 Ga0495616_0025697 3300046513 Bacteria 3143
875 Ga0495616_0026041 3300046513 Bacteria 3117
876 Ga0495616_0028635 3300046513 Bacteria 2948
877 Ga0495616_0058116 3300046513 Bacteria 1905
878 Ga0495616_0082227 3300046513 Bacteria 1538
879 Ga0495616_0095331 3300046513 Bacteria 1402
880 Ga0495618_0014135 3300046514 Bacteria 4860
881 Ga0495620_0000085 3300046515 Bacteria 77879
882 Ga0495620_0000306 3300046515 Bacteria 34954
883 Ga0495620_0006325 3300046515 Bacteria 6518
884 Ga0495620_0010688 3300046515 Bacteria 4830
885 Ga0495620_0012319 3300046515 Bacteria 4425
886 Ga0495620_0015484 3300046515 Bacteria 3848
887 Ga0495620_0018041 3300046515 Bacteria 3502
888 Ga0495620_0019621 3300046515 Bacteria 3320
889 Ga0495620_0027695 3300046515 Bacteria 2648
890 Ga0495628_0000076 3300046516 Bacteria 78344
891 Ga0495628_0011291 3300046516 Bacteria 7555
892 Ga0495628_0145649 3300046516 Bacteria 1806
893 Ga0495631_0002255 3300046518 Bacteria 11055
894 Ga0495631_0018449 3300046518 Bacteria 3283
895 Ga0495631_0018531 3300046518 Bacteria 3275
896 Ga0495631_0033479 3300046518 Bacteria 2308
897 Ga0495631_0084394 3300046518 Bacteria 1368
898 Ga0495631_0123550 3300046518 Bacteria 1113
899 Ga0495632_0000843 3300046519 Bacteria 27042
900 Ga0495632_0007773 3300046519 Bacteria 6685
901 Ga0495632_0015914 3300046519 Bacteria 4199
902 Ga0495632_0017927 3300046519 Bacteria 3894
903 Ga0495632_0020548 3300046519 Bacteria 3571
904 Ga0495632_0023533 3300046519 Bacteria 3289
905 Ga0495632_0025244 3300046519 Bacteria 3145
906 Ga0495632_0028338 3300046519 Bacteria 2923
907 Ga0495632_0052463 3300046519 Bacteria 2005
908 Ga0495632_0095995 3300046519 Bacteria 1400
909 Ga0495632_0102171 3300046519 Bacteria 1350
910 Ga0495632_0109272 3300046519 Bacteria 1299
911 Ga0495632_0139413 3300046519 Bacteria 1125
912 Ga0495637_0000301 3300046520 Bacteria 38275
913 Ga0495637_0000948 3300046520 Bacteria 18540
914 Ga0495637_0007787 3300046520 Bacteria 5292
915 Ga0495637_0009362 3300046520 Bacteria 4778
916 Ga0495637_0010322 3300046520 Bacteria 4523
917 Ga0495637_0015564 3300046520 Bacteria 3568
918 Ga0495637_0019071 3300046520 Bacteria 3175
919 Ga0495637_0020136 3300046520 Bacteria 3073
920 Ga0495637_0033696 3300046520 Bacteria 2247
921 Ga0495637_0035009 3300046520 Bacteria 2195
922 Ga0495637_0046098 3300046520 Bacteria 1845
923 Ga0495637_0050312 3300046520 Bacteria 1748
924 Ga0495637_0056721 3300046520 Bacteria 1620
925 Ga0495637_0062852 3300046520 Bacteria 1518
926 Ga0495637_0129753 3300046520 Bacteria 963
927 Ga0495643_0000017 3300046522 Bacteria 313381
928 Ga0495643_0009169 3300046522 Bacteria 6178
929 Ga0495643_0024262 3300046522 Bacteria 3441
930 Ga0495643_0032085 3300046522 Bacteria 2918
931 Ga0495643_0092113 3300046522 Bacteria 1562
932 Ga0495643_0142913 3300046522 Bacteria 1191
933 Ga0495643_0163289 3300046522 Bacteria 1094
934 Ga0495643_0210030 3300046522 Bacteria 929
935 Ga0495643_0293515 3300046522 Bacteria 743
936 Ga0495644_0008107 3300046523 Bacteria 4040
937 Ga0495644_0010436 3300046523 Bacteria 3580
938 Ga0495644_0015458 3300046523 Bacteria 2922
939 Ga0495644_0018365 3300046523 Bacteria 2671
940 Ga0495648_0005408 3300046524 Bacteria 10618
941 Ga0495648_0006603 3300046524 Bacteria 9421
942 Ga0495648_0017221 3300046524 Bacteria 5174
943 Ga0495648_0018140 3300046524 Bacteria 5000
944 Ga0495648_0031268 3300046524 Bacteria 3507
945 Ga0495648_0039184 3300046524 Bacteria 3018
946 Ga0495648_0040940 3300046524 Bacteria 2932
947 Ga0495648_0042386 3300046524 Bacteria 2863
948 Ga0495648_0094394 3300046524 Bacteria 1666
949 Ga0495648_0103956 3300046524 Bacteria 1560
950 Ga0495648_0131601 3300046524 Bacteria 1329
951 Ga0495648_0167299 3300046524 Bacteria 1130
952 Ga0495648_0187893 3300046524 Bacteria 1044
953 Ga0495666_0003913 3300046526 Bacteria 7526
954 Ga0495666_0067328 3300046526 Bacteria 1706
955 Ga0495642_0003183 3300046528 Bacteria 6510
956 Ga0495642_0003695 3300046528 Bacteria 6007
957 Ga0495642_0048265 3300046528 Bacteria 1745
958 Ga0495652_0024033 3300046529 Bacteria 5398
959 Ga0495652_0048460 3300046529 Bacteria 3640
960 Ga0495652_0083701 3300046529 Bacteria 2625
961 Ga0495654_0000446 3300046530 Bacteria 35044
962 Ga0495654_0008111 3300046530 Bacteria 5821
963 Ga0495654_0011590 3300046530 Bacteria 4766
964 Ga0495654_0011680 3300046530 Bacteria 4744
965 Ga0495654_0013053 3300046530 Bacteria 4451
966 Ga0495654_0014627 3300046530 Bacteria 4173
967 Ga0495654_0017413 3300046530 Bacteria 3780
968 Ga0495654_0022733 3300046530 Bacteria 3252
969 Ga0495654_0022931 3300046530 Bacteria 3236
970 Ga0495654_0028942 3300046530 Bacteria 2829
971 Ga0495654_0031638 3300046530 Bacteria 2685
972 Ga0495654_0056740 3300046530 Bacteria 1892
973 Ga0495654_0080553 3300046530 Bacteria 1527
974 Ga0495654_0081388 3300046530 Bacteria 1517
975 Ga0495654_0094659 3300046530 Bacteria 1381
976 Ga0495654_0118859 3300046530 Bacteria 1198
977 Ga0495654_0126113 3300046530 Bacteria 1153
978 Ga0495654_0143185 3300046530 Bacteria 1063
979 Ga0495587_0014770 3300046536 Bacteria 4890
980 Ga0495609_0000012 3300046538 Bacteria 333994
981 Ga0495609_0000023 3300046538 Bacteria 269702
982 Ga0495609_0000088 3300046538 Bacteria 109269
983 Ga0495609_0000132 3300046538 Bacteria 80926
984 Ga0495609_0000649 3300046538 Bacteria 27069
985 Ga0495609_0007369 3300046538 Bacteria 5500
986 Ga0495609_0015268 3300046538 Bacteria 3596
987 Ga0495609_0028323 3300046538 Bacteria 2556
988 Ga0495609_0033448 3300046538 Bacteria 2334
989 Ga0495609_0087541 3300046538 Bacteria 1356
990 Ga0495609_0090652 3300046538 Bacteria 1330
991 Ga0495597_0000011 3300046542 Bacteria 221377
992 Ga0495597_0000185 3300046542 Bacteria 56031
993 Ga0495597_0001086 3300046542 Bacteria 20631
994 Ga0495597_0015149 3300046542 Bacteria 3654
995 Ga0495597_0016172 3300046542 Bacteria 3527
996 Ga0495597_0021177 3300046542 Bacteria 3023
997 Ga0495597_0028158 3300046542 Bacteria 2572
998 Ga0495597_0090729 3300046542 Bacteria 1297
999 Ga0495597_0120057 3300046542 Bacteria 1096
1000 Ga0495597_0135545 3300046542 Bacteria 1018
1001 Ga0495597_0151658 3300046542 Bacteria 950
1002 Ga0495645_0055410 3300046543 Bacteria 2879
1003 Ga0495622_0011715 3300046557 Bacteria 4054
1004 Ga0495622_0016547 3300046557 Bacteria 3435
1005 Ga0495622_0020286 3300046557 Bacteria 3094
1006 Ga0495622_0084911 3300046557 Bacteria 1456
1007 Ga0495622_0101775 3300046557 Bacteria 1316
1008 Ga0495633_0000034 3300046558 Bacteria 185552
1009 Ga0495633_0009015 3300046558 Bacteria 5549
1010 Ga0495633_0014506 3300046558 Bacteria 4117
1011 Ga0495656_0003752 3300046615 Bacteria 5158
1012 Ga0495656_0082991 3300046615 Bacteria 1450
1013 Ga0495656_0114758 3300046615 Bacteria 1264
1014 Ga0495668_0006815 3300046616 Bacteria 7416
1015 Ga0495668_0016904 3300046616 Bacteria 4236
1016 Ga0495668_0026872 3300046616 Bacteria 3263
1017 Ga0495668_0086948 3300046616 Bacteria 1714
1018 Ga0495668_0198571 3300046616 Bacteria 1098
1019 Ga0495634_0016357 3300046642 Bacteria 5305
1020 Ga0495634_0052805 3300046642 Bacteria 2724
1021 Ga0495634_0126500 3300046642 Bacteria 1633
1022 Ga0495611_0001661 3300046648 Bacteria 10790
1023 Ga0495611_0004094 3300046648 Bacteria 6345
1024 Ga0495611_0004457 3300046648 Bacteria 6060
1025 Ga0495611_0082749 3300046648 Bacteria 1477
1026 Ga0495611_0168905 3300046648 Bacteria 1022
1027 Ga0495625_0000061 3300046660 Bacteria 179140
1028 Ga0495625_0001913 3300046660 Bacteria 23538
1029 Ga0495625_0012656 3300046660 Bacteria 6828
1030 Ga0495625_0014555 3300046660 Bacteria 6271
1031 Ga0495625_0038915 3300046660 Bacteria 3476
1032 Ga0495625_0045837 3300046660 Bacteria 3159
1033 Ga0495625_0201382 3300046660 Bacteria 1314
1034 Ga0495625_0209300 3300046660 Bacteria 1283
1035 Ga0495625_0230565 3300046660 Bacteria 1209
1036 Ga0495635_0041374 3300046663 Bacteria 3183
1037 Ga0495635_0155319 3300046663 Bacteria 1557
1038 Ga0495659_0002669 3300046664 Bacteria 5744
1039 Ga0495659_0077951 3300046664 Bacteria 1252
1040 Ga0495661_0000004 3300046665 Bacteria 555340
1041 Ga0495661_0000036 3300046665 Bacteria 164694
1042 Ga0495661_0000060 3300046665 Bacteria 131162
1043 Ga0495661_0000187 3300046665 Bacteria 71327
1044 Ga0495661_0001218 3300046665 Bacteria 22323
1045 Ga0495661_0002367 3300046665 Bacteria 14543
1046 Ga0495661_0009192 3300046665 Bacteria 6790
1047 Ga0495661_0048174 3300046665 Bacteria 2590
1048 Ga0495661_0097426 3300046665 Bacteria 1661
1049 Ga0495661_0140827 3300046665 Bacteria 1312
1050 Ga0495661_0162307 3300046665 Bacteria 1198
1051 Ga0495588_0158347 3300046674 Bacteria 1197
1052 Ga0495588_0274324 3300046674 Bacteria 888
1053 Ga0495657_0100484 3300046675 Bacteria 1844
1054 Ga0495657_0220054 3300046675 Bacteria 1151
1055 Ga0495599_0034503 3300046678 Bacteria 3178
1056 Ga0495623_0006955 3300046679 Bacteria 7353
1057 Ga0495623_0039096 3300046679 Bacteria 3032
1058 Ga0495646_0003698 3300046680 Bacteria 9547
1059 Ga0495669_0008374 3300046684 Bacteria 4346
1060 Ga0495613_0122405 3300046689 Bacteria 1867
1061 Ga0495613_0415467 3300046689 Bacteria 916
1062 Ga0495624_0011454 3300046690 Bacteria 6094
1063 Ga0495624_0020811 3300046690 Bacteria 4359
1064 Ga0495624_0030721 3300046690 Bacteria 3497
1065 Ga0495670_0024067 3300046691 Bacteria 3007
1066 Ga0495670_0025848 3300046691 Bacteria 2905
1067 Ga0495670_0032353 3300046691 Bacteria 2601
1068 Ga0495670_0038481 3300046691 Bacteria 2384
1069 Ga0495670_0056069 3300046691 Bacteria 1976
1070 Ga0495670_0078241 3300046691 Bacteria 1682
1071 Ga0495670_0244214 3300046691 Bacteria 956
1072 Ga0495670_0369036 3300046691 Bacteria 773
1073 Ga0495671_0000662 3300046692 Bacteria 24991
1074 Ga0495671_0001738 3300046692 Bacteria 14119
1075 Ga0495671_0001929 3300046692 Bacteria 13311
1076 Ga0495671_0004125 3300046692 Bacteria 8757
1077 Ga0495671_0023909 3300046692 Bacteria 3189
1078 Ga0495671_0028439 3300046692 Bacteria 2879
1079 Ga0495671_0028502 3300046692 Bacteria 2875
1080 Ga0495671_0035860 3300046692 Bacteria 2516
1081 Ga0495671_0054514 3300046692 Bacteria 1982
1082 Ga0495671_0059564 3300046692 Bacteria 1886
1083 Ga0495671_0060744 3300046692 Bacteria 1865
1084 Ga0495671_0078233 3300046692 Bacteria 1621
1085 Ga0495671_0086076 3300046692 Bacteria 1539
1086 Ga0495671_0100340 3300046692 Bacteria 1415
1087 Ga0495671_0125138 3300046692 Bacteria 1253
1088 Ga0495671_0144353 3300046692 Bacteria 1159
1089 Ga0495649_0007545 3300046694 Bacteria 6620
1090 Ga0495649_0013292 3300046694 Bacteria 4753
1091 Ga0495649_0015889 3300046694 Bacteria 4276
1092 Ga0495649_0023844 3300046694 Bacteria 3416
1093 Ga0495649_0030657 3300046694 Bacteria 2969
1094 Ga0495649_0056291 3300046694 Bacteria 2123
1095 Ga0495649_0064754 3300046694 Bacteria 1962
1096 Ga0495649_0072808 3300046694 Bacteria 1841
1097 Ga0495649_0078469 3300046694 Bacteria 1766
1098 Ga0495649_0080867 3300046694 Bacteria 1737
1099 Ga0495649_0096429 3300046694 Bacteria 1574
1100 Ga0495649_0104176 3300046694 Bacteria 1506
1101 Ga0495589_0003318 3300046794 Bacteria 8734
1102 Ga0495589_0010874 3300046794 Bacteria 4728
1103 Ga0495589_0021478 3300046794 Bacteria 3298
1104 Ga0495589_0022326 3300046794 Bacteria 3229
1105 Ga0495589_0082550 3300046794 Bacteria 1562
1106 Ga0495589_0231540 3300046794 Bacteria 866
1107 Ga0495600_0003938 3300046809 Bacteria 8822
1108 Ga0495600_0179248 3300046809 Bacteria 1365
1109 Ga0495600_0185820 3300046809 Bacteria 1338
1110 Ga0495600_0204923 3300046809 Bacteria 1265
1111 Ga0495660_0003401 3300046810 Bacteria 9847
1112 Ga0495660_0003415 3300046810 Bacteria 9832
1113 Ga0495660_0011226 3300046810 Bacteria 5201
1114 Ga0495660_0026559 3300046810 Bacteria 3281
1115 Ga0495660_0028351 3300046810 Bacteria 3164
1116 Ga0495660_0028386 3300046810 Bacteria 3161
1117 Ga0495660_0038247 3300046810 Bacteria 2668
1118 Ga0495660_0050839 3300046810 Bacteria 2256
1119 Ga0495660_0053651 3300046810 Bacteria 2187
1120 Ga0495660_0065478 3300046810 Bacteria 1939
1121 Ga0495660_0089028 3300046810 Bacteria 1607
1122 Ga0495660_0097599 3300046810 Bacteria 1517
1123 Ga0495660_0160907 3300046810 Bacteria 1101
1124 Ga0495660_0176078 3300046810 Bacteria 1038
1125 Ga0495660_0210676 3300046810 Bacteria 922
1126 Ga0495604_0000948 3300047317 Bacteria 24198
1127 Ga0495604_0050468 3300047317 Bacteria 3230
1128 Ga0495604_0094930 3300047317 Bacteria 2204
1129 Ga0495604_0182182 3300047317 Bacteria 1468
1130 Ga0495604_0218715 3300047317 Bacteria 1312
1131 Ga0495636_0011170 3300047318 Bacteria 3552
1132 Ga0495674_0093556 3300047319 Bacteria 2565
1133 Ga0495672_0006253 3300047320 Bacteria 9279
1134 Ga0495672_0007817 3300047320 Bacteria 7988
1135 Ga0495672_0008177 3300047320 Bacteria 7759
1136 Ga0495672_0010931 3300047320 Bacteria 6438
1137 Ga0495672_0013983 3300047320 Bacteria 5516
1138 Ga0495672_0017033 3300047320 Bacteria 4868
1139 Ga0495672_0017358 3300047320 Bacteria 4815
1140 Ga0495672_0018955 3300047320 Bacteria 4552
1141 Ga0495672_0025697 3300047320 Bacteria 3764
1142 Ga0495672_0032878 3300047320 Bacteria 3219
1143 Ga0495672_0036278 3300047320 Bacteria 3028
1144 Ga0495672_0037415 3300047320 Bacteria 2969
1145 Ga0495672_0040141 3300047320 Bacteria 2840
1146 Ga0495672_0042164 3300047320 Bacteria 2754
1147 Ga0495672_0072442 3300047320 Bacteria 1946
1148 Ga0495672_0088004 3300047320 Bacteria 1713
1149 Ga0495672_0100895 3300047320 Bacteria 1565
1150 Ga0495672_0108685 3300047320 Bacteria 1492
1151 Ga0495672_0165702 3300047320 Bacteria 1131
1152 Ga0495672_0242159 3300047320 Bacteria 880
1153 Ga0495676_0000011 3300047321 Bacteria 242612
1154 Ga0495676_0020361 3300047321 Bacteria 5820
1155 Ga0495676_0173689 3300047321 Bacteria 1514
1156 Ga0495680_0055612 3300047322 Bacteria 3068
1157 Ga0495680_0342418 3300047322 Bacteria 1042
1158 Ga0495683_0000028 3300047323 Bacteria 153672
1159 Ga0495683_0000034 3300047323 Bacteria 148959
1160 Ga0495683_0000070 3300047323 Bacteria 108186
1161 Ga0495683_0017499 3300047323 Bacteria 3714
1162 Ga0495683_0022075 3300047323 Bacteria 3274
1163 Ga0495683_0057785 3300047323 Bacteria 1927
1164 Ga0495687_006777 3300047443 Bacteria 6928
1165 Ga0495687_008366 3300047443 Bacteria 5927
1166 Ga0495687_008443 3300047443 Bacteria 5897
1167 Ga0495675_0039511 3300047444 Bacteria 3004
1168 Ga0495677_0019091 3300047445 Bacteria 2486
1169 Ga0495677_0093214 3300047445 Bacteria 1136
1170 Ga0495679_000028 3300047446 Bacteria 192300
1171 Ga0495679_000370 3300047446 Bacteria 34815
1172 Ga0495679_004083 3300047446 Bacteria 6837
1173 Ga0495679_013446 3300047446 Bacteria 3073
1174 Ga0495679_031520 3300047446 Bacteria 1709
1175 Ga0495679_054703 3300047446 Bacteria 1187
1176 Ga0495679_059342 3300047446 Bacteria 1125
1177 Ga0495673_0002589 3300047469 Bacteria 12590
1178 Ga0495673_0004790 3300047469 Bacteria 8369
1179 Ga0495673_0005801 3300047469 Bacteria 7392
1180 Ga0495673_0015551 3300047469 Bacteria 3917
1181 Ga0495673_0015946 3300047469 Bacteria 3855
1182 Ga0495673_0016029 3300047469 Bacteria 3844
1183 Ga0495673_0017738 3300047469 Bacteria 3604
1184 Ga0495673_0018232 3300047469 Bacteria 3545
1185 Ga0495673_0023496 3300047469 Bacteria 2997
1186 Ga0495673_0025842 3300047469 Bacteria 2814
1187 Ga0495673_0029397 3300047469 Bacteria 2593
1188 Ga0495673_0035779 3300047469 Bacteria 2284
1189 Ga0495673_0040254 3300047469 Bacteria 2113
1190 Ga0495673_0049794 3300047469 Bacteria 1842
1191 Ga0495673_0050604 3300047469 Bacteria 1822
1192 Ga0495673_0057994 3300047469 Bacteria 1670
1193 Ga0495673_0064001 3300047469 Bacteria 1566
1194 Ga0495673_0076174 3300047469 Bacteria 1399
1195 Ga0495673_0088590 3300047469 Bacteria 1268
1196 Ga0495673_0115752 3300047469 Bacteria 1066
1197 Ga0495673_0125643 3300047469 Bacteria 1012
1198 Ga0495673_0141971 3300047469 Bacteria 935
1199 Ga0495673_0174170 3300047469 Bacteria 818
1200 Ga0495681_0008476 3300047470 Bacteria 6447
1201 Ga0495681_0019090 3300047470 Bacteria 3754
1202 Ga0495681_0021856 3300047470 Bacteria 3437
1203 Ga0495681_0022771 3300047470 Bacteria 3343
1204 Ga0495681_0024639 3300047470 Bacteria 3163
1205 Ga0495681_0027271 3300047470 Bacteria 2957
1206 Ga0495681_0031133 3300047470 Bacteria 2706
1207 Ga0495681_0041865 3300047470 Bacteria 2221
1208 Ga0495681_0045559 3300047470 Bacteria 2098
1209 Ga0495681_0059234 3300047470 Bacteria 1771
1210 Ga0495681_0062733 3300047470 Bacteria 1708
1211 Ga0495681_0071169 3300047470 Bacteria 1575
1212 Ga0495681_0110542 3300047470 Bacteria 1190
1213 Ga0495681_0151488 3300047470 Bacteria 972
1214 Ga0495684_0095672 3300047471 Bacteria 2248
1215 Ga0495686_0104090 3300047472 Bacteria 1709
1216 Ga0495686_0113864 3300047472 Bacteria 1619
1217 Ga0495686_0142235 3300047472 Bacteria 1415
1218 Ga0495686_0148283 3300047472 Bacteria 1379
1219 Ga0495593_0078652 3300047673 Bacteria 1708
1220 Ga0495593_0127608 3300047673 Bacteria 1292
1221 Ga0495593_0135498 3300047673 Bacteria 1248
1222 Ga0495602_0009002 3300048088 Bacteria 10403
1223 Ga0495602_0376219 3300048088 Bacteria 1018
1224 Ga0495626_0000024 3300048091 Bacteria 214179
1225 Ga0495626_0006473 3300048091 Bacteria 6665
1226 Ga0495626_0007135 3300048091 Bacteria 6253
1227 Ga0495626_0016350 3300048091 Bacteria 3770
1228 Ga0495626_0022425 3300048091 Bacteria 3118
1229 Ga0495626_0044773 3300048091 Bacteria 2068
1230 Ga0495626_0052961 3300048091 Bacteria 1869
1231 Ga0495626_0070204 3300048091 Bacteria 1576
1232 Ga0495626_0076772 3300048091 Bacteria 1490
1233 Ga0496100_0039148 3300048903 Bacteria 3009
1234 Ga0496101_0009650 3300048904 Bacteria 6349
1235 Ga0496102_0004242 3300048905 Bacteria 12120
1236 Ga0496102_0004534 3300048905 Bacteria 11740
1237 Ga0496103_0013210 3300048906 Bacteria 4896
1238 Ga0496104_0137938 3300048907 Bacteria 2343
1239 Ga0496105_0002236 3300048908 Bacteria 14021
1240 Ga0496106_0011540 3300048909 Bacteria 6531
1241 Ga0496107_0315144 3300048910 Bacteria 1164
1242 Ga0496110_0038468 3300048913 Bacteria 4163
1243 Ga0496110_0195940 3300048913 Bacteria 1835
1244 Ga0496111_0187292 3300048914 Bacteria 1538
1245 Ga0496112_0441141 3300048915 Bacteria 1240
1246 Ga0496112_0569987 3300048915 Bacteria 1065
1247 Ga0496114_0002270 3300048917 Bacteria 14636
1248 Ga0496114_0102391 3300048917 Bacteria 2446
1249 Ga0496116_0001954 3300048919 Bacteria 22220
1250 Ga0496116_0006985 3300048919 Bacteria 10115
1251 Ga0496116_0020749 3300048919 Bacteria 4978
1252 Ga0496116_0022501 3300048919 Bacteria 4722
1253 Ga0496116_0029771 3300048919 Bacteria 3930
1254 Ga0496116_0041683 3300048919 Bacteria 3147
1255 Ga0496116_0065419 3300048919 Bacteria 2332
1256 Ga0496116_0117438 3300048919 Bacteria 1548
1257 Ga0496116_0135888 3300048919 Bacteria 1392
1258 Ga0496116_0138478 3300048919 Bacteria 1373
1259 Ga0496117_0004774 3300048920 Bacteria 14697
1260 Ga0496117_0012455 3300048920 Bacteria 7491
1261 Ga0496117_0029302 3300048920 Bacteria 4247
1262 Ga0496117_0087048 3300048920 Bacteria 2026
1263 Ga0496117_0124601 3300048920 Bacteria 1575
1264 Ga0496117_0147306 3300048920 Bacteria 1399
1265 Ga0496117_0159215 3300048920 Bacteria 1325
1266 Ga0496118_0014455 3300048921 Bacteria 7390
1267 Ga0496118_0073811 3300048921 Bacteria 2441
1268 Ga0496118_0095396 3300048921 Bacteria 2030
1269 Ga0496118_0110003 3300048921 Bacteria 1832
1270 Ga0496118_0141186 3300048921 Bacteria 1526
1271 Ga0496118_0182613 3300048921 Bacteria 1265
1272 Ga0496118_0206247 3300048921 Bacteria 1158
1273 Ga0496119_0052709 3300048922 Bacteria 2490
1274 Ga0496119_0191494 3300048922 Bacteria 1065
1275 Ga0496120_0005221 3300048923 Bacteria 10458
1276 Ga0496120_0015311 3300048923 Bacteria 5065
1277 Ga0496121_0001365 3300048924 Bacteria 41600
1278 Ga0496121_0013843 3300048924 Bacteria 8630
1279 Ga0496121_0015990 3300048924 Bacteria 7781
1280 Ga0496121_0016038 3300048924 Bacteria 7766
1281 Ga0496121_0017647 3300048924 Bacteria 7270
1282 Ga0496121_0043798 3300048924 Bacteria 3870
1283 Ga0496121_0086255 3300048924 Bacteria 2467
1284 Ga0496121_0096435 3300048924 Bacteria 2295
1285 Ga0496121_0155626 3300048924 Bacteria 1677
1286 Ga0496121_0221953 3300048924 Bacteria 1330
1287 Ga0496121_0300223 3300048924 Bacteria 1090
1288 Ga0496121_0484260 3300048924 Bacteria 789
1289 Ga0496122_0000449 3300048925 Bacteria 85961
1290 Ga0496122_0000616 3300048925 Bacteria 73030
1291 Ga0496122_0000669 3300048925 Bacteria 68904
1292 Ga0496122_0001392 3300048925 Bacteria 39241
1293 Ga0496122_0003626 3300048925 Bacteria 20083
1294 Ga0496122_0011766 3300048925 Bacteria 8813
1295 Ga0496122_0020263 3300048925 Bacteria 6021
1296 Ga0496122_0038861 3300048925 Bacteria 3803
1297 Ga0496122_0071453 3300048925 Bacteria 2473
1298 Ga0496122_0123299 3300048925 Bacteria 1665
1299 Ga0496122_0127065 3300048925 Bacteria 1629
1300 Ga0496123_0000263 3300048926 Bacteria 105886
1301 Ga0496123_0000632 3300048926 Bacteria 58881
1302 Ga0496123_0000977 3300048926 Bacteria 44079
1303 Ga0496123_0001569 3300048926 Bacteria 31270
1304 Ga0496123_0008524 3300048926 Bacteria 9401
1305 Ga0496123_0065943 3300048926 Bacteria 2297
1306 Ga0496123_0067508 3300048926 Bacteria 2258
1307 Ga0496123_0071585 3300048926 Bacteria 2161
1308 Ga0496123_0090133 3300048926 Bacteria 1824
1309 Ga0496124_0000073 3300048927 Bacteria 219306
1310 Ga0496124_0007897 3300048927 Bacteria 11206
1311 Ga0496124_0015211 3300048927 Bacteria 7386
1312 Ga0496124_0015525 3300048927 Bacteria 7292
1313 Ga0496124_0050107 3300048927 Bacteria 3559
1314 Ga0496124_0081214 3300048927 Bacteria 2665
1315 Ga0496124_0087475 3300048927 Bacteria 2548
1316 Ga0496124_0174404 3300048927 Bacteria 1661
1317 Ga0496124_0381807 3300048927 Bacteria 985
1318 Ga0496125_0000168 3300048928 Bacteria 146364
1319 Ga0496125_0000319 3300048928 Bacteria 93727
1320 Ga0496125_0000947 3300048928 Bacteria 45544
1321 Ga0496125_0003314 3300048928 Bacteria 19714
1322 Ga0496125_0005089 3300048928 Bacteria 14806
1323 Ga0496125_0005136 3300048928 Bacteria 14724
1324 Ga0496125_0026564 3300048928 Bacteria 5271
1325 Ga0496125_0037898 3300048928 Bacteria 4184
1326 Ga0496125_0046824 3300048928 Bacteria 3624
1327 Ga0496125_0057758 3300048928 Bacteria 3139
1328 Ga0496125_0062306 3300048928 Bacteria 2984
1329 Ga0496125_0211080 3300048928 Bacteria 1261
1330 Ga0496126_0023661 3300048929 Bacteria 5949
1331 Ga0496126_0024217 3300048929 Bacteria 5864
1332 Ga0496126_0086476 3300048929 Bacteria 2763
1333 Ga0496126_0101023 3300048929 Bacteria 2523
1334 Ga0496126_0150981 3300048929 Bacteria 1991
1335 Ga0496126_0226004 3300048929 Bacteria 1570
1336 Ga0496126_0248988 3300048929 Bacteria 1481
1337 Ga0496126_0360461 3300048929 Bacteria 1187
1338 Ga0495678_000049 3300049459 Bacteria 163929
1339 Ga0495678_000160 3300049459 Bacteria 80551
1340 Ga0495678_009421 3300049459 Bacteria 4833
1341 Ga0495678_013793 3300049459 Bacteria 3782
1342 Ga0495678_018525 3300049459 Bacteria 3128
1343 Ga0495678_018970 3300049459 Bacteria 3079
1344 Ga0495678_020127 3300049459 Bacteria 2961
1345 Ga0495678_021976 3300049459 Bacteria 2798
1346 Ga0495678_025529 3300049459 Bacteria 2535
1347 Ga0495678_026414 3300049459 Bacteria 2479
1348 Ga0495678_053864 3300049459 Bacteria 1542
1349 Ga0495678_060446 3300049459 Bacteria 1425
1350 Ga0495678_102818 3300049459 Bacteria 987
1351 Ga0495682_0000090 3300049460 Bacteria 79463
1352 Ga0495682_0001506 3300049460 Bacteria 12391
1353 Ga0495682_0028204 3300049460 Bacteria 2081
1354 Ga0495682_0040104 3300049460 Bacteria 1717
1355 Ga0495682_0087915 3300049460 Bacteria 1116
1356 Ga0501238_007309 3300049671 Bacteria 1433
1357 Ga0501241_022199 3300049758 Bacteria 1172
1358 nmdc:mga00v17_11469_c1 3300050491 Bacteria 4870
1359 nmdc:mga00v17_188609_c1 3300050491 Bacteria 1331
1360 nmdc:mga00v17_50346_c1 3300050491 Bacteria 2177
1361 nmdc:mga0yw44_249364_c1 3300050492 Bacteria 1181
1362 nmdc:mga0k408_184357_c1 3300050493 Bacteria 1245
1363 nmdc:mga0k408_198142_c1 3300050493 Bacteria 1198
1364 nmdc:mga0k408_2992_c1 3300050493 Bacteria 8961
1365 nmdc:mga06z11_105374_c1 3300050494 Bacteria 1553
1366 nmdc:mga08x19_251483_c1 3300050514 Bacteria 1220
1367 nmdc:mga08x19_355381_c1 3300050514 Bacteria 1023
1368 Ga0495601_0019812 3300053077 Bacteria 4107
1369 Ga0500646_0000914 3300053090 Bacteria 8136
1370 Ga0500583_0006260 3300053092 Bacteria 4078
1371 Ga0500583_0179503 3300053092 Bacteria 1054
1372 Ga0500641_0022457 3300053096 Bacteria 2417
1373 Ga0500650_0065649 3300053098 Bacteria 1695
1374 Ga0500594_0011721 3300053118 Bacteria 2051
1375 Ga0500595_001205 3300053119 Bacteria 14280
1376 Ga0500618_023789 3300053125 Bacteria 1480
1377 Ga0500618_025568 3300053125 Bacteria 1414
1378 Ga0500655_004044 3300053133 Bacteria 2642
1379 Ga0500559_0000578 3300053136 Bacteria 25123
1380 Ga0500573_0034392 3300053140 Bacteria 2924
1381 Ga0500586_056689 3300053145 Bacteria 1359
1382 Ga0500604_0003723 3300053151 Bacteria 4077
1383 Ga0500619_003230 3300053154 Bacteria 3298

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009036 Ga0105244_10000008 Ga0105244_10000008265 195
2 3300025728 Ga0207655_1000083 Ga0207655_100008324 195
3 3300046512 Ga0495610_0023286 Ga0495610_0023286_2543_3136 197
4 3300046538 Ga0495609_0000649 Ga0495609_0000649_5311_5967 197
5 3300047469 Ga0495673_0088590 Ga0495673_0088590_400_1056 197
6 3300006946 Ga0079104_1000093 Ga0079104_100009336 198
7 3300013104 Ga0157370_10011932 Ga0157370_100119326 198
8 3300027111 Ga0209281_1000084 Ga0209281_1000084144 198
9 3300041404 Ga0439436_0002185 Ga0439436_0002185_4970_5626 199
10 3300041411 Ga0439466_0002488 Ga0439466_0002488_1126_1782 199
11 3300041413 Ga0439465_0002411 Ga0439465_0002411_5086_5742 199
12 3300041997 Ga0439431_0000362 Ga0439431_0000362_2537_3193 199
13 3300041999 Ga0439433_0000386 Ga0439433_0000386_3343_3999 199
14 3300042002 Ga0439442_003449 Ga0439442_003449_923_1579 199
15 3300042004 Ga0439445_0000121 Ga0439445_0000121_891_1547 199
16 3300042006 Ga0439432_015834 Ga0439432_015834_1406_2062 199
17 3300042007 Ga0439449_0001222 Ga0439449_0001222_2800_3456 199
18 3300046474 Ga0495605_0000157 Ga0495605_0000157_40234_40890 199
19 3300046474 Ga0495605_0072134 Ga0495605_0072134_410_1066 199
20 3300046506 Ga0495583_0006439 Ga0495583_0006439_5774_6430 199
21 3300047320 Ga0495672_0242159 Ga0495672_0242159_17_664 199
22 3300003775 Ga0055524_1000061 Ga0055524_1000061118 200
23 3300003791 Ga0055530_10000800 Ga0055530_1000080025 200
24 3300003791 Ga0055530_10001011 Ga0055530_100010119 200
25 3300003792 Ga0055540_1000026 Ga0055540_100002658 200
26 3300003794 Ga0055531_10006377 Ga0055531_100063775 200
27 3300025291 Ga0209675_1004183 Ga0209675_10041835 200
28 3300025298 Ga0209050_1000228 Ga0209050_100022821 200
29 3300025298 Ga0209050_1035225 Ga0209050_10352252 200
30 3300025299 Ga0209256_1000030 Ga0209256_1000030117 200
31 3300025303 Ga0209051_1000004 Ga0209051_1000004537 200
32 3300025304 Ga0209257_1000063 Ga0209257_100006323 200
33 3300044684 Ga0466966_0080819 Ga0466966_0080819_545_1204 200
34 3300046460 Ga0495638_0207299 Ga0495638_0207299_12_614 200
35 3300048917 Ga0496114_0002270 Ga0496114_0002270_5568_6227 200
36 3300013102 Ga0157371_10000039 Ga0157371_1000003961 201
37 3300014497 Ga0182008_10003064 Ga0182008_100030645 201
38 3300003794 Ga0055531_10001242 Ga0055531_1000124213 202
39 3300025273 Ga0209673_1011314 Ga0209673_10113142 202
40 3300025303 Ga0209051_1000367 Ga0209051_100036732 202
41 3300025304 Ga0209257_1000012 Ga0209257_1000012554 202
42 3300046642 Ga0495634_0126500 Ga0495634_0126500_390_1052 202
43 3300030744 Ga0316181_1054368 Ga0316181_10543683 203
44 3300031911 Ga0307412_10027454 Ga0307412_100274542 203
45 3300046453 Ga0495627_006280 Ga0495627_006280_659_1324 203
46 3300046518 Ga0495631_0033479 Ga0495631_0033479_1061_1726 203
47 3300046519 Ga0495632_0095995 Ga0495632_0095995_691_1356 203
48 3300046530 Ga0495654_0011680 Ga0495654_0011680_3156_3821 203
49 3300047320 Ga0495672_0013983 Ga0495672_0013983_2593_3258 203
50 3300049460 Ga0495682_0000090 Ga0495682_0000090_11287_11952 203
51 3300005339 Ga0070660_100439878 Ga0070660_1004398782 204
52 3300005457 Ga0070662_100025623 Ga0070662_1000256233 204
53 3300005564 Ga0070664_100385963 Ga0070664_1003859632 204
54 3300006353 Ga0075370_10004516 Ga0075370_100045167 204
55 3300006946 Ga0079104_1000754 Ga0079104_100075423 204
56 3300006948 Ga0099826_10004941 Ga0099826_100049417 204
57 3300009036 Ga0105244_10097516 Ga0105244_100975162 204
58 3300009092 Ga0105250_10011988 Ga0105250_100119883 204
59 3300013102 Ga0157371_10115285 Ga0157371_101152852 204
60 3300013105 Ga0157369_10052988 Ga0157369_100529884 204
61 3300013307 Ga0157372_10109402 Ga0157372_101094023 204
62 3300015261 Ga0182006_1023930 Ga0182006_10239302 204
63 3300015261 Ga0182006_1044379 Ga0182006_10443792 204
64 3300015265 Ga0182005_1021610 Ga0182005_10216102 204
65 3300017792 Ga0163161_10181486 Ga0163161_101814862 204
66 3300025711 Ga0207696_1000031 Ga0207696_1000031275 204
67 3300025728 Ga0207655_1005543 Ga0207655_10055433 204
68 3300025735 Ga0207713_1007842 Ga0207713_10078427 204
69 3300025933 Ga0207706_10042839 Ga0207706_100428394 204
70 3300027111 Ga0209281_1000019 Ga0209281_1000019184 204
71 3300030521 Ga0307511_10046070 Ga0307511_100460704 204
72 3300031548 Ga0307408_100839944 Ga0307408_1008399441 204
73 3300031901 Ga0307406_10422248 Ga0307406_104222482 204
74 3300031911 Ga0307412_10114444 Ga0307412_101144443 204
75 3300032002 Ga0307416_100168469 Ga0307416_1001684693 204
76 3300041404 Ga0439436_0014730 Ga0439436_0014730_1094_1756 204
77 3300041411 Ga0439466_0022629 Ga0439466_0022629_547_1209 204
78 3300042006 Ga0439432_012071 Ga0439432_012071_1365_2027 204
79 3300042007 Ga0439449_0052621 Ga0439449_0052621_197_859 204
80 3300042010 Ga0439452_022738 Ga0439452_022738_25_687 204
81 3300042013 Ga0439456_042724 Ga0439456_042724_24_692 204
82 3300042015 Ga0439462_0011605 Ga0439462_0011605_790_1452 204
83 3300042185 Ga0450909_007436 Ga0450909_007436_575_1237 204
84 3300042435 Ga0439434_0034102 Ga0439434_0034102_343_1005 204
85 3300046692 Ga0495671_0028502 Ga0495671_0028502_1545_2210 204
86 3300048919 Ga0496116_0138478 Ga0496116_0138478_206_874 204
87 3300048920 Ga0496117_0087048 Ga0496117_0087048_581_1249 204
88 3300048921 Ga0496118_0095396 Ga0496118_0095396_585_1253 204
89 3300048924 Ga0496121_0221953 Ga0496121_0221953_218_886 204
90 3300050494 nmdc:mga06z11_105374_c1 nmdc:mga06z11_105374_c1_55_717 204
91 3300005288 Ga0065714_10015263 Ga0065714_100152632 205
92 3300005339 Ga0070660_100663137 Ga0070660_1006631371 205
93 3300005353 Ga0070669_100002215 Ga0070669_1000022157 205
94 3300005539 Ga0068853_100167212 Ga0068853_1001672123 205
95 3300009011 Ga0105251_10034134 Ga0105251_100341342 205
96 3300009036 Ga0105244_10034271 Ga0105244_100342713 205
97 3300009148 Ga0105243_10007538 Ga0105243_100075385 205
98 3300011119 Ga0105246_10000432 Ga0105246_100004322 205
99 3300011119 Ga0105246_10111801 Ga0105246_101118012 205
100 3300013100 Ga0157373_10007482 Ga0157373_100074825 205
101 3300013308 Ga0157375_10249140 Ga0157375_102491402 205
102 3300014497 Ga0182008_10153588 Ga0182008_101535882 205
103 3300025291 Ga0209675_1001701 Ga0209675_100170111 205
104 3300025728 Ga0207655_1020094 Ga0207655_10200944 205
105 3300025735 Ga0207713_1002266 Ga0207713_10022663 205
106 3300025919 Ga0207657_10210920 Ga0207657_102109202 205
107 3300025920 Ga0207649_10194479 Ga0207649_101944792 205
108 3300025923 Ga0207681_10000482 Ga0207681_100004825 205
109 3300025935 Ga0207709_10000248 Ga0207709_1000024822 205
110 3300031251 Ga0265327_10058111 Ga0265327_100581113 205
111 3300037312 Ga0395899_0021543 Ga0395899_0021543_4063_4731 205
112 3300037418 Ga0395900_0009793 Ga0395900_0009793_4828_5496 205
113 3300037466 Ga0395898_0012935 Ga0395898_0012935_4448_5116 205
114 3300037471 Ga0395905_0040143 Ga0395905_0040143_1805_2473 205
115 3300038443 Ga0395901_0021143 Ga0395901_0021143_2377_3045 205
116 3300038705 Ga0237819_00552 Ga0237819_00552_6727_7407 205
117 3300042005 Ga0439448_0000259 Ga0439448_0000259_9852_10520 205
118 3300042008 Ga0439450_003664 Ga0439450_003664_1207_1875 205
119 3300042009 Ga0439451_003347 Ga0439451_003347_2410_3090 205
120 3300042012 Ga0439455_0023343 Ga0439455_0023343_611_1279 205
121 3300046491 Ga0495584_0026803 Ga0495584_0026803_2006_2674 205
122 3300046519 Ga0495632_0028338 Ga0495632_0028338_1879_2547 205
123 3300046528 Ga0495642_0048265 Ga0495642_0048265_638_1306 205
124 3300046538 Ga0495609_0015268 Ga0495609_0015268_568_1236 205
125 3300046694 Ga0495649_0007545 Ga0495649_0007545_5508_6176 205
126 3300047320 Ga0495672_0088004 Ga0495672_0088004_148_813 205
127 3300047443 Ga0495687_008366 Ga0495687_008366_450_1118 205
128 3300047446 Ga0495679_013446 Ga0495679_013446_1819_2487 205
129 3300048091 Ga0495626_0052961 Ga0495626_0052961_402_1070 205
130 3300049459 Ga0495678_020127 Ga0495678_020127_393_1061 205
131 2162886007 SwRhRL2b_contig_3259057 SwRhRL2b_0388.00005800 206
132 3300001915 JGI24741J21665_1006777 JGI24741J21665_10067773 206
133 3300002704 JGI25155J39150_1001260 JGI25155J39150_10012603 206
134 3300002738 JGI25154J39366_1004380 JGI25154J39366_10043803 206
135 3300003322 rootL2_10082487 rootL2_100824873 206
136 3300003751 Ga0055538_1000032 Ga0055538_1000032177 206
137 3300003752 Ga0055539_1000043 Ga0055539_1000043177 206
138 3300003756 Ga0055533_1000052 Ga0055533_1000052177 206
139 3300003758 Ga0055532_1000047 Ga0055532_1000047157 206
140 3300003759 Ga0055525_1000062 Ga0055525_1000062177 206
141 3300003761 Ga0055535_1006556 Ga0055535_10065563 206
142 3300003841 Ga0055541_1000030 Ga0055541_1000030177 206
143 3300005288 Ga0065714_10078533 Ga0065714_100785333 206
144 3300005289 Ga0065704_10008310 Ga0065704_100083103 206
145 3300005290 Ga0065712_10068537 Ga0065712_100685379 206
146 3300005331 Ga0070670_100001343 Ga0070670_10000134316 206
147 3300005331 Ga0070670_100005930 Ga0070670_1000059302 206
148 3300005344 Ga0070661_100000126 Ga0070661_10000012652 206
149 3300005344 Ga0070661_100568593 Ga0070661_1005685932 206
150 3300005353 Ga0070669_100000764 Ga0070669_10000076420 206
151 3300005455 Ga0070663_100590763 Ga0070663_1005907632 206
152 3300005457 Ga0070662_100000426 Ga0070662_10000042620 206
153 3300005539 Ga0068853_100002460 Ga0068853_10000246010 206
154 3300005548 Ga0070665_100289486 Ga0070665_1002894862 206
155 3300005548 Ga0070665_100719054 Ga0070665_1007190541 206
156 3300005564 Ga0070664_100002791 Ga0070664_1000027915 206
157 3300005578 Ga0068854_100042852 Ga0068854_1000428523 206
158 3300005834 Ga0068851_10000007 Ga0068851_1000000782 206
159 3300006051 Ga0075364_10373248 Ga0075364_103732482 206
160 3300009011 Ga0105251_10004529 Ga0105251_100045294 206
161 3300009011 Ga0105251_10037689 Ga0105251_100376891 206
162 3300009036 Ga0105244_10003377 Ga0105244_100033779 206
163 3300009036 Ga0105244_10008099 Ga0105244_100080994 206
164 3300009176 Ga0105242_10004917 Ga0105242_100049178 206
165 3300009176 Ga0105242_10033598 Ga0105242_100335982 206
166 3300009545 Ga0105237_10005994 Ga0105237_100059945 206
167 3300009545 Ga0105237_10149362 Ga0105237_101493622 206
168 3300009551 Ga0105238_10080399 Ga0105238_100803994 206
169 3300013100 Ga0157373_10043148 Ga0157373_100431483 206
170 3300013100 Ga0157373_10085841 Ga0157373_100858412 206
171 3300013102 Ga0157371_10227328 Ga0157371_102273282 206
172 3300013104 Ga0157370_10052578 Ga0157370_100525782 206
173 3300013105 Ga0157369_10039350 Ga0157369_100393501 206
174 3300013105 Ga0157369_10086792 Ga0157369_100867923 206
175 3300013105 Ga0157369_10094667 Ga0157369_100946672 206
176 3300013308 Ga0157375_10086735 Ga0157375_100867352 206
177 3300013308 Ga0157375_10090932 Ga0157375_100909323 206
178 3300014497 Ga0182008_10024543 Ga0182008_100245433 206
179 3300015261 Ga0182006_1010871 Ga0182006_10108712 206
180 3300015261 Ga0182006_1148228 Ga0182006_11482281 206
181 3300015262 Ga0182007_10025132 Ga0182007_100251322 206
182 3300017792 Ga0163161_10258045 Ga0163161_102580452 206
183 3300017792 Ga0163161_10287576 Ga0163161_102875762 206
184 3300025206 Ga0209435_100377 Ga0209435_1003778 206
185 3300025224 Ga0209784_100007 Ga0209784_100007340 206
186 3300025225 Ga0209566_100009 Ga0209566_100009340 206
187 3300025226 Ga0209674_100021 Ga0209674_100021340 206
188 3300025229 Ga0209147_100009 Ga0209147_100009340 206
189 3300025230 Ga0209563_100018 Ga0209563_100018340 206
190 3300025242 Ga0209258_101397 Ga0209258_1013972 206
191 3300025246 Ga0209646_1000184 Ga0209646_100018459 206
192 3300025253 Ga0209677_100012 Ga0209677_100012340 206
193 3300025321 Ga0207656_10000006 Ga0207656_1000000620 206
194 3300025711 Ga0207696_1001215 Ga0207696_100121511 206
195 3300025728 Ga0207655_1000703 Ga0207655_10007035 206
196 3300025728 Ga0207655_1013705 Ga0207655_10137055 206
197 3300025735 Ga0207713_1000837 Ga0207713_100083711 206
198 3300025735 Ga0207713_1001056 Ga0207713_10010564 206
199 3300025914 Ga0207671_10000131 Ga0207671_1000013184 206
200 3300025920 Ga0207649_10000012 Ga0207649_10000012149 206
201 3300025923 Ga0207681_10000381 Ga0207681_1000038120 206
202 3300025925 Ga0207650_10000338 Ga0207650_1000033818 206
203 3300025925 Ga0207650_10000564 Ga0207650_100005649 206
204 3300025933 Ga0207706_10001424 Ga0207706_100014244 206
205 3300025934 Ga0207686_10000663 Ga0207686_1000066310 206
206 3300025934 Ga0207686_10241547 Ga0207686_102415472 206
207 3300025945 Ga0207679_10000015 Ga0207679_10000015149 206
208 3300026041 Ga0207639_10000286 Ga0207639_1000028610 206
209 3300026116 Ga0207674_10246713 Ga0207674_102467133 206
210 3300028379 Ga0268266_10290161 Ga0268266_102901613 206
211 3300028379 Ga0268266_10622091 Ga0268266_106220912 206
212 3300031344 Ga0265316_10199969 Ga0265316_101999692 206
213 3300031731 Ga0307405_10030612 Ga0307405_100306123 206
214 3300031911 Ga0307412_10143622 Ga0307412_101436223 206
215 3300042006 Ga0439432_000513 Ga0439432_000513_2569_3237 206
216 3300044658 Ga0466972_0003793 Ga0466972_0003793_2864_3532 206
217 3300044683 Ga0466965_0004441 Ga0466965_0004441_934_1602 206
218 3300044706 Ga0466964_0026220 Ga0466964_0026220_1449_2117 206
219 3300044735 Ga0466968_0008302 Ga0466968_0008302_2183_2851 206
220 3300044842 Ga0466957_0020683 Ga0466957_0020683_1496_2164 206
221 3300044901 Ga0466960_0140472 Ga0466960_0140472_520_1188 206
222 3300045049 Ga0466959_0045215 Ga0466959_0045215_2133_2801 206
223 3300045836 Ga0466958_0077912 Ga0466958_0077912_730_1398 206
224 3300046452 Ga0495617_008515 Ga0495617_008515_941_1609 206
225 3300046506 Ga0495583_0021365 Ga0495583_0021365_689_1357 206
226 3300046512 Ga0495610_0025576 Ga0495610_0025576_620_1288 206
227 3300046518 Ga0495631_0123550 Ga0495631_0123550_297_965 206
228 3300046530 Ga0495654_0022733 Ga0495654_0022733_693_1361 206
229 3300046530 Ga0495654_0126113 Ga0495654_0126113_396_1064 206
230 3300047446 Ga0495679_031520 Ga0495679_031520_451_1119 206
231 3300047469 Ga0495673_0002589 Ga0495673_0002589_9093_9758 206
232 3300048921 Ga0496118_0182613 Ga0496118_0182613_445_1113 206
233 3300048922 Ga0496119_0191494 Ga0496119_0191494_198_866 206
234 3300048924 Ga0496121_0155626 Ga0496121_0155626_441_1109 206
235 3300048925 Ga0496122_0123299 Ga0496122_0123299_555_1223 206
236 3300048927 Ga0496124_0081214 Ga0496124_0081214_904_1572 206
237 3300048927 Ga0496124_0174404 Ga0496124_0174404_591_1259 206
238 3300048929 Ga0496126_0101023 Ga0496126_0101023_1812_2480 206
239 3300048929 Ga0496126_0360461 Ga0496126_0360461_284_952 206
240 3300006038 Ga0075365_10085235 Ga0075365_100852353 207
241 3300009011 Ga0105251_10009680 Ga0105251_100096804 207
242 3300009011 Ga0105251_10175120 Ga0105251_101751202 207
243 3300025735 Ga0207713_1007888 Ga0207713_10078885 207
244 3300025735 Ga0207713_1008313 Ga0207713_10083134 207
245 3300030742 Ga0316183_1079327 Ga0316183_10793273 207
246 3300031548 Ga0307408_100368944 Ga0307408_1003689441 207
247 3300031731 Ga0307405_10021286 Ga0307405_100212864 207
248 3300031901 Ga0307406_10064864 Ga0307406_100648643 207
249 3300031911 Ga0307412_10014881 Ga0307412_100148814 207
250 3300032002 Ga0307416_100235127 Ga0307416_1002351272 207
251 3300032004 Ga0307414_10529026 Ga0307414_105290262 207
252 3300032004 Ga0307414_11003013 Ga0307414_110030131 207
253 3300032005 Ga0307411_10044282 Ga0307411_100442821 207
254 3300041405 Ga0439438_008131 Ga0439438_008131_2431_3099 207
255 3300046453 Ga0495627_024339 Ga0495627_024339_17_682 207
256 3300046458 Ga0495591_014025 Ga0495591_014025_628_1293 207
257 3300046474 Ga0495605_0000100 Ga0495605_0000100_76988_77653 207
258 3300046499 Ga0495594_0028474 Ga0495594_0028474_1975_2640 207
259 3300046506 Ga0495583_0000174 Ga0495583_0000174_31380_32045 207
260 3300046512 Ga0495610_0027599 Ga0495610_0027599_2333_2998 207
261 3300046515 Ga0495620_0000085 Ga0495620_0000085_74583_75248 207
262 3300046518 Ga0495631_0018449 Ga0495631_0018449_2143_2808 207
263 3300046524 Ga0495648_0017221 Ga0495648_0017221_1900_2565 207
264 3300046530 Ga0495654_0013053 Ga0495654_0013053_1668_2333 207
265 3300046538 Ga0495609_0000088 Ga0495609_0000088_31471_32136 207
266 3300046542 Ga0495597_0015149 Ga0495597_0015149_2449_3114 207
267 3300046558 Ga0495633_0009015 Ga0495633_0009015_2259_2924 207
268 3300046648 Ga0495611_0004457 Ga0495611_0004457_4043_4708 207
269 3300046665 Ga0495661_0000187 Ga0495661_0000187_2695_3360 207
270 3300046691 Ga0495670_0369036 Ga0495670_0369036_17_682 207
271 3300046692 Ga0495671_0035860 Ga0495671_0035860_818_1483 207
272 3300046794 Ga0495589_0021478 Ga0495589_0021478_197_862 207
273 3300046810 Ga0495660_0011226 Ga0495660_0011226_2642_3307 207
274 3300047323 Ga0495683_0000070 Ga0495683_0000070_30576_31241 207
275 3300047446 Ga0495679_004083 Ga0495679_004083_2779_3444 207
276 3300047469 Ga0495673_0004790 Ga0495673_0004790_6102_6767 207
277 3300047470 Ga0495681_0062733 Ga0495681_0062733_788_1453 207
278 3300048925 Ga0496122_0038861 Ga0496122_0038861_2599_3264 207
279 3300049459 Ga0495678_000160 Ga0495678_000160_2859_3524 207
280 3300003791 Ga0055530_10001044 Ga0055530_100010444 208
281 3300003792 Ga0055540_1000745 Ga0055540_10007454 208
282 3300005288 Ga0065714_10009964 Ga0065714_100099643 208
283 3300005288 Ga0065714_10018929 Ga0065714_100189292 208
284 3300009092 Ga0105250_10003447 Ga0105250_100034472 208
285 3300015262 Ga0182007_10026086 Ga0182007_100260862 208
286 3300017792 Ga0163161_10279826 Ga0163161_102798262 208
287 3300025298 Ga0209050_1000024 Ga0209050_1000024129 208
288 3300025303 Ga0209051_1000023 Ga0209051_100002345 208
289 3300025304 Ga0209257_1022106 Ga0209257_10221063 208
290 3300028794 Ga0307515_10000215 Ga0307515_10000215123 208
291 3300042009 Ga0439451_000646 Ga0439451_000646_4016_4684 208
292 3300046472 Ga0495580_0002103 Ga0495580_0002103_2726_3385 208
293 3300046515 Ga0495620_0012319 Ga0495620_0012319_1842_2510 208
294 3300046526 Ga0495666_0003913 Ga0495666_0003913_4725_5384 208
295 3300046530 Ga0495654_0118859 Ga0495654_0118859_205_873 208
296 3300046538 Ga0495609_0090652 Ga0495609_0090652_29_697 208
297 3300046694 Ga0495649_0064754 Ga0495649_0064754_798_1466 208
298 3300046794 Ga0495589_0082550 Ga0495589_0082550_208_876 208
299 3300046794 Ga0495589_0231540 Ga0495589_0231540_166_834 208
300 3300047317 Ga0495604_0000948 Ga0495604_0000948_6844_7503 208
301 3300047320 Ga0495672_0042164 Ga0495672_0042164_623_1291 208
302 3300047469 Ga0495673_0174170 Ga0495673_0174170_113_781 208
303 3300047470 Ga0495681_0024639 Ga0495681_0024639_595_1263 208
304 3300048091 Ga0495626_0016350 Ga0495626_0016350_713_1381 208
305 3300002737 JGI25162J39368_1000378 JGI25162J39368_10003784 209
306 3300002771 JGI25163J39215_1001139 JGI25163J39215_10011395 209
307 3300002772 JGI25164J39214_1000273 JGI25164J39214_100027334 209
308 3300003214 JGI25165J46597_1000498 JGI25165J46597_100049834 209
309 3300005288 Ga0065714_10040903 Ga0065714_100409032 209
310 3300006058 Ga0075432_10011631 Ga0075432_100116314 209
311 3300009011 Ga0105251_10017668 Ga0105251_100176682 209
312 3300009036 Ga0105244_10061120 Ga0105244_100611202 209
313 3300009092 Ga0105250_10032680 Ga0105250_100326803 209
314 3300011119 Ga0105246_10000162 Ga0105246_1000016228 209
315 3300011119 Ga0105246_10169006 Ga0105246_101690062 209
316 3300014497 Ga0182008_10025165 Ga0182008_100251653 209
317 3300015261 Ga0182006_1016147 Ga0182006_10161472 209
318 3300015262 Ga0182007_10001934 Ga0182007_100019344 209
319 3300015265 Ga0182005_1007397 Ga0182005_10073972 209
320 3300025207 Ga0209760_100027 Ga0209760_10002769 209
321 3300025231 Ga0207427_100006 Ga0207427_100006401 209
322 3300025233 Ga0209437_100013 Ga0209437_100013401 209
323 3300025261 Ga0209233_1000022 Ga0209233_1000022401 209
324 3300025711 Ga0207696_1024464 Ga0207696_10244642 209
325 3300025711 Ga0207696_1041534 Ga0207696_10415342 209
326 3300025728 Ga0207655_1005392 Ga0207655_10053925 209
327 3300025735 Ga0207713_1002477 Ga0207713_10024779 209
328 3300041411 Ga0439466_0002249 Ga0439466_0002249_2418_3098 209
329 3300042009 Ga0439451_048696 Ga0439451_048696_49_729 209
330 3300042010 Ga0439452_008471 Ga0439452_008471_2071_2751 209
331 3300046452 Ga0495617_011744 Ga0495617_011744_425_1093 209
332 3300046453 Ga0495627_008624 Ga0495627_008624_2476_3144 209
333 3300046457 Ga0495590_0014464 Ga0495590_0014464_1893_2561 209
334 3300046458 Ga0495591_009701 Ga0495591_009701_659_1327 209
335 3300046471 Ga0495650_0067092 Ga0495650_0067092_588_1256 209
336 3300046474 Ga0495605_0009534 Ga0495605_0009534_2282_2950 209
337 3300046475 Ga0495639_0003059 Ga0495639_0003059_6053_6733 209
338 3300046501 Ga0495607_0013887 Ga0495607_0013887_2500_3168 209
339 3300046501 Ga0495607_0113072 Ga0495607_0113072_692_1360 209
340 3300046501 Ga0495607_0229300 Ga0495607_0229300_42_707 209
341 3300046507 Ga0495606_0007622 Ga0495606_0007622_6484_7152 209
342 3300046513 Ga0495616_0028635 Ga0495616_0028635_408_1076 209
343 3300046515 Ga0495620_0019621 Ga0495620_0019621_2350_3018 209
344 3300046519 Ga0495632_0052463 Ga0495632_0052463_680_1348 209
345 3300046522 Ga0495643_0293515 Ga0495643_0293515_50_718 209
346 3300046530 Ga0495654_0008111 Ga0495654_0008111_359_1039 209
347 3300046557 Ga0495622_0016547 Ga0495622_0016547_1935_2615 209
348 3300046664 Ga0495659_0002669 Ga0495659_0002669_308_988 209
349 3300046665 Ga0495661_0001218 Ga0495661_0001218_2477_3145 209
350 3300046810 Ga0495660_0097599 Ga0495660_0097599_450_1115 209
351 3300047318 Ga0495636_0011170 Ga0495636_0011170_419_1087 209
352 3300047320 Ga0495672_0017033 Ga0495672_0017033_1698_2366 209
353 3300047320 Ga0495672_0017358 Ga0495672_0017358_2360_3040 209
354 3300047443 Ga0495687_008443 Ga0495687_008443_4867_5547 209
355 3300047469 Ga0495673_0023496 Ga0495673_0023496_1719_2387 209
356 3300048091 Ga0495626_0044773 Ga0495626_0044773_551_1231 209
357 3300048919 Ga0496116_0029771 Ga0496116_0029771_2492_3172 209
358 3300048920 Ga0496117_0004774 Ga0496117_0004774_2477_3145 209
359 3300048921 Ga0496118_0073811 Ga0496118_0073811_1420_2088 209
360 3300048923 Ga0496120_0005221 Ga0496120_0005221_8188_8856 209
361 3300048924 Ga0496121_0086255 Ga0496121_0086255_1304_1984 209
362 3300048926 Ga0496123_0065943 Ga0496123_0065943_1555_2223 209
363 3300048927 Ga0496124_0007897 Ga0496124_0007897_8195_8863 209
364 3300048928 Ga0496125_0005136 Ga0496125_0005136_11505_12173 209
365 3300048928 Ga0496125_0037898 Ga0496125_0037898_1863_2531 209
366 3300048929 Ga0496126_0248988 Ga0496126_0248988_52_720 209
367 3300013100 Ga0157373_10178942 Ga0157373_101789422 210
368 3300044706 Ga0466964_0001947 Ga0466964_0001947_6408_7076 210
369 3300045976 Ga0466967_0010798 Ga0466967_0010798_2202_2870 210
370 3300046507 Ga0495606_0002388 Ga0495606_0002388_15961_16629 210
371 3300009011 Ga0105251_10000009 Ga0105251_10000009132 211
372 3300009092 Ga0105250_10000605 Ga0105250_1000060522 211
373 3300025711 Ga0207696_1000020 Ga0207696_1000020247 211
374 3300025735 Ga0207713_1000032 Ga0207713_1000032129 211
375 3300037312 Ga0395899_0002559 Ga0395899_0002559_5598_6266 211
376 3300037418 Ga0395900_0000689 Ga0395900_0000689_38423_39091 211
377 3300037466 Ga0395898_0006853 Ga0395898_0006853_5477_6145 211
378 3300037471 Ga0395905_0006806 Ga0395905_0006806_4041_4709 211
379 3300038443 Ga0395901_0000448 Ga0395901_0000448_6512_7180 211
380 3300042136 Ga0450900_001223 Ga0450900_001223_501_1166 212
381 3300042137 Ga0450902_004412 Ga0450902_004412_675_1340 212
382 3300042142 Ga0450905_001395 Ga0450905_001395_1518_2183 212
383 3300042533 Ga0450901_000243 Ga0450901_000243_5039_5704 212
384 3300037312 Ga0395899_0000478 Ga0395899_0000478_11550_12218 213
385 3300046615 Ga0495656_0114758 Ga0495656_0114758_600_1241 213
386 iso_pu_bacteria 2738543013 2739252448 213
387 iso_pu_bacteria 2842733646 2842735689 213
388 iso_pu_bacteria 2842747753 2842749122 213
389 iso_pu_bacteria 2885192300 2885195978 213
390 3300005288 Ga0065714_10000115 Ga0065714_100001153 214
391 3300053090 Ga0500646_0000914 Ga0500646_0000914_6427_7092 214
392 3300053092 Ga0500583_0179503 Ga0500583_0179503_113_778 214
393 3300053098 Ga0500650_0065649 Ga0500650_0065649_480_1145 214
394 3300053133 Ga0500655_004044 Ga0500655_004044_1544_2209 214
395 3300053151 Ga0500604_0003723 Ga0500604_0003723_1182_1847 214
396 iso_pu_bacteria 2643221644 2644246219 214
397 3300037312 Ga0395899_0010527 Ga0395899_0010527_1461_2129 215
398 3300037418 Ga0395900_0067915 Ga0395900_0067915_437_1105 215
399 3300037466 Ga0395898_0542779 Ga0395898_0542779_78_746 215
400 3300038443 Ga0395901_0013926 Ga0395901_0013926_5978_6646 215
401 3300046458 Ga0495591_015116 Ga0495591_015116_15_662 215
402 3300046663 Ga0495635_0155319 Ga0495635_0155319_548_1198 215
403 3300047469 Ga0495673_0115752 Ga0495673_0115752_20_667 215
404 iso_pu_bacteria 2904479285 2904480751 215
405 3300044683 Ga0466965_0015148 Ga0466965_0015148_819_1487 216
406 3300045049 Ga0466959_0014864 Ga0466959_0014864_3692_4360 216
407 3300003781 Ga0055536_1011459 Ga0055536_10114593 217
408 3300003784 Ga0055534_1000470 Ga0055534_10004705 217
409 3300005353 Ga0070669_100010461 Ga0070669_1000104614 217
410 3300005548 Ga0070665_100055165 Ga0070665_1000551655 217
411 3300013306 Ga0163162_10770004 Ga0163162_107700042 217
412 3300014497 Ga0182008_10000662 Ga0182008_1000066212 217
413 3300017792 Ga0163161_10167083 Ga0163161_101670832 217
414 3300025284 Ga0209130_1010307 Ga0209130_10103072 217
415 3300025291 Ga0209675_1000573 Ga0209675_10005739 217
416 3300025292 Ga0209676_1007094 Ga0209676_10070945 217
417 3300025295 Ga0209564_1020032 Ga0209564_10200323 217
418 3300025298 Ga0209050_1022072 Ga0209050_10220723 217
419 3300025303 Ga0209051_1009205 Ga0209051_10092055 217
420 3300025901 Ga0207688_10362594 Ga0207688_103625941 217
421 3300025907 Ga0207645_10307425 Ga0207645_103074252 217
422 3300025923 Ga0207681_10009066 Ga0207681_100090665 217
423 3300026089 Ga0207648_10239465 Ga0207648_102394652 217
424 3300028379 Ga0268266_10040199 Ga0268266_100401995 217
425 3300031456 Ga0307513_10146120 Ga0307513_101461202 217
426 3300044706 Ga0466964_0017499 Ga0466964_0017499_722_1390 217
427 3300044735 Ga0466968_0007529 Ga0466968_0007529_2179_2847 217
428 3300044901 Ga0466960_0127563 Ga0466960_0127563_341_1009 217
429 3300046453 Ga0495627_005462 Ga0495627_005462_4052_4708 217
430 3300046455 Ga0495603_0102798 Ga0495603_0102798_145_801 217
431 3300046458 Ga0495591_051672 Ga0495591_051672_150_806 217
432 3300046471 Ga0495650_0002491 Ga0495650_0002491_10033_10689 217
433 3300046471 Ga0495650_0089405 Ga0495650_0089405_388_1044 217
434 3300046474 Ga0495605_0000048 Ga0495605_0000048_18134_18790 217
435 3300046475 Ga0495639_0143286 Ga0495639_0143286_372_1028 217
436 3300046499 Ga0495594_0026034 Ga0495594_0026034_654_1310 217
437 3300046501 Ga0495607_0009429 Ga0495607_0009429_3096_3752 217
438 3300046501 Ga0495607_0071229 Ga0495607_0071229_1127_1783 217
439 3300046506 Ga0495583_0000096 Ga0495583_0000096_4353_5009 217
440 3300046512 Ga0495610_0127871 Ga0495610_0127871_325_981 217
441 3300046515 Ga0495620_0000306 Ga0495620_0000306_4306_4962 217
442 3300046518 Ga0495631_0002255 Ga0495631_0002255_3837_4493 217
443 3300046519 Ga0495632_0000843 Ga0495632_0000843_19264_19920 217
444 3300046524 Ga0495648_0005408 Ga0495648_0005408_3915_4571 217
445 3300046530 Ga0495654_0000446 Ga0495654_0000446_4623_5279 217
446 3300046538 Ga0495609_0000012 Ga0495609_0000012_6997_7653 217
447 3300046542 Ga0495597_0001086 Ga0495597_0001086_2535_3191 217
448 3300046558 Ga0495633_0000034 Ga0495633_0000034_180574_181230 217
449 3300046615 Ga0495656_0082991 Ga0495656_0082991_197_877 217
450 3300046648 Ga0495611_0082749 Ga0495611_0082749_266_922 217
451 3300046648 Ga0495611_0168905 Ga0495611_0168905_51_707 217
452 3300046665 Ga0495661_0000004 Ga0495661_0000004_550322_550978 217
453 3300046691 Ga0495670_0032353 Ga0495670_0032353_1534_2190 217
454 3300046692 Ga0495671_0028439 Ga0495671_0028439_1993_2649 217
455 3300046794 Ga0495589_0010874 Ga0495589_0010874_3962_4618 217
456 3300046810 Ga0495660_0053651 Ga0495660_0053651_523_1179 217
457 3300047320 Ga0495672_0006253 Ga0495672_0006253_3961_4617 217
458 3300047323 Ga0495683_0000034 Ga0495683_0000034_144182_144838 217
459 3300047446 Ga0495679_000370 Ga0495679_000370_4213_4869 217
460 3300047469 Ga0495673_0018232 Ga0495673_0018232_1688_2344 217
461 3300048925 Ga0496122_0000449 Ga0496122_0000449_8952_9608 217
462 3300048925 Ga0496122_0011766 Ga0496122_0011766_812_1468 217
463 3300048926 Ga0496123_0000263 Ga0496123_0000263_96224_96880 217
464 3300048926 Ga0496123_0071585 Ga0496123_0071585_812_1468 217
465 3300048927 Ga0496124_0015525 Ga0496124_0015525_3240_3896 217
466 3300049459 Ga0495678_000049 Ga0495678_000049_158947_159603 217
467 3300049671 Ga0501238_007309 Ga0501238_007309_276_932 217
468 3300049758 Ga0501241_022199 Ga0501241_022199_392_1048 217
469 3300050492 nmdc:mga0yw44_249364_c1 nmdc:mga0yw44_249364_c1_214_870 217
470 3300053136 Ga0500559_0000578 Ga0500559_0000578_23258_23914 217
471 iso_pu_bacteria 2511231003 2511249605 217
472 iso_pu_bacteria 2511231026 2511384059 217
473 iso_pu_bacteria 2521172590 2521560192 217
474 iso_pu_bacteria 2548876994 2550695313 217
475 iso_pu_bacteria 2548876994 2550695898 217
476 iso_pu_bacteria 2551306416 2553004989 217
477 iso_pu_bacteria 2599185155 2599327552 217
478 iso_pu_bacteria 2599185307 2599972351 217
479 iso_pu_bacteria 2600254954 2600444136 217
480 iso_pu_bacteria 2600255283 2601627449 217
481 iso_pu_bacteria 2600255389 2602008386 217
482 iso_pu_bacteria 2713897148 2715749791 217
483 iso_pu_bacteria 2721755763 2723876522 217
484 iso_pu_bacteria 2738541271 2738690393 217
485 iso_pu_bacteria 2738543016 2739266167 217
486 iso_pu_bacteria 2738543020 2739289968 217
487 iso_pu_bacteria 2738543021 2739295280 217
488 iso_pu_bacteria 2765235838 2765571360 217
489 iso_pu_bacteria 2806310737 2807408848 217
490 iso_pu_bacteria 2806310745 2807457179 217
491 iso_pu_bacteria 2808606386 2808982470 217
492 iso_pu_bacteria 2808606415 2809129703 217
493 iso_pu_bacteria 2808606419 2809149242 217
494 iso_pu_bacteria 2818991445 2819592889 217
495 iso_pu_bacteria 2818991445 2819592919 217
496 iso_pu_bacteria 2818991449 2819616549 217
497 iso_pu_bacteria 2823421272 2823425757 217
498 iso_pu_bacteria 2826581358 2826581861 217
499 iso_pu_bacteria 2839094727 2839099201 217
500 iso_pu_bacteria 2842805378 2842805863 217
501 iso_pu_bacteria 2842815866 2842816885 217
502 iso_pu_bacteria 2842849001 2842854151 217
503 iso_pu_bacteria 2852618963 2852619383 217
504 iso_pu_bacteria 2884811622 2884813274 217
505 iso_pu_bacteria 2884836552 2884838572 217
506 iso_pu_bacteria 2884852848 2884854863 217
507 iso_pu_bacteria 2896154374 2896156468 217
508 iso_pu_bacteria 2904434214 2904435818 217
509 iso_pu_bacteria 2904439833 2904440767 217
510 iso_pu_bacteria 2904530477 2904535366 217
511 iso_pu_bacteria 2904584206 2904588486 217
512 iso_pu_bacteria 2904589729 2904594626 217
513 iso_pu_bacteria 2904601388 2904605858 217
514 iso_pu_bacteria 2919046199 2919048933 217
515 iso_pu_bacteria 2919079590 2919084835 217
516 iso_pu_bacteria 2919487758 2919488128 217
517 iso_pu_bacteria 2919501602 2919502515 217
518 iso_pu_bacteria 2923510766 2923513938 217
519 iso_pu_bacteria 2926063275 2926064188 217
520 iso_pu_bacteria 2928130867 2928134200 217
521 iso_pu_bacteria 3007419365 3007425770 217
522 iso_pu_bacteria 3007872151 3007872938 217
523 iso_pu_bacteria 8034962539 8034965083 217
524 iso_pu_bacteria 8054929484 8054931855 217
525 iso_pu_bacteria 8056137416 8056140402 217
526 3300025931 Ga0207644_10289078 Ga0207644_102890782 218
527 3300042121 Ga0450919_001489 Ga0450919_001489_1902_2561 218
528 3300042125 Ga0450923_015979 Ga0450923_015979_25_684 218
529 3300042435 Ga0439434_0104232 Ga0439434_0104232_148_807 218
530 3300042531 Ga0450918_000196 Ga0450918_000196_5235_5894 218
531 iso_pu_bacteria 2511231004 2511254814 218
532 iso_pu_bacteria 2511231006 2511266028 218
533 iso_pu_bacteria 2511231008 2511275051 218
534 iso_pu_bacteria 2511231011 2511297998 218
535 iso_pu_bacteria 2511231012 2511303991 218
536 iso_pu_bacteria 2511231014 2511311963 218
537 iso_pu_bacteria 2511231015 2511320679 218
538 iso_pu_bacteria 2511231016 2511327969 218
539 iso_pu_bacteria 2511231017 2511329712 218
540 iso_pu_bacteria 2511231018 2511335884 218
541 iso_pu_bacteria 2511231019 2511344754 218
542 iso_pu_bacteria 2511231020 2511349517 218
543 iso_pu_bacteria 2511231021 2511360140 218
544 iso_pu_bacteria 2511231031 2511412133 218
545 iso_pu_bacteria 2512047018 2512326631 218
546 iso_pu_bacteria 2513237165 2514045004 218
547 iso_pu_bacteria 2513237165 2514045247 218
548 iso_pu_bacteria 2513237165 2514045305 218
549 iso_pu_bacteria 2574179768 2574431087 218
550 iso_pu_bacteria 2582580891 2583795681 218
551 iso_pu_bacteria 2597489887 2597860925 218
552 iso_pu_bacteria 2597489888 2597866672 218
553 iso_pu_bacteria 2597489889 2597872530 218
554 iso_pu_bacteria 2599185167 2599400495 218
555 iso_pu_bacteria 2599185179 2599449819 218
556 iso_pu_bacteria 2599185185 2599485840 218
557 iso_pu_bacteria 2599185188 2599500304 218
558 iso_pu_bacteria 2599185189 2599505792 218
559 iso_pu_bacteria 2599185190 2599511893 218
560 iso_pu_bacteria 2599185191 2599516877 218
561 iso_pu_bacteria 2599185212 2599614472 218
562 iso_pu_bacteria 2599185257 2599804620 218
563 iso_pu_bacteria 2599185288 2599879080 218
564 iso_pu_bacteria 2599185290 2599892745 218
565 iso_pu_bacteria 2599185292 2599902896 218
566 iso_pu_bacteria 2599185300 2599930673 218
567 iso_pu_bacteria 2599185303 2599951494 218
568 iso_pu_bacteria 2599185311 2599994030 218
569 iso_pu_bacteria 2599185316 2600026302 218
570 iso_pu_bacteria 2599185317 2600032047 218
571 iso_pu_bacteria 2599185318 2600036015 218
572 iso_pu_bacteria 2599185319 2600044580 218
573 iso_pu_bacteria 2599185322 2600061090 218
574 iso_pu_bacteria 2599185325 2600076500 218
575 iso_pu_bacteria 2600254930 2600358950 218
576 iso_pu_bacteria 2600254931 2600363506 218
577 iso_pu_bacteria 2600255296 2601693403 218
578 iso_pu_bacteria 2619619299 2621296804 218
579 iso_pu_bacteria 2643221565 2643843003 218
580 iso_pu_bacteria 2643221569 2643861719 218
581 iso_pu_bacteria 2643221571 2643872308 218
582 iso_pu_bacteria 2643221589 2643955591 218
583 iso_pu_bacteria 2643221602 2644020385 218
584 iso_pu_bacteria 2643221603 2644028505 218
585 iso_pu_bacteria 2643221633 2644184440 218
586 iso_pu_bacteria 2643221713 2644624726 218
587 iso_pu_bacteria 2667528176 2671128545 218
588 iso_pu_bacteria 2671180172 2671771627 218
589 iso_pu_bacteria 2675903420 2677897174 218
590 iso_pu_bacteria 2675903515 2678266191 218
591 iso_pu_bacteria 2718217725 2718636656 218
592 iso_pu_bacteria 2721755607 2723251408 218
593 iso_pu_bacteria 2738541265 2738671624 218
594 iso_pu_bacteria 2738541282 2738750018 218
595 iso_pu_bacteria 2738541294 2738807296 218
596 iso_pu_bacteria 2738541303 2738859058 218
597 iso_pu_bacteria 2738541309 2738894656 218
598 iso_pu_bacteria 2738543004 2739199100 218
599 iso_pu_bacteria 2738543015 2739259039 218
600 iso_pu_bacteria 2738543025 2739312464 218
601 iso_pu_bacteria 2740892503 2743740465 218
602 iso_pu_bacteria 2744054620 2745007423 218
603 iso_pu_bacteria 2773857673 2774135524 218
604 iso_pu_bacteria 2784132063 2784261773 218
605 iso_pu_bacteria 2791355520 2794593797 218
606 iso_pu_bacteria 2808606377 2808928401 218
607 iso_pu_bacteria 2808606381 2808950416 218
608 iso_pu_bacteria 2808606382 2808959798 218
609 iso_pu_bacteria 2808606385 2808976190 218
610 iso_pu_bacteria 2808606388 2808994346 218
611 iso_pu_bacteria 2808606395 2809033228 218
612 iso_pu_bacteria 2808606445 2809217227 218
613 iso_pu_bacteria 2816332298 2817494083 218
614 iso_pu_bacteria 2818991456 2819655175 218
615 iso_pu_bacteria 2834028612 2834030994 218
616 iso_pu_bacteria 2842826826 2842831245 218
617 iso_pu_bacteria 2842832357 2842833498 218
618 iso_pu_bacteria 2842837860 2842837941 218
619 iso_pu_bacteria 2842843487 2842845728 218
620 iso_pu_bacteria 2842854478 2842855665 218
621 iso_pu_bacteria 2844665904 2844667141 218
622 iso_pu_bacteria 2852612431 2852616393 218
623 iso_pu_bacteria 2852657418 2852659721 218
624 iso_pu_bacteria 2852667396 2852671361 218
625 iso_pu_bacteria 2855730933 2855732747 218
626 iso_pu_bacteria 2855767633 2855771499 218
627 iso_pu_bacteria 2857547612 2857553213 218
628 iso_pu_bacteria 2857576091 2857577578 218
629 iso_pu_bacteria 2860339153 2860341759 218
630 iso_pu_bacteria 2860867994 2860873068 218
631 iso_pu_bacteria 2880230671 2880236039 218
632 iso_pu_bacteria 2881412998 2881415543 218
633 iso_pu_bacteria 2891633521 2891634427 218
634 iso_pu_bacteria 2904518522 2904518915 218
635 iso_pu_bacteria 2904550169 2904551402 218
636 iso_pu_bacteria 2908446538 2908452628 218
637 iso_pu_bacteria 2913036834 2913042572 218
638 iso_pu_bacteria 2919385768 2919389152 218
639 iso_pu_bacteria 2919481497 2919485699 218
640 iso_pu_bacteria 2923153595 2923159558 218
641 iso_pu_bacteria 2929144301 2929149961 218
642 iso_pu_bacteria 2929189879 2929195192 218
643 iso_pu_bacteria 2931390751 2931396457 218
644 iso_pu_bacteria 2931396565 2931398122 218
645 iso_pu_bacteria 2939636861 2939640764 218
646 iso_pu_bacteria 2941479691 2941482521 218
647 iso_pu_bacteria 2945928738 2945930873 218
648 iso_pu_bacteria 2945961074 2945966903 218
649 iso_pu_bacteria 2946006987 2946013238 218
650 iso_pu_bacteria 2946027586 2946027945 218
651 iso_pu_bacteria 2947233263 2947234470 218
652 iso_pu_bacteria 2969304461 2969310216 218
653 iso_pu_bacteria 2974289157 2974294041 218
654 iso_pu_bacteria 2984286254 2984286556 218
655 iso_pu_bacteria 2998139840 2998145438 218
656 iso_pu_bacteria 2998344455 2998344656 218
657 iso_pu_bacteria 3007395558 3007399357 218
658 iso_pu_bacteria 3007511990 3007517224 218
659 iso_pu_bacteria 3007614139 3007618865 218
660 iso_pu_bacteria 3007855910 3007859231 218
661 iso_pu_bacteria 3007861166 3007865065 218
662 iso_pu_bacteria 3007866637 3007866742 218
663 iso_pu_bacteria 639633007 639787418 218
664 iso_pu_bacteria 8015687852 8015693656 218
665 iso_pu_bacteria 8029995093 8029995466 218
666 iso_pu_bacteria 8054285046 8054285680 218
667 iso_pu_bacteria 8054347763 8054349543 218
668 iso_pu_bacteria 8054503363 8054508978 218
669 iso_pu_bacteria 8055770955 8055776903 218
670 iso_pu_bacteria 8055817908 8055823949 218
671 iso_pu_bacteria 8056125926 8056131647 218
672 iso_pu_bacteria 8056131705 8056137353 218
673 iso_pu_bacteria 8056143049 8056148814 218
674 iso_pu_bacteria 8056148874 8056151450 218
675 iso_pu_bacteria 8056161164 8056163670 218
676 iso_pu_bacteria 8056166840 8056171269 218
677 iso_pu_bacteria 8056177738 8056182039 218
678 iso_pu_bacteria 8056569372 8056570507 218
679 3300005289 Ga0065704_10076165 Ga0065704_100761656 219
680 3300005335 Ga0070666_10044566 Ga0070666_100445663 219
681 3300005364 Ga0070673_100336409 Ga0070673_1003364092 219
682 3300005367 Ga0070667_100025826 Ga0070667_1000258262 219
683 3300006195 Ga0075366_10005256 Ga0075366_100052566 219
684 3300014497 Ga0182008_10013647 Ga0182008_100136475 219
685 3300014969 Ga0157376_10340397 Ga0157376_103403972 219
686 3300015262 Ga0182007_10006630 Ga0182007_100066308 219
687 3300015683 Ga0183362_10001 Ga0183362_10001510 219
688 3300017792 Ga0163161_10173430 Ga0163161_101734302 219
689 3300025924 Ga0207694_10340000 Ga0207694_103400002 219
690 3300025926 Ga0207659_10173289 Ga0207659_101732892 219
691 3300025960 Ga0207651_10280762 Ga0207651_102807622 219
692 3300026023 Ga0207677_10102893 Ga0207677_101028933 219
693 3300026121 Ga0207683_10472243 Ga0207683_104722432 219
694 3300031251 Ga0265327_10036761 Ga0265327_100367612 219
695 3300031731 Ga0307405_10219610 Ga0307405_102196102 219
696 3300041404 Ga0439436_0031731 Ga0439436_0031731_140_802 219
697 3300041408 Ga0439453_0033084 Ga0439453_0033084_270_932 219
698 3300041410 Ga0439461_0060740 Ga0439461_0060740_173_835 219
699 3300042156 Ga0439446_0021589 Ga0439446_0021589_893_1555 219
700 3300042184 Ga0450908_022912 Ga0450908_022912_75_737 219
701 3300046462 Ga0495651_0154753 Ga0495651_0154753_756_1418 219
702 3300046462 Ga0495651_0187053 Ga0495651_0187053_338_1000 219
703 3300046475 Ga0495639_0003490 Ga0495639_0003490_2442_3104 219
704 3300046615 Ga0495656_0003752 Ga0495656_0003752_1565_2227 219
705 3300046674 Ga0495588_0158347 Ga0495588_0158347_76_738 219
706 3300046675 Ga0495657_0100484 Ga0495657_0100484_244_906 219
707 3300046675 Ga0495657_0220054 Ga0495657_0220054_141_803 219
708 3300046689 Ga0495613_0415467 Ga0495613_0415467_139_801 219
709 3300046809 Ga0495600_0185820 Ga0495600_0185820_599_1261 219
710 3300047317 Ga0495604_0094930 Ga0495604_0094930_807_1469 219
711 3300047673 Ga0495593_0078652 Ga0495593_0078652_717_1379 219
712 3300048903 Ga0496100_0039148 Ga0496100_0039148_554_1216 219
713 3300048904 Ga0496101_0009650 Ga0496101_0009650_3962_4624 219
714 3300048905 Ga0496102_0004534 Ga0496102_0004534_8420_9082 219
715 3300048906 Ga0496103_0013210 Ga0496103_0013210_1255_1917 219
716 3300048907 Ga0496104_0137938 Ga0496104_0137938_510_1172 219
717 3300048908 Ga0496105_0002236 Ga0496105_0002236_5518_6180 219
718 3300048909 Ga0496106_0011540 Ga0496106_0011540_3256_3918 219
719 3300048910 Ga0496107_0315144 Ga0496107_0315144_448_1110 219
720 3300048913 Ga0496110_0038468 Ga0496110_0038468_2356_3018 219
721 3300048914 Ga0496111_0187292 Ga0496111_0187292_566_1228 219
722 3300048915 Ga0496112_0441141 Ga0496112_0441141_219_881 219
723 3300048917 Ga0496114_0102391 Ga0496114_0102391_1122_1784 219
724 3300048925 Ga0496122_0020263 Ga0496122_0020263_533_1195 219
725 3300048928 Ga0496125_0000319 Ga0496125_0000319_64295_64957 219
726 3300048929 Ga0496126_0023661 Ga0496126_0023661_1296_1958 219
727 3300050493 nmdc:mga0k408_2992_c1 nmdc:mga0k408_2992_c1_3886_4548 219
728 iso_pu_bacteria 2511231007 2511273340 219
729 iso_pu_bacteria 2511231010 2511288501 219
730 iso_pu_bacteria 2511231022 2511365982 219
731 iso_pu_bacteria 2511231023 2511368993 219
732 iso_pu_bacteria 2511231156 2511827682 219
733 iso_pu_bacteria 2511231221 2512037785 219
734 iso_pu_bacteria 2599185248 2599768102 219
735 iso_pu_bacteria 2599185289 2599885538 219
736 iso_pu_bacteria 2599185291 2599897252 219
737 iso_pu_bacteria 2599185302 2599942311 219
738 iso_pu_bacteria 2599185304 2599954276 219
739 iso_pu_bacteria 2599185305 2599961961 219
740 iso_pu_bacteria 2599185306 2599965984 219
741 iso_pu_bacteria 2599185308 2599977966 219
742 iso_pu_bacteria 2599185309 2599982881 219
743 iso_pu_bacteria 2599185310 2599988369 219
744 iso_pu_bacteria 2599185312 2599999164 219
745 iso_pu_bacteria 2599185313 2600004265 219
746 iso_pu_bacteria 2599185314 2600012133 219
747 iso_pu_bacteria 2599185315 2600020445 219
748 iso_pu_bacteria 2599185320 2600046695 219
749 iso_pu_bacteria 2599185321 2600054877 219
750 iso_pu_bacteria 2599185323 2600068003 219
751 iso_pu_bacteria 2599185324 2600071912 219
752 iso_pu_bacteria 2600255318 2601798521 219
753 iso_pu_bacteria 2603880185 2606077415 219
754 iso_pu_bacteria 2603880199 2606129339 219
755 iso_pu_bacteria 2623620443 2624483451 219
756 iso_pu_bacteria 2623620446 2624494976 219
757 iso_pu_bacteria 2643221650 2644283185 219
758 iso_pu_bacteria 2651869719 2652546691 219
759 iso_pu_bacteria 2667528170 2671089598 219
760 iso_pu_bacteria 2713897149 2715754809 219
761 iso_pu_bacteria 2773857670 2774118335 219
762 iso_pu_bacteria 2784132072 2784313616 219
763 iso_pu_bacteria 2808606361 2808855656 219
764 iso_pu_bacteria 2808606376 2808926782 219
765 iso_pu_bacteria 2808606378 2808935507 219
766 iso_pu_bacteria 2808606380 2808948943 219
767 iso_pu_bacteria 2808606383 2808964115 219
768 iso_pu_bacteria 2808606389 2808999049 219
769 iso_pu_bacteria 2818991436 2819543929 219
770 iso_pu_bacteria 2825651385 2825655053 219
771 iso_pu_bacteria 2878029506 2878035392 219
772 iso_pu_bacteria 2897803580 2897806768 219
773 iso_pu_bacteria 2919063839 2919065477 219
774 iso_pu_bacteria 2919697872 2919700532 219
775 iso_pu_bacteria 2923586266 2923589041 219
776 iso_pu_bacteria 2931369376 2931372598 219
777 iso_pu_bacteria 2988728565 2988731498 219
778 iso_pu_bacteria 3007718800 3007721799 219
779 iso_pu_bacteria 8019775933 8019777639 219
780 iso_pu_bacteria 8054002106 8054007067 219
781 iso_pu_bacteria 8056155041 8056159743 219
782 3300026118 Ga0207675_101211330 Ga0207675_1012113301 220
783 3300050491 nmdc:mga00v17_11469_c1 nmdc:mga00v17_11469_c1_727_1401 220
784 3300002704 JGI25155J39150_1000370 JGI25155J39150_100037010 221
785 3300002704 JGI25155J39150_1000428 JGI25155J39150_100042812 221
786 3300002704 JGI25155J39150_1000795 JGI25155J39150_10007956 221
787 3300002705 JGI25156J39149_1000117 JGI25156J39149_100011745 221
788 3300002705 JGI25156J39149_1000989 JGI25156J39149_100098910 221
789 3300002705 JGI25156J39149_1002357 JGI25156J39149_10023572 221
790 3300002737 JGI25162J39368_1004300 JGI25162J39368_10043002 221
791 3300002737 JGI25162J39368_1004556 JGI25162J39368_10045562 221
792 3300002738 JGI25154J39366_1000107 JGI25154J39366_100010733 221
793 3300002738 JGI25154J39366_1000249 JGI25154J39366_100024926 221
794 3300002738 JGI25154J39366_1000826 JGI25154J39366_100082610 221
795 3300002741 JGI25157J39369_1000966 JGI25157J39369_100096610 221
796 3300002741 JGI25157J39369_1001016 JGI25157J39369_10010167 221
797 3300003751 Ga0055538_1000229 Ga0055538_100022917 221
798 3300003752 Ga0055539_1000269 Ga0055539_100026917 221
799 3300003756 Ga0055533_1000258 Ga0055533_100025817 221
800 3300003758 Ga0055532_1000044 Ga0055532_1000044113 221
801 3300003758 Ga0055532_1000647 Ga0055532_100064710 221
802 3300003759 Ga0055525_1000359 Ga0055525_100035917 221
803 3300003761 Ga0055535_1002174 Ga0055535_10021747 221
804 3300003763 Ga0055529_1008064 Ga0055529_10080642 221
805 3300003841 Ga0055541_1000168 Ga0055541_100016817 221
806 3300005288 Ga0065714_10007511 Ga0065714_100075111 221
807 3300005290 Ga0065712_10067900 Ga0065712_100679004 221
808 3300005331 Ga0070670_100024674 Ga0070670_1000246745 221
809 3300005539 Ga0068853_100247147 Ga0068853_1002471471 221
810 3300005548 Ga0070665_100244070 Ga0070665_1002440703 221
811 3300005563 Ga0068855_100000083 Ga0068855_10000008312 221
812 3300005563 Ga0068855_100075954 Ga0068855_1000759544 221
813 3300005563 Ga0068855_100156925 Ga0068855_1001569253 221
814 3300005563 Ga0068855_100230745 Ga0068855_1002307452 221
815 3300005578 Ga0068854_100009626 Ga0068854_1000096265 221
816 3300005614 Ga0068856_100045478 Ga0068856_1000454784 221
817 3300005614 Ga0068856_100062089 Ga0068856_1000620892 221
818 3300005616 Ga0068852_100010440 Ga0068852_1000104404 221
819 3300006038 Ga0075365_10145557 Ga0075365_101455572 221
820 3300006177 Ga0075362_10037732 Ga0075362_100377322 221
821 3300006946 Ga0079104_1001469 Ga0079104_10014696 221
822 3300009011 Ga0105251_10000133 Ga0105251_100001335 221
823 3300009011 Ga0105251_10006398 Ga0105251_100063985 221
824 3300009011 Ga0105251_10008326 Ga0105251_100083265 221
825 3300009011 Ga0105251_10014310 Ga0105251_100143102 221
826 3300009011 Ga0105251_10044660 Ga0105251_100446602 221
827 3300009036 Ga0105244_10001453 Ga0105244_100014533 221
828 3300009036 Ga0105244_10067665 Ga0105244_100676653 221
829 3300009036 Ga0105244_10276542 Ga0105244_102765421 221
830 3300009092 Ga0105250_10003816 Ga0105250_100038166 221
831 3300009093 Ga0105240_10003351 Ga0105240_1000335110 221
832 3300009093 Ga0105240_10028663 Ga0105240_100286634 221
833 3300009093 Ga0105240_10118802 Ga0105240_101188023 221
834 3300009148 Ga0105243_10007062 Ga0105243_100070628 221
835 3300009148 Ga0105243_10013877 Ga0105243_100138775 221
836 3300009176 Ga0105242_10164967 Ga0105242_101649673 221
837 3300009545 Ga0105237_10093575 Ga0105237_100935753 221
838 3300009545 Ga0105237_10268524 Ga0105237_102685243 221
839 3300009545 Ga0105237_10340359 Ga0105237_103403592 221
840 3300009551 Ga0105238_10000037 Ga0105238_10000037156 221
841 3300010375 Ga0105239_10013749 Ga0105239_100137496 221
842 3300010375 Ga0105239_10092298 Ga0105239_100922983 221
843 3300011119 Ga0105246_10019035 Ga0105246_100190352 221
844 3300013100 Ga0157373_10003992 Ga0157373_100039925 221
845 3300013102 Ga0157371_10025849 Ga0157371_100258494 221
846 3300013104 Ga0157370_10000070 Ga0157370_1000007030 221
847 3300013104 Ga0157370_10039117 Ga0157370_100391174 221
848 3300013104 Ga0157370_10105658 Ga0157370_101056583 221
849 3300013105 Ga0157369_10138981 Ga0157369_101389812 221
850 3300013307 Ga0157372_10131463 Ga0157372_101314633 221
851 3300014326 Ga0157380_10410785 Ga0157380_104107852 221
852 3300014497 Ga0182008_10013293 Ga0182008_100132931 221
853 3300014497 Ga0182008_10052314 Ga0182008_100523142 221
854 3300015261 Ga0182006_1050795 Ga0182006_10507952 221
855 3300015265 Ga0182005_1010616 Ga0182005_10106164 221
856 3300016635 Ga0183361_10004 Ga0183361_10004222 221
857 3300025206 Ga0209435_100004 Ga0209435_100004522 221
858 3300025206 Ga0209435_100046 Ga0209435_10004614 221
859 3300025206 Ga0209435_100768 Ga0209435_1007682 221
860 3300025224 Ga0209784_100009 Ga0209784_100009497 221
861 3300025225 Ga0209566_100007 Ga0209566_100007497 221
862 3300025226 Ga0209674_100018 Ga0209674_100018497 221
863 3300025229 Ga0209147_100011 Ga0209147_100011591 221
864 3300025229 Ga0209147_100157 Ga0209147_10015777 221
865 3300025230 Ga0209563_100020 Ga0209563_100020497 221
866 3300025233 Ga0209437_100207 Ga0209437_10020717 221
867 3300025233 Ga0209437_100939 Ga0209437_1009396 221
868 3300025242 Ga0209258_100851 Ga0209258_1008516 221
869 3300025242 Ga0209258_100913 Ga0209258_1009133 221
870 3300025246 Ga0209646_1000141 Ga0209646_100014194 221
871 3300025246 Ga0209646_1000149 Ga0209646_100014984 221
872 3300025246 Ga0209646_1000156 Ga0209646_100015679 221
873 3300025246 Ga0209646_1000233 Ga0209646_100023345 221
874 3300025246 Ga0209646_1000524 Ga0209646_10005248 221
875 3300025250 Ga0209026_1000066 Ga0209026_100006654 221
876 3300025250 Ga0209026_1000776 Ga0209026_10007768 221
877 3300025253 Ga0209677_100010 Ga0209677_100010497 221
878 3300025254 Ga0209148_1012493 Ga0209148_10124932 221
879 3300025254 Ga0209148_1015404 Ga0209148_10154042 221
880 3300025256 Ga0209759_1000072 Ga0209759_100007290 221
881 3300025256 Ga0209759_1000182 Ga0209759_100018212 221
882 3300025256 Ga0209759_1001083 Ga0209759_10010838 221
883 3300025256 Ga0209759_1001715 Ga0209759_10017156 221
884 3300025272 Ga0209455_1001032 Ga0209455_10010323 221
885 3300025272 Ga0209455_1002502 Ga0209455_10025022 221
886 3300025728 Ga0207655_1000033 Ga0207655_100003397 221
887 3300025728 Ga0207655_1002748 Ga0207655_10027487 221
888 3300025728 Ga0207655_1007307 Ga0207655_10073076 221
889 3300025728 Ga0207655_1041823 Ga0207655_10418233 221
890 3300025728 Ga0207655_1142231 Ga0207655_11422311 221
891 3300025735 Ga0207713_1000079 Ga0207713_1000079105 221
892 3300025735 Ga0207713_1000750 Ga0207713_100075011 221
893 3300025735 Ga0207713_1021313 Ga0207713_10213132 221
894 3300025735 Ga0207713_1022601 Ga0207713_10226015 221
895 3300025913 Ga0207695_10000748 Ga0207695_1000074847 221
896 3300025913 Ga0207695_10000979 Ga0207695_1000097948 221
897 3300025913 Ga0207695_10085612 Ga0207695_100856123 221
898 3300025914 Ga0207671_10027798 Ga0207671_100277984 221
899 3300025914 Ga0207671_10312044 Ga0207671_103120442 221
900 3300025924 Ga0207694_10000069 Ga0207694_10000069116 221
901 3300025924 Ga0207694_10033085 Ga0207694_100330853 221
902 3300025925 Ga0207650_10176277 Ga0207650_101762773 221
903 3300025934 Ga0207686_10271493 Ga0207686_102714932 221
904 3300025935 Ga0207709_10003176 Ga0207709_100031765 221
905 3300025935 Ga0207709_10181605 Ga0207709_101816052 221
906 3300025949 Ga0207667_10000043 Ga0207667_10000043188 221
907 3300025949 Ga0207667_10030089 Ga0207667_100300891 221
908 3300025949 Ga0207667_10223683 Ga0207667_102236832 221
909 3300025949 Ga0207667_10398203 Ga0207667_103982032 221
910 3300025981 Ga0207640_10015014 Ga0207640_100150142 221
911 3300026078 Ga0207702_10027104 Ga0207702_100271044 221
912 3300026078 Ga0207702_10333543 Ga0207702_103335432 221
913 3300026142 Ga0207698_10000966 Ga0207698_1000096610 221
914 3300027111 Ga0209281_1005170 Ga0209281_10051704 221
915 3300027312 Ga0209371_1000871 Ga0209371_10008717 221
916 3300030500 Ga0268256_1000771 Ga0268256_10007716 221
917 3300030521 Ga0307511_10003163 Ga0307511_1000316312 221
918 3300031507 Ga0307509_10373778 Ga0307509_103737782 221
919 3300031548 Ga0307408_100000002 Ga0307408_100000002446 221
920 3300031731 Ga0307405_10445495 Ga0307405_104454951 221
921 3300039447 Ga0436361_0383577 Ga0436361_0383577_649_1320 221
922 3300042016 Ga0439463_001732 Ga0439463_001732_1823_2488 221
923 3300042016 Ga0439463_029998 Ga0439463_029998_189_854 221
924 3300042439 Ga0439464_0002118 Ga0439464_0002118_2481_3146 221
925 3300046453 Ga0495627_009171 Ga0495627_009171_2559_3224 221
926 3300046455 Ga0495603_0080815 Ga0495603_0080815_600_1265 221
927 3300046457 Ga0495590_0073097 Ga0495590_0073097_321_986 221
928 3300046458 Ga0495591_000113 Ga0495591_000113_49598_50263 221
929 3300046458 Ga0495591_003516 Ga0495591_003516_4361_5026 221
930 3300046458 Ga0495591_008694 Ga0495591_008694_2453_3118 221
931 3300046458 Ga0495591_009752 Ga0495591_009752_2548_3213 221
932 3300046458 Ga0495591_034834 Ga0495591_034834_527_1192 221
933 3300046458 Ga0495591_036110 Ga0495591_036110_503_1168 221
934 3300046463 Ga0495653_0026743 Ga0495653_0026743_3500_4165 221
935 3300046471 Ga0495650_0000623 Ga0495650_0000623_29855_30520 221
936 3300046471 Ga0495650_0003593 Ga0495650_0003593_3465_4130 221
937 3300046474 Ga0495605_0000122 Ga0495605_0000122_97146_97811 221
938 3300046474 Ga0495605_0000339 Ga0495605_0000339_2692_3357 221
939 3300046474 Ga0495605_0008405 Ga0495605_0008405_2181_2846 221
940 3300046474 Ga0495605_0040719 Ga0495605_0040719_1575_2240 221
941 3300046474 Ga0495605_0060194 Ga0495605_0060194_674_1339 221
942 3300046491 Ga0495584_0002441 Ga0495584_0002441_3862_4527 221
943 3300046492 Ga0495585_0010646 Ga0495585_0010646_2443_3108 221
944 3300046492 Ga0495585_0036941 Ga0495585_0036941_1702_2367 221
945 3300046500 Ga0495596_0088404 Ga0495596_0088404_494_1159 221
946 3300046501 Ga0495607_0000700 Ga0495607_0000700_29179_29844 221
947 3300046501 Ga0495607_0010126 Ga0495607_0010126_3604_4269 221
948 3300046501 Ga0495607_0020703 Ga0495607_0020703_2897_3562 221
949 3300046501 Ga0495607_0023824 Ga0495607_0023824_47_712 221
950 3300046501 Ga0495607_0027597 Ga0495607_0027597_2212_2877 221
951 3300046501 Ga0495607_0036551 Ga0495607_0036551_453_1118 221
952 3300046501 Ga0495607_0052257 Ga0495607_0052257_141_806 221
953 3300046501 Ga0495607_0087140 Ga0495607_0087140_228_893 221
954 3300046501 Ga0495607_0105796 Ga0495607_0105796_419_1084 221
955 3300046506 Ga0495583_0005999 Ga0495583_0005999_4963_5628 221
956 3300046506 Ga0495583_0007722 Ga0495583_0007722_3664_4329 221
957 3300046506 Ga0495583_0007740 Ga0495583_0007740_3562_4227 221
958 3300046506 Ga0495583_0017638 Ga0495583_0017638_2513_3178 221
959 3300046506 Ga0495583_0056286 Ga0495583_0056286_359_1024 221
960 3300046507 Ga0495606_0008130 Ga0495606_0008130_69_734 221
961 3300046507 Ga0495606_0011278 Ga0495606_0011278_4183_4848 221
962 3300046507 Ga0495606_0025647 Ga0495606_0025647_561_1226 221
963 3300046507 Ga0495606_0062812 Ga0495606_0062812_1288_1953 221
964 3300046507 Ga0495606_0339071 Ga0495606_0339071_69_734 221
965 3300046512 Ga0495610_0021338 Ga0495610_0021338_526_1191 221
966 3300046513 Ga0495616_0095331 Ga0495616_0095331_604_1269 221
967 3300046515 Ga0495620_0006325 Ga0495620_0006325_3703_4368 221
968 3300046515 Ga0495620_0015484 Ga0495620_0015484_170_835 221
969 3300046515 Ga0495620_0018041 Ga0495620_0018041_651_1316 221
970 3300046518 Ga0495631_0018531 Ga0495631_0018531_495_1160 221
971 3300046519 Ga0495632_0007773 Ga0495632_0007773_2558_3223 221
972 3300046519 Ga0495632_0015914 Ga0495632_0015914_1694_2359 221
973 3300046519 Ga0495632_0139413 Ga0495632_0139413_161_826 221
974 3300046520 Ga0495637_0000301 Ga0495637_0000301_34895_35560 221
975 3300046520 Ga0495637_0009362 Ga0495637_0009362_2049_2714 221
976 3300046520 Ga0495637_0015564 Ga0495637_0015564_477_1142 221
977 3300046520 Ga0495637_0019071 Ga0495637_0019071_594_1259 221
978 3300046520 Ga0495637_0050312 Ga0495637_0050312_547_1212 221
979 3300046522 Ga0495643_0000017 Ga0495643_0000017_265774_266439 221
980 3300046522 Ga0495643_0009169 Ga0495643_0009169_3384_4049 221
981 3300046522 Ga0495643_0210030 Ga0495643_0210030_168_833 221
982 3300046523 Ga0495644_0008107 Ga0495644_0008107_3164_3829 221
983 3300046524 Ga0495648_0006603 Ga0495648_0006603_5942_6607 221
984 3300046524 Ga0495648_0018140 Ga0495648_0018140_2036_2701 221
985 3300046530 Ga0495654_0022931 Ga0495654_0022931_2513_3178 221
986 3300046530 Ga0495654_0028942 Ga0495654_0028942_316_981 221
987 3300046530 Ga0495654_0094659 Ga0495654_0094659_225_890 221
988 3300046538 Ga0495609_0000023 Ga0495609_0000023_98072_98737 221
989 3300046538 Ga0495609_0000132 Ga0495609_0000132_27927_28592 221
990 3300046538 Ga0495609_0033448 Ga0495609_0033448_166_831 221
991 3300046542 Ga0495597_0000185 Ga0495597_0000185_51532_52197 221
992 3300046557 Ga0495622_0011715 Ga0495622_0011715_3307_3972 221
993 3300046616 Ga0495668_0016904 Ga0495668_0016904_2513_3178 221
994 3300046616 Ga0495668_0086948 Ga0495668_0086948_982_1647 221
995 3300046616 Ga0495668_0198571 Ga0495668_0198571_369_1034 221
996 3300046648 Ga0495611_0001661 Ga0495611_0001661_3875_4540 221
997 3300046660 Ga0495625_0000061 Ga0495625_0000061_101080_101745 221
998 3300046660 Ga0495625_0001913 Ga0495625_0001913_4706_5419 221
999 3300046660 Ga0495625_0014555 Ga0495625_0014555_728_1399 221
1000 3300046660 Ga0495625_0201382 Ga0495625_0201382_284_949 221
1001 3300046665 Ga0495661_0000036 Ga0495661_0000036_47090_47755 221
1002 3300046665 Ga0495661_0000060 Ga0495661_0000060_102659_103324 221
1003 3300046665 Ga0495661_0009192 Ga0495661_0009192_2561_3226 221
1004 3300046665 Ga0495661_0140827 Ga0495661_0140827_624_1289 221
1005 3300046692 Ga0495671_0001738 Ga0495671_0001738_2130_2795 221
1006 3300046692 Ga0495671_0001929 Ga0495671_0001929_10716_11381 221
1007 3300046692 Ga0495671_0059564 Ga0495671_0059564_134_799 221
1008 3300046692 Ga0495671_0100340 Ga0495671_0100340_265_930 221
1009 3300046694 Ga0495649_0015889 Ga0495649_0015889_590_1255 221
1010 3300046694 Ga0495649_0056291 Ga0495649_0056291_958_1623 221
1011 3300046694 Ga0495649_0078469 Ga0495649_0078469_202_867 221
1012 3300046810 Ga0495660_0003401 Ga0495660_0003401_3436_4101 221
1013 3300046810 Ga0495660_0176078 Ga0495660_0176078_137_802 221
1014 3300047320 Ga0495672_0032878 Ga0495672_0032878_2265_2930 221
1015 3300047320 Ga0495672_0072442 Ga0495672_0072442_864_1529 221
1016 3300047321 Ga0495676_0000011 Ga0495676_0000011_77826_78491 221
1017 3300047321 Ga0495676_0020361 Ga0495676_0020361_3766_4431 221
1018 3300047323 Ga0495683_0000028 Ga0495683_0000028_35781_36446 221
1019 3300047446 Ga0495679_000028 Ga0495679_000028_96581_97246 221
1020 3300047446 Ga0495679_059342 Ga0495679_059342_243_908 221
1021 3300047469 Ga0495673_0005801 Ga0495673_0005801_4227_4892 221
1022 3300047469 Ga0495673_0015946 Ga0495673_0015946_2607_3272 221
1023 3300047469 Ga0495673_0017738 Ga0495673_0017738_1013_1678 221
1024 3300047469 Ga0495673_0025842 Ga0495673_0025842_20_685 221
1025 3300047469 Ga0495673_0057994 Ga0495673_0057994_276_941 221
1026 3300047469 Ga0495673_0064001 Ga0495673_0064001_629_1294 221
1027 3300047469 Ga0495673_0125643 Ga0495673_0125643_151_816 221
1028 3300047469 Ga0495673_0141971 Ga0495673_0141971_251_916 221
1029 3300047470 Ga0495681_0045559 Ga0495681_0045559_762_1427 221
1030 3300047472 Ga0495686_0142235 Ga0495686_0142235_43_708 221
1031 3300047472 Ga0495686_0148283 Ga0495686_0148283_159_824 221
1032 3300048091 Ga0495626_0000024 Ga0495626_0000024_204399_205064 221
1033 3300048913 Ga0496110_0195940 Ga0496110_0195940_286_951 221
1034 3300048915 Ga0496112_0569987 Ga0496112_0569987_150_815 221
1035 3300048919 Ga0496116_0006985 Ga0496116_0006985_1899_2612 221
1036 3300048919 Ga0496116_0041683 Ga0496116_0041683_971_1642 221
1037 3300048919 Ga0496116_0117438 Ga0496116_0117438_141_806 221
1038 3300048920 Ga0496117_0029302 Ga0496117_0029302_697_1362 221
1039 3300048921 Ga0496118_0110003 Ga0496118_0110003_742_1407 221
1040 3300048921 Ga0496118_0206247 Ga0496118_0206247_113_778 221
1041 3300048924 Ga0496121_0013843 Ga0496121_0013843_3122_3793 221
1042 3300048924 Ga0496121_0015990 Ga0496121_0015990_3103_3768 221
1043 3300048924 Ga0496121_0016038 Ga0496121_0016038_3267_3932 221
1044 3300048924 Ga0496121_0096435 Ga0496121_0096435_30_743 221
1045 3300048924 Ga0496121_0300223 Ga0496121_0300223_233_904 221
1046 3300048925 Ga0496122_0000616 Ga0496122_0000616_2604_3269 221
1047 3300048925 Ga0496122_0001392 Ga0496122_0001392_16675_17346 221
1048 3300048926 Ga0496123_0000632 Ga0496123_0000632_11352_12023 221
1049 3300048926 Ga0496123_0008524 Ga0496123_0008524_4624_5289 221
1050 3300048927 Ga0496124_0000073 Ga0496124_0000073_145616_146281 221
1051 3300048927 Ga0496124_0015211 Ga0496124_0015211_3923_4588 221
1052 3300048927 Ga0496124_0381807 Ga0496124_0381807_35_700 221
1053 3300048928 Ga0496125_0000947 Ga0496125_0000947_39969_40682 221
1054 3300048928 Ga0496125_0003314 Ga0496125_0003314_18693_19364 221
1055 3300048928 Ga0496125_0005089 Ga0496125_0005089_9926_10597 221
1056 3300049459 Ga0495678_009421 Ga0495678_009421_1973_2638 221
1057 3300049459 Ga0495678_018525 Ga0495678_018525_2444_3109 221
1058 3300049459 Ga0495678_021976 Ga0495678_021976_20_685 221
1059 3300049460 Ga0495682_0001506 Ga0495682_0001506_4395_5060 221
1060 3300050493 nmdc:mga0k408_198142_c1 nmdc:mga0k408_198142_c1_352_1017 221
1061 3300053092 Ga0500583_0006260 Ga0500583_0006260_1785_2450 221
1062 3300053096 Ga0500641_0022457 Ga0500641_0022457_323_997 221
1063 3300053118 Ga0500594_0011721 Ga0500594_0011721_330_995 221
1064 3300053125 Ga0500618_023789 Ga0500618_023789_619_1302 221
1065 3300053125 Ga0500618_025568 Ga0500618_025568_238_903 221
1066 3300053140 Ga0500573_0034392 Ga0500573_0034392_1999_2664 221
1067 3300053145 Ga0500586_056689 Ga0500586_056689_561_1226 221
1068 3300003187 JGI25151J46595_10001598 JGI25151J46595_100015988 222
1069 3300003187 JGI25151J46595_10001939 JGI25151J46595_1000193912 222
1070 3300003320 rootH2_10020080 rootH2_100200801 222
1071 3300003771 Ga0055526_1002434 Ga0055526_10024348 222
1072 3300003781 Ga0055536_1000081 Ga0055536_10000814 222
1073 3300003781 Ga0055536_1000201 Ga0055536_100020122 222
1074 3300003781 Ga0055536_1000704 Ga0055536_100070420 222
1075 3300003784 Ga0055534_1000104 Ga0055534_100010412 222
1076 3300003791 Ga0055530_10000324 Ga0055530_100003244 222
1077 3300003792 Ga0055540_1003757 Ga0055540_10037574 222
1078 3300005288 Ga0065714_10016786 Ga0065714_100167862 222
1079 3300005288 Ga0065714_10065569 Ga0065714_100655695 222
1080 3300005288 Ga0065714_10072683 Ga0065714_100726832 222
1081 3300005288 Ga0065714_10092492 Ga0065714_100924922 222
1082 3300005288 Ga0065714_10129168 Ga0065714_101291682 222
1083 3300005288 Ga0065714_10135547 Ga0065714_101355472 222
1084 3300005289 Ga0065704_10080568 Ga0065704_100805683 222
1085 3300005435 Ga0070714_100523115 Ga0070714_1005231152 222
1086 3300005548 Ga0070665_100045202 Ga0070665_1000452025 222
1087 3300005548 Ga0070665_101406873 Ga0070665_1014068731 222
1088 3300006051 Ga0075364_10129569 Ga0075364_101295692 222
1089 3300006058 Ga0075432_10028200 Ga0075432_100282001 222
1090 3300006058 Ga0075432_10032413 Ga0075432_100324133 222
1091 3300006058 Ga0075432_10074428 Ga0075432_100744281 222
1092 3300006177 Ga0075362_10034210 Ga0075362_100342102 222
1093 3300006177 Ga0075362_10108739 Ga0075362_101087391 222
1094 3300006914 Ga0075436_100042606 Ga0075436_1000426062 222
1095 3300006914 Ga0075436_100176405 Ga0075436_1001764052 222
1096 3300006914 Ga0075436_100235249 Ga0075436_1002352492 222
1097 3300006914 Ga0075436_100269535 Ga0075436_1002695352 222
1098 3300006914 Ga0075436_100494052 Ga0075436_1004940521 222
1099 3300006914 Ga0075436_100536753 Ga0075436_1005367531 222
1100 3300006946 Ga0079104_1000518 Ga0079104_10005184 222
1101 3300006946 Ga0079104_1010922 Ga0079104_10109222 222
1102 3300006948 Ga0099826_10000039 Ga0099826_1000003934 222
1103 3300009011 Ga0105251_10016733 Ga0105251_100167335 222
1104 3300009036 Ga0105244_10098580 Ga0105244_100985801 222
1105 3300009092 Ga0105250_10002587 Ga0105250_100025877 222
1106 3300009092 Ga0105250_10004205 Ga0105250_100042055 222
1107 3300009092 Ga0105250_10057968 Ga0105250_100579682 222
1108 3300009148 Ga0105243_10053584 Ga0105243_100535842 222
1109 3300009148 Ga0105243_10170509 Ga0105243_101705093 222
1110 3300009176 Ga0105242_10440437 Ga0105242_104404372 222
1111 3300011119 Ga0105246_10025124 Ga0105246_100251243 222
1112 3300012498 Ga0157345_1000059 Ga0157345_10000593 222
1113 3300013100 Ga0157373_10043917 Ga0157373_100439172 222
1114 3300013100 Ga0157373_10129501 Ga0157373_101295012 222
1115 3300013100 Ga0157373_10152386 Ga0157373_101523862 222
1116 3300013102 Ga0157371_10011165 Ga0157371_100111655 222
1117 3300013102 Ga0157371_10163806 Ga0157371_101638062 222
1118 3300013104 Ga0157370_10072242 Ga0157370_100722424 222
1119 3300013104 Ga0157370_10386291 Ga0157370_103862912 222
1120 3300013105 Ga0157369_10095256 Ga0157369_100952562 222
1121 3300013105 Ga0157369_10133358 Ga0157369_101333582 222
1122 3300013306 Ga0163162_10048268 Ga0163162_100482683 222
1123 3300013306 Ga0163162_11101635 Ga0163162_111016352 222
1124 3300013308 Ga0157375_10382958 Ga0157375_103829582 222
1125 3300013308 Ga0157375_10911217 Ga0157375_109112171 222
1126 3300014497 Ga0182008_10005030 Ga0182008_100050304 222
1127 3300014497 Ga0182008_10026256 Ga0182008_100262564 222
1128 3300014497 Ga0182008_10097056 Ga0182008_100970562 222
1129 3300015261 Ga0182006_1006448 Ga0182006_10064485 222
1130 3300015261 Ga0182006_1028676 Ga0182006_10286762 222
1131 3300015261 Ga0182006_1068441 Ga0182006_10684412 222
1132 3300015262 Ga0182007_10019671 Ga0182007_100196713 222
1133 3300015265 Ga0182005_1035003 Ga0182005_10350032 222
1134 3300017792 Ga0163161_10046855 Ga0163161_100468553 222
1135 3300017792 Ga0163161_10101646 Ga0163161_101016462 222
1136 3300017792 Ga0163161_10124933 Ga0163161_101249333 222
1137 3300017792 Ga0163161_10215667 Ga0163161_102156672 222
1138 3300017792 Ga0163161_10325029 Ga0163161_103250292 222
1139 3300025230 Ga0209563_100268 Ga0209563_10026811 222
1140 3300025263 Ga0209565_1001951 Ga0209565_10019516 222
1141 3300025284 Ga0209130_1032862 Ga0209130_10328622 222
1142 3300025291 Ga0209675_1000078 Ga0209675_100007893 222
1143 3300025291 Ga0209675_1003212 Ga0209675_10032124 222
1144 3300025292 Ga0209676_1000030 Ga0209676_1000030311 222
1145 3300025292 Ga0209676_1000041 Ga0209676_1000041136 222
1146 3300025292 Ga0209676_1000121 Ga0209676_100012191 222
1147 3300025292 Ga0209676_1026401 Ga0209676_10264012 222
1148 3300025294 Ga0209025_1000019 Ga0209025_100001940 222
1149 3300025294 Ga0209025_1000051 Ga0209025_100005197 222
1150 3300025294 Ga0209025_1003638 Ga0209025_100363810 222
1151 3300025294 Ga0209025_1034026 Ga0209025_10340262 222
1152 3300025295 Ga0209564_1000133 Ga0209564_100013386 222
1153 3300025298 Ga0209050_1000332 Ga0209050_10003325 222
1154 3300025298 Ga0209050_1001473 Ga0209050_100147321 222
1155 3300025298 Ga0209050_1011157 Ga0209050_10111573 222
1156 3300025299 Ga0209256_1000699 Ga0209256_100069912 222
1157 3300025303 Ga0209051_1001294 Ga0209051_100129419 222
1158 3300025303 Ga0209051_1007252 Ga0209051_10072523 222
1159 3300025711 Ga0207696_1003799 Ga0207696_10037995 222
1160 3300025728 Ga0207655_1005590 Ga0207655_10055906 222
1161 3300025728 Ga0207655_1012880 Ga0207655_10128802 222
1162 3300025728 Ga0207655_1015570 Ga0207655_10155704 222
1163 3300025735 Ga0207713_1000659 Ga0207713_100065923 222
1164 3300025735 Ga0207713_1006015 Ga0207713_10060155 222
1165 3300025929 Ga0207664_10665713 Ga0207664_106657132 222
1166 3300025935 Ga0207709_10203623 Ga0207709_102036232 222
1167 3300025937 Ga0207669_10759510 Ga0207669_107595101 222
1168 3300027111 Ga0209281_1000016 Ga0209281_1000016353 222
1169 3300027111 Ga0209281_1007590 Ga0209281_10075904 222
1170 3300027666 Ga0209282_1000058 Ga0209282_100005834 222
1171 3300027907 Ga0207428_10007071 Ga0207428_100070713 222
1172 3300027907 Ga0207428_10072024 Ga0207428_100720241 222
1173 3300027907 Ga0207428_10076055 Ga0207428_100760553 222
1174 3300027907 Ga0207428_10085395 Ga0207428_100853953 222
1175 3300027907 Ga0207428_10093304 Ga0207428_100933041 222
1176 3300028379 Ga0268266_10004944 Ga0268266_100049446 222
1177 3300028379 Ga0268266_10834620 Ga0268266_108346202 222
1178 3300028786 Ga0307517_10186905 Ga0307517_101869052 222
1179 3300030521 Ga0307511_10105971 Ga0307511_101059712 222
1180 3300030735 Ga0316178_1051183 Ga0316178_105118311 222
1181 3300031238 Ga0265332_10002934 Ga0265332_100029346 222
1182 3300031242 Ga0265329_10028102 Ga0265329_100281022 222
1183 3300031247 Ga0265340_10001308 Ga0265340_100013088 222
1184 3300031250 Ga0265331_10011421 Ga0265331_100114212 222
1185 3300031344 Ga0265316_10053295 Ga0265316_100532954 222
1186 3300031507 Ga0307509_10141275 Ga0307509_101412752 222
1187 3300031548 Ga0307408_100018437 Ga0307408_1000184373 222
1188 3300031548 Ga0307408_100030557 Ga0307408_1000305574 222
1189 3300031548 Ga0307408_100135174 Ga0307408_1001351741 222
1190 3300031711 Ga0265314_10038167 Ga0265314_100381673 222
1191 3300031712 Ga0265342_10002113 Ga0265342_100021137 222
1192 3300031731 Ga0307405_10118288 Ga0307405_101182882 222
1193 3300031824 Ga0307413_10467860 Ga0307413_104678602 222
1194 3300031901 Ga0307406_10031651 Ga0307406_100316512 222
1195 3300031911 Ga0307412_10000401 Ga0307412_1000040110 222
1196 3300031911 Ga0307412_10128873 Ga0307412_101288732 222
1197 3300031911 Ga0307412_10229525 Ga0307412_102295252 222
1198 3300031995 Ga0307409_100114929 Ga0307409_1001149292 222
1199 3300032002 Ga0307416_100313562 Ga0307416_1003135622 222
1200 3300032002 Ga0307416_101373701 Ga0307416_1013737011 222
1201 3300032004 Ga0307414_10018847 Ga0307414_100188474 222
1202 3300032004 Ga0307414_10351963 Ga0307414_103519631 222
1203 3300032005 Ga0307411_10021537 Ga0307411_100215374 222
1204 3300032005 Ga0307411_10069287 Ga0307411_100692872 222
1205 3300033180 Ga0307510_10081644 Ga0307510_100816442 222
1206 3300037312 Ga0395899_0003641 Ga0395899_0003641_9160_9828 222
1207 3300037418 Ga0395900_0054673 Ga0395900_0054673_1861_2529 222
1208 3300037471 Ga0395905_0001455 Ga0395905_0001455_10543_11211 222
1209 3300037471 Ga0395905_0131624 Ga0395905_0131624_1186_1854 222
1210 3300038443 Ga0395901_0707761 Ga0395901_0707761_261_929 222
1211 3300041405 Ga0439438_009379 Ga0439438_009379_1332_2000 222
1212 3300041405 Ga0439438_029762 Ga0439438_029762_348_1016 222
1213 3300041405 Ga0439438_056012 Ga0439438_056012_277_945 222
1214 3300041407 Ga0439447_003011 Ga0439447_003011_4425_5093 222
1215 3300041407 Ga0439447_005933 Ga0439447_005933_1621_2289 222
1216 3300041407 Ga0439447_008182 Ga0439447_008182_1974_2642 222
1217 3300041407 Ga0439447_041380 Ga0439447_041380_339_1007 222
1218 3300041407 Ga0439447_048871 Ga0439447_048871_95_763 222
1219 3300041411 Ga0439466_0005445 Ga0439466_0005445_2169_2837 222
1220 3300041411 Ga0439466_0007824 Ga0439466_0007824_1690_2358 222
1221 3300041411 Ga0439466_0011931 Ga0439466_0011931_473_1141 222
1222 3300041411 Ga0439466_0072787 Ga0439466_0072787_203_871 222
1223 3300042006 Ga0439432_032113 Ga0439432_032113_322_990 222
1224 3300042006 Ga0439432_059886 Ga0439432_059886_97_765 222
1225 3300042009 Ga0439451_008272 Ga0439451_008272_1383_2051 222
1226 3300042009 Ga0439451_051306 Ga0439451_051306_142_810 222
1227 3300042010 Ga0439452_002368 Ga0439452_002368_1535_2203 222
1228 3300042010 Ga0439452_008262 Ga0439452_008262_1893_2561 222
1229 3300042010 Ga0439452_048695 Ga0439452_048695_40_708 222
1230 3300042013 Ga0439456_004150 Ga0439456_004150_299_967 222
1231 3300042016 Ga0439463_001315 Ga0439463_001315_3622_4290 222
1232 3300042115 Ga0450911_007537 Ga0450911_007537_378_1046 222
1233 3300042122 Ga0450920_001631 Ga0450920_001631_1095_1763 222
1234 3300042138 Ga0450903_009052 Ga0450903_009052_546_1214 222
1235 3300042138 Ga0450903_015548 Ga0450903_015548_77_748 222
1236 3300042145 Ga0450906_004512 Ga0450906_004512_309_977 222
1237 3300042146 Ga0450907_001403 Ga0450907_001403_2030_2698 222
1238 3300042146 Ga0450907_001502 Ga0450907_001502_1943_2611 222
1239 3300042147 Ga0450910_001446 Ga0450910_001446_811_1479 222
1240 3300042184 Ga0450908_042764 Ga0450908_042764_53_721 222
1241 3300042461 Ga0439460_0027876 Ga0439460_0027876_297_965 222
1242 3300044656 Ga0466969_0002577 Ga0466969_0002577_5357_6025 222
1243 3300044658 Ga0466972_0029120 Ga0466972_0029120_756_1424 222
1244 3300044658 Ga0466972_0184092 Ga0466972_0184092_68_736 222
1245 3300044683 Ga0466965_0038432 Ga0466965_0038432_213_881 222
1246 3300044683 Ga0466965_0161174 Ga0466965_0161174_390_1058 222
1247 3300044684 Ga0466966_0052393 Ga0466966_0052393_1675_2343 222
1248 3300044693 Ga0466961_0017656 Ga0466961_0017656_3618_4286 222
1249 3300044706 Ga0466964_0214650 Ga0466964_0214650_157_825 222
1250 3300044735 Ga0466968_0007003 Ga0466968_0007003_1329_1997 222
1251 3300044901 Ga0466960_0325598 Ga0466960_0325598_192_860 222
1252 3300045049 Ga0466959_0365778 Ga0466959_0365778_59_727 222
1253 3300046452 Ga0495617_015578 Ga0495617_015578_112_780 222
1254 3300046453 Ga0495627_000083 Ga0495627_000083_424_1092 222
1255 3300046453 Ga0495627_003909 Ga0495627_003909_3853_4521 222
1256 3300046453 Ga0495627_041276 Ga0495627_041276_405_1073 222
1257 3300046457 Ga0495590_0012084 Ga0495590_0012084_1965_2633 222
1258 3300046457 Ga0495590_0025283 Ga0495590_0025283_628_1296 222
1259 3300046457 Ga0495590_0074436 Ga0495590_0074436_96_764 222
1260 3300046457 Ga0495590_0138886 Ga0495590_0138886_123_791 222
1261 3300046458 Ga0495591_000002 Ga0495591_000002_141992_142660 222
1262 3300046458 Ga0495591_003651 Ga0495591_003651_2494_3162 222
1263 3300046458 Ga0495591_022913 Ga0495591_022913_1218_1886 222
1264 3300046458 Ga0495591_044438 Ga0495591_044438_275_943 222
1265 3300046458 Ga0495591_073907 Ga0495591_073907_199_867 222
1266 3300046460 Ga0495638_0031008 Ga0495638_0031008_803_1471 222
1267 3300046460 Ga0495638_0103993 Ga0495638_0103993_329_997 222
1268 3300046460 Ga0495638_0192496 Ga0495638_0192496_418_1086 222
1269 3300046460 Ga0495638_0238693 Ga0495638_0238693_118_786 222
1270 3300046463 Ga0495653_0013706 Ga0495653_0013706_2386_3054 222
1271 3300046463 Ga0495653_0107228 Ga0495653_0107228_940_1608 222
1272 3300046463 Ga0495653_0409177 Ga0495653_0409177_91_759 222
1273 3300046471 Ga0495650_0073259 Ga0495650_0073259_255_923 222
1274 3300046474 Ga0495605_0001304 Ga0495605_0001304_15504_16172 222
1275 3300046474 Ga0495605_0003104 Ga0495605_0003104_5379_6047 222
1276 3300046474 Ga0495605_0007095 Ga0495605_0007095_1931_2599 222
1277 3300046474 Ga0495605_0024062 Ga0495605_0024062_559_1227 222
1278 3300046474 Ga0495605_0041933 Ga0495605_0041933_414_1082 222
1279 3300046474 Ga0495605_0062160 Ga0495605_0062160_819_1487 222
1280 3300046491 Ga0495584_0007556 Ga0495584_0007556_588_1256 222
1281 3300046491 Ga0495584_0008229 Ga0495584_0008229_1940_2608 222
1282 3300046491 Ga0495584_0017198 Ga0495584_0017198_2007_2675 222
1283 3300046491 Ga0495584_0022541 Ga0495584_0022541_1925_2593 222
1284 3300046491 Ga0495584_0073146 Ga0495584_0073146_618_1286 222
1285 3300046491 Ga0495584_0106135 Ga0495584_0106135_297_965 222
1286 3300046491 Ga0495584_0124228 Ga0495584_0124228_242_910 222
1287 3300046491 Ga0495584_0166746 Ga0495584_0166746_414_1082 222
1288 3300046492 Ga0495585_0025718 Ga0495585_0025718_2137_2805 222
1289 3300046492 Ga0495585_0058636 Ga0495585_0058636_1010_1678 222
1290 3300046492 Ga0495585_0116298 Ga0495585_0116298_77_745 222
1291 3300046500 Ga0495596_0000060 Ga0495596_0000060_17866_18534 222
1292 3300046500 Ga0495596_0008186 Ga0495596_0008186_1501_2169 222
1293 3300046501 Ga0495607_0000025 Ga0495607_0000025_158011_158679 222
1294 3300046501 Ga0495607_0004307 Ga0495607_0004307_1939_2607 222
1295 3300046501 Ga0495607_0027473 Ga0495607_0027473_1963_2631 222
1296 3300046501 Ga0495607_0032656 Ga0495607_0032656_570_1238 222
1297 3300046501 Ga0495607_0124743 Ga0495607_0124743_546_1214 222
1298 3300046507 Ga0495606_0013494 Ga0495606_0013494_2493_3161 222
1299 3300046507 Ga0495606_0014237 Ga0495606_0014237_3589_4257 222
1300 3300046507 Ga0495606_0035068 Ga0495606_0035068_850_1518 222
1301 3300046507 Ga0495606_0067153 Ga0495606_0067153_1004_1672 222
1302 3300046507 Ga0495606_0154542 Ga0495606_0154542_63_731 222
1303 3300046507 Ga0495606_0345354 Ga0495606_0345354_21_689 222
1304 3300046512 Ga0495610_0000793 Ga0495610_0000793_22359_23027 222
1305 3300046512 Ga0495610_0011986 Ga0495610_0011986_2768_3436 222
1306 3300046512 Ga0495610_0019717 Ga0495610_0019717_2405_3073 222
1307 3300046512 Ga0495610_0063291 Ga0495610_0063291_528_1196 222
1308 3300046512 Ga0495610_0065205 Ga0495610_0065205_526_1194 222
1309 3300046512 Ga0495610_0085897 Ga0495610_0085897_347_1015 222
1310 3300046512 Ga0495610_0115229 Ga0495610_0115229_132_800 222
1311 3300046512 Ga0495610_0115843 Ga0495610_0115843_341_1009 222
1312 3300046513 Ga0495616_0011878 Ga0495616_0011878_2268_2936 222
1313 3300046513 Ga0495616_0015111 Ga0495616_0015111_2406_3074 222
1314 3300046513 Ga0495616_0026041 Ga0495616_0026041_485_1153 222
1315 3300046513 Ga0495616_0058116 Ga0495616_0058116_669_1337 222
1316 3300046513 Ga0495616_0082227 Ga0495616_0082227_669_1337 222
1317 3300046515 Ga0495620_0010688 Ga0495620_0010688_1977_2645 222
1318 3300046515 Ga0495620_0027695 Ga0495620_0027695_44_712 222
1319 3300046518 Ga0495631_0084394 Ga0495631_0084394_614_1282 222
1320 3300046519 Ga0495632_0017927 Ga0495632_0017927_663_1331 222
1321 3300046519 Ga0495632_0020548 Ga0495632_0020548_393_1061 222
1322 3300046519 Ga0495632_0023533 Ga0495632_0023533_337_1005 222
1323 3300046519 Ga0495632_0025244 Ga0495632_0025244_612_1280 222
1324 3300046519 Ga0495632_0102171 Ga0495632_0102171_185_856 222
1325 3300046519 Ga0495632_0109272 Ga0495632_0109272_392_1060 222
1326 3300046520 Ga0495637_0000948 Ga0495637_0000948_2410_3078 222
1327 3300046520 Ga0495637_0007787 Ga0495637_0007787_2499_3167 222
1328 3300046520 Ga0495637_0010322 Ga0495637_0010322_139_807 222
1329 3300046520 Ga0495637_0020136 Ga0495637_0020136_1965_2633 222
1330 3300046520 Ga0495637_0033696 Ga0495637_0033696_1448_2116 222
1331 3300046520 Ga0495637_0035009 Ga0495637_0035009_1132_1800 222
1332 3300046520 Ga0495637_0046098 Ga0495637_0046098_642_1310 222
1333 3300046520 Ga0495637_0056721 Ga0495637_0056721_441_1109 222
1334 3300046520 Ga0495637_0062852 Ga0495637_0062852_603_1271 222
1335 3300046520 Ga0495637_0129753 Ga0495637_0129753_272_940 222
1336 3300046522 Ga0495643_0024262 Ga0495643_0024262_2724_3392 222
1337 3300046522 Ga0495643_0032085 Ga0495643_0032085_1576_2244 222
1338 3300046522 Ga0495643_0092113 Ga0495643_0092113_444_1112 222
1339 3300046522 Ga0495643_0142913 Ga0495643_0142913_390_1058 222
1340 3300046522 Ga0495643_0163289 Ga0495643_0163289_407_1075 222
1341 3300046523 Ga0495644_0010436 Ga0495644_0010436_412_1080 222
1342 3300046523 Ga0495644_0015458 Ga0495644_0015458_292_960 222
1343 3300046523 Ga0495644_0018365 Ga0495644_0018365_1606_2274 222
1344 3300046524 Ga0495648_0031268 Ga0495648_0031268_481_1149 222
1345 3300046524 Ga0495648_0039184 Ga0495648_0039184_1501_2169 222
1346 3300046524 Ga0495648_0040940 Ga0495648_0040940_614_1282 222
1347 3300046524 Ga0495648_0042386 Ga0495648_0042386_1635_2303 222
1348 3300046524 Ga0495648_0094394 Ga0495648_0094394_328_996 222
1349 3300046524 Ga0495648_0103956 Ga0495648_0103956_568_1236 222
1350 3300046524 Ga0495648_0167299 Ga0495648_0167299_383_1051 222
1351 3300046524 Ga0495648_0187893 Ga0495648_0187893_349_1017 222
1352 3300046526 Ga0495666_0067328 Ga0495666_0067328_169_837 222
1353 3300046528 Ga0495642_0003183 Ga0495642_0003183_3873_4541 222
1354 3300046528 Ga0495642_0003695 Ga0495642_0003695_450_1118 222
1355 3300046530 Ga0495654_0011590 Ga0495654_0011590_4022_4690 222
1356 3300046530 Ga0495654_0014627 Ga0495654_0014627_1128_1796 222
1357 3300046530 Ga0495654_0031638 Ga0495654_0031638_1816_2484 222
1358 3300046530 Ga0495654_0056740 Ga0495654_0056740_248_916 222
1359 3300046530 Ga0495654_0080553 Ga0495654_0080553_236_904 222
1360 3300046530 Ga0495654_0081388 Ga0495654_0081388_491_1159 222
1361 3300046530 Ga0495654_0143185 Ga0495654_0143185_72_740 222
1362 3300046536 Ga0495587_0014770 Ga0495587_0014770_1877_2545 222
1363 3300046538 Ga0495609_0007369 Ga0495609_0007369_2229_2897 222
1364 3300046538 Ga0495609_0087541 Ga0495609_0087541_488_1156 222
1365 3300046542 Ga0495597_0000011 Ga0495597_0000011_220082_220750 222
1366 3300046542 Ga0495597_0016172 Ga0495597_0016172_1469_2137 222
1367 3300046542 Ga0495597_0021177 Ga0495597_0021177_391_1059 222
1368 3300046542 Ga0495597_0028158 Ga0495597_0028158_69_737 222
1369 3300046542 Ga0495597_0090729 Ga0495597_0090729_519_1187 222
1370 3300046542 Ga0495597_0120057 Ga0495597_0120057_254_922 222
1371 3300046542 Ga0495597_0135545 Ga0495597_0135545_135_803 222
1372 3300046542 Ga0495597_0151658 Ga0495597_0151658_81_752 222
1373 3300046557 Ga0495622_0101775 Ga0495622_0101775_612_1280 222
1374 3300046558 Ga0495633_0014506 Ga0495633_0014506_1141_1809 222
1375 3300046616 Ga0495668_0006815 Ga0495668_0006815_4249_4917 222
1376 3300046616 Ga0495668_0026872 Ga0495668_0026872_629_1297 222
1377 3300046642 Ga0495634_0016357 Ga0495634_0016357_4562_5230 222
1378 3300046648 Ga0495611_0004094 Ga0495611_0004094_3770_4438 222
1379 3300046660 Ga0495625_0012656 Ga0495625_0012656_414_1082 222
1380 3300046660 Ga0495625_0038915 Ga0495625_0038915_858_1526 222
1381 3300046660 Ga0495625_0045837 Ga0495625_0045837_1865_2533 222
1382 3300046660 Ga0495625_0209300 Ga0495625_0209300_410_1078 222
1383 3300046663 Ga0495635_0041374 Ga0495635_0041374_128_796 222
1384 3300046664 Ga0495659_0077951 Ga0495659_0077951_11_679 222
1385 3300046665 Ga0495661_0002367 Ga0495661_0002367_2857_3525 222
1386 3300046665 Ga0495661_0048174 Ga0495661_0048174_530_1198 222
1387 3300046665 Ga0495661_0097426 Ga0495661_0097426_429_1097 222
1388 3300046665 Ga0495661_0162307 Ga0495661_0162307_137_805 222
1389 3300046679 Ga0495623_0039096 Ga0495623_0039096_1994_2662 222
1390 3300046684 Ga0495669_0008374 Ga0495669_0008374_3078_3746 222
1391 3300046689 Ga0495613_0122405 Ga0495613_0122405_651_1319 222
1392 3300046690 Ga0495624_0011454 Ga0495624_0011454_1894_2562 222
1393 3300046691 Ga0495670_0025848 Ga0495670_0025848_30_698 222
1394 3300046691 Ga0495670_0038481 Ga0495670_0038481_459_1127 222
1395 3300046691 Ga0495670_0056069 Ga0495670_0056069_378_1046 222
1396 3300046691 Ga0495670_0078241 Ga0495670_0078241_10_678 222
1397 3300046691 Ga0495670_0244214 Ga0495670_0244214_255_923 222
1398 3300046692 Ga0495671_0000662 Ga0495671_0000662_1966_2634 222
1399 3300046692 Ga0495671_0004125 Ga0495671_0004125_5688_6356 222
1400 3300046692 Ga0495671_0054514 Ga0495671_0054514_664_1332 222
1401 3300046692 Ga0495671_0060744 Ga0495671_0060744_413_1081 222
1402 3300046692 Ga0495671_0078233 Ga0495671_0078233_176_844 222
1403 3300046692 Ga0495671_0086076 Ga0495671_0086076_47_715 222
1404 3300046692 Ga0495671_0125138 Ga0495671_0125138_490_1158 222
1405 3300046692 Ga0495671_0144353 Ga0495671_0144353_112_780 222
1406 3300046694 Ga0495649_0013292 Ga0495649_0013292_3200_3868 222
1407 3300046694 Ga0495649_0023844 Ga0495649_0023844_1894_2562 222
1408 3300046694 Ga0495649_0030657 Ga0495649_0030657_376_1044 222
1409 3300046694 Ga0495649_0072808 Ga0495649_0072808_249_917 222
1410 3300046694 Ga0495649_0080867 Ga0495649_0080867_386_1054 222
1411 3300046694 Ga0495649_0096429 Ga0495649_0096429_622_1290 222
1412 3300046794 Ga0495589_0003318 Ga0495589_0003318_2499_3167 222
1413 3300046794 Ga0495589_0022326 Ga0495589_0022326_1961_2629 222
1414 3300046809 Ga0495600_0179248 Ga0495600_0179248_591_1259 222
1415 3300046809 Ga0495600_0204923 Ga0495600_0204923_97_765 222
1416 3300046810 Ga0495660_0003415 Ga0495660_0003415_7684_8352 222
1417 3300046810 Ga0495660_0026559 Ga0495660_0026559_938_1606 222
1418 3300046810 Ga0495660_0028351 Ga0495660_0028351_612_1280 222
1419 3300046810 Ga0495660_0028386 Ga0495660_0028386_1965_2633 222
1420 3300046810 Ga0495660_0038247 Ga0495660_0038247_35_703 222
1421 3300046810 Ga0495660_0065478 Ga0495660_0065478_336_1004 222
1422 3300046810 Ga0495660_0089028 Ga0495660_0089028_573_1241 222
1423 3300046810 Ga0495660_0160907 Ga0495660_0160907_281_949 222
1424 3300046810 Ga0495660_0210676 Ga0495660_0210676_40_708 222
1425 3300047317 Ga0495604_0182182 Ga0495604_0182182_315_983 222
1426 3300047317 Ga0495604_0218715 Ga0495604_0218715_429_1097 222
1427 3300047319 Ga0495674_0093556 Ga0495674_0093556_357_1025 222
1428 3300047320 Ga0495672_0007817 Ga0495672_0007817_1705_2373 222
1429 3300047320 Ga0495672_0008177 Ga0495672_0008177_2035_2703 222
1430 3300047320 Ga0495672_0010931 Ga0495672_0010931_1519_2187 222
1431 3300047320 Ga0495672_0018955 Ga0495672_0018955_2387_3055 222
1432 3300047320 Ga0495672_0025697 Ga0495672_0025697_1086_1754 222
1433 3300047320 Ga0495672_0036278 Ga0495672_0036278_395_1063 222
1434 3300047320 Ga0495672_0037415 Ga0495672_0037415_482_1150 222
1435 3300047320 Ga0495672_0040141 Ga0495672_0040141_654_1322 222
1436 3300047320 Ga0495672_0100895 Ga0495672_0100895_535_1203 222
1437 3300047320 Ga0495672_0108685 Ga0495672_0108685_246_914 222
1438 3300047320 Ga0495672_0165702 Ga0495672_0165702_283_951 222
1439 3300047321 Ga0495676_0173689 Ga0495676_0173689_583_1251 222
1440 3300047322 Ga0495680_0055612 Ga0495680_0055612_486_1154 222
1441 3300047322 Ga0495680_0342418 Ga0495680_0342418_259_927 222
1442 3300047323 Ga0495683_0017499 Ga0495683_0017499_677_1345 222
1443 3300047323 Ga0495683_0022075 Ga0495683_0022075_1976_2644 222
1444 3300047323 Ga0495683_0057785 Ga0495683_0057785_319_987 222
1445 3300047443 Ga0495687_006777 Ga0495687_006777_2364_3032 222
1446 3300047444 Ga0495675_0039511 Ga0495675_0039511_1431_2099 222
1447 3300047445 Ga0495677_0019091 Ga0495677_0019091_30_698 222
1448 3300047445 Ga0495677_0093214 Ga0495677_0093214_231_899 222
1449 3300047446 Ga0495679_054703 Ga0495679_054703_97_765 222
1450 3300047469 Ga0495673_0015551 Ga0495673_0015551_2351_3019 222
1451 3300047469 Ga0495673_0029397 Ga0495673_0029397_427_1095 222
1452 3300047469 Ga0495673_0035779 Ga0495673_0035779_96_764 222
1453 3300047469 Ga0495673_0040254 Ga0495673_0040254_1166_1834 222
1454 3300047469 Ga0495673_0049794 Ga0495673_0049794_814_1482 222
1455 3300047469 Ga0495673_0050604 Ga0495673_0050604_341_1009 222
1456 3300047469 Ga0495673_0076174 Ga0495673_0076174_318_986 222
1457 3300047470 Ga0495681_0008476 Ga0495681_0008476_1855_2523 222
1458 3300047470 Ga0495681_0019090 Ga0495681_0019090_1122_1790 222
1459 3300047470 Ga0495681_0021856 Ga0495681_0021856_611_1279 222
1460 3300047470 Ga0495681_0022771 Ga0495681_0022771_700_1368 222
1461 3300047470 Ga0495681_0027271 Ga0495681_0027271_1954_2622 222
1462 3300047470 Ga0495681_0031133 Ga0495681_0031133_565_1233 222
1463 3300047470 Ga0495681_0041865 Ga0495681_0041865_1413_2081 222
1464 3300047470 Ga0495681_0059234 Ga0495681_0059234_1059_1727 222
1465 3300047470 Ga0495681_0071169 Ga0495681_0071169_271_939 222
1466 3300047470 Ga0495681_0110542 Ga0495681_0110542_77_745 222
1467 3300047470 Ga0495681_0151488 Ga0495681_0151488_226_897 222
1468 3300047471 Ga0495684_0095672 Ga0495684_0095672_336_1004 222
1469 3300047472 Ga0495686_0104090 Ga0495686_0104090_405_1073 222
1470 3300047472 Ga0495686_0113864 Ga0495686_0113864_558_1226 222
1471 3300047673 Ga0495593_0127608 Ga0495593_0127608_162_830 222
1472 3300047673 Ga0495593_0135498 Ga0495593_0135498_552_1220 222
1473 3300048088 Ga0495602_0376219 Ga0495602_0376219_322_990 222
1474 3300048091 Ga0495626_0006473 Ga0495626_0006473_3589_4257 222
1475 3300048091 Ga0495626_0007135 Ga0495626_0007135_2494_3162 222
1476 3300048091 Ga0495626_0076772 Ga0495626_0076772_622_1290 222
1477 3300048905 Ga0496102_0004242 Ga0496102_0004242_2391_3059 222
1478 3300048919 Ga0496116_0001954 Ga0496116_0001954_3600_4268 222
1479 3300048919 Ga0496116_0020749 Ga0496116_0020749_3590_4258 222
1480 3300048919 Ga0496116_0022501 Ga0496116_0022501_2201_2869 222
1481 3300048919 Ga0496116_0065419 Ga0496116_0065419_1086_1754 222
1482 3300048919 Ga0496116_0135888 Ga0496116_0135888_398_1066 222
1483 3300048920 Ga0496117_0012455 Ga0496117_0012455_601_1269 222
1484 3300048920 Ga0496117_0124601 Ga0496117_0124601_411_1079 222
1485 3300048920 Ga0496117_0147306 Ga0496117_0147306_68_736 222
1486 3300048920 Ga0496117_0159215 Ga0496117_0159215_339_1007 222
1487 3300048921 Ga0496118_0014455 Ga0496118_0014455_3817_4485 222
1488 3300048921 Ga0496118_0141186 Ga0496118_0141186_442_1110 222
1489 3300048922 Ga0496119_0052709 Ga0496119_0052709_1563_2231 222
1490 3300048923 Ga0496120_0015311 Ga0496120_0015311_2614_3282 222
1491 3300048924 Ga0496121_0001365 Ga0496121_0001365_6701_7369 222
1492 3300048924 Ga0496121_0017647 Ga0496121_0017647_4411_5079 222
1493 3300048924 Ga0496121_0043798 Ga0496121_0043798_258_926 222
1494 3300048924 Ga0496121_0484260 Ga0496121_0484260_87_755 222
1495 3300048925 Ga0496122_0000669 Ga0496122_0000669_42631_43299 222
1496 3300048925 Ga0496122_0003626 Ga0496122_0003626_4854_5522 222
1497 3300048925 Ga0496122_0071453 Ga0496122_0071453_1455_2123 222
1498 3300048925 Ga0496122_0127065 Ga0496122_0127065_267_935 222
1499 3300048926 Ga0496123_0000977 Ga0496123_0000977_1984_2652 222
1500 3300048926 Ga0496123_0001569 Ga0496123_0001569_22356_23024 222
1501 3300048926 Ga0496123_0067508 Ga0496123_0067508_1156_1824 222
1502 3300048926 Ga0496123_0090133 Ga0496123_0090133_299_967 222
1503 3300048927 Ga0496124_0050107 Ga0496124_0050107_882_1550 222
1504 3300048927 Ga0496124_0087475 Ga0496124_0087475_286_954 222
1505 3300048928 Ga0496125_0000168 Ga0496125_0000168_132117_132785 222
1506 3300048928 Ga0496125_0026564 Ga0496125_0026564_2530_3198 222
1507 3300048928 Ga0496125_0046824 Ga0496125_0046824_1189_1857 222
1508 3300048928 Ga0496125_0057758 Ga0496125_0057758_603_1271 222
1509 3300048928 Ga0496125_0062306 Ga0496125_0062306_257_925 222
1510 3300048929 Ga0496126_0024217 Ga0496126_0024217_1897_2565 222
1511 3300048929 Ga0496126_0086476 Ga0496126_0086476_1562_2230 222
1512 3300048929 Ga0496126_0150981 Ga0496126_0150981_1147_1815 222
1513 3300048929 Ga0496126_0226004 Ga0496126_0226004_217_885 222
1514 3300049459 Ga0495678_013793 Ga0495678_013793_631_1299 222
1515 3300049459 Ga0495678_018970 Ga0495678_018970_418_1086 222
1516 3300049459 Ga0495678_025529 Ga0495678_025529_208_876 222
1517 3300049459 Ga0495678_026414 Ga0495678_026414_1256_1924 222
1518 3300049459 Ga0495678_053864 Ga0495678_053864_435_1103 222
1519 3300049459 Ga0495678_060446 Ga0495678_060446_321_989 222
1520 3300049459 Ga0495678_102818 Ga0495678_102818_258_926 222
1521 3300049460 Ga0495682_0028204 Ga0495682_0028204_1143_1811 222
1522 3300049460 Ga0495682_0040104 Ga0495682_0040104_101_769 222
1523 3300049460 Ga0495682_0087915 Ga0495682_0087915_134_802 222
1524 3300050491 nmdc:mga00v17_188609_c1 nmdc:mga00v17_188609_c1_266_934 222
1525 3300050491 nmdc:mga00v17_50346_c1 nmdc:mga00v17_50346_c1_1294_1962 222
1526 3300050514 nmdc:mga08x19_251483_c1 nmdc:mga08x19_251483_c1_211_879 222
1527 3300050514 nmdc:mga08x19_355381_c1 nmdc:mga08x19_355381_c1_139_807 222
1528 2124908027 MRS2a_Contig_718 MRS2a_00573810 223
1529 3300002737 JGI25162J39368_1000001 JGI25162J39368_1000001446 223
1530 3300003214 JGI25165J46597_1000001 JGI25165J46597_1000001437 223
1531 3300003751 Ga0055538_1000001 Ga0055538_1000001596 223
1532 3300003752 Ga0055539_1000001 Ga0055539_1000001596 223
1533 3300003756 Ga0055533_1000003 Ga0055533_1000003437 223
1534 3300003759 Ga0055525_1000003 Ga0055525_1000003437 223
1535 3300003791 Ga0055530_10003143 Ga0055530_100031436 223
1536 3300003792 Ga0055540_1003950 Ga0055540_10039504 223
1537 3300003794 Ga0055531_10000404 Ga0055531_1000040428 223
1538 3300003841 Ga0055541_1000001 Ga0055541_1000001437 223
1539 3300005288 Ga0065714_10065087 Ga0065714_100650874 223
1540 3300005289 Ga0065704_10024159 Ga0065704_100241592 223
1541 3300005289 Ga0065704_10073325 Ga0065704_100733254 223
1542 3300005293 Ga0065715_10117248 Ga0065715_101172482 223
1543 3300006173 Ga0070716_100037343 Ga0070716_1000373433 223
1544 3300006195 Ga0075366_10024685 Ga0075366_100246853 223
1545 3300009011 Ga0105251_10162951 Ga0105251_101629512 223
1546 3300009036 Ga0105244_10076791 Ga0105244_100767912 223
1547 3300009092 Ga0105250_10030034 Ga0105250_100300343 223
1548 3300009092 Ga0105250_10101348 Ga0105250_101013481 223
1549 3300013100 Ga0157373_10011402 Ga0157373_100114023 223
1550 3300013104 Ga0157370_10141128 Ga0157370_101411282 223
1551 3300015261 Ga0182006_1014777 Ga0182006_10147773 223
1552 3300015261 Ga0182006_1020055 Ga0182006_10200553 223
1553 3300015261 Ga0182006_1020526 Ga0182006_10205263 223
1554 3300015262 Ga0182007_10001352 Ga0182007_100013523 223
1555 3300015262 Ga0182007_10017947 Ga0182007_100179473 223
1556 3300015265 Ga0182005_1000183 Ga0182005_100018335 223
1557 3300017792 Ga0163161_10239651 Ga0163161_102396511 223
1558 3300025207 Ga0209760_101344 Ga0209760_1013442 223
1559 3300025224 Ga0209784_100004 Ga0209784_100004436 223
1560 3300025225 Ga0209566_100004 Ga0209566_100004593 223
1561 3300025226 Ga0209674_100006 Ga0209674_100006593 223
1562 3300025230 Ga0209563_100009 Ga0209563_100009436 223
1563 3300025231 Ga0207427_100149 Ga0207427_10014958 223
1564 3300025233 Ga0209437_100004 Ga0209437_100004436 223
1565 3300025253 Ga0209677_100005 Ga0209677_100005436 223
1566 3300025261 Ga0209233_1000005 Ga0209233_1000005593 223
1567 3300025292 Ga0209676_1000015 Ga0209676_1000015373 223
1568 3300025298 Ga0209050_1000030 Ga0209050_100003065 223
1569 3300025303 Ga0209051_1000012 Ga0209051_1000012306 223
1570 3300025304 Ga0209257_1000262 Ga0209257_1000262121 223
1571 3300025711 Ga0207696_1005266 Ga0207696_10052665 223
1572 3300025728 Ga0207655_1012751 Ga0207655_10127515 223
1573 3300025735 Ga0207713_1011258 Ga0207713_10112585 223
1574 3300025939 Ga0207665_10052433 Ga0207665_100524332 223
1575 3300031730 Ga0307516_10329423 Ga0307516_103294231 223
1576 3300041405 Ga0439438_003027 Ga0439438_003027_5894_6565 223
1577 3300041407 Ga0439447_002518 Ga0439447_002518_1197_1868 223
1578 3300041411 Ga0439466_0002406 Ga0439466_0002406_4168_4839 223
1579 3300042006 Ga0439432_001999 Ga0439432_001999_5200_5871 223
1580 3300042009 Ga0439451_004400 Ga0439451_004400_353_1024 223
1581 3300042010 Ga0439452_002759 Ga0439452_002759_5604_6275 223
1582 3300042013 Ga0439456_001671 Ga0439456_001671_377_1048 223
1583 3300042016 Ga0439463_003054 Ga0439463_003054_2439_3110 223
1584 3300042115 Ga0450911_001308 Ga0450911_001308_4783_5454 223
1585 3300042121 Ga0450919_003601 Ga0450919_003601_786_1457 223
1586 3300042127 Ga0450890_003335 Ga0450890_003335_1025_1696 223
1587 3300042137 Ga0450902_016447 Ga0450902_016447_237_908 223
1588 3300042138 Ga0450903_001035 Ga0450903_001035_4203_4874 223
1589 3300042145 Ga0450906_001441 Ga0450906_001441_4435_5106 223
1590 3300042146 Ga0450907_001564 Ga0450907_001564_410_1081 223
1591 3300042156 Ga0439446_0017528 Ga0439446_0017528_379_1050 223
1592 3300042184 Ga0450908_011990 Ga0450908_011990_161_832 223
1593 3300042185 Ga0450909_002330 Ga0450909_002330_1949_2620 223
1594 3300042461 Ga0439460_0000913 Ga0439460_0000913_3591_4262 223
1595 3300042531 Ga0450918_004059 Ga0450918_004059_1888_2559 223
1596 3300042993 Ga0439440_0011461 Ga0439440_0011461_354_1025 223
1597 3300046454 Ga0495592_0064774 Ga0495592_0064774_1196_1876 223
1598 3300046455 Ga0495603_0004335 Ga0495603_0004335_5454_6125 223
1599 3300046458 Ga0495591_004074 Ga0495591_004074_617_1291 223
1600 3300046458 Ga0495591_013527 Ga0495591_013527_215_889 223
1601 3300046462 Ga0495651_0017632 Ga0495651_0017632_2151_2831 223
1602 3300046462 Ga0495651_0126203 Ga0495651_0126203_956_1636 223
1603 3300046463 Ga0495653_0019246 Ga0495653_0019246_2491_3171 223
1604 3300046474 Ga0495605_0131142 Ga0495605_0131142_394_1068 223
1605 3300046501 Ga0495607_0047097 Ga0495607_0047097_1664_2335 223
1606 3300046506 Ga0495583_0002655 Ga0495583_0002655_11724_12395 223
1607 3300046507 Ga0495606_0157725 Ga0495606_0157725_418_1092 223
1608 3300046511 Ga0495608_0008033 Ga0495608_0008033_403_1083 223
1609 3300046512 Ga0495610_0036476 Ga0495610_0036476_623_1297 223
1610 3300046513 Ga0495616_0025697 Ga0495616_0025697_1859_2533 223
1611 3300046514 Ga0495618_0014135 Ga0495618_0014135_546_1226 223
1612 3300046516 Ga0495628_0000076 Ga0495628_0000076_68760_69440 223
1613 3300046516 Ga0495628_0011291 Ga0495628_0011291_1865_2545 223
1614 3300046516 Ga0495628_0145649 Ga0495628_0145649_766_1446 223
1615 3300046524 Ga0495648_0131601 Ga0495648_0131601_611_1285 223
1616 3300046529 Ga0495652_0024033 Ga0495652_0024033_4019_4699 223
1617 3300046529 Ga0495652_0048460 Ga0495652_0048460_1272_1952 223
1618 3300046529 Ga0495652_0083701 Ga0495652_0083701_1661_2341 223
1619 3300046530 Ga0495654_0017413 Ga0495654_0017413_2493_3167 223
1620 3300046538 Ga0495609_0028323 Ga0495609_0028323_201_872 223
1621 3300046543 Ga0495645_0055410 Ga0495645_0055410_2053_2733 223
1622 3300046557 Ga0495622_0020286 Ga0495622_0020286_2379_3050 223
1623 3300046557 Ga0495622_0084911 Ga0495622_0084911_120_800 223
1624 3300046642 Ga0495634_0052805 Ga0495634_0052805_546_1226 223
1625 3300046660 Ga0495625_0230565 Ga0495625_0230565_508_1182 223
1626 3300046674 Ga0495588_0274324 Ga0495588_0274324_173_844 223
1627 3300046678 Ga0495599_0034503 Ga0495599_0034503_658_1338 223
1628 3300046679 Ga0495623_0006955 Ga0495623_0006955_5878_6558 223
1629 3300046680 Ga0495646_0003698 Ga0495646_0003698_5025_5705 223
1630 3300046690 Ga0495624_0020811 Ga0495624_0020811_2282_2962 223
1631 3300046690 Ga0495624_0030721 Ga0495624_0030721_866_1546 223
1632 3300046691 Ga0495670_0024067 Ga0495670_0024067_2042_2728 223
1633 3300046692 Ga0495671_0023909 Ga0495671_0023909_1662_2333 223
1634 3300046694 Ga0495649_0104176 Ga0495649_0104176_629_1303 223
1635 3300046809 Ga0495600_0003938 Ga0495600_0003938_4032_4712 223
1636 3300046810 Ga0495660_0050839 Ga0495660_0050839_1434_2108 223
1637 3300047317 Ga0495604_0050468 Ga0495604_0050468_1352_2032 223
1638 3300047469 Ga0495673_0016029 Ga0495673_0016029_663_1337 223
1639 3300048088 Ga0495602_0009002 Ga0495602_0009002_2811_3491 223
1640 3300048091 Ga0495626_0022425 Ga0495626_0022425_1844_2518 223
1641 3300048091 Ga0495626_0070204 Ga0495626_0070204_201_872 223
1642 3300048928 Ga0496125_0211080 Ga0496125_0211080_263_934 223
1643 3300050493 nmdc:mga0k408_184357_c1 nmdc:mga0k408_184357_c1_514_1185 223
1644 3300053077 Ga0495601_0019812 Ga0495601_0019812_2543_3223 223
1645 3300053119 Ga0500595_001205 Ga0500595_001205_9191_9871 223
1646 3300053154 Ga0500619_003230 Ga0500619_003230_783_1463 223

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

56

235

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8402 4 216
4ymu-assembly1.cif.gz_C crystal structure of an amino acid abc transporter complex with arginines and atps 0.8332 4 216
3dhw-assembly1.cif.gz_B crystal structure of methionine importer metni 0.7206 16 206
3tui-assembly2.cif.gz_E inward facing conformations of the metni methionine abc transporter: cy5 native crystal form 0.7106 14 215
7ahh-assembly1.cif.gz_A opua inhibited inward-facing, sbd docked 0.6899 20 214
ID Description Score Start End Superfamily
af_P52094_1_222_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8469 15 215 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8428 4 215 1.10.3720.10
af_P0AE34_6_232_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8308 17 215 1.10.3720.10
4ymsD00 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8288 4 215 1.10.3720.10
af_P45767_178_390_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.8198 85 215 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A430DZQ7-F1-model_v4 ABC transporter permease subunit 0.8848 1 218 GO:0006865
GO:0022857
GO:0043190
AF-A0A3S4MXR4-F1-model_v4 AcnD 0.8834 1 215 GO:0016829
GO:0022857
GO:0043190
AF-A0A1Y0L479-F1-model_v4 ABC transporter 0.8833 1 218 GO:0006865
GO:0022857
GO:0043190
AF-A0A502SB01-F1-model_v4 Amino acid ABC transporter permease 0.8832 1 217 GO:0006865
GO:0022857
GO:0043190
AF-A0A7Z2NYA0-F1-model_v4 ABC transporter permease subunit 0.8822 1 218 GO:0006865
GO:0022857
GO:0043190

Feature Viewer

pLDDT pTM Quality
84.04 0.79 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map