F495123
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1629 | 763 | 1266 | 176 |
Family's Representative Sequence
| Representative Sequence | 3300047323|Ga0495683_0000299|Ga0495683_0000299_968_1573 |
| Length | 201 |
| Sequence | MLLFIEKQSSTPLLQRIMNFRSLDPMAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHMGIEEVLGADAYAEILYKAGYKSAWHWCEKEAECHGIEGVAVFEHYMKRLSQRGWGLFKIQDIDLDKGTCSVKLEHSCFVYVYGKVGRKVDYMFTGWFAGAMDQILAAKGSSVRTVAEQVYGGSEEGHEDGLFTVKPL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2124908027 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 | Metagenome | Rhizosphere |
| 2 | 2501025501 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 3 | 2501025504 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 4 | 2508501125 | Burkholderia sp. WSM2232 | Isolate | Nodule |
| 5 | 2510065045 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 6 | 2510065053 | Pseudomonas sp. MOIL14HWK12:I1 | Isolate | Rhizosphere |
| 7 | 2510065055 | Pseudomonas sp. MOIL14HWK12:I2 | Isolate | Rhizosphere |
| 8 | 2510065058 | Pseudomonas oleovorans MOIL14HWK12 | Isolate | Rhizosphere |
| 9 | 2510917014 | Paraburkholderia silvatlantica SRMrh-20 | Isolate | Unclassified |
| 10 | 2510917015 | Paraburkholderia silvatlantica PVA5 | Isolate | Unclassified |
| 11 | 2511231004 | Pseudomonas sp. GM102 | Isolate | Nodule |
| 12 | 2511231006 | Pseudomonas sp. GM17 | Isolate | Nodule |
| 13 | 2511231007 | Pseudomonas sp. GM18 | Isolate | Nodule |
| 14 | 2511231008 | Pseudomonas sp. GM21 | Isolate | Nodule |
| 15 | 2511231010 | Pseudomonas sp. GM25 | Isolate | Nodule |
| 16 | 2511231011 | Pseudomonas sp. GM30 | Isolate | Nodule |
| 17 | 2511231012 | Pseudomonas sp. GM33 | Isolate | Nodule |
| 18 | 2511231014 | Pseudomonas sp. GM48 | Isolate | Nodule |
| 19 | 2511231015 | Pseudomonas sp. GM49 | Isolate | Nodule |
| 20 | 2511231016 | Pseudomonas sp. GM50 | Isolate | Nodule |
| 21 | 2511231017 | Pseudomonas sp. GM55 | Isolate | Nodule |
| 22 | 2511231018 | Pseudomonas sp. GM60 | Isolate | Nodule |
| 23 | 2511231019 | Pseudomonas sp. GM67 | Isolate | Nodule |
| 24 | 2511231020 | Pseudomonas sp. GM74 | Isolate | Nodule |
| 25 | 2511231021 | Pseudomonas sp. GM78 | Isolate | Nodule |
| 26 | 2511231022 | Pseudomonas sp. GM79 | Isolate | Nodule |
| 27 | 2511231023 | Pseudomonas sp. GM80 | Isolate | Nodule |
| 28 | 2511231024 | Pseudomonas sp. GM84 | Isolate | Nodule |
| 29 | 2511231031 | Pseudomonas sp. GM16 | Isolate | Nodule |
| 30 | 2511231156 | Pseudomonas ogarae F113 | Isolate | Rhizosphere |
| 31 | 2512047018 | Pseudomonas chlororaphis chlororaphis GP72 | Isolate | Rhizosphere |
| 32 | 2512047030 | Paraburkholderia tuberum STM678 | Isolate | Nodule |
| 33 | 2513237082 | Paraburkholderia mimosarum STM3621 | Isolate | Nodule |
| 34 | 2513237083 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 35 | 2513237087 | Azorhizobium doebereinerae UFLA1-100 | Isolate | Nodule |
| 36 | 2513237151 | Burkholderia sp. WSM2230 | Isolate | Nodule |
| 37 | 2513237165 | Cupriavidus neocaledonicus STM6070 | Isolate | Nodule |
| 38 | 2513237166 | Paraburkholderia azotifigens UYPR1.413 | Isolate | Nodule |
| 39 | 2515154122 | Paraburkholderia atlantica JPY251 | Isolate | Nodule |
| 40 | 2515154123 | Trinickia symbiotica JPY347 | Isolate | Nodule |
| 41 | 2515154189 | Paraburkholderia nodosa DSM 21604 | Isolate | Unclassified |
| 42 | 2519103095 | Burkholderia sp. KJ006 | Isolate | Nodule |
| 43 | 2526164713 | Paraburkholderia phenoliruptrix JPY366 | Isolate | Nodule |
| 44 | 2554235132 | Pseudomonas aeruginosa PGPR2 | Isolate | Unclassified |
| 45 | 2554235231 | Pseudomonas putida MTCC 5279 | Isolate | Unclassified |
| 46 | 2554235341 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 47 | 2562617112 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 48 | 2582580891 | Pseudomonas chlororaphis YL-1 | Isolate | Unclassified |
| 49 | 2582581311 | Burkholderia sp. WP42 | Isolate | Rhizosphere |
| 50 | 2597489887 | Pseudomonas chlororaphis aureofaciens 30-84 | Isolate | Rhizosphere |
| 51 | 2597489888 | Pseudomonas fluorescens SS101 | Isolate | Rhizosphere |
| 52 | 2597489889 | Pseudomonas synxantha BG33R | Isolate | Rhizosphere |
| 53 | 2599185155 | Pseudomonas sp. NFACC10-1 | Isolate | Rhizoplane |
| 54 | 2599185160 | Pseudomonas sp. NFPP25 | Isolate | Rhizoplane |
| 55 | 2599185161 | Pseudomonas sp. NFPP09 | Isolate | Rhizoplane |
| 56 | 2599185162 | Pseudomonas sp. NFPP10 | Isolate | Rhizoplane |
| 57 | 2599185163 | Pseudomonas sp. NFPP12 | Isolate | Rhizoplane |
| 58 | 2599185164 | Pseudomonas sp. NFPP13 | Isolate | Rhizoplane |
| 59 | 2599185165 | Pseudomonas sp. NFPP18 | Isolate | Rhizoplane |
| 60 | 2599185166 | Pseudomonas sp. NFPP08 | Isolate | Rhizoplane |
| 61 | 2599185167 | Pseudomonas sp. NFPP28 | Isolate | Rhizoplane |
| 62 | 2599185168 | Pseudomonas sp. NFPP05 | Isolate | Rhizoplane |
| 63 | 2599185178 | Ralstonia sp. NFACC01 | Isolate | Rhizoplane |
| 64 | 2599185179 | Pseudomonas sp. NFR09 | Isolate | Rhizoplane |
| 65 | 2599185181 | Pseudomonas sp. NFPP17 | Isolate | Rhizoplane |
| 66 | 2599185182 | Pseudomonas sp. NFPP19 | Isolate | Rhizoplane |
| 67 | 2599185185 | Pseudomonas sp. NFPP07 | Isolate | Rhizoplane |
| 68 | 2599185186 | Pseudomonas sp. NFPP15 | Isolate | Rhizoplane |
| 69 | 2599185188 | Pseudomonas sp. NFACC45 | Isolate | Rhizoplane |
| 70 | 2599185189 | Pseudomonas sp. NFPP02 | Isolate | Rhizoplane |
| 71 | 2599185190 | Pseudomonas sp. NFPP04 | Isolate | Rhizoplane |
| 72 | 2599185191 | Pseudomonas sp. NFPP24 | Isolate | Rhizoplane |
| 73 | 2599185212 | Pseudomonas sp. NFACC15-1 | Isolate | Rhizoplane |
| 74 | 2599185239 | Burkholderia sp. NFACC38-1 | Isolate | Rhizoplane |
| 75 | 2599185240 | Burkholderia sp. NFPP32 | Isolate | Rhizoplane |
| 76 | 2599185248 | Pseudomonas sp. NFACC08-1 | Isolate | Rhizoplane |
| 77 | 2599185257 | Pseudomonas sp. NFACC41-3 | Isolate | Rhizoplane |
| 78 | 2599185288 | Pseudomonas sp. NFACC25 | Isolate | Rhizoplane |
| 79 | 2599185289 | Pseudomonas sp. NFACC51 | Isolate | Rhizoplane |
| 80 | 2599185290 | Pseudomonas sp. NFPP11 | Isolate | Rhizoplane |
| 81 | 2599185291 | Pseudomonas sp. NFACC48-1 | Isolate | Rhizoplane |
| 82 | 2599185300 | Pseudomonas sp. NFACC39-1 | Isolate | Rhizoplane |
| 83 | 2599185302 | Pseudomonas sp. NFACC43 | Isolate | Rhizoplane |
| 84 | 2599185303 | Pseudomonas sp. NFACC42-2 | Isolate | Rhizoplane |
| 85 | 2599185304 | Pseudomonas sp. NFACC47-1 | Isolate | Rhizoplane |
| 86 | 2599185305 | Pseudomonas sp. NFACC07-1 | Isolate | Rhizoplane |
| 87 | 2599185306 | Pseudomonas sp. NFACC16-2 | Isolate | Rhizoplane |
| 88 | 2599185307 | Pseudomonas sp. NFACC02 | Isolate | Rhizoplane |
| 89 | 2599185308 | Pseudomonas sp. NFACC17-2 | Isolate | Rhizoplane |
| 90 | 2599185309 | Pseudomonas sp. NFACC49-2 | Isolate | Rhizoplane |
| 91 | 2599185310 | Pseudomonas sp. NFACC09-4 | Isolate | Rhizoplane |
| 92 | 2599185311 | Pseudomonas sp. NFACC04-2 | Isolate | Rhizoplane |
| 93 | 2599185312 | Pseudomonas sp. NFACC32-1 | Isolate | Rhizoplane |
| 94 | 2599185313 | Pseudomonas sp. NFACC05-1 | Isolate | Rhizoplane |
| 95 | 2599185314 | Pseudomonas sp. NFACC23-1 | Isolate | Rhizoplane |
| 96 | 2599185315 | Pseudomonas sp. NFACC44-2 | Isolate | Rhizoplane |
| 97 | 2599185316 | Pseudomonas sp. NFACC52 | Isolate | Rhizoplane |
| 98 | 2599185317 | Pseudomonas sp. NFACC06-1 | Isolate | Rhizoplane |
| 99 | 2599185318 | Pseudomonas sp. NFACC13-1 | Isolate | Rhizoplane |
| 100 | 2599185319 | Pseudomonas sp. NFACC24-1 | Isolate | Rhizoplane |
| 101 | 2599185320 | Pseudomonas sp. NFACC36 | Isolate | Rhizoplane |
| 102 | 2599185321 | Pseudomonas sp. NFACC54 | Isolate | Rhizoplane |
| 103 | 2599185322 | Pseudomonas sp. NFACC14 | Isolate | Rhizoplane |
| 104 | 2599185323 | Pseudomonas sp. NFACC37-1 | Isolate | Rhizoplane |
| 105 | 2599185324 | Pseudomonas sp. NFACC46-3 | Isolate | Rhizoplane |
| 106 | 2599185325 | Pseudomonas sp. NFACC56-3 | Isolate | Rhizoplane |
| 107 | 2599185355 | Burkholderia sp. NFACC33-1 | Isolate | Rhizoplane |
| 108 | 2599185356 | Pseudomonas sp. NFPP14 | Isolate | Rhizoplane |
| 109 | 2600254930 | Pseudomonas sp. NFIX10 | Isolate | Rhizoplane |
| 110 | 2600254931 | Pseudomonas sp. NFIX28 | Isolate | Rhizoplane |
| 111 | 2600254954 | Pseudomonas sp. NFACC19-2 | Isolate | Rhizoplane |
| 112 | 2600255067 | Paraburkholderia kururiensis thiooxydans NBRC 107107 | Isolate | Unclassified |
| 113 | 2600255283 | Pseudomonas sp. NFR16 | Isolate | Rhizoplane |
| 114 | 2600255296 | Pseudomonas sp. NFR02 | Isolate | Rhizoplane |
| 115 | 2600255313 | Pseudomonas sp. NFPP16 | Isolate | Rhizoplane |
| 116 | 2600255318 | Pseudomonas putida NFIX47 | Isolate | Rhizoplane |
| 117 | 2600255389 | Pseudomonas sp. NFPP33 | Isolate | Rhizoplane |
| 118 | 2603880185 | Pseudomonas sp. NFIX46 | Isolate | Rhizoplane |
| 119 | 2603880199 | Pseudomonas sp. NFIX49 | Isolate | Rhizoplane |
| 120 | 2606217733 | Pseudomonas aeruginosa NFHH01 | Isolate | Rhizoplane |
| 121 | 2619619299 | Pseudomonas veronii R4 Genome sequencing | Isolate | Unclassified |
| 122 | 2623620443 | Pseudomonas sp. DR 5-09 | Isolate | Unclassified |
| 123 | 2623620446 | Pseudomonas sp. GR 6-02 | Isolate | Unclassified |
| 124 | 2643221565 | Pseudomonas sp. Root562 | Isolate | Unclassified |
| 125 | 2643221571 | Pseudomonas sp. Root569 | Isolate | Unclassified |
| 126 | 2643221589 | Pseudomonas sp. Root68 | Isolate | Unclassified |
| 127 | 2643221602 | Pseudomonas sp. Root71 | Isolate | Unclassified |
| 128 | 2643221633 | Pseudomonas sp. Root329 | Isolate | Unclassified |
| 129 | 2643221650 | Pseudomonas sp. Root401 | Isolate | Unclassified |
| 130 | 2643221713 | Pseudomonas sp. Root9 | Isolate | Unclassified |
| 131 | 2651869719 | Genome Sequence of Pseudomonas fluorescens UM270 | Isolate | Rhizosphere |
| 132 | 2667528170 | Pseudomonas sp. NFACC50-1 | Isolate | Rhizoplane |
| 133 | 2667528171 | Pseudomonas sp. NFPP22 | Isolate | Rhizoplane |
| 134 | 2667528176 | Pseudomonas sp. NFACC11-2 | Isolate | Rhizoplane |
| 135 | 2671180172 | Pseudomonas sp. NFIX51 | Isolate | Rhizoplane |
| 136 | 2675903129 | Burkholderia pyrrocinia NFIX32 | Isolate | Rhizoplane |
| 137 | 2675903420 | Pseudomonas fluorescens Ps006 | Isolate | Unclassified |
| 138 | 2675903515 | Pseudomonas thivervalensis DSM 13194 | Isolate | Unclassified |
| 139 | 2711768613 | Burkholderia sp. BT03 | Isolate | Rhizosphere |
| 140 | 2713897148 | Pseudomonas fluorescens SF39a | Isolate | Rhizosphere |
| 141 | 2713897149 | Pseudomonas fluorescens SF4c | Isolate | Rhizosphere |
| 142 | 2718217725 | Pseudomonas fluorescens CREA-C16 | Isolate | Rhizosphere |
| 143 | 2718217991 | Paraburkholderia sprentiae WSM5005 | Isolate | Nodule |
| 144 | 2721755607 | Pseudomonas fluorescens Pt14 | Isolate | Rhizosphere |
| 145 | 2738541265 | Pseudomonas sp. GV077 | Isolate | Unclassified |
| 146 | 2738541271 | Pseudomonas sp. GV021 | Isolate | Unclassified |
| 147 | 2738541282 | Pseudomonas sp. GV058 | Isolate | Unclassified |
| 148 | 2738541294 | Pseudomonas sp. GV087 | Isolate | Unclassified |
| 149 | 2738541296 | Paraburkholderia sp. GV073 | Isolate | Unclassified |
| 150 | 2738541298 | Paraburkholderia sp. GV068 | Isolate | Unclassified |
| 151 | 2738541303 | Pseudomonas sp. GV105 | Isolate | Unclassified |
| 152 | 2738541306 | Paraburkholderia sp. GV052 | Isolate | Unclassified |
| 153 | 2738541309 | Pseudomonas sp. GV047 | Isolate | Unclassified |
| 154 | 2738543002 | Paraburkholderia sp. GV072 | Isolate | Unclassified |
| 155 | 2738543004 | Pseudomonas sp. GV085 | Isolate | Unclassified |
| 156 | 2738543008 | Paraburkholderia sp. GV060 | Isolate | Unclassified |
| 157 | 2738543015 | Pseudomonas sp. GV041 | Isolate | Unclassified |
| 158 | 2738543016 | Pseudomonas sp. GV012 | Isolate | Unclassified |
| 159 | 2738543020 | Pseudomonas sp. GV054 | Isolate | Unclassified |
| 160 | 2738543021 | Pseudomonas sp. GV071 | Isolate | Unclassified |
| 161 | 2738543025 | Pseudomonas sp. GV091 | Isolate | Unclassified |
| 162 | 2740892503 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 163 | 2744054620 | Pseudomonas thivervalensis LMG 21626 | Isolate | Unclassified |
| 164 | 2744054900 | Paraburkholderia ginsengiterrae DCY85-1 | Isolate | Unclassified |
| 165 | 2744054901 | Paraburkholderia ginsengiterrae DCY85 | Isolate | Unclassified |
| 166 | 2751185846 | Paraburkholderia ribeironis STM 7296 | Isolate | Unclassified |
| 167 | 2765235841 | Pseudomonas putida AA7 | Isolate | Unclassified |
| 168 | 2773857670 | Pseudomonas sp. 478 | Isolate | Unclassified |
| 169 | 2773857672 | Pseudomonas sp. 1766 | Isolate | Unclassified |
| 170 | 2773857673 | Pseudomonas sp. 443 | Isolate | Unclassified |
| 171 | 2784132063 | Pseudomonas sp. 424 | Isolate | Unclassified |
| 172 | 2784132072 | Pseudomonas sp. 460 | Isolate | Unclassified |
| 173 | 2791355137 | Paraburkholderia piptadeniae STM7183 | Isolate | Unclassified |
| 174 | 2791355520 | Pseudomonas sp. s211(2017) | Isolate | Unclassified |
| 175 | 2806310737 | Pseudomonas mosselii BS011 | Isolate | Unclassified |
| 176 | 2806310745 | Pseudomonas mosselii PtA1 | Isolate | Unclassified |
| 177 | 2808606361 | Pseudomonas sp. SJZ075 | Isolate | Rhizosphere |
| 178 | 2808606376 | Pseudomonas sp. SJZ074 | Isolate | Rhizosphere |
| 179 | 2808606377 | Pseudomonas sp. SJZ083 | Isolate | Rhizosphere |
| 180 | 2808606378 | Pseudomonas sp. SJZ078 | Isolate | Rhizosphere |
| 181 | 2808606379 | Pseudomonas sp. SJZ079 | Isolate | Rhizosphere |
| 182 | 2808606380 | Pseudomonas sp. SJZ085 | Isolate | Rhizosphere |
| 183 | 2808606381 | Pseudomonas sp. SJZ077 | Isolate | Rhizosphere |
| 184 | 2808606382 | Pseudomonas sp. SJZ080 | Isolate | Rhizosphere |
| 185 | 2808606383 | Pseudomonas sp. SJZ124 | Isolate | Rhizosphere |
| 186 | 2808606384 | Burkholderia sp. SJZ089 | Isolate | Rhizosphere |
| 187 | 2808606385 | Pseudomonas sp. SJZ103 | Isolate | Rhizosphere |
| 188 | 2808606388 | Pseudomonas sp. SJZ094 | Isolate | Rhizosphere |
| 189 | 2808606389 | Pseudomonas sp. SJZ101 | Isolate | Rhizosphere |
| 190 | 2808606390 | Burkholderia sp. SJZ115 | Isolate | Rhizosphere |
| 191 | 2808606391 | Burkholderia sp. SJZ091 | Isolate | Rhizosphere |
| 192 | 2808606445 | Pseudomonas sp. SJZ131 | Isolate | Rhizosphere |
| 193 | 2811994881 | Pseudomonas sp. SLBN-26 | Isolate | Unclassified |
| 194 | 2816332253 | Burkholderia vietnamiensis HI2297 | Isolate | Unclassified |
| 195 | 2816332256 | Burkholderia vietnamiensis MSMB608WGS | Isolate | Unclassified |
| 196 | 2816332286 | Burkholderia vietnamiensis HI2221 | Isolate | Rhizosphere |
| 197 | 2816332298 | Pseudomonas veronii R02 | Isolate | Rhizosphere |
| 198 | 2818991436 | Collimonas arenae 515 | Isolate | Unclassified |
| 199 | 2818991450 | Burkholderia sp. 604 | Isolate | Unclassified |
| 200 | 2818991452 | Burkholderia cepacia 561 | Isolate | Unclassified |
| 201 | 2818991456 | Pseudomonas koreensis 3286 | Isolate | Rhizosphere |
| 202 | 2818991464 | Pseudomonas protegens 3295 | Isolate | Rhizosphere |
| 203 | 2823421272 | Pseudomonas mendocina S5.2 | Isolate | Rhizoplane |
| 204 | 2825651385 | Pseudomonas brassicacearum L13-6-12 | Isolate | Rhizosphere |
| 205 | 2826581358 | Pseudomonas viridiflava CDRTc14 | Isolate | Unclassified |
| 206 | 2834028612 | Pseudomonas fluorescens 513 | Isolate | Unclassified |
| 207 | 2842324504 | Paraburkholderia fungorum SEMIA 4007 | Isolate | Nodule |
| 208 | 2842348783 | Paraburkholderia fungorum SEMIA 4013 | Isolate | Nodule |
| 209 | 2842454564 | Paraburkholderia fungorum SEMIA 4056 | Isolate | Nodule |
| 210 | 2842805378 | Pseudomonas sp. R-72599 | Isolate | Unclassified |
| 211 | 2842815866 | Pseudomonas sp. R-72210 | Isolate | Unclassified |
| 212 | 2842826826 | Pseudomonas sp. R-72172 | Isolate | Unclassified |
| 213 | 2842832357 | Pseudomonas sp. R-72164 | Isolate | Unclassified |
| 214 | 2842837860 | Pseudomonas sp. R-72102 | Isolate | Unclassified |
| 215 | 2842843487 | Pseudomonas sp. R-72074 | Isolate | Unclassified |
| 216 | 2842849001 | Pseudomonas sp. R-72008 | Isolate | Unclassified |
| 217 | 2842854478 | Pseudomonas sp. R-71998 | Isolate | Unclassified |
| 218 | 2843690924 | Chromobacterium rhizoryzae JP2-74 | Isolate | Rhizosphere |
| 219 | 2844665904 | Pseudomonas protegens H1F10C | Isolate | Unclassified |
| 220 | 2852612431 | Pseudomonas sp. SJZ073 | Isolate | Rhizosphere |
| 221 | 2852657418 | Pseudomonas sp. JAI115 | Isolate | Rhizosphere |
| 222 | 2852667396 | Pseudomonas sp. JAI120 | Isolate | Rhizosphere |
| 223 | 2856287931 | Paraburkholderia bannensis BE22 | Isolate | Rhizosphere |
| 224 | 2857357740 | Paraburkholderia tropica BE15 | Isolate | Rhizosphere |
| 225 | 2858688981 | Cupriavidus sp. UYMMa02A | Isolate | Unclassified |
| 226 | 2860339153 | Pseudomonas sp. JAI111 | Isolate | Rhizosphere |
| 227 | 2860867994 | Pseudomonas sp. R1-43-08 | Isolate | Rhizosphere |
| 228 | 2863421361 | Burkholderia cenocepacia CACua-24 | Isolate | Rhizosphere |
| 229 | 2870068957 | Burkholderia sp. JP2-270 | Isolate | Unclassified |
| 230 | 2878029506 | Pseudomonas fluorescens DR397 | Isolate | Rhizosphere |
| 231 | 2880230671 | Pseudomonas fluorescens LBUM677 | Isolate | Unclassified |
| 232 | 2883087390 | Paraburkholderia guartelaensis CNPSo 3008 | Isolate | Unclassified |
| 233 | 2885270888 | Paraburkholderia sp. UYCPa14C | Isolate | Unclassified |
| 234 | 2888373701 | Serratia rhizosphaerae KUDC3025 | Isolate | Rhizosphere |
| 235 | 2900634093 | Paraburkholderia dipogonis ICMP 19430 | Isolate | Unclassified |
| 236 | 2901300506 | Cupriavidus sp. UYMSc13B | Isolate | Unclassified |
| 237 | 2902682994 | Paraburkholderia atlantica CNPSo 3155 | Isolate | Unclassified |
| 238 | 2904483920 | Paraburkholderia caledonica 575 | Isolate | Unclassified |
| 239 | 2904518522 | Pseudomonas fluorescens 4488 | Isolate | Rhizosphere |
| 240 | 2904550169 | Stutzerimonas stutzeri 1099 | Isolate | Rhizosphere |
| 241 | 2904564687 | Burkholderia sp. 571 | Isolate | Unclassified |
| 242 | 2904571731 | Burkholderia cenocepacia 574 | Isolate | Unclassified |
| 243 | 2904615490 | Paraburkholderia franconis CNPSo 3157 | Isolate | Unclassified |
| 244 | 2908446538 | Pseudomonas sp. R76 | Isolate | Rhizosphere |
| 245 | 2912963787 | Pseudomonas sp. R32 | Isolate | Rhizosphere |
| 246 | 2913036834 | Pseudomonas viciae 11K1 | Isolate | Rhizosphere |
| 247 | 2917070673 | Pseudomonas protegens CHA0 | Isolate | Rhizosphere |
| 248 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 249 | 2917832318 | Pseudomonas rhizoryzae RY24 | Isolate | Unclassified |
| 250 | 2919063839 | Pseudomonas pharyngis 1098 | Isolate | Rhizosphere |
| 251 | 2919125081 | Pseudomonas psychrotolerans 1545 | Isolate | Rhizosphere |
| 252 | 2919155634 | Pseudomonas fulva 1992 | Isolate | Unclassified |
| 253 | 2919385768 | Pseudomonas sp. 2957 | Isolate | Unclassified |
| 254 | 2919456309 | Pseudomonas sp. 3296 | Isolate | Rhizosphere |
| 255 | 2919481497 | Pseudomonas brassicacearum 3432 | Isolate | Unclassified |
| 256 | 2919487758 | Pseudomonas koreensis 3441 | Isolate | Unclassified |
| 257 | 2919501602 | Pseudomonas alcaliphila 3512 | Isolate | Unclassified |
| 258 | 2919527303 | Paraburkholderia strydomiana 3827 | Isolate | Unclassified |
| 259 | 2919697872 | Pseudomonas frederiksbergensis 4169 | Isolate | Unclassified |
| 260 | 2921643360 | Paraburkholderia steynii HC1.1ba | Isolate | Nodule |
| 261 | 2923153595 | Pseudomonas chlororaphis piscium PCL1391 | Isolate | Unclassified |
| 262 | 2923519811 | Pseudomonas otitidis SLBN-103 | Isolate | Rhizosphere |
| 263 | 2923586266 | Pseudomonas fluorescens 1550 | Isolate | Rhizosphere |
| 264 | 2926063275 | Pseudomonas sp. 3400 | Isolate | Unclassified |
| 265 | 2928108538 | Paraburkholderia terricola 1595 | Isolate | Rhizosphere |
| 266 | 2928135762 | Paraburkholderia terricola 1988 | Isolate | Unclassified |
| 267 | 2928157003 | Burkholderia ambifaria 566 | Isolate | Unclassified |
| 268 | 2928163908 | Burkholderia sp. 567 | Isolate | Unclassified |
| 269 | 2928170801 | Burkholderia sp. 572 | Isolate | Unclassified |
| 270 | 2928503688 | Paraburkholderia terricola 1263 | Isolate | Rhizosphere |
| 271 | 2928536128 | Burkholderia sola 565 | Isolate | Unclassified |
| 272 | 2929144301 | Pseudomonas sp. R-71838 Hybrid assembly | Isolate | Unclassified |
| 273 | 2929189879 | Pseudomonas sp. R-71842 Hybrid assembly | Isolate | Unclassified |
| 274 | 2931369376 | Pseudomonas fluorescens DR133 | Isolate | Rhizosphere |
| 275 | 2931390751 | Pseudomonas sp. DR208 | Isolate | Rhizosphere |
| 276 | 2931396565 | Pseudomonas sp. DR48 | Isolate | Rhizosphere |
| 277 | 2935353572 | Pseudomonas protegens TECH19 | Isolate | Unclassified |
| 278 | 2939636861 | Pseudomonas sp. 2725 | Isolate | Rhizosphere |
| 279 | 2939651529 | Pseudomonas sp. 2835 | Isolate | Rhizosphere |
| 280 | 2939669807 | Kaistia defluvii 3207 | Isolate | Rhizosphere |
| 281 | 2945916053 | Arthrobacter ulcerisalmonis W1I2 | Isolate | Rhizosphere |
| 282 | 2945928738 | Pseudomonas cedrina W1I11 | Isolate | Rhizosphere |
| 283 | 2945934425 | Paraburkholderia graminis W1I13 | Isolate | Rhizosphere |
| 284 | 2945961074 | Pseudomonas sp. W2I6 | Isolate | Rhizosphere |
| 285 | 2946006987 | Pseudomonas sp. W3I7 | Isolate | Rhizosphere |
| 286 | 2946027586 | Pseudomonas sp. W4I3 | Isolate | Rhizosphere |
| 287 | 2947233263 | Pseudomonas synxantha W2I4 | Isolate | Rhizosphere |
| 288 | 2952252522 | Salinicola sp. DM10 | Isolate | Unclassified |
| 289 | 2969304461 | Pseudomonas sp. R84 | Isolate | Rhizosphere |
| 290 | 2974289157 | Pseudomonas fluorescens SORGH_AS 191 | Isolate | Unclassified |
| 291 | 2974298342 | Pseudomonas sp. SORGH_AS 211 | Isolate | Unclassified |
| 292 | 2981990288 | Burkholderia sp. PvR073 | Isolate | Rhizosphere |
| 293 | 2984286254 | Pseudomonas chlororaphis aurantiaca JD37 | Isolate | Rhizosphere |
| 294 | 2984499530 | Pseudomonas sp. SORGH_AS199 | Isolate | Aerial Root |
| 295 | 2984504281 | Pseudomonas psychrotolerans SORGH_AS201 | Isolate | Aerial Root |
| 296 | 2988728565 | Pseudomonas corrugata RM1-1-4 | Isolate | Rhizosphere |
| 297 | 2990703756 | Paraburkholderia graminis SLBN-33 | Isolate | Rhizosphere |
| 298 | 2998139840 | Pseudomonas iranensis SWRI54 | Isolate | Rhizosphere |
| 299 | 3007252601 | Pseudomonas punonensis D1-6 | Isolate | Unclassified |
| 300 | 3007315729 | Pseudomonas argentinensis SA190 | Isolate | Unclassified |
| 301 | 3007395558 | Pseudomonas chlororaphis PCL1601 | Isolate | Rhizosphere |
| 302 | 3007419365 | Pseudomonas vanderleydeniana RW8P3 | Isolate | Unclassified |
| 303 | 3007511990 | Pseudomonas fluorescens G20-18 | Isolate | Rhizosphere |
| 304 | 3007614139 | Pseudomonas sp. PB106 | Isolate | Unclassified |
| 305 | 3007619802 | Pseudomonas sp. PB120 | Isolate | Unclassified |
| 306 | 3007718800 | Pseudomonas fluorescens BW11P2 | Isolate | Rhizosphere |
| 307 | 3007803356 | Pseudomonas sp. CM27 | Isolate | Unclassified |
| 308 | 3007855910 | Pseudomonas khorasanensis SWRI153 | Isolate | Rhizosphere |
| 309 | 3007861166 | Pseudomonas hamedanensis SWRI65 | Isolate | Rhizosphere |
| 310 | 3007866637 | Pseudomonas marvdashtae SWRI102 | Isolate | Rhizosphere |
| 311 | 3007872151 | Pseudomonas sp. SWRI51 | Isolate | Rhizosphere |
| 312 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 313 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 314 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 315 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 316 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 317 | 3300002067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 | Metagenome | Rhizosphere |
| 318 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 319 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 320 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 321 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 322 | 3300002771 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB | Metagenome | Endosphere |
| 323 | 3300002772 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS | Metagenome | Endosphere |
| 324 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 325 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 326 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 327 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 328 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 329 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 330 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 331 | 3300003756 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 | Metagenome | Endosphere |
| 332 | 3300003758 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 | Metagenome | Endosphere |
| 333 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 334 | 3300003760 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 | Metagenome | Endosphere |
| 335 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 336 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 337 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 338 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 339 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 340 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 341 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 342 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 343 | 3300003841 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 344 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 345 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 346 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 347 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 348 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 349 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 350 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 351 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 352 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 353 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 354 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 355 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 356 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 357 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 358 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 359 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 360 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 361 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 362 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 363 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 364 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 365 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 366 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 367 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 368 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 369 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 370 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 371 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 372 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 373 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 374 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 375 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 376 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 377 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 378 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 379 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 380 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 381 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 382 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 383 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 384 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 385 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 386 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 387 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 388 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 389 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 390 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 391 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 392 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 393 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 394 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 395 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 396 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 397 | 3300012498 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 | Metagenome | Rhizosphere |
| 398 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 399 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 400 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 401 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 402 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 403 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 404 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 405 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 406 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 407 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 408 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 409 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 410 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 411 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 412 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 413 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 414 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 415 | 3300016635 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 | Metagenome | Rhizosphere |
| 416 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 417 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 418 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 419 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 420 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 421 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 422 | 3300025225 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 423 | 3300025226 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 424 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 425 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 426 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 427 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 428 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 429 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 430 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 431 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 432 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 433 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 434 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 435 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 436 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 437 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 438 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 439 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 440 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 441 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 442 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 443 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 444 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 445 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 446 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 447 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300025711 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300025735 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 459 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 462 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 466 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 467 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 468 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 469 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 470 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 471 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 472 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 473 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 474 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 475 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 476 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 477 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 478 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 479 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 480 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 481 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 482 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 483 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 484 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 485 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 486 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 487 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 488 | 3300027617 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 489 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 490 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 491 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 492 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 493 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 494 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 495 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 496 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 497 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 498 | 3300030734 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 | Metagenome | Rhizosphere |
| 499 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 500 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 501 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 502 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 503 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 504 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 505 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 506 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 507 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 508 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 509 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 510 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 511 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 512 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 513 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 514 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 515 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 516 | 3300038705 | Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 | Metagenome | Unclassified |
| 517 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 518 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 519 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 520 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 521 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 522 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 523 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 524 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 525 | 3300041509 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG | Metagenome | Unclassified |
| 526 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 527 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 528 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 529 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 530 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 531 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 532 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 533 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 534 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 535 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 536 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 537 | 3300042138 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 | Metagenome | Rhizosphere |
| 538 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 539 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 540 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 541 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 542 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 543 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 544 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 545 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 546 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 547 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 548 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 549 | 3300042533 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 | Metagenome | Rhizosphere |
| 550 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 551 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 552 | 3300044659 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E | Metagenome | Unclassified |
| 553 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 554 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 555 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 556 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 557 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 558 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 559 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 560 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 561 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 562 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 563 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 590 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 591 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 592 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 593 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 594 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 595 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 596 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 597 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 598 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 599 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 600 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 601 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 602 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 603 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 604 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 605 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 606 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 607 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 608 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 609 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 610 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 611 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 612 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 613 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 616 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 617 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 618 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 619 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 620 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 621 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 622 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 623 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 624 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 625 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 626 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 627 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 628 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 629 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 630 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 631 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 632 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 633 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 634 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 635 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 636 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 637 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 638 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 639 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 640 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 641 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 642 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 643 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 644 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 645 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 646 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 647 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 648 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 649 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 650 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 651 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 652 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 653 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 654 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 655 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 656 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 657 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 658 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 659 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 660 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 661 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 662 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 663 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 664 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 665 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 666 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 667 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 668 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 669 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 670 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 671 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 672 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 673 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 674 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 675 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 676 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 677 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 678 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 679 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 680 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 681 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 682 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 683 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 684 | 3300049653 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control | Metagenome | Rhizosphere |
| 685 | 3300049654 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control | Metagenome | Rhizosphere |
| 686 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 687 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 688 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 689 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 690 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 691 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 692 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 693 | 3300059491 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 694 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 695 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 696 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 697 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 698 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 699 | 3300059604 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 700 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 701 | 3300059623 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 702 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 703 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 704 | 3300059641 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 705 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 706 | 3300059643 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 707 | 3300059645 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 708 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 709 | 3300059648 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 710 | 3300059649 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 711 | 3300059651 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 712 | 3300059660 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 713 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 714 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 715 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 716 | 637000220 | Pseudomonas protegens Pf-5 | Isolate | Rhizoplane |
| 717 | 641736151 | Paraburkholderia graminis C4D1M | Isolate | Rhizoplane |
| 718 | 641736154 | Burkholderia ambifaria IOP40-10 | Isolate | Rhizosphere |
| 719 | 642555112 | Paraburkholderia phymatum STM815 | Isolate | Nodule |
| 720 | 642555113 | Paraburkholderia phytofirmans PsJN | Isolate | Unclassified |
| 721 | 8002745576 | Marinomonas spartinae USM8 | Isolate | Rhizosphere |
| 722 | 8003955200 | Paraburkholderia mimosarum LMG 23256 | Isolate | Nodule |
| 723 | 8011350971 | Pseudomonas sp. 30_B | Isolate | Rhizosphere |
| 724 | 8015687852 | Pseudomonas chlororaphis aurantiaca RP4 | Isolate | Rhizosphere |
| 725 | 8016728285 | Pseudomonas psychrotolerans SORGH_AS 227 | Isolate | Unclassified |
| 726 | 8018845410 | Burkholderia reimsis BE51 | Isolate | Rhizosphere |
| 727 | 8019769354 | Pseudomonas sp. MSSRFD41 | Isolate | Rhizosphere |
| 728 | 8019775933 | Pseudomonas sp. PvR083 | Isolate | Rhizosphere |
| 729 | 8020807995 | Burkholderia sp. B10 | Isolate | Rhizosphere |
| 730 | 8020938398 | Burkholderia sp. BE12 | Isolate | Rhizosphere |
| 731 | 8020945358 | Burkholderia sp. BE17 | Isolate | Rhizosphere |
| 732 | 8020953355 | Burkholderia sp. BE24 | Isolate | Rhizosphere |
| 733 | 8021120328 | Burkholderia sp. LS-044 | Isolate | Rhizosphere |
| 734 | 8029995093 | Pseudomonas atacamensis SM1 | Isolate | Rhizosphere |
| 735 | 8034962539 | Pseudomonas sediminis PI11 | Isolate | Rhizosphere |
| 736 | 8039098773 | Burkholderia multivorans MSMB612WGS | Isolate | Unclassified |
| 737 | 8040167225 | Burkholderia vietnamiensis RS1 | Isolate | Unclassified |
| 738 | 8040173305 | Burkholderia vietnamiensis BE10 | Isolate | Rhizosphere |
| 739 | 8052494512 | Pseudomonas putida LD6 | Isolate | Unclassified |
| 740 | 8054285046 | Pseudomonas petroselini MAFF 311096 | Isolate | Nodule |
| 741 | 8054347763 | Pseudomonas carnis NWU Be30 | Isolate | Unclassified |
| 742 | 8054503363 | Pseudomonas sivasensis BsEB-1 | Isolate | Unclassified |
| 743 | 8054929484 | Pseudomonas vlassakiae RW4S1 | Isolate | Rhizosphere |
| 744 | 8055266321 | Paraburkholderia rhynchosiae LMG 27174 | Isolate | Nodule |
| 745 | 8055301274 | Paraburkholderia kirstenboschensis LMG 28727 | Isolate | Nodule |
| 746 | 8055770955 | Pseudomonas chlororaphis qlu-1 | Isolate | Rhizosphere |
| 747 | 8055817908 | Pseudomonas pergaminensis 1008 | Isolate | Rhizosphere |
| 748 | 8055878733 | Pseudomonas palmensis BBB001 | Isolate | Rhizosphere |
| 749 | 8056115690 | Pseudomonas muyukensis COW39 | Isolate | Rhizosphere |
| 750 | 8056120720 | Pseudomonas maumuensis COW77 | Isolate | Rhizosphere |
| 751 | 8056125926 | Pseudomonas azerbaijanorientalis SWRI123 | Isolate | Rhizosphere |
| 752 | 8056131705 | Pseudomonas asgharzadehiana SWRI132 | Isolate | Rhizosphere |
| 753 | 8056137416 | Pseudomonas fakonensis COW40 | Isolate | Rhizosphere |
| 754 | 8056143049 | Pseudomonas alvandae SWRI17 | Isolate | Rhizosphere |
| 755 | 8056148874 | Pseudomonas khavaziana SWRI124 | Isolate | Rhizosphere |
| 756 | 8056155041 | Pseudomonas farris SWRI79 | Isolate | Rhizosphere |
| 757 | 8056161164 | Pseudomonas azadiae SWRI103 | Isolate | Rhizosphere |
| 758 | 8056166840 | Pseudomonas triticicola SWRI88 | Isolate | Rhizosphere |
| 759 | 8056172158 | Pseudomonas ekonensis COR58 | Isolate | Rhizosphere |
| 760 | 8056177738 | Pseudomonas azerbaijanoccidentalis SWRI74 | Isolate | Rhizosphere |
| 761 | 8056569372 | Pseudomonas serboccidentalis IT-P374 | Isolate | Rhizosphere |
| 762 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
| 763 | 8057798959 | Pseudomonas piscis BW16M1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 74.65 |
| Metatranscriptomes | 3.07 |
| Isolates | 22.28 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.12 |
| Bulb | 0 |
| Endosphere | 8.16 |
| Nodule | 3.25 |
| Rhizoplane | 7.37 |
| Rhizosphere | 67.22 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | MRS2a_Contig_111 | 2124908027 | Bacteria | 7788 |
| 2 | JGI24736J21556_1004411 | 3300001904 | Bacteria | 2404 |
| 3 | JGI24741J21665_1013051 | 3300001915 | Bacteria | 1416 |
| 4 | JGI24740J21852_10000031 | 3300001979 | Bacteria | 46967 |
| 5 | JGI24740J21852_10000396 | 3300001979 | Bacteria | 18681 |
| 6 | JGI24740J21852_10006262 | 3300001979 | Bacteria | 4946 |
| 7 | JGI24740J21852_10025467 | 3300001979 | Bacteria | 1993 |
| 8 | JGI24739J22299_10001631 | 3300001989 | Bacteria | 8513 |
| 9 | JGI24739J22299_10002580 | 3300001989 | Bacteria | 6985 |
| 10 | JGI24739J22299_10006601 | 3300001989 | Bacteria | 4373 |
| 11 | JGI24739J22299_10065571 | 3300001989 | Bacteria | 1138 |
| 12 | JGI24737J22298_10007728 | 3300001990 | Bacteria | 3624 |
| 13 | JGI24737J22298_10029982 | 3300001990 | Bacteria | 1704 |
| 14 | JGI24737J22298_10045959 | 3300001990 | Bacteria | 1333 |
| 15 | JGI24735J21928_10000955 | 3300002067 | Bacteria | 10329 |
| 16 | JGI24735J21928_10001973 | 3300002067 | Bacteria | 7209 |
| 17 | JGI24735J21928_10011294 | 3300002067 | Bacteria | 2834 |
| 18 | JGI24735J21928_10013510 | 3300002067 | Bacteria | 2566 |
| 19 | JGI24735J21928_10023445 | 3300002067 | Bacteria | 1872 |
| 20 | JGI24735J21928_10036373 | 3300002067 | Bacteria | 1444 |
| 21 | JGI24738J21930_10011550 | 3300002075 | Bacteria | 1940 |
| 22 | JGI25156J39149_1000366 | 3300002705 | Bacteria | 29011 |
| 23 | JGI25156J39149_1000389 | 3300002705 | Bacteria | 27572 |
| 24 | JGI25156J39149_1000562 | 3300002705 | Bacteria | 21189 |
| 25 | JGI25156J39149_1002605 | 3300002705 | Bacteria | 6357 |
| 26 | JGI25156J39149_1007380 | 3300002705 | Bacteria | 2895 |
| 27 | JGI25162J39368_1000076 | 3300002737 | Bacteria | 120246 |
| 28 | JGI25154J39366_1000271 | 3300002738 | Bacteria | 32100 |
| 29 | JGI25154J39366_1015861 | 3300002738 | Bacteria | 770 |
| 30 | JGI25163J39215_1001848 | 3300002771 | Bacteria | 2796 |
| 31 | JGI25164J39214_1000083 | 3300002772 | Bacteria | 93706 |
| 32 | JGI25164J39214_1000084 | 3300002772 | Bacteria | 93684 |
| 33 | JGI25151J46595_10005206 | 3300003187 | Bacteria | 6745 |
| 34 | JGI25165J46597_1000140 | 3300003214 | Bacteria | 120246 |
| 35 | JGI25165J46597_1000186 | 3300003214 | Bacteria | 93706 |
| 36 | JGI25165J46597_1000717 | 3300003214 | Bacteria | 26046 |
| 37 | rootH1_10070082 | 3300003316 | Bacteria | 1403 |
| 38 | rootH1_10075861 | 3300003316 | Bacteria | 3600 |
| 39 | rootL2_10014775 | 3300003322 | Bacteria | 1483 |
| 40 | Ga0006562J51391_1006636 | 3300003578 | Bacteria | 3648 |
| 41 | Ga0006562J51391_1014803 | 3300003578 | Bacteria | 2891 |
| 42 | Ga0055538_1000095 | 3300003751 | Bacteria | 75040 |
| 43 | Ga0055538_1000219 | 3300003751 | Bacteria | 33042 |
| 44 | Ga0055539_1000139 | 3300003752 | Bacteria | 75040 |
| 45 | Ga0055539_1000233 | 3300003752 | Bacteria | 38473 |
| 46 | Ga0055533_1000064 | 3300003756 | Bacteria | 169672 |
| 47 | Ga0055533_1000145 | 3300003756 | Bacteria | 75040 |
| 48 | Ga0055533_1000247 | 3300003756 | Bacteria | 33939 |
| 49 | Ga0055533_1000835 | 3300003756 | Bacteria | 9483 |
| 50 | Ga0055533_1001095 | 3300003756 | Bacteria | 7758 |
| 51 | Ga0055532_1000013 | 3300003758 | Bacteria | 380677 |
| 52 | Ga0055532_1000128 | 3300003758 | Bacteria | 75040 |
| 53 | Ga0055532_1000245 | 3300003758 | Bacteria | 39120 |
| 54 | Ga0055532_1000292 | 3300003758 | Bacteria | 31681 |
| 55 | Ga0055525_1000190 | 3300003759 | Bacteria | 75040 |
| 56 | Ga0055525_1000318 | 3300003759 | Bacteria | 38473 |
| 57 | Ga0055527_1000010 | 3300003760 | Bacteria | 380677 |
| 58 | Ga0055527_1000159 | 3300003760 | Bacteria | 47732 |
| 59 | Ga0055527_1000260 | 3300003760 | Bacteria | 32074 |
| 60 | Ga0055527_1006249 | 3300003760 | Bacteria | 1498 |
| 61 | Ga0055535_1000010 | 3300003761 | Bacteria | 380677 |
| 62 | Ga0055535_1000315 | 3300003761 | Bacteria | 48887 |
| 63 | Ga0055535_1000431 | 3300003761 | Bacteria | 39120 |
| 64 | Ga0055535_1004327 | 3300003761 | Bacteria | 3493 |
| 65 | Ga0055542_1000016 | 3300003762 | Bacteria | 380677 |
| 66 | Ga0055542_1000990 | 3300003762 | Bacteria | 18375 |
| 67 | Ga0055542_1003449 | 3300003762 | Bacteria | 4275 |
| 68 | Ga0055529_1000012 | 3300003763 | Bacteria | 380677 |
| 69 | Ga0055529_1000517 | 3300003763 | Bacteria | 33886 |
| 70 | Ga0055536_1000764 | 3300003781 | Bacteria | 21428 |
| 71 | Ga0055536_1011893 | 3300003781 | Bacteria | 3283 |
| 72 | Ga0055528_1002297 | 3300003790 | Bacteria | 10350 |
| 73 | Ga0055530_10009302 | 3300003791 | Bacteria | 3795 |
| 74 | Ga0055540_1000452 | 3300003792 | Bacteria | 31985 |
| 75 | Ga0055531_10000109 | 3300003794 | Bacteria | 89901 |
| 76 | Ga0055541_1000093 | 3300003841 | Bacteria | 75040 |
| 77 | Ga0055541_1000113 | 3300003841 | Bacteria | 58560 |
| 78 | Ga0055541_1000160 | 3300003841 | Bacteria | 33042 |
| 79 | Ga0058692_1002918 | 3300003856 | Bacteria | 5516 |
| 80 | Ga0065165_1000810 | 3300005262 | Bacteria | 41615 |
| 81 | Ga0065714_10000596 | 3300005288 | Bacteria | 3551 |
| 82 | Ga0065714_10002541 | 3300005288 | Bacteria | 25727 |
| 83 | Ga0065714_10006685 | 3300005288 | Bacteria | 3184 |
| 84 | Ga0065714_10051673 | 3300005288 | Bacteria | 591 |
| 85 | Ga0065714_10066645 | 3300005288 | Bacteria | 6512 |
| 86 | Ga0065714_10117165 | 3300005288 | Bacteria | 1394 |
| 87 | Ga0065714_10142132 | 3300005288 | Bacteria | 1162 |
| 88 | Ga0065714_10223962 | 3300005288 | Bacteria | 829 |
| 89 | Ga0065714_10288258 | 3300005288 | Bacteria | 709 |
| 90 | Ga0065704_10000995 | 3300005289 | Bacteria | 10453 |
| 91 | Ga0065704_10034078 | 3300005289 | Bacteria | 971 |
| 92 | Ga0065704_10201950 | 3300005289 | Bacteria | 1142 |
| 93 | Ga0065704_10424606 | 3300005289 | Bacteria | 729 |
| 94 | Ga0065712_10067838 | 3300005290 | Bacteria | 26755 |
| 95 | Ga0065715_10007584 | 3300005293 | Bacteria | 3036 |
| 96 | Ga0070658_10003407 | 3300005327 | Bacteria | 13079 |
| 97 | Ga0070658_10048516 | 3300005327 | Bacteria | 3438 |
| 98 | Ga0070676_10180759 | 3300005328 | Bacteria | 1371 |
| 99 | Ga0070683_101118265 | 3300005329 | Bacteria | 757 |
| 100 | Ga0070670_100007436 | 3300005331 | Bacteria | 9304 |
| 101 | Ga0070682_100103553 | 3300005337 | Bacteria | 1883 |
| 102 | Ga0070660_100000006 | 3300005339 | Bacteria | 166714 |
| 103 | Ga0070660_100000507 | 3300005339 | Bacteria | 26032 |
| 104 | Ga0070660_100067883 | 3300005339 | Bacteria | 2778 |
| 105 | Ga0070661_100000038 | 3300005344 | Bacteria | 104775 |
| 106 | Ga0070661_100000348 | 3300005344 | Bacteria | 36613 |
| 107 | Ga0070669_100000248 | 3300005353 | Bacteria | 44834 |
| 108 | Ga0070669_100066159 | 3300005353 | Bacteria | 2664 |
| 109 | Ga0070675_100483202 | 3300005354 | Bacteria | 1114 |
| 110 | Ga0070671_100440642 | 3300005355 | Bacteria | 1117 |
| 111 | Ga0070659_100000082 | 3300005366 | Bacteria | 71707 |
| 112 | Ga0070659_100002151 | 3300005366 | Bacteria | 14041 |
| 113 | Ga0070659_100239763 | 3300005366 | Bacteria | 1500 |
| 114 | Ga0070659_100273629 | 3300005366 | Bacteria | 1404 |
| 115 | Ga0070667_100551988 | 3300005367 | Bacteria | 1059 |
| 116 | Ga0070667_100914291 | 3300005367 | Bacteria | 817 |
| 117 | Ga0070714_100582607 | 3300005435 | Bacteria | 1073 |
| 118 | Ga0070714_100629501 | 3300005435 | Bacteria | 1032 |
| 119 | Ga0070714_101115677 | 3300005435 | Bacteria | 769 |
| 120 | Ga0070663_100000069 | 3300005455 | Bacteria | 44710 |
| 121 | Ga0070663_100000075 | 3300005455 | Bacteria | 43381 |
| 122 | Ga0070663_100205344 | 3300005455 | Bacteria | 1540 |
| 123 | Ga0070678_100281207 | 3300005456 | Bacteria | 1407 |
| 124 | Ga0070662_100000423 | 3300005457 | Bacteria | 25105 |
| 125 | Ga0070662_100088025 | 3300005457 | Bacteria | 2327 |
| 126 | Ga0068853_100000155 | 3300005539 | Bacteria | 46420 |
| 127 | Ga0070665_100492023 | 3300005548 | Bacteria | 1237 |
| 128 | Ga0070665_101072000 | 3300005548 | Bacteria | 817 |
| 129 | Ga0070665_101945906 | 3300005548 | Bacteria | 593 |
| 130 | Ga0068855_100013952 | 3300005563 | Bacteria | 9688 |
| 131 | Ga0068855_100028268 | 3300005563 | Bacteria | 6707 |
| 132 | Ga0068855_100040376 | 3300005563 | Bacteria | 5539 |
| 133 | Ga0068855_100690129 | 3300005563 | Bacteria | 1093 |
| 134 | Ga0068855_101102753 | 3300005563 | Bacteria | 830 |
| 135 | Ga0070664_100000191 | 3300005564 | Bacteria | 43340 |
| 136 | Ga0070664_100002818 | 3300005564 | Bacteria | 14062 |
| 137 | Ga0068854_100004356 | 3300005578 | Bacteria | 8926 |
| 138 | Ga0068856_100000504 | 3300005614 | Bacteria | 43340 |
| 139 | Ga0068856_100076217 | 3300005614 | Bacteria | 3323 |
| 140 | Ga0068852_100015182 | 3300005616 | Bacteria | 5961 |
| 141 | Ga0068852_100081937 | 3300005616 | Bacteria | 2866 |
| 142 | Ga0068861_100016273 | 3300005719 | Bacteria | 5259 |
| 143 | Ga0068851_10000012 | 3300005834 | Bacteria | 175130 |
| 144 | Ga0068851_10136348 | 3300005834 | Bacteria | 1331 |
| 145 | Ga0068851_10425110 | 3300005834 | Bacteria | 785 |
| 146 | Ga0075363_100202386 | 3300006048 | Bacteria | 1135 |
| 147 | Ga0075432_10021103 | 3300006058 | Bacteria | 2228 |
| 148 | Ga0075432_10040746 | 3300006058 | Bacteria | 1621 |
| 149 | Ga0075432_10059931 | 3300006058 | Bacteria | 1353 |
| 150 | Ga0075432_10122923 | 3300006058 | Bacteria | 976 |
| 151 | Ga0075432_10149183 | 3300006058 | Bacteria | 897 |
| 152 | Ga0075432_10152952 | 3300006058 | Bacteria | 887 |
| 153 | Ga0075362_10077500 | 3300006177 | Bacteria | 1527 |
| 154 | Ga0075369_10276721 | 3300006186 | Bacteria | 781 |
| 155 | Ga0075427_10052499 | 3300006194 | Bacteria | 704 |
| 156 | Ga0075436_100479195 | 3300006914 | Bacteria | 908 |
| 157 | Ga0099823_1000137 | 3300006944 | Bacteria | 37992 |
| 158 | Ga0099823_1051170 | 3300006944 | Bacteria | 2513 |
| 159 | Ga0079104_1000322 | 3300006946 | Bacteria | 60025 |
| 160 | Ga0079104_1000338 | 3300006946 | Bacteria | 57315 |
| 161 | Ga0105251_10000019 | 3300009011 | Bacteria | 141884 |
| 162 | Ga0105251_10000127 | 3300009011 | Bacteria | 76233 |
| 163 | Ga0105251_10000542 | 3300009011 | Bacteria | 35584 |
| 164 | Ga0105251_10003857 | 3300009011 | Bacteria | 10680 |
| 165 | Ga0105251_10006346 | 3300009011 | Bacteria | 7555 |
| 166 | Ga0105251_10006467 | 3300009011 | Bacteria | 7457 |
| 167 | Ga0105251_10012349 | 3300009011 | Bacteria | 4835 |
| 168 | Ga0105251_10023834 | 3300009011 | Bacteria | 3151 |
| 169 | Ga0105251_10027925 | 3300009011 | Bacteria | 2855 |
| 170 | Ga0105251_10065832 | 3300009011 | Bacteria | 1695 |
| 171 | Ga0105251_10077797 | 3300009011 | Bacteria | 1537 |
| 172 | Ga0105251_10116570 | 3300009011 | Bacteria | 1214 |
| 173 | Ga0105251_10154236 | 3300009011 | Bacteria | 1036 |
| 174 | Ga0105251_10214615 | 3300009011 | Bacteria | 866 |
| 175 | Ga0105251_10234814 | 3300009011 | Bacteria | 826 |
| 176 | Ga0105244_10000417 | 3300009036 | Bacteria | 39564 |
| 177 | Ga0105244_10002181 | 3300009036 | Bacteria | 15009 |
| 178 | Ga0105244_10006408 | 3300009036 | Bacteria | 7626 |
| 179 | Ga0105244_10006864 | 3300009036 | Bacteria | 7309 |
| 180 | Ga0105244_10021397 | 3300009036 | Bacteria | 3577 |
| 181 | Ga0105244_10044510 | 3300009036 | Bacteria | 2287 |
| 182 | Ga0105244_10062006 | 3300009036 | Bacteria | 1880 |
| 183 | Ga0105244_10074841 | 3300009036 | Bacteria | 1684 |
| 184 | Ga0105244_10113371 | 3300009036 | Bacteria | 1317 |
| 185 | Ga0105244_10116648 | 3300009036 | Bacteria | 1295 |
| 186 | Ga0105244_10125489 | 3300009036 | Bacteria | 1241 |
| 187 | Ga0105244_10151667 | 3300009036 | Bacteria | 1110 |
| 188 | Ga0105244_10179832 | 3300009036 | Bacteria | 1003 |
| 189 | Ga0105244_10196762 | 3300009036 | Bacteria | 951 |
| 190 | Ga0105244_10209653 | 3300009036 | Bacteria | 917 |
| 191 | Ga0105244_10212566 | 3300009036 | Bacteria | 909 |
| 192 | Ga0105244_10326496 | 3300009036 | Bacteria | 708 |
| 193 | Ga0105250_10000563 | 3300009092 | Bacteria | 24835 |
| 194 | Ga0105250_10000709 | 3300009092 | Bacteria | 20531 |
| 195 | Ga0105250_10025779 | 3300009092 | Bacteria | 2369 |
| 196 | Ga0105250_10083222 | 3300009092 | Bacteria | 1298 |
| 197 | Ga0105250_10090213 | 3300009092 | Bacteria | 1246 |
| 198 | Ga0105250_10167291 | 3300009092 | Bacteria | 919 |
| 199 | Ga0105250_10197655 | 3300009092 | Bacteria | 848 |
| 200 | Ga0105250_10198210 | 3300009092 | Bacteria | 846 |
| 201 | Ga0105250_10210716 | 3300009092 | Bacteria | 821 |
| 202 | Ga0105240_10004374 | 3300009093 | Bacteria | 21565 |
| 203 | Ga0105240_10066046 | 3300009093 | Bacteria | 4490 |
| 204 | Ga0105240_10196992 | 3300009093 | Bacteria | 2364 |
| 205 | Ga0105240_10442527 | 3300009093 | Bacteria | 1456 |
| 206 | Ga0105245_10309157 | 3300009098 | Bacteria | 1554 |
| 207 | Ga0105243_10000325 | 3300009148 | Bacteria | 52234 |
| 208 | Ga0105243_10003183 | 3300009148 | Bacteria | 13445 |
| 209 | Ga0105243_10007615 | 3300009148 | Bacteria | 8323 |
| 210 | Ga0105243_10020292 | 3300009148 | Bacteria | 5039 |
| 211 | Ga0105243_10377983 | 3300009148 | Bacteria | 1309 |
| 212 | Ga0105243_10558101 | 3300009148 | Bacteria | 1095 |
| 213 | Ga0105243_11119613 | 3300009148 | Bacteria | 797 |
| 214 | Ga0105243_11859999 | 3300009148 | Bacteria | 634 |
| 215 | Ga0105241_10232790 | 3300009174 | Bacteria | 1554 |
| 216 | Ga0105241_10703039 | 3300009174 | Bacteria | 923 |
| 217 | Ga0105242_10000846 | 3300009176 | Bacteria | 23789 |
| 218 | Ga0105242_11060105 | 3300009176 | Bacteria | 822 |
| 219 | Ga0105248_10640824 | 3300009177 | Bacteria | 1199 |
| 220 | Ga0105237_10000756 | 3300009545 | Bacteria | 44299 |
| 221 | Ga0105237_10141691 | 3300009545 | Bacteria | 2398 |
| 222 | Ga0105237_10198047 | 3300009545 | Bacteria | 2008 |
| 223 | Ga0105237_10239067 | 3300009545 | Bacteria | 1817 |
| 224 | Ga0105237_10450867 | 3300009545 | Bacteria | 1292 |
| 225 | Ga0105238_10063614 | 3300009551 | Bacteria | 3690 |
| 226 | Ga0105238_10423733 | 3300009551 | Bacteria | 1326 |
| 227 | Ga0105249_10253643 | 3300009553 | Bacteria | 1745 |
| 228 | Ga0105239_10002079 | 3300010375 | Bacteria | 25954 |
| 229 | Ga0105239_10003831 | 3300010375 | Bacteria | 18277 |
| 230 | Ga0105239_10047907 | 3300010375 | Bacteria | 4684 |
| 231 | Ga0105239_10485553 | 3300010375 | Bacteria | 1404 |
| 232 | Ga0105246_10005716 | 3300011119 | Bacteria | 7593 |
| 233 | Ga0105246_10072921 | 3300011119 | Bacteria | 2422 |
| 234 | Ga0105246_10272649 | 3300011119 | Bacteria | 1353 |
| 235 | Ga0105246_10278998 | 3300011119 | Bacteria | 1339 |
| 236 | Ga0105246_10716170 | 3300011119 | Bacteria | 879 |
| 237 | Ga0105246_10858619 | 3300011119 | Bacteria | 810 |
| 238 | Ga0157345_1000797 | 3300012498 | Bacteria | 2413 |
| 239 | Ga0157373_10000358 | 3300013100 | Bacteria | 36729 |
| 240 | Ga0157373_10002832 | 3300013100 | Bacteria | 13112 |
| 241 | Ga0157373_10048867 | 3300013100 | Bacteria | 3016 |
| 242 | Ga0157373_10184475 | 3300013100 | Bacteria | 1469 |
| 243 | Ga0157373_10591262 | 3300013100 | Bacteria | 807 |
| 244 | Ga0157373_11060393 | 3300013100 | Bacteria | 607 |
| 245 | Ga0157371_10000608 | 3300013102 | Bacteria | 42626 |
| 246 | Ga0157371_10008084 | 3300013102 | Bacteria | 8411 |
| 247 | Ga0157371_10192771 | 3300013102 | Bacteria | 1459 |
| 248 | Ga0157371_10212686 | 3300013102 | Bacteria | 1388 |
| 249 | Ga0157371_10413781 | 3300013102 | Bacteria | 988 |
| 250 | Ga0157371_10456965 | 3300013102 | Bacteria | 939 |
| 251 | Ga0157370_10000086 | 3300013104 | Bacteria | 103729 |
| 252 | Ga0157370_10000690 | 3300013104 | Bacteria | 42091 |
| 253 | Ga0157370_10000852 | 3300013104 | Bacteria | 38700 |
| 254 | Ga0157370_10001717 | 3300013104 | Bacteria | 26975 |
| 255 | Ga0157370_10155885 | 3300013104 | Bacteria | 2125 |
| 256 | Ga0157370_10253317 | 3300013104 | Bacteria | 1628 |
| 257 | Ga0157370_10708071 | 3300013104 | Bacteria | 919 |
| 258 | Ga0157370_10835041 | 3300013104 | Bacteria | 838 |
| 259 | Ga0157370_11275780 | 3300013104 | Bacteria | 662 |
| 260 | Ga0157369_10000120 | 3300013105 | Bacteria | 111290 |
| 261 | Ga0157369_10000743 | 3300013105 | Bacteria | 42070 |
| 262 | Ga0157369_10003555 | 3300013105 | Bacteria | 18512 |
| 263 | Ga0157369_10004872 | 3300013105 | Bacteria | 15751 |
| 264 | Ga0157369_10095222 | 3300013105 | Bacteria | 3178 |
| 265 | Ga0157369_10123142 | 3300013105 | Bacteria | 2751 |
| 266 | Ga0157369_10743561 | 3300013105 | Bacteria | 1009 |
| 267 | Ga0157369_10808121 | 3300013105 | Bacteria | 963 |
| 268 | Ga0157369_11829878 | 3300013105 | Bacteria | 617 |
| 269 | Ga0171462_1021 | 3300013250 | Bacteria | 141297 |
| 270 | Ga0157374_10000976 | 3300013296 | Bacteria | 24794 |
| 271 | Ga0157374_10080599 | 3300013296 | Bacteria | 3088 |
| 272 | Ga0157374_10240568 | 3300013296 | Bacteria | 1780 |
| 273 | Ga0157378_10471771 | 3300013297 | Bacteria | 1249 |
| 274 | Ga0163162_10000454 | 3300013306 | Bacteria | 37941 |
| 275 | Ga0163162_10436994 | 3300013306 | Bacteria | 1441 |
| 276 | Ga0163162_11931083 | 3300013306 | Bacteria | 676 |
| 277 | Ga0157372_10000519 | 3300013307 | Bacteria | 42478 |
| 278 | Ga0157372_10001060 | 3300013307 | Bacteria | 30037 |
| 279 | Ga0157372_10003761 | 3300013307 | Bacteria | 16301 |
| 280 | Ga0157372_10063189 | 3300013307 | Bacteria | 4150 |
| 281 | Ga0157372_10090525 | 3300013307 | Bacteria | 3478 |
| 282 | Ga0157372_10143368 | 3300013307 | Bacteria | 2754 |
| 283 | Ga0157372_10152645 | 3300013307 | Bacteria | 2666 |
| 284 | Ga0157372_10325218 | 3300013307 | Bacteria | 1790 |
| 285 | Ga0157375_10010236 | 3300013308 | Bacteria | 8249 |
| 286 | Ga0157375_10365139 | 3300013308 | Bacteria | 1610 |
| 287 | Ga0163163_10671412 | 3300014325 | Bacteria | 1100 |
| 288 | Ga0157380_10001066 | 3300014326 | Bacteria | 17591 |
| 289 | Ga0182008_10001464 | 3300014497 | Bacteria | 15783 |
| 290 | Ga0182008_10067557 | 3300014497 | Bacteria | 1759 |
| 291 | Ga0182008_10245974 | 3300014497 | Bacteria | 921 |
| 292 | Ga0182008_10291886 | 3300014497 | Bacteria | 851 |
| 293 | Ga0157376_10966044 | 3300014969 | Bacteria | 873 |
| 294 | Ga0182006_1001401 | 3300015261 | Bacteria | 14627 |
| 295 | Ga0182006_1003771 | 3300015261 | Bacteria | 7645 |
| 296 | Ga0182006_1009036 | 3300015261 | Bacteria | 4484 |
| 297 | Ga0182006_1017240 | 3300015261 | Bacteria | 3070 |
| 298 | Ga0182006_1078932 | 3300015261 | Bacteria | 1204 |
| 299 | Ga0182006_1106463 | 3300015261 | Bacteria | 989 |
| 300 | Ga0182007_10000795 | 3300015262 | Bacteria | 17642 |
| 301 | Ga0182007_10003364 | 3300015262 | Bacteria | 7557 |
| 302 | Ga0182007_10018828 | 3300015262 | Bacteria | 2495 |
| 303 | Ga0182007_10045275 | 3300015262 | Bacteria | 1459 |
| 304 | Ga0182007_10121479 | 3300015262 | Bacteria | 874 |
| 305 | Ga0182005_1000509 | 3300015265 | Bacteria | 19915 |
| 306 | Ga0182005_1001429 | 3300015265 | Bacteria | 9616 |
| 307 | Ga0182005_1190854 | 3300015265 | Bacteria | 612 |
| 308 | Ga0183361_10038 | 3300016635 | Bacteria | 26120 |
| 309 | Ga0163161_10151963 | 3300017792 | Bacteria | 1760 |
| 310 | Ga0163161_10907523 | 3300017792 | Bacteria | 747 |
| 311 | Ga0163161_11032598 | 3300017792 | Bacteria | 703 |
| 312 | Ga0213872_10133782 | 3300021361 | Bacteria | 1091 |
| 313 | Ga0224712_10000332 | 3300022467 | Bacteria | 8963 |
| 314 | Ga0209435_100436 | 3300025206 | Bacteria | 8636 |
| 315 | Ga0209435_102054 | 3300025206 | Bacteria | 2417 |
| 316 | Ga0209435_114785 | 3300025206 | Bacteria | 821 |
| 317 | Ga0209760_100098 | 3300025207 | Bacteria | 66801 |
| 318 | Ga0209760_100101 | 3300025207 | Bacteria | 65719 |
| 319 | Ga0209784_100007 | 3300025224 | Bacteria | 747715 |
| 320 | Ga0209784_100215 | 3300025224 | Bacteria | 39580 |
| 321 | Ga0209566_100018 | 3300025225 | Bacteria | 448638 |
| 322 | Ga0209566_100062 | 3300025225 | Bacteria | 193033 |
| 323 | Ga0209566_100161 | 3300025225 | Bacteria | 75269 |
| 324 | Ga0209566_100215 | 3300025225 | Bacteria | 58348 |
| 325 | Ga0209674_100011 | 3300025226 | Bacteria | 997175 |
| 326 | Ga0209674_100021 | 3300025226 | Bacteria | 629811 |
| 327 | Ga0209674_100048 | 3300025226 | Bacteria | 353032 |
| 328 | Ga0209674_100183 | 3300025226 | Bacteria | 71751 |
| 329 | Ga0209674_100271 | 3300025226 | Bacteria | 39580 |
| 330 | Ga0209674_102469 | 3300025226 | Bacteria | 3952 |
| 331 | Ga0209672_100002 | 3300025228 | Bacteria | 1733325 |
| 332 | Ga0209672_100012 | 3300025228 | Bacteria | 795742 |
| 333 | Ga0209672_100020 | 3300025228 | Bacteria | 429003 |
| 334 | Ga0209672_100066 | 3300025228 | Bacteria | 189828 |
| 335 | Ga0209672_100234 | 3300025228 | Bacteria | 42161 |
| 336 | Ga0209672_100439 | 3300025228 | Bacteria | 23788 |
| 337 | Ga0209147_100003 | 3300025229 | Bacteria | 1733325 |
| 338 | Ga0209147_100007 | 3300025229 | Bacteria | 795684 |
| 339 | Ga0209147_100009 | 3300025229 | Bacteria | 747409 |
| 340 | Ga0209147_100024 | 3300025229 | Bacteria | 429003 |
| 341 | Ga0209147_100084 | 3300025229 | Bacteria | 189828 |
| 342 | Ga0209147_100295 | 3300025229 | Bacteria | 42161 |
| 343 | Ga0209563_100018 | 3300025230 | Bacteria | 747850 |
| 344 | Ga0209563_100181 | 3300025230 | Bacteria | 39580 |
| 345 | Ga0209563_100395 | 3300025230 | Bacteria | 15618 |
| 346 | Ga0209563_101061 | 3300025230 | Bacteria | 7950 |
| 347 | Ga0209563_104234 | 3300025230 | Bacteria | 2778 |
| 348 | Ga0207427_100005 | 3300025231 | Bacteria | 797999 |
| 349 | Ga0207427_100006 | 3300025231 | Bacteria | 785415 |
| 350 | Ga0207427_101307 | 3300025231 | Bacteria | 9356 |
| 351 | Ga0207427_110510 | 3300025231 | Bacteria | 962 |
| 352 | Ga0209437_100013 | 3300025233 | Bacteria | 785457 |
| 353 | Ga0209437_100018 | 3300025233 | Bacteria | 694400 |
| 354 | Ga0209437_104789 | 3300025233 | Bacteria | 2354 |
| 355 | Ga0209258_100014 | 3300025242 | Bacteria | 720132 |
| 356 | Ga0209258_100042 | 3300025242 | Bacteria | 380729 |
| 357 | Ga0209258_100084 | 3300025242 | Bacteria | 244783 |
| 358 | Ga0209258_100117 | 3300025242 | Bacteria | 189828 |
| 359 | Ga0209258_100330 | 3300025242 | Bacteria | 71644 |
| 360 | Ga0209258_100477 | 3300025242 | Bacteria | 42161 |
| 361 | Ga0209646_1000046 | 3300025246 | Bacteria | 332737 |
| 362 | Ga0209646_1000400 | 3300025246 | Bacteria | 25870 |
| 363 | Ga0209026_1026636 | 3300025250 | Bacteria | 868 |
| 364 | Ga0209677_100056 | 3300025253 | Bacteria | 165557 |
| 365 | Ga0209677_100230 | 3300025253 | Bacteria | 39580 |
| 366 | Ga0209677_102128 | 3300025253 | Bacteria | 7768 |
| 367 | Ga0209148_1000006 | 3300025254 | Bacteria | 1733325 |
| 368 | Ga0209148_1000148 | 3300025254 | Bacteria | 159642 |
| 369 | Ga0209148_1000187 | 3300025254 | Bacteria | 117659 |
| 370 | Ga0209148_1000739 | 3300025254 | Bacteria | 25313 |
| 371 | Ga0209148_1000785 | 3300025254 | Bacteria | 23584 |
| 372 | Ga0209148_1003392 | 3300025254 | Bacteria | 4445 |
| 373 | Ga0209759_1000002 | 3300025256 | Bacteria | 1027596 |
| 374 | Ga0209759_1000032 | 3300025256 | Bacteria | 278697 |
| 375 | Ga0209759_1000210 | 3300025256 | Bacteria | 90325 |
| 376 | Ga0209759_1000587 | 3300025256 | Bacteria | 35659 |
| 377 | Ga0209759_1003308 | 3300025256 | Bacteria | 6485 |
| 378 | Ga0209759_1003547 | 3300025256 | Bacteria | 6177 |
| 379 | Ga0209759_1006814 | 3300025256 | Bacteria | 3781 |
| 380 | Ga0209759_1018458 | 3300025256 | Bacteria | 1683 |
| 381 | Ga0209759_1021767 | 3300025256 | Bacteria | 1450 |
| 382 | Ga0209233_1000021 | 3300025261 | Bacteria | 798078 |
| 383 | Ga0209233_1000022 | 3300025261 | Bacteria | 785415 |
| 384 | Ga0209233_1000033 | 3300025261 | Bacteria | 596094 |
| 385 | Ga0209455_1000003 | 3300025272 | Bacteria | 1471893 |
| 386 | Ga0209455_1000110 | 3300025272 | Bacteria | 189828 |
| 387 | Ga0209455_1000269 | 3300025272 | Bacteria | 58101 |
| 388 | Ga0209455_1000362 | 3300025272 | Bacteria | 42161 |
| 389 | Ga0209455_1004621 | 3300025272 | Bacteria | 4449 |
| 390 | Ga0209673_1000057 | 3300025273 | Bacteria | 270150 |
| 391 | Ga0209130_1004039 | 3300025284 | Bacteria | 5826 |
| 392 | Ga0209675_1006697 | 3300025291 | Bacteria | 4568 |
| 393 | Ga0209676_1000015 | 3300025292 | Bacteria | 784458 |
| 394 | Ga0209676_1000030 | 3300025292 | Bacteria | 506421 |
| 395 | Ga0209676_1000041 | 3300025292 | Bacteria | 424583 |
| 396 | Ga0209676_1000548 | 3300025292 | Bacteria | 57446 |
| 397 | Ga0209676_1004486 | 3300025292 | Bacteria | 7750 |
| 398 | Ga0209025_1000123 | 3300025294 | Bacteria | 204125 |
| 399 | Ga0209564_1006643 | 3300025295 | Bacteria | 6176 |
| 400 | Ga0209050_1000024 | 3300025298 | Bacteria | 533389 |
| 401 | Ga0209050_1000075 | 3300025298 | Bacteria | 286562 |
| 402 | Ga0209050_1000128 | 3300025298 | Bacteria | 187432 |
| 403 | Ga0209050_1002450 | 3300025298 | Bacteria | 15871 |
| 404 | Ga0207426_1000152 | 3300025302 | Bacteria | 183514 |
| 405 | Ga0209051_1000012 | 3300025303 | Bacteria | 595474 |
| 406 | Ga0209051_1000023 | 3300025303 | Bacteria | 437371 |
| 407 | Ga0209051_1000041 | 3300025303 | Bacteria | 311155 |
| 408 | Ga0209051_1007648 | 3300025303 | Bacteria | 5875 |
| 409 | Ga0209257_1000069 | 3300025304 | Bacteria | 339826 |
| 410 | Ga0209257_1007474 | 3300025304 | Bacteria | 6584 |
| 411 | Ga0207656_10000006 | 3300025321 | Bacteria | 395044 |
| 412 | Ga0207696_1000031 | 3300025711 | Bacteria | 384169 |
| 413 | Ga0207696_1000064 | 3300025711 | Bacteria | 238379 |
| 414 | Ga0207696_1000094 | 3300025711 | Bacteria | 184065 |
| 415 | Ga0207696_1000095 | 3300025711 | Bacteria | 179123 |
| 416 | Ga0207696_1000149 | 3300025711 | Bacteria | 120461 |
| 417 | Ga0207696_1004438 | 3300025711 | Bacteria | 6047 |
| 418 | Ga0207696_1004760 | 3300025711 | Bacteria | 5775 |
| 419 | Ga0207696_1006915 | 3300025711 | Bacteria | 4505 |
| 420 | Ga0207696_1013636 | 3300025711 | Bacteria | 2820 |
| 421 | Ga0207696_1059603 | 3300025711 | Bacteria | 1075 |
| 422 | Ga0207655_1000007 | 3300025728 | Bacteria | 773492 |
| 423 | Ga0207655_1000068 | 3300025728 | Bacteria | 241705 |
| 424 | Ga0207655_1000107 | 3300025728 | Bacteria | 178758 |
| 425 | Ga0207655_1000455 | 3300025728 | Bacteria | 53605 |
| 426 | Ga0207655_1001758 | 3300025728 | Bacteria | 18989 |
| 427 | Ga0207655_1002516 | 3300025728 | Bacteria | 14758 |
| 428 | Ga0207655_1002730 | 3300025728 | Bacteria | 13789 |
| 429 | Ga0207655_1002939 | 3300025728 | Bacteria | 13102 |
| 430 | Ga0207655_1005320 | 3300025728 | Bacteria | 8800 |
| 431 | Ga0207655_1005323 | 3300025728 | Bacteria | 8797 |
| 432 | Ga0207655_1009161 | 3300025728 | Bacteria | 6184 |
| 433 | Ga0207655_1018841 | 3300025728 | Bacteria | 3639 |
| 434 | Ga0207655_1028195 | 3300025728 | Bacteria | 2654 |
| 435 | Ga0207655_1053962 | 3300025728 | Bacteria | 1602 |
| 436 | Ga0207655_1164587 | 3300025728 | Bacteria | 690 |
| 437 | Ga0207655_1178649 | 3300025728 | Bacteria | 650 |
| 438 | Ga0207655_1208568 | 3300025728 | Bacteria | 578 |
| 439 | Ga0207713_1000010 | 3300025735 | Bacteria | 528374 |
| 440 | Ga0207713_1000081 | 3300025735 | Bacteria | 166910 |
| 441 | Ga0207713_1000302 | 3300025735 | Bacteria | 56383 |
| 442 | Ga0207713_1000307 | 3300025735 | Bacteria | 55987 |
| 443 | Ga0207713_1000511 | 3300025735 | Bacteria | 39537 |
| 444 | Ga0207713_1001808 | 3300025735 | Bacteria | 16343 |
| 445 | Ga0207713_1002377 | 3300025735 | Bacteria | 13751 |
| 446 | Ga0207713_1004357 | 3300025735 | Bacteria | 9202 |
| 447 | Ga0207713_1004870 | 3300025735 | Bacteria | 8597 |
| 448 | Ga0207713_1006244 | 3300025735 | Bacteria | 7294 |
| 449 | Ga0207713_1011807 | 3300025735 | Bacteria | 4717 |
| 450 | Ga0207713_1017287 | 3300025735 | Bacteria | 3625 |
| 451 | Ga0207713_1018158 | 3300025735 | Bacteria | 3490 |
| 452 | Ga0207713_1018668 | 3300025735 | Bacteria | 3426 |
| 453 | Ga0207713_1020156 | 3300025735 | Bacteria | 3240 |
| 454 | Ga0207713_1026512 | 3300025735 | Bacteria | 2653 |
| 455 | Ga0207713_1031868 | 3300025735 | Bacteria | 2323 |
| 456 | Ga0207713_1045297 | 3300025735 | Bacteria | 1798 |
| 457 | Ga0207713_1048313 | 3300025735 | Bacteria | 1714 |
| 458 | Ga0207713_1050074 | 3300025735 | Bacteria | 1669 |
| 459 | Ga0207680_10254216 | 3300025903 | Bacteria | 1214 |
| 460 | Ga0207647_10001027 | 3300025904 | Bacteria | 21661 |
| 461 | Ga0207647_10011755 | 3300025904 | Bacteria | 6123 |
| 462 | Ga0207647_10019511 | 3300025904 | Bacteria | 4558 |
| 463 | Ga0207647_10047244 | 3300025904 | Bacteria | 2678 |
| 464 | Ga0207647_10058678 | 3300025904 | Bacteria | 2356 |
| 465 | Ga0207647_10078869 | 3300025904 | Bacteria | 1978 |
| 466 | Ga0207705_10003789 | 3300025909 | Bacteria | 11515 |
| 467 | Ga0207705_10052350 | 3300025909 | Bacteria | 2939 |
| 468 | Ga0207654_10063366 | 3300025911 | Bacteria | 2169 |
| 469 | Ga0207654_10507425 | 3300025911 | Bacteria | 852 |
| 470 | Ga0207695_10001113 | 3300025913 | Bacteria | 46732 |
| 471 | Ga0207695_10006823 | 3300025913 | Bacteria | 14704 |
| 472 | Ga0207695_10048057 | 3300025913 | Bacteria | 4509 |
| 473 | Ga0207671_10000299 | 3300025914 | Bacteria | 73023 |
| 474 | Ga0207671_10043195 | 3300025914 | Bacteria | 3333 |
| 475 | Ga0207671_10084192 | 3300025914 | Bacteria | 2388 |
| 476 | Ga0207671_10320464 | 3300025914 | Bacteria | 1226 |
| 477 | Ga0207657_10000003 | 3300025919 | Bacteria | 263148 |
| 478 | Ga0207657_10000885 | 3300025919 | Bacteria | 31657 |
| 479 | Ga0207657_10010571 | 3300025919 | Bacteria | 9203 |
| 480 | Ga0207649_10000022 | 3300025920 | Bacteria | 188959 |
| 481 | Ga0207649_10000326 | 3300025920 | Bacteria | 36079 |
| 482 | Ga0207649_10073741 | 3300025920 | Bacteria | 2187 |
| 483 | Ga0207649_10139362 | 3300025920 | Bacteria | 1657 |
| 484 | Ga0207681_10000384 | 3300025923 | Bacteria | 30968 |
| 485 | Ga0207681_10013092 | 3300025923 | Bacteria | 5128 |
| 486 | Ga0207694_10016667 | 3300025924 | Bacteria | 5553 |
| 487 | Ga0207694_10114426 | 3300025924 | Bacteria | 2148 |
| 488 | Ga0207650_10000138 | 3300025925 | Bacteria | 88802 |
| 489 | Ga0207650_10000735 | 3300025925 | Bacteria | 25242 |
| 490 | Ga0207659_10417359 | 3300025926 | Bacteria | 1125 |
| 491 | Ga0207664_10970221 | 3300025929 | Bacteria | 762 |
| 492 | Ga0207644_10034485 | 3300025931 | Bacteria | 3542 |
| 493 | Ga0207690_10000007 | 3300025932 | Bacteria | 388533 |
| 494 | Ga0207690_10000380 | 3300025932 | Bacteria | 29474 |
| 495 | Ga0207690_10602187 | 3300025932 | Bacteria | 897 |
| 496 | Ga0207706_10000290 | 3300025933 | Bacteria | 54761 |
| 497 | Ga0207706_10059986 | 3300025933 | Bacteria | 3351 |
| 498 | Ga0207686_10019741 | 3300025934 | Bacteria | 3839 |
| 499 | Ga0207686_10071769 | 3300025934 | Bacteria | 2229 |
| 500 | Ga0207686_10623740 | 3300025934 | Bacteria | 851 |
| 501 | Ga0207709_10000086 | 3300025935 | Bacteria | 156177 |
| 502 | Ga0207709_10000096 | 3300025935 | Bacteria | 136585 |
| 503 | Ga0207709_10002767 | 3300025935 | Bacteria | 10809 |
| 504 | Ga0207709_10005890 | 3300025935 | Bacteria | 6919 |
| 505 | Ga0207709_10153078 | 3300025935 | Bacteria | 1599 |
| 506 | Ga0207709_10273361 | 3300025935 | Bacteria | 1245 |
| 507 | Ga0207669_10265808 | 3300025937 | Bacteria | 1286 |
| 508 | Ga0207711_10074677 | 3300025941 | Bacteria | 2949 |
| 509 | Ga0207711_10085911 | 3300025941 | Bacteria | 2757 |
| 510 | Ga0207679_10000002 | 3300025945 | Bacteria | 634491 |
| 511 | Ga0207679_10000027 | 3300025945 | Bacteria | 196811 |
| 512 | Ga0207679_10194351 | 3300025945 | Bacteria | 1690 |
| 513 | Ga0207667_10003560 | 3300025949 | Bacteria | 19249 |
| 514 | Ga0207667_10006579 | 3300025949 | Bacteria | 14061 |
| 515 | Ga0207667_10006899 | 3300025949 | Bacteria | 13718 |
| 516 | Ga0207667_10097174 | 3300025949 | Bacteria | 3040 |
| 517 | Ga0207667_10155758 | 3300025949 | Bacteria | 2351 |
| 518 | Ga0207712_10136731 | 3300025961 | Bacteria | 1875 |
| 519 | Ga0207640_10035401 | 3300025981 | Bacteria | 3124 |
| 520 | Ga0207639_10000442 | 3300026041 | Bacteria | 28717 |
| 521 | Ga0207678_10000319 | 3300026067 | Bacteria | 43404 |
| 522 | Ga0207678_10001465 | 3300026067 | Bacteria | 21657 |
| 523 | Ga0207678_10008540 | 3300026067 | Bacteria | 9025 |
| 524 | Ga0207678_10391346 | 3300026067 | Bacteria | 1202 |
| 525 | Ga0207702_10000504 | 3300026078 | Bacteria | 44031 |
| 526 | Ga0207702_10049899 | 3300026078 | Bacteria | 3532 |
| 527 | Ga0207674_10456110 | 3300026116 | Bacteria | 1235 |
| 528 | Ga0207674_11209831 | 3300026116 | Bacteria | 725 |
| 529 | Ga0207675_100057916 | 3300026118 | Bacteria | 3616 |
| 530 | Ga0207683_10193050 | 3300026121 | Bacteria | 1849 |
| 531 | Ga0207698_10086845 | 3300026142 | Bacteria | 2545 |
| 532 | Ga0209281_1000016 | 3300027111 | Bacteria | 588107 |
| 533 | Ga0209281_1000019 | 3300027111 | Bacteria | 576164 |
| 534 | Ga0209281_1015383 | 3300027111 | Bacteria | 1597 |
| 535 | Ga0209389_1000195 | 3300027296 | Bacteria | 44002 |
| 536 | Ga0209389_1044274 | 3300027296 | Bacteria | 3307 |
| 537 | Ga0209371_1000066 | 3300027312 | Bacteria | 212660 |
| 538 | Ga0209371_1000076 | 3300027312 | Bacteria | 195166 |
| 539 | Ga0209371_1003220 | 3300027312 | Bacteria | 8200 |
| 540 | Ga0209371_1008067 | 3300027312 | Bacteria | 3557 |
| 541 | Ga0209981_1017575 | 3300027378 | Bacteria | 1010 |
| 542 | Ga0209982_1018467 | 3300027552 | Bacteria | 1066 |
| 543 | Ga0209970_1015628 | 3300027614 | Bacteria | 1264 |
| 544 | Ga0210002_1032004 | 3300027617 | Bacteria | 876 |
| 545 | Ga0209282_1109673 | 3300027666 | Bacteria | 1403 |
| 546 | Ga0209974_10058877 | 3300027876 | Bacteria | 1299 |
| 547 | Ga0207428_10009753 | 3300027907 | Bacteria | 8605 |
| 548 | Ga0207428_10349858 | 3300027907 | Bacteria | 1087 |
| 549 | Ga0207428_10448691 | 3300027907 | Bacteria | 941 |
| 550 | Ga0268266_10114843 | 3300028379 | Bacteria | 2389 |
| 551 | Ga0268266_10823950 | 3300028379 | Bacteria | 896 |
| 552 | Ga0307515_10040414 | 3300028794 | Bacteria | 7374 |
| 553 | Ga0265338_10296066 | 3300028800 | Bacteria | 1178 |
| 554 | Ga0268256_1000063 | 3300030500 | Bacteria | 212660 |
| 555 | Ga0268256_1000087 | 3300030500 | Bacteria | 157659 |
| 556 | Ga0268256_1001416 | 3300030500 | Bacteria | 14539 |
| 557 | Ga0268256_1005103 | 3300030500 | Bacteria | 5238 |
| 558 | Ga0316176_1139831 | 3300030732 | Bacteria | 812 |
| 559 | Ga0314311_1125624 | 3300030733 | Bacteria | 2082 |
| 560 | Ga0316179_1002808 | 3300030734 | Bacteria | 2185 |
| 561 | Ga0316178_1083275 | 3300030735 | Bacteria | 51744 |
| 562 | Ga0316181_1005751 | 3300030744 | Bacteria | 2730 |
| 563 | Ga0307408_100000002 | 3300031548 | Bacteria | 827227 |
| 564 | Ga0307408_100004532 | 3300031548 | Bacteria | 9417 |
| 565 | Ga0307408_100736009 | 3300031548 | Bacteria | 889 |
| 566 | Ga0307408_101320937 | 3300031548 | Bacteria | 676 |
| 567 | Ga0307405_10265306 | 3300031731 | Bacteria | 1285 |
| 568 | Ga0307405_10657798 | 3300031731 | Bacteria | 862 |
| 569 | Ga0307413_10163090 | 3300031824 | Bacteria | 1568 |
| 570 | Ga0307406_10991834 | 3300031901 | Bacteria | 720 |
| 571 | Ga0307412_10000095 | 3300031911 | Bacteria | 75002 |
| 572 | Ga0307412_10267713 | 3300031911 | Bacteria | 1335 |
| 573 | Ga0307412_10373368 | 3300031911 | Bacteria | 1152 |
| 574 | Ga0307409_101390269 | 3300031995 | Bacteria | 728 |
| 575 | Ga0307416_100182275 | 3300032002 | Bacteria | 1969 |
| 576 | Ga0307414_10460059 | 3300032004 | Bacteria | 1118 |
| 577 | Ga0307411_10280699 | 3300032005 | Bacteria | 1325 |
| 578 | Ga0307510_10035520 | 3300033180 | Bacteria | 5564 |
| 579 | Ga0395899_0006229 | 3300037312 | Bacteria | 9242 |
| 580 | Ga0395899_0029500 | 3300037312 | Bacteria | 4126 |
| 581 | Ga0395899_0068100 | 3300037312 | Bacteria | 2611 |
| 582 | Ga0395899_0078539 | 3300037312 | Bacteria | 2405 |
| 583 | Ga0395899_0082115 | 3300037312 | Bacteria | 2344 |
| 584 | Ga0395899_0105700 | 3300037312 | Bacteria | 2027 |
| 585 | Ga0395899_0213408 | 3300037312 | Bacteria | 1340 |
| 586 | Ga0395900_0001069 | 3300037418 | Bacteria | 34842 |
| 587 | Ga0395900_0001922 | 3300037418 | Bacteria | 23569 |
| 588 | Ga0395900_0096528 | 3300037418 | Bacteria | 3037 |
| 589 | Ga0395900_0101315 | 3300037418 | Bacteria | 2958 |
| 590 | Ga0395900_0164362 | 3300037418 | Bacteria | 2262 |
| 591 | Ga0395900_0268621 | 3300037418 | Bacteria | 1701 |
| 592 | Ga0395900_0276234 | 3300037418 | Bacteria | 1673 |
| 593 | Ga0395900_0306495 | 3300037418 | Bacteria | 1572 |
| 594 | Ga0395900_0310588 | 3300037418 | Bacteria | 1560 |
| 595 | Ga0395900_0547016 | 3300037418 | Bacteria | 1103 |
| 596 | Ga0395898_0001705 | 3300037466 | Bacteria | 29237 |
| 597 | Ga0395898_0013543 | 3300037466 | Bacteria | 8397 |
| 598 | Ga0395898_0091311 | 3300037466 | Bacteria | 2930 |
| 599 | Ga0395898_0098228 | 3300037466 | Bacteria | 2811 |
| 600 | Ga0395898_0113022 | 3300037466 | Bacteria | 2602 |
| 601 | Ga0395898_0155359 | 3300037466 | Bacteria | 2188 |
| 602 | Ga0395898_0236639 | 3300037466 | Bacteria | 1741 |
| 603 | Ga0395905_0000048 | 3300037471 | Bacteria | 236537 |
| 604 | Ga0395905_0000144 | 3300037471 | Bacteria | 117622 |
| 605 | Ga0395905_0007757 | 3300037471 | Bacteria | 10646 |
| 606 | Ga0395905_0032686 | 3300037471 | Bacteria | 4892 |
| 607 | Ga0395905_0048375 | 3300037471 | Bacteria | 3985 |
| 608 | Ga0395905_0215767 | 3300037471 | Bacteria | 1797 |
| 609 | Ga0395905_0322946 | 3300037471 | Bacteria | 1433 |
| 610 | Ga0395905_0437125 | 3300037471 | Bacteria | 1205 |
| 611 | Ga0395905_0571803 | 3300037471 | Bacteria | 1031 |
| 612 | Ga0395905_0790484 | 3300037471 | Bacteria | 852 |
| 613 | Ga0395901_0000081 | 3300038443 | Bacteria | 130244 |
| 614 | Ga0395901_0000157 | 3300038443 | Bacteria | 88435 |
| 615 | Ga0395901_0014499 | 3300038443 | Bacteria | 8015 |
| 616 | Ga0395901_0046848 | 3300038443 | Bacteria | 4491 |
| 617 | Ga0395901_0075354 | 3300038443 | Bacteria | 3519 |
| 618 | Ga0395901_0096738 | 3300038443 | Bacteria | 3094 |
| 619 | Ga0395901_0422100 | 3300038443 | Bacteria | 1367 |
| 620 | Ga0395901_0914402 | 3300038443 | Bacteria | 858 |
| 621 | Ga0395901_1029648 | 3300038443 | Bacteria | 797 |
| 622 | Ga0395901_1243653 | 3300038443 | Bacteria | 708 |
| 623 | Ga0237819_03039 | 3300038705 | Bacteria | 3111 |
| 624 | Ga0436365_0041924 | 3300039437 | Bacteria | 4210 |
| 625 | Ga0436360_0381606 | 3300039438 | Bacteria | 1293 |
| 626 | Ga0436361_1016186 | 3300039447 | Bacteria | 5055 |
| 627 | Ga0436361_1024429 | 3300039447 | Bacteria | 2114 |
| 628 | Ga0439436_0042762 | 3300041404 | Bacteria | 1294 |
| 629 | Ga0439438_015011 | 3300041405 | Bacteria | 2290 |
| 630 | Ga0439438_024273 | 3300041405 | Bacteria | 1660 |
| 631 | Ga0439438_088737 | 3300041405 | Bacteria | 754 |
| 632 | Ga0439447_008617 | 3300041407 | Bacteria | 3148 |
| 633 | Ga0439447_011715 | 3300041407 | Bacteria | 2544 |
| 634 | Ga0439466_0005646 | 3300041411 | Bacteria | 4769 |
| 635 | Ga0439466_0026215 | 3300041411 | Bacteria | 2028 |
| 636 | Ga0439466_0033891 | 3300041411 | Bacteria | 1733 |
| 637 | Ga0439466_0043859 | 3300041411 | Bacteria | 1484 |
| 638 | Ga0451807_2026621 | 3300041486 | Bacteria | 767 |
| 639 | Ga0451843_0886000 | 3300041509 | Bacteria | 1096 |
| 640 | Ga0439448_0000277 | 3300042005 | Bacteria | 11224 |
| 641 | Ga0439448_0024425 | 3300042005 | Bacteria | 1890 |
| 642 | Ga0439432_023353 | 3300042006 | Bacteria | 2037 |
| 643 | Ga0439450_009019 | 3300042008 | Bacteria | 1880 |
| 644 | Ga0439450_018690 | 3300042008 | Bacteria | 1459 |
| 645 | Ga0439451_016205 | 3300042009 | Bacteria | 1502 |
| 646 | Ga0439452_000728 | 3300042010 | Bacteria | 15897 |
| 647 | Ga0439452_009508 | 3300042010 | Bacteria | 2860 |
| 648 | Ga0439452_033599 | 3300042010 | Bacteria | 1244 |
| 649 | Ga0439452_089382 | 3300042010 | Bacteria | 666 |
| 650 | Ga0439455_0085699 | 3300042012 | Bacteria | 860 |
| 651 | Ga0439456_010104 | 3300042013 | Bacteria | 1949 |
| 652 | Ga0439456_029395 | 3300042013 | Bacteria | 1173 |
| 653 | Ga0439456_098190 | 3300042013 | Bacteria | 661 |
| 654 | Ga0439463_018423 | 3300042016 | Bacteria | 1737 |
| 655 | Ga0439463_071792 | 3300042016 | Bacteria | 887 |
| 656 | Ga0450911_004367 | 3300042115 | Bacteria | 2325 |
| 657 | Ga0450911_017530 | 3300042115 | Bacteria | 942 |
| 658 | Ga0450890_002721 | 3300042127 | Bacteria | 2400 |
| 659 | Ga0450900_014225 | 3300042136 | Bacteria | 1060 |
| 660 | Ga0450903_005417 | 3300042138 | Bacteria | 2136 |
| 661 | Ga0450904_003726 | 3300042139 | Bacteria | 1626 |
| 662 | Ga0450905_005260 | 3300042142 | Bacteria | 1737 |
| 663 | Ga0450906_006219 | 3300042145 | Bacteria | 2418 |
| 664 | Ga0450907_000587 | 3300042146 | Bacteria | 9757 |
| 665 | Ga0450907_002130 | 3300042146 | Bacteria | 3896 |
| 666 | Ga0439446_0006010 | 3300042156 | Bacteria | 3145 |
| 667 | Ga0439446_0055313 | 3300042156 | Bacteria | 1191 |
| 668 | Ga0439458_0013096 | 3300042157 | Bacteria | 1865 |
| 669 | Ga0450908_038983 | 3300042184 | Bacteria | 823 |
| 670 | Ga0450909_011634 | 3300042185 | Bacteria | 1289 |
| 671 | Ga0439464_0013453 | 3300042439 | Bacteria | 2191 |
| 672 | Ga0439464_0107026 | 3300042439 | Bacteria | 853 |
| 673 | Ga0439460_0009609 | 3300042461 | Bacteria | 2457 |
| 674 | Ga0450918_022186 | 3300042531 | Bacteria | 1109 |
| 675 | Ga0450901_007013 | 3300042533 | Bacteria | 1161 |
| 676 | Ga0466969_0004304 | 3300044656 | Bacteria | 7573 |
| 677 | Ga0466969_0006179 | 3300044656 | Bacteria | 6375 |
| 678 | Ga0466969_0017551 | 3300044656 | Bacteria | 3734 |
| 679 | Ga0466969_0068969 | 3300044656 | Bacteria | 1703 |
| 680 | Ga0466969_0082322 | 3300044656 | Bacteria | 1534 |
| 681 | Ga0466972_0010584 | 3300044658 | Bacteria | 4628 |
| 682 | Ga0466973_0010148 | 3300044659 | Bacteria | 8683 |
| 683 | Ga0466965_0003673 | 3300044683 | Bacteria | 6771 |
| 684 | Ga0466965_0015457 | 3300044683 | Bacteria | 3626 |
| 685 | Ga0466966_0000009 | 3300044684 | Bacteria | 150954 |
| 686 | Ga0466966_0002666 | 3300044684 | Bacteria | 11694 |
| 687 | Ga0466966_0446945 | 3300044684 | Bacteria | 777 |
| 688 | Ga0466961_0001729 | 3300044693 | Bacteria | 13578 |
| 689 | Ga0466961_0021964 | 3300044693 | Bacteria | 4106 |
| 690 | Ga0466961_0104073 | 3300044693 | Bacteria | 1787 |
| 691 | Ga0466961_0144769 | 3300044693 | Bacteria | 1486 |
| 692 | Ga0466961_0164022 | 3300044693 | Bacteria | 1384 |
| 693 | Ga0466963_0004763 | 3300044694 | Bacteria | 7911 |
| 694 | Ga0466963_0108759 | 3300044694 | Bacteria | 1901 |
| 695 | Ga0466963_0351380 | 3300044694 | Bacteria | 1038 |
| 696 | Ga0466963_0471545 | 3300044694 | Bacteria | 886 |
| 697 | Ga0466968_0376707 | 3300044735 | Bacteria | 693 |
| 698 | Ga0466970_0007794 | 3300044765 | Bacteria | 5372 |
| 699 | Ga0466970_0063990 | 3300044765 | Bacteria | 1972 |
| 700 | Ga0466970_0109451 | 3300044765 | Bacteria | 1508 |
| 701 | Ga0466957_0008641 | 3300044842 | Bacteria | 5798 |
| 702 | Ga0466957_0055369 | 3300044842 | Bacteria | 2424 |
| 703 | Ga0466957_0058628 | 3300044842 | Bacteria | 2359 |
| 704 | Ga0466957_0137722 | 3300044842 | Bacteria | 1570 |
| 705 | Ga0466960_0126579 | 3300044901 | Bacteria | 1343 |
| 706 | Ga0466959_0001367 | 3300045049 | Bacteria | 14894 |
| 707 | Ga0466959_0007139 | 3300045049 | Bacteria | 7818 |
| 708 | Ga0466959_0015359 | 3300045049 | Bacteria | 5576 |
| 709 | Ga0466959_0070837 | 3300045049 | Bacteria | 2525 |
| 710 | Ga0466958_0012698 | 3300045836 | Bacteria | 4776 |
| 711 | Ga0466958_0014712 | 3300045836 | Bacteria | 4469 |
| 712 | Ga0466958_0028692 | 3300045836 | Bacteria | 3300 |
| 713 | Ga0466958_0051920 | 3300045836 | Bacteria | 2484 |
| 714 | Ga0495617_077854 | 3300046452 | Bacteria | 1087 |
| 715 | Ga0495627_000073 | 3300046453 | Bacteria | 123319 |
| 716 | Ga0495627_001834 | 3300046453 | Bacteria | 11297 |
| 717 | Ga0495627_006045 | 3300046453 | Bacteria | 4790 |
| 718 | Ga0495627_017519 | 3300046453 | Bacteria | 2433 |
| 719 | Ga0495592_0105775 | 3300046454 | Bacteria | 1998 |
| 720 | Ga0495592_0124916 | 3300046454 | Bacteria | 1807 |
| 721 | Ga0495603_0119288 | 3300046455 | Bacteria | 1537 |
| 722 | Ga0495590_0001159 | 3300046457 | Bacteria | 11537 |
| 723 | Ga0495590_0006265 | 3300046457 | Bacteria | 4657 |
| 724 | Ga0495590_0045663 | 3300046457 | Bacteria | 1528 |
| 725 | Ga0495591_001276 | 3300046458 | Bacteria | 16086 |
| 726 | Ga0495591_007032 | 3300046458 | Bacteria | 4852 |
| 727 | Ga0495591_029212 | 3300046458 | Bacteria | 1677 |
| 728 | Ga0495591_050877 | 3300046458 | Bacteria | 1132 |
| 729 | Ga0495629_0000137 | 3300046459 | Bacteria | 64048 |
| 730 | Ga0495629_0000758 | 3300046459 | Bacteria | 26094 |
| 731 | Ga0495629_0004710 | 3300046459 | Bacteria | 10227 |
| 732 | Ga0495629_0075609 | 3300046459 | Bacteria | 2352 |
| 733 | Ga0495638_0045977 | 3300046460 | Bacteria | 2744 |
| 734 | Ga0495638_0063705 | 3300046460 | Bacteria | 2272 |
| 735 | Ga0495638_0110718 | 3300046460 | Bacteria | 1631 |
| 736 | Ga0495638_0253589 | 3300046460 | Bacteria | 969 |
| 737 | Ga0495638_0283298 | 3300046460 | Bacteria | 899 |
| 738 | Ga0495641_0052028 | 3300046461 | Bacteria | 1868 |
| 739 | Ga0495651_0021068 | 3300046462 | Bacteria | 5063 |
| 740 | Ga0495651_0106421 | 3300046462 | Bacteria | 2079 |
| 741 | Ga0495651_0289306 | 3300046462 | Bacteria | 1103 |
| 742 | Ga0495653_0054926 | 3300046463 | Bacteria | 3041 |
| 743 | Ga0495653_0071418 | 3300046463 | Bacteria | 2595 |
| 744 | Ga0495653_0089718 | 3300046463 | Bacteria | 2251 |
| 745 | Ga0495653_0153329 | 3300046463 | Bacteria | 1607 |
| 746 | Ga0495650_0000226 | 3300046471 | Bacteria | 115930 |
| 747 | Ga0495650_0005961 | 3300046471 | Bacteria | 7727 |
| 748 | Ga0495650_0013190 | 3300046471 | Bacteria | 4388 |
| 749 | Ga0495650_0027642 | 3300046471 | Bacteria | 2617 |
| 750 | Ga0495650_0064766 | 3300046471 | Bacteria | 1452 |
| 751 | Ga0495650_0068416 | 3300046471 | Bacteria | 1401 |
| 752 | Ga0495580_0000703 | 3300046472 | Bacteria | 28614 |
| 753 | Ga0495580_0010665 | 3300046472 | Bacteria | 7138 |
| 754 | Ga0495580_0016508 | 3300046472 | Bacteria | 5538 |
| 755 | Ga0495580_0049717 | 3300046472 | Bacteria | 2966 |
| 756 | Ga0495580_0064624 | 3300046472 | Bacteria | 2565 |
| 757 | Ga0495580_0078208 | 3300046472 | Bacteria | 2307 |
| 758 | Ga0495580_0118813 | 3300046472 | Bacteria | 1835 |
| 759 | Ga0495580_0360130 | 3300046472 | Bacteria | 984 |
| 760 | Ga0495582_0071388 | 3300046473 | Bacteria | 1921 |
| 761 | Ga0495582_0161717 | 3300046473 | Bacteria | 1273 |
| 762 | Ga0495582_0277826 | 3300046473 | Bacteria | 962 |
| 763 | Ga0495605_0000019 | 3300046474 | Bacteria | 270010 |
| 764 | Ga0495605_0000342 | 3300046474 | Bacteria | 45965 |
| 765 | Ga0495605_0001460 | 3300046474 | Bacteria | 15450 |
| 766 | Ga0495605_0014706 | 3300046474 | Bacteria | 4278 |
| 767 | Ga0495605_0016413 | 3300046474 | Bacteria | 4008 |
| 768 | Ga0495605_0116059 | 3300046474 | Bacteria | 1217 |
| 769 | Ga0495605_0125302 | 3300046474 | Bacteria | 1162 |
| 770 | Ga0495605_0175880 | 3300046474 | Bacteria | 943 |
| 771 | Ga0495664_0007353 | 3300046477 | Bacteria | 6116 |
| 772 | Ga0495664_0107192 | 3300046477 | Bacteria | 1685 |
| 773 | Ga0495664_0225610 | 3300046477 | Bacteria | 1134 |
| 774 | Ga0495584_0001972 | 3300046491 | Bacteria | 11805 |
| 775 | Ga0495584_0017445 | 3300046491 | Bacteria | 3655 |
| 776 | Ga0495584_0246831 | 3300046491 | Bacteria | 908 |
| 777 | Ga0495585_0112494 | 3300046492 | Bacteria | 1446 |
| 778 | Ga0495585_0241404 | 3300046492 | Bacteria | 904 |
| 779 | Ga0495594_0001675 | 3300046499 | Bacteria | 11522 |
| 780 | Ga0495594_0127206 | 3300046499 | Bacteria | 1442 |
| 781 | Ga0495596_0002590 | 3300046500 | Bacteria | 9610 |
| 782 | Ga0495596_0048064 | 3300046500 | Bacteria | 1673 |
| 783 | Ga0495596_0153768 | 3300046500 | Bacteria | 893 |
| 784 | Ga0495596_0158162 | 3300046500 | Bacteria | 880 |
| 785 | Ga0495607_0000773 | 3300046501 | Bacteria | 30620 |
| 786 | Ga0495607_0001163 | 3300046501 | Bacteria | 23816 |
| 787 | Ga0495607_0002362 | 3300046501 | Bacteria | 15412 |
| 788 | Ga0495607_0005030 | 3300046501 | Bacteria | 9587 |
| 789 | Ga0495607_0030889 | 3300046501 | Bacteria | 3283 |
| 790 | Ga0495607_0032490 | 3300046501 | Bacteria | 3185 |
| 791 | Ga0495607_0043713 | 3300046501 | Bacteria | 2647 |
| 792 | Ga0495607_0052720 | 3300046501 | Bacteria | 2354 |
| 793 | Ga0495607_0077872 | 3300046501 | Bacteria | 1830 |
| 794 | Ga0495607_0104069 | 3300046501 | Bacteria | 1515 |
| 795 | Ga0495607_0164793 | 3300046501 | Bacteria | 1123 |
| 796 | Ga0495607_0244881 | 3300046501 | Bacteria | 865 |
| 797 | Ga0495583_0000097 | 3300046506 | Bacteria | 149533 |
| 798 | Ga0495583_0002802 | 3300046506 | Bacteria | 14305 |
| 799 | Ga0495583_0010285 | 3300046506 | Bacteria | 5474 |
| 800 | Ga0495583_0030641 | 3300046506 | Bacteria | 2616 |
| 801 | Ga0495606_0000066 | 3300046507 | Bacteria | 181028 |
| 802 | Ga0495606_0000862 | 3300046507 | Bacteria | 45436 |
| 803 | Ga0495606_0017374 | 3300046507 | Bacteria | 5440 |
| 804 | Ga0495606_0025160 | 3300046507 | Bacteria | 4270 |
| 805 | Ga0495606_0025587 | 3300046507 | Bacteria | 4222 |
| 806 | Ga0495606_0031661 | 3300046507 | Bacteria | 3673 |
| 807 | Ga0495606_0033155 | 3300046507 | Bacteria | 3566 |
| 808 | Ga0495606_0129780 | 3300046507 | Bacteria | 1499 |
| 809 | Ga0495606_0160261 | 3300046507 | Bacteria | 1313 |
| 810 | Ga0495606_0200446 | 3300046507 | Bacteria | 1138 |
| 811 | Ga0495606_0388850 | 3300046507 | Bacteria | 730 |
| 812 | Ga0495610_0000745 | 3300046512 | Bacteria | 30877 |
| 813 | Ga0495610_0005941 | 3300046512 | Bacteria | 8548 |
| 814 | Ga0495610_0008139 | 3300046512 | Bacteria | 6847 |
| 815 | Ga0495610_0034706 | 3300046512 | Bacteria | 2595 |
| 816 | Ga0495610_0135980 | 3300046512 | Bacteria | 1062 |
| 817 | Ga0495616_0016126 | 3300046513 | Bacteria | 4140 |
| 818 | Ga0495616_0027863 | 3300046513 | Bacteria | 2995 |
| 819 | Ga0495616_0058525 | 3300046513 | Bacteria | 1897 |
| 820 | Ga0495616_0166841 | 3300046513 | Bacteria | 987 |
| 821 | Ga0495616_0211290 | 3300046513 | Bacteria | 848 |
| 822 | Ga0495618_0012697 | 3300046514 | Bacteria | 5119 |
| 823 | Ga0495618_0176056 | 3300046514 | Bacteria | 1360 |
| 824 | Ga0495618_0212213 | 3300046514 | Bacteria | 1223 |
| 825 | Ga0495620_0000199 | 3300046515 | Bacteria | 46081 |
| 826 | Ga0495620_0012809 | 3300046515 | Bacteria | 4313 |
| 827 | Ga0495620_0060575 | 3300046515 | Bacteria | 1577 |
| 828 | Ga0495620_0061141 | 3300046515 | Bacteria | 1568 |
| 829 | Ga0495620_0105447 | 3300046515 | Bacteria | 1120 |
| 830 | Ga0495628_0006690 | 3300046516 | Bacteria | 10051 |
| 831 | Ga0495628_0077898 | 3300046516 | Bacteria | 2578 |
| 832 | Ga0495630_0006496 | 3300046517 | Bacteria | 8324 |
| 833 | Ga0495630_0075178 | 3300046517 | Bacteria | 2545 |
| 834 | Ga0495630_0143959 | 3300046517 | Bacteria | 1812 |
| 835 | Ga0495630_0174489 | 3300046517 | Bacteria | 1638 |
| 836 | Ga0495631_0002478 | 3300046518 | Bacteria | 10389 |
| 837 | Ga0495632_0011402 | 3300046519 | Bacteria | 5187 |
| 838 | Ga0495632_0059407 | 3300046519 | Bacteria | 1860 |
| 839 | Ga0495632_0122816 | 3300046519 | Bacteria | 1212 |
| 840 | Ga0495637_0000695 | 3300046520 | Bacteria | 23132 |
| 841 | Ga0495637_0018892 | 3300046520 | Bacteria | 3192 |
| 842 | Ga0495637_0033292 | 3300046520 | Bacteria | 2264 |
| 843 | Ga0495637_0089247 | 3300046520 | Bacteria | 1218 |
| 844 | Ga0495637_0140378 | 3300046520 | Bacteria | 917 |
| 845 | Ga0495643_0000778 | 3300046522 | Bacteria | 35560 |
| 846 | Ga0495643_0011876 | 3300046522 | Bacteria | 5279 |
| 847 | Ga0495643_0086585 | 3300046522 | Bacteria | 1622 |
| 848 | Ga0495644_0001886 | 3300046523 | Bacteria | 8443 |
| 849 | Ga0495644_0043389 | 3300046523 | Bacteria | 1692 |
| 850 | Ga0495648_0023932 | 3300046524 | Bacteria | 4170 |
| 851 | Ga0495648_0087115 | 3300046524 | Bacteria | 1759 |
| 852 | Ga0495648_0099040 | 3300046524 | Bacteria | 1613 |
| 853 | Ga0495648_0135471 | 3300046524 | Bacteria | 1303 |
| 854 | Ga0495648_0143350 | 3300046524 | Bacteria | 1254 |
| 855 | Ga0495648_0169697 | 3300046524 | Bacteria | 1119 |
| 856 | Ga0495648_0229511 | 3300046524 | Bacteria | 910 |
| 857 | Ga0495648_0281437 | 3300046524 | Bacteria | 788 |
| 858 | Ga0495666_0046001 | 3300046526 | Bacteria | 2105 |
| 859 | Ga0495666_0065631 | 3300046526 | Bacteria | 1731 |
| 860 | Ga0495666_0096618 | 3300046526 | Bacteria | 1392 |
| 861 | Ga0495666_0157182 | 3300046526 | Bacteria | 1055 |
| 862 | Ga0495642_0105743 | 3300046528 | Bacteria | 1201 |
| 863 | Ga0495652_0013748 | 3300046529 | Bacteria | 7283 |
| 864 | Ga0495652_0077639 | 3300046529 | Bacteria | 2751 |
| 865 | Ga0495652_0104805 | 3300046529 | Bacteria | 2286 |
| 866 | Ga0495652_0308066 | 3300046529 | Bacteria | 1148 |
| 867 | Ga0495652_0319584 | 3300046529 | Bacteria | 1122 |
| 868 | Ga0495654_0002890 | 3300046530 | Bacteria | 10774 |
| 869 | Ga0495654_0020248 | 3300046530 | Bacteria | 3469 |
| 870 | Ga0495654_0032212 | 3300046530 | Bacteria | 2657 |
| 871 | Ga0495654_0037996 | 3300046530 | Bacteria | 2410 |
| 872 | Ga0495654_0044327 | 3300046530 | Bacteria | 2200 |
| 873 | Ga0495654_0045050 | 3300046530 | Bacteria | 2177 |
| 874 | Ga0495654_0069121 | 3300046530 | Bacteria | 1677 |
| 875 | Ga0495654_0070608 | 3300046530 | Bacteria | 1656 |
| 876 | Ga0495654_0128819 | 3300046530 | Bacteria | 1138 |
| 877 | Ga0495654_0229886 | 3300046530 | Bacteria | 780 |
| 878 | Ga0495665_0001219 | 3300046531 | Bacteria | 13732 |
| 879 | Ga0495665_0002867 | 3300046531 | Bacteria | 9321 |
| 880 | Ga0495665_0012093 | 3300046531 | Bacteria | 4672 |
| 881 | Ga0495665_0057582 | 3300046531 | Bacteria | 2051 |
| 882 | Ga0495665_0103915 | 3300046531 | Bacteria | 1490 |
| 883 | Ga0495665_0225210 | 3300046531 | Bacteria | 969 |
| 884 | Ga0495640_0009812 | 3300046533 | Bacteria | 7432 |
| 885 | Ga0495640_0049346 | 3300046533 | Bacteria | 2903 |
| 886 | Ga0495640_0133440 | 3300046533 | Bacteria | 1605 |
| 887 | Ga0495586_0132326 | 3300046535 | Bacteria | 1397 |
| 888 | Ga0495587_0014233 | 3300046536 | Bacteria | 4993 |
| 889 | Ga0495587_0116857 | 3300046536 | Bacteria | 1529 |
| 890 | Ga0495587_0144163 | 3300046536 | Bacteria | 1358 |
| 891 | Ga0495609_0000057 | 3300046538 | Bacteria | 143793 |
| 892 | Ga0495609_0000076 | 3300046538 | Bacteria | 120170 |
| 893 | Ga0495609_0000223 | 3300046538 | Bacteria | 55773 |
| 894 | Ga0495609_0121495 | 3300046538 | Bacteria | 1122 |
| 895 | Ga0495597_0000202 | 3300046542 | Bacteria | 54803 |
| 896 | Ga0495597_0038812 | 3300046542 | Bacteria | 2133 |
| 897 | Ga0495597_0061070 | 3300046542 | Bacteria | 1642 |
| 898 | Ga0495597_0066881 | 3300046542 | Bacteria | 1556 |
| 899 | Ga0495597_0094157 | 3300046542 | Bacteria | 1268 |
| 900 | Ga0495597_0200856 | 3300046542 | Bacteria | 798 |
| 901 | Ga0495645_0038240 | 3300046543 | Bacteria | 3500 |
| 902 | Ga0495645_0041914 | 3300046543 | Bacteria | 3337 |
| 903 | Ga0495645_0082632 | 3300046543 | Bacteria | 2303 |
| 904 | Ga0495645_0128508 | 3300046543 | Bacteria | 1778 |
| 905 | Ga0495622_0000287 | 3300046557 | Bacteria | 38482 |
| 906 | Ga0495633_0000038 | 3300046558 | Bacteria | 182144 |
| 907 | Ga0495633_0308907 | 3300046558 | Bacteria | 718 |
| 908 | Ga0495667_0095636 | 3300046559 | Bacteria | 1923 |
| 909 | Ga0495668_0023511 | 3300046616 | Bacteria | 3512 |
| 910 | Ga0495634_0096031 | 3300046642 | Bacteria | 1919 |
| 911 | Ga0495634_0155823 | 3300046642 | Bacteria | 1442 |
| 912 | Ga0495634_0191215 | 3300046642 | Bacteria | 1276 |
| 913 | Ga0495611_0004652 | 3300046648 | Bacteria | 5898 |
| 914 | Ga0495611_0034588 | 3300046648 | Bacteria | 2234 |
| 915 | Ga0495611_0204377 | 3300046648 | Bacteria | 921 |
| 916 | Ga0495625_0000027 | 3300046660 | Bacteria | 258545 |
| 917 | Ga0495625_0114311 | 3300046660 | Bacteria | 1843 |
| 918 | Ga0495635_0003260 | 3300046663 | Bacteria | 11194 |
| 919 | Ga0495635_0031526 | 3300046663 | Bacteria | 3679 |
| 920 | Ga0495635_0067239 | 3300046663 | Bacteria | 2458 |
| 921 | Ga0495661_0000027 | 3300046665 | Bacteria | 184297 |
| 922 | Ga0495661_0000174 | 3300046665 | Bacteria | 74521 |
| 923 | Ga0495661_0000605 | 3300046665 | Bacteria | 36676 |
| 924 | Ga0495661_0011245 | 3300046665 | Bacteria | 6073 |
| 925 | Ga0495661_0026657 | 3300046665 | Bacteria | 3720 |
| 926 | Ga0495661_0053064 | 3300046665 | Bacteria | 2440 |
| 927 | Ga0495661_0057156 | 3300046665 | Bacteria | 2330 |
| 928 | Ga0495599_0115987 | 3300046678 | Bacteria | 1666 |
| 929 | Ga0495623_0005611 | 3300046679 | Bacteria | 8191 |
| 930 | Ga0495623_0086152 | 3300046679 | Bacteria | 1936 |
| 931 | Ga0495623_0095211 | 3300046679 | Bacteria | 1820 |
| 932 | Ga0495623_0107684 | 3300046679 | Bacteria | 1692 |
| 933 | Ga0495646_0013419 | 3300046680 | Bacteria | 5209 |
| 934 | Ga0495646_0021175 | 3300046680 | Bacteria | 4110 |
| 935 | Ga0495646_0045895 | 3300046680 | Bacteria | 2666 |
| 936 | Ga0495646_0083368 | 3300046680 | Bacteria | 1858 |
| 937 | Ga0495646_0114856 | 3300046680 | Bacteria | 1529 |
| 938 | Ga0495646_0273778 | 3300046680 | Bacteria | 899 |
| 939 | Ga0495669_0009043 | 3300046684 | Bacteria | 4198 |
| 940 | Ga0495669_0028636 | 3300046684 | Bacteria | 2440 |
| 941 | Ga0495613_0014252 | 3300046689 | Bacteria | 5900 |
| 942 | Ga0495613_0016752 | 3300046689 | Bacteria | 5457 |
| 943 | Ga0495624_0002935 | 3300046690 | Bacteria | 12761 |
| 944 | Ga0495624_0008831 | 3300046690 | Bacteria | 7006 |
| 945 | Ga0495624_0016596 | 3300046690 | Bacteria | 4956 |
| 946 | Ga0495624_0017350 | 3300046690 | Bacteria | 4834 |
| 947 | Ga0495624_0029501 | 3300046690 | Bacteria | 3578 |
| 948 | Ga0495624_0066377 | 3300046690 | Bacteria | 2252 |
| 949 | Ga0495624_0158189 | 3300046690 | Bacteria | 1384 |
| 950 | Ga0495624_0226695 | 3300046690 | Bacteria | 1132 |
| 951 | Ga0495624_0452060 | 3300046690 | Bacteria | 770 |
| 952 | Ga0495670_0007385 | 3300046691 | Bacteria | 5401 |
| 953 | Ga0495670_0028245 | 3300046691 | Bacteria | 2781 |
| 954 | Ga0495670_0045036 | 3300046691 | Bacteria | 2202 |
| 955 | Ga0495671_0009807 | 3300046692 | Bacteria | 5333 |
| 956 | Ga0495671_0014512 | 3300046692 | Bacteria | 4238 |
| 957 | Ga0495671_0024267 | 3300046692 | Bacteria | 3159 |
| 958 | Ga0495671_0105447 | 3300046692 | Bacteria | 1376 |
| 959 | Ga0495671_0118954 | 3300046692 | Bacteria | 1289 |
| 960 | Ga0495649_0004871 | 3300046694 | Bacteria | 8674 |
| 961 | Ga0495649_0028311 | 3300046694 | Bacteria | 3105 |
| 962 | Ga0495649_0033152 | 3300046694 | Bacteria | 2842 |
| 963 | Ga0495649_0037820 | 3300046694 | Bacteria | 2648 |
| 964 | Ga0495649_0106211 | 3300046694 | Bacteria | 1490 |
| 965 | Ga0495649_0170522 | 3300046694 | Bacteria | 1139 |
| 966 | Ga0495649_0217058 | 3300046694 | Bacteria | 990 |
| 967 | Ga0495649_0220327 | 3300046694 | Bacteria | 981 |
| 968 | Ga0495589_0019602 | 3300046794 | Bacteria | 3463 |
| 969 | Ga0495589_0058040 | 3300046794 | Bacteria | 1903 |
| 970 | Ga0495589_0060027 | 3300046794 | Bacteria | 1868 |
| 971 | Ga0495589_0099209 | 3300046794 | Bacteria | 1410 |
| 972 | Ga0495589_0121620 | 3300046794 | Bacteria | 1256 |
| 973 | Ga0495600_0018722 | 3300046809 | Bacteria | 4416 |
| 974 | Ga0495600_0071222 | 3300046809 | Bacteria | 2271 |
| 975 | Ga0495660_0042998 | 3300046810 | Bacteria | 2494 |
| 976 | Ga0495660_0076166 | 3300046810 | Bacteria | 1767 |
| 977 | Ga0495660_0115848 | 3300046810 | Bacteria | 1362 |
| 978 | Ga0495660_0116171 | 3300046810 | Bacteria | 1359 |
| 979 | Ga0495581_0006112 | 3300047315 | Bacteria | 6979 |
| 980 | Ga0495581_0028287 | 3300047315 | Bacteria | 3250 |
| 981 | Ga0495581_0102085 | 3300047315 | Bacteria | 1666 |
| 982 | Ga0495604_0001571 | 3300047317 | Bacteria | 18805 |
| 983 | Ga0495604_0025773 | 3300047317 | Bacteria | 4683 |
| 984 | Ga0495604_0026260 | 3300047317 | Bacteria | 4637 |
| 985 | Ga0495604_0042301 | 3300047317 | Bacteria | 3571 |
| 986 | Ga0495604_0087198 | 3300047317 | Bacteria | 2325 |
| 987 | Ga0495604_0110489 | 3300047317 | Bacteria | 2005 |
| 988 | Ga0495604_0181992 | 3300047317 | Bacteria | 1469 |
| 989 | Ga0495674_0003691 | 3300047319 | Bacteria | 14890 |
| 990 | Ga0495674_0013082 | 3300047319 | Bacteria | 7807 |
| 991 | Ga0495674_0022068 | 3300047319 | Bacteria | 5875 |
| 992 | Ga0495674_0045991 | 3300047319 | Bacteria | 3875 |
| 993 | Ga0495674_0049855 | 3300047319 | Bacteria | 3696 |
| 994 | Ga0495674_0085690 | 3300047319 | Bacteria | 2698 |
| 995 | Ga0495674_0099233 | 3300047319 | Bacteria | 2479 |
| 996 | Ga0495674_0534688 | 3300047319 | Bacteria | 934 |
| 997 | Ga0495672_0001027 | 3300047320 | Bacteria | 28668 |
| 998 | Ga0495672_0004381 | 3300047320 | Bacteria | 11594 |
| 999 | Ga0495672_0023540 | 3300047320 | Bacteria | 3985 |
| 1000 | Ga0495672_0062662 | 3300047320 | Bacteria | 2137 |
| 1001 | Ga0495672_0074855 | 3300047320 | Bacteria | 1905 |
| 1002 | Ga0495672_0175249 | 3300047320 | Bacteria | 1090 |
| 1003 | Ga0495672_0248515 | 3300047320 | Bacteria | 864 |
| 1004 | Ga0495676_0000012 | 3300047321 | Bacteria | 230043 |
| 1005 | Ga0495676_0016588 | 3300047321 | Bacteria | 6529 |
| 1006 | Ga0495676_0083100 | 3300047321 | Bacteria | 2421 |
| 1007 | Ga0495676_0098077 | 3300047321 | Bacteria | 2175 |
| 1008 | Ga0495680_0017847 | 3300047322 | Bacteria | 6040 |
| 1009 | Ga0495680_0062652 | 3300047322 | Bacteria | 2859 |
| 1010 | Ga0495680_0076671 | 3300047322 | Bacteria | 2534 |
| 1011 | Ga0495680_0087042 | 3300047322 | Bacteria | 2350 |
| 1012 | Ga0495680_0188315 | 3300047322 | Bacteria | 1485 |
| 1013 | Ga0495680_0297571 | 3300047322 | Bacteria | 1133 |
| 1014 | Ga0495680_0578524 | 3300047322 | Bacteria | 753 |
| 1015 | Ga0495683_0000032 | 3300047323 | Bacteria | 149612 |
| 1016 | Ga0495683_0000299 | 3300047323 | Bacteria | 42246 |
| 1017 | Ga0495683_0008992 | 3300047323 | Bacteria | 5331 |
| 1018 | Ga0495683_0055362 | 3300047323 | Bacteria | 1974 |
| 1019 | Ga0495683_0090617 | 3300047323 | Bacteria | 1481 |
| 1020 | Ga0495683_0132276 | 3300047323 | Bacteria | 1175 |
| 1021 | Ga0495687_000021 | 3300047443 | Bacteria | 334681 |
| 1022 | Ga0495687_007444 | 3300047443 | Bacteria | 6445 |
| 1023 | Ga0495687_031541 | 3300047443 | Bacteria | 2430 |
| 1024 | Ga0495687_103383 | 3300047443 | Bacteria | 1063 |
| 1025 | Ga0495675_0017368 | 3300047444 | Bacteria | 4559 |
| 1026 | Ga0495675_0046970 | 3300047444 | Bacteria | 2748 |
| 1027 | Ga0495675_0049921 | 3300047444 | Bacteria | 2659 |
| 1028 | Ga0495675_0057153 | 3300047444 | Bacteria | 2473 |
| 1029 | Ga0495675_0114040 | 3300047444 | Bacteria | 1685 |
| 1030 | Ga0495679_000013 | 3300047446 | Bacteria | 313222 |
| 1031 | Ga0495679_000716 | 3300047446 | Bacteria | 21459 |
| 1032 | Ga0495679_000885 | 3300047446 | Bacteria | 18761 |
| 1033 | Ga0495679_005818 | 3300047446 | Bacteria | 5423 |
| 1034 | Ga0495679_009825 | 3300047446 | Bacteria | 3798 |
| 1035 | Ga0495685_043635 | 3300047447 | Bacteria | 1530 |
| 1036 | Ga0495673_0007429 | 3300047469 | Bacteria | 6301 |
| 1037 | Ga0495673_0029989 | 3300047469 | Bacteria | 2561 |
| 1038 | Ga0495673_0033822 | 3300047469 | Bacteria | 2368 |
| 1039 | Ga0495673_0039418 | 3300047469 | Bacteria | 2143 |
| 1040 | Ga0495673_0042121 | 3300047469 | Bacteria | 2051 |
| 1041 | Ga0495673_0068027 | 3300047469 | Bacteria | 1506 |
| 1042 | Ga0495673_0129585 | 3300047469 | Bacteria | 992 |
| 1043 | Ga0495673_0158381 | 3300047469 | Bacteria | 870 |
| 1044 | Ga0495681_0011056 | 3300047470 | Bacteria | 5411 |
| 1045 | Ga0495681_0015894 | 3300047470 | Bacteria | 4246 |
| 1046 | Ga0495681_0019129 | 3300047470 | Bacteria | 3748 |
| 1047 | Ga0495681_0044276 | 3300047470 | Bacteria | 2140 |
| 1048 | Ga0495681_0158050 | 3300047470 | Bacteria | 946 |
| 1049 | Ga0495684_0013909 | 3300047471 | Bacteria | 6190 |
| 1050 | Ga0495684_0240650 | 3300047471 | Bacteria | 1320 |
| 1051 | Ga0495684_0485152 | 3300047471 | Bacteria | 853 |
| 1052 | Ga0495686_0000081 | 3300047472 | Bacteria | 201295 |
| 1053 | Ga0495686_0091173 | 3300047472 | Bacteria | 1850 |
| 1054 | Ga0495593_0005939 | 3300047673 | Bacteria | 7193 |
| 1055 | Ga0495593_0008969 | 3300047673 | Bacteria | 5805 |
| 1056 | Ga0495593_0019987 | 3300047673 | Bacteria | 3750 |
| 1057 | Ga0495593_0026977 | 3300047673 | Bacteria | 3165 |
| 1058 | Ga0495593_0046642 | 3300047673 | Bacteria | 2307 |
| 1059 | Ga0495602_0042153 | 3300048088 | Bacteria | 4161 |
| 1060 | Ga0495602_0045768 | 3300048088 | Bacteria | 3957 |
| 1061 | Ga0495602_0089662 | 3300048088 | Bacteria | 2556 |
| 1062 | Ga0495602_0099043 | 3300048088 | Bacteria | 2397 |
| 1063 | Ga0495602_0231121 | 3300048088 | Bacteria | 1389 |
| 1064 | Ga0495602_0552112 | 3300048088 | Bacteria | 798 |
| 1065 | Ga0495614_0010574 | 3300048089 | Bacteria | 4069 |
| 1066 | Ga0495614_0028617 | 3300048089 | Bacteria | 2399 |
| 1067 | Ga0495614_0040887 | 3300048089 | Bacteria | 1989 |
| 1068 | Ga0495626_0000545 | 3300048091 | Bacteria | 37397 |
| 1069 | Ga0495626_0012629 | 3300048091 | Bacteria | 4417 |
| 1070 | Ga0495626_0080088 | 3300048091 | Bacteria | 1452 |
| 1071 | Ga0495626_0150132 | 3300048091 | Bacteria | 983 |
| 1072 | Ga0496100_0195637 | 3300048903 | Bacteria | 1470 |
| 1073 | Ga0496100_0205631 | 3300048903 | Bacteria | 1437 |
| 1074 | Ga0496100_0373084 | 3300048903 | Bacteria | 1082 |
| 1075 | Ga0496101_0005318 | 3300048904 | Bacteria | 8197 |
| 1076 | Ga0496101_0005742 | 3300048904 | Bacteria | 7927 |
| 1077 | Ga0496101_0007002 | 3300048904 | Bacteria | 7282 |
| 1078 | Ga0496101_0312314 | 3300048904 | Bacteria | 1232 |
| 1079 | Ga0496102_0001948 | 3300048905 | Bacteria | 17797 |
| 1080 | Ga0496102_0012587 | 3300048905 | Bacteria | 7328 |
| 1081 | Ga0496102_0017272 | 3300048905 | Bacteria | 6320 |
| 1082 | Ga0496102_0169031 | 3300048905 | Bacteria | 2058 |
| 1083 | Ga0496102_0402081 | 3300048905 | Bacteria | 1287 |
| 1084 | Ga0496102_0528365 | 3300048905 | Bacteria | 1102 |
| 1085 | Ga0496102_0581042 | 3300048905 | Bacteria | 1043 |
| 1086 | Ga0496102_0956540 | 3300048905 | Bacteria | 777 |
| 1087 | Ga0496103_0102895 | 3300048906 | Bacteria | 1809 |
| 1088 | Ga0496103_0602814 | 3300048906 | Bacteria | 699 |
| 1089 | Ga0496104_0172798 | 3300048907 | Bacteria | 2071 |
| 1090 | Ga0496104_0372972 | 3300048907 | Bacteria | 1339 |
| 1091 | Ga0496104_0446361 | 3300048907 | Bacteria | 1205 |
| 1092 | Ga0496105_0075444 | 3300048908 | Bacteria | 2784 |
| 1093 | Ga0496105_0214924 | 3300048908 | Bacteria | 1566 |
| 1094 | Ga0496105_0583387 | 3300048908 | Bacteria | 869 |
| 1095 | Ga0496106_0009549 | 3300048909 | Bacteria | 7165 |
| 1096 | Ga0496106_0205462 | 3300048909 | Bacteria | 1568 |
| 1097 | Ga0496107_0114849 | 3300048910 | Bacteria | 1981 |
| 1098 | Ga0496107_0850547 | 3300048910 | Bacteria | 666 |
| 1099 | Ga0496108_0036849 | 3300048911 | Bacteria | 4071 |
| 1100 | Ga0496109_1290545 | 3300048912 | Bacteria | 666 |
| 1101 | Ga0496110_0210860 | 3300048913 | Bacteria | 1766 |
| 1102 | Ga0496110_0360478 | 3300048913 | Bacteria | 1325 |
| 1103 | Ga0496110_0629122 | 3300048913 | Bacteria | 972 |
| 1104 | Ga0496110_0993246 | 3300048913 | Bacteria | 747 |
| 1105 | Ga0496111_0123848 | 3300048914 | Bacteria | 1910 |
| 1106 | Ga0496111_0298479 | 3300048914 | Bacteria | 1194 |
| 1107 | Ga0496112_0016884 | 3300048915 | Bacteria | 6849 |
| 1108 | Ga0496112_0017729 | 3300048915 | Bacteria | 6701 |
| 1109 | Ga0496112_0157336 | 3300048915 | Bacteria | 2239 |
| 1110 | Ga0496113_0142375 | 3300048916 | Bacteria | 1887 |
| 1111 | Ga0496113_0347556 | 3300048916 | Bacteria | 1189 |
| 1112 | Ga0496114_0012267 | 3300048917 | Bacteria | 6858 |
| 1113 | Ga0496114_0801884 | 3300048917 | Bacteria | 820 |
| 1114 | Ga0496115_0114478 | 3300048918 | Bacteria | 2217 |
| 1115 | Ga0496115_0215959 | 3300048918 | Bacteria | 1583 |
| 1116 | Ga0496116_0000698 | 3300048919 | Bacteria | 43460 |
| 1117 | Ga0496116_0001275 | 3300048919 | Bacteria | 28966 |
| 1118 | Ga0496116_0008789 | 3300048919 | Bacteria | 8712 |
| 1119 | Ga0496116_0017048 | 3300048919 | Bacteria | 5657 |
| 1120 | Ga0496116_0034617 | 3300048919 | Bacteria | 3561 |
| 1121 | Ga0496116_0057918 | 3300048919 | Bacteria | 2529 |
| 1122 | Ga0496117_0003200 | 3300048920 | Bacteria | 19382 |
| 1123 | Ga0496117_0003808 | 3300048920 | Bacteria | 17184 |
| 1124 | Ga0496117_0003944 | 3300048920 | Bacteria | 16784 |
| 1125 | Ga0496117_0010066 | 3300048920 | Bacteria | 8686 |
| 1126 | Ga0496117_0015912 | 3300048920 | Bacteria | 6373 |
| 1127 | Ga0496117_0086561 | 3300048920 | Bacteria | 2035 |
| 1128 | Ga0496117_0133523 | 3300048920 | Bacteria | 1499 |
| 1129 | Ga0496117_0191463 | 3300048920 | Bacteria | 1164 |
| 1130 | Ga0496118_0001751 | 3300048921 | Bacteria | 31501 |
| 1131 | Ga0496118_0004406 | 3300048921 | Bacteria | 16720 |
| 1132 | Ga0496118_0022028 | 3300048921 | Bacteria | 5587 |
| 1133 | Ga0496118_0044323 | 3300048921 | Bacteria | 3484 |
| 1134 | Ga0496118_0045495 | 3300048921 | Bacteria | 3425 |
| 1135 | Ga0496118_0074998 | 3300048921 | Bacteria | 2415 |
| 1136 | Ga0496118_0139088 | 3300048921 | Bacteria | 1543 |
| 1137 | Ga0496118_0199193 | 3300048921 | Bacteria | 1188 |
| 1138 | Ga0496118_0201452 | 3300048921 | Bacteria | 1178 |
| 1139 | Ga0496118_0261770 | 3300048921 | Bacteria | 975 |
| 1140 | Ga0496118_0268957 | 3300048921 | Bacteria | 956 |
| 1141 | Ga0496118_0318146 | 3300048921 | Bacteria | 846 |
| 1142 | Ga0496119_0000071 | 3300048922 | Bacteria | 153652 |
| 1143 | Ga0496119_0128710 | 3300048922 | Bacteria | 1382 |
| 1144 | Ga0496120_0000126 | 3300048923 | Bacteria | 128689 |
| 1145 | Ga0496120_0290367 | 3300048923 | Bacteria | 753 |
| 1146 | Ga0496121_0001129 | 3300048924 | Bacteria | 46851 |
| 1147 | Ga0496121_0003930 | 3300048924 | Bacteria | 20584 |
| 1148 | Ga0496121_0005413 | 3300048924 | Bacteria | 16389 |
| 1149 | Ga0496121_0005701 | 3300048924 | Bacteria | 15822 |
| 1150 | Ga0496121_0023755 | 3300048924 | Bacteria | 5890 |
| 1151 | Ga0496121_0025167 | 3300048924 | Bacteria | 5661 |
| 1152 | Ga0496121_0032774 | 3300048924 | Bacteria | 4715 |
| 1153 | Ga0496121_0045649 | 3300048924 | Bacteria | 3762 |
| 1154 | Ga0496121_0084888 | 3300048924 | Bacteria | 2494 |
| 1155 | Ga0496121_0159913 | 3300048924 | Bacteria | 1648 |
| 1156 | Ga0496122_0000370 | 3300048925 | Bacteria | 96422 |
| 1157 | Ga0496122_0004026 | 3300048925 | Bacteria | 18685 |
| 1158 | Ga0496122_0031791 | 3300048925 | Bacteria | 4381 |
| 1159 | Ga0496122_0076528 | 3300048925 | Bacteria | 2354 |
| 1160 | Ga0496122_0106778 | 3300048925 | Bacteria | 1852 |
| 1161 | Ga0496122_0133830 | 3300048925 | Bacteria | 1568 |
| 1162 | Ga0496123_0000135 | 3300048926 | Bacteria | 153056 |
| 1163 | Ga0496123_0012095 | 3300048926 | Bacteria | 7398 |
| 1164 | Ga0496123_0013389 | 3300048926 | Bacteria | 6890 |
| 1165 | Ga0496123_0056125 | 3300048926 | Bacteria | 2577 |
| 1166 | Ga0496123_0141072 | 3300048926 | Bacteria | 1317 |
| 1167 | Ga0496123_0141790 | 3300048926 | Bacteria | 1312 |
| 1168 | Ga0496123_0227234 | 3300048926 | Bacteria | 937 |
| 1169 | Ga0496123_0257552 | 3300048926 | Bacteria | 857 |
| 1170 | Ga0496124_0000144 | 3300048927 | Bacteria | 146921 |
| 1171 | Ga0496124_0000967 | 3300048927 | Bacteria | 45780 |
| 1172 | Ga0496124_0003720 | 3300048927 | Bacteria | 18402 |
| 1173 | Ga0496124_0066416 | 3300048927 | Bacteria | 3003 |
| 1174 | Ga0496124_0237306 | 3300048927 | Bacteria | 1358 |
| 1175 | Ga0496124_0300726 | 3300048927 | Bacteria | 1159 |
| 1176 | Ga0496124_0465688 | 3300048927 | Bacteria | 857 |
| 1177 | Ga0496124_0492305 | 3300048927 | Bacteria | 824 |
| 1178 | Ga0496125_0018061 | 3300048928 | Bacteria | 6704 |
| 1179 | Ga0496125_0097534 | 3300048928 | Bacteria | 2178 |
| 1180 | Ga0496125_0148816 | 3300048928 | Bacteria | 1613 |
| 1181 | Ga0496125_0192152 | 3300048928 | Bacteria | 1347 |
| 1182 | Ga0496125_0287061 | 3300048928 | Bacteria | 1015 |
| 1183 | Ga0496125_0325484 | 3300048928 | Bacteria | 929 |
| 1184 | Ga0496125_0426440 | 3300048928 | Bacteria | 767 |
| 1185 | Ga0496126_0004750 | 3300048929 | Bacteria | 16019 |
| 1186 | Ga0496126_0154013 | 3300048929 | Bacteria | 1968 |
| 1187 | Ga0496126_0155464 | 3300048929 | Bacteria | 1957 |
| 1188 | Ga0496126_0240172 | 3300048929 | Bacteria | 1514 |
| 1189 | Ga0496126_0617030 | 3300048929 | Bacteria | 852 |
| 1190 | Ga0496126_0975102 | 3300048929 | Bacteria | 638 |
| 1191 | Ga0495678_000046 | 3300049459 | Bacteria | 171703 |
| 1192 | Ga0495678_005322 | 3300049459 | Bacteria | 7140 |
| 1193 | Ga0495678_009603 | 3300049459 | Bacteria | 4770 |
| 1194 | Ga0495678_027079 | 3300049459 | Bacteria | 2437 |
| 1195 | Ga0495678_054133 | 3300049459 | Bacteria | 1537 |
| 1196 | Ga0495682_0004456 | 3300049460 | Bacteria | 5987 |
| 1197 | Ga0495682_0027727 | 3300049460 | Bacteria | 2100 |
| 1198 | Ga0495682_0030129 | 3300049460 | Bacteria | 2008 |
| 1199 | Ga0495682_0038206 | 3300049460 | Bacteria | 1764 |
| 1200 | Ga0501313_028712 | 3300049529 | Bacteria | 714 |
| 1201 | Ga0501034_0151855 | 3300049571 | Bacteria | 2291 |
| 1202 | Ga0501034_0453220 | 3300049571 | Bacteria | 1200 |
| 1203 | Ga0501037_0287122 | 3300049573 | Bacteria | 1145 |
| 1204 | Ga0501038_0114085 | 3300049574 | Bacteria | 2235 |
| 1205 | Ga0501038_0405531 | 3300049574 | Bacteria | 1054 |
| 1206 | Ga0501039_0298363 | 3300049575 | Bacteria | 1267 |
| 1207 | Ga0501043_0020100 | 3300049579 | Bacteria | 5242 |
| 1208 | Ga0501206_051819 | 3300049653 | Bacteria | 655 |
| 1209 | Ga0501207_045306 | 3300049654 | Bacteria | 774 |
| 1210 | Ga0501230_020237 | 3300049667 | Bacteria | 1155 |
| 1211 | Ga0501241_011072 | 3300049758 | Bacteria | 1638 |
| 1212 | Ga0501035_0009489 | 3300049822 | Bacteria | 9048 |
| 1213 | Ga0501044_0025028 | 3300049823 | Bacteria | 6329 |
| 1214 | Ga0500573_0450659 | 3300053140 | Bacteria | 595 |
| 1215 | Ga0500634_0167092 | 3300053161 | Bacteria | 1007 |
| 1216 | Ga0587084_007755 | 3300059477 | Bacteria | 1342 |
| 1217 | Ga0587084_019179 | 3300059477 | Bacteria | 1005 |
| 1218 | Ga0587070_018743 | 3300059491 | Bacteria | 1138 |
| 1219 | Ga0587070_071260 | 3300059491 | Bacteria | 742 |
| 1220 | Ga0587080_038036 | 3300059503 | Bacteria | 866 |
| 1221 | Ga0587080_082992 | 3300059503 | Bacteria | 661 |
| 1222 | Ga0587080_086051 | 3300059503 | Bacteria | 653 |
| 1223 | Ga0587083_0001420 | 3300059505 | Bacteria | 2682 |
| 1224 | Ga0587083_0017588 | 3300059505 | Bacteria | 1281 |
| 1225 | Ga0587083_0023874 | 3300059505 | Bacteria | 1158 |
| 1226 | Ga0587083_0058859 | 3300059505 | Bacteria | 860 |
| 1227 | Ga0587090_012317 | 3300059510 | Bacteria | 1218 |
| 1228 | Ga0587091_016901 | 3300059511 | Bacteria | 1222 |
| 1229 | Ga0587091_021107 | 3300059511 | Bacteria | 1137 |
| 1230 | Ga0587091_088330 | 3300059511 | Bacteria | 708 |
| 1231 | Ga0587094_008973 | 3300059513 | Bacteria | 1265 |
| 1232 | Ga0587098_001525 | 3300059604 | Bacteria | 1794 |
| 1233 | Ga0587098_003070 | 3300059604 | Bacteria | 1472 |
| 1234 | Ga0587098_019425 | 3300059604 | Bacteria | 850 |
| 1235 | Ga0587106_047238 | 3300059605 | Bacteria | 752 |
| 1236 | Ga0587106_075140 | 3300059605 | Bacteria | 648 |
| 1237 | Ga0587101_049214 | 3300059623 | Bacteria | 721 |
| 1238 | Ga0587128_013884 | 3300059630 | Bacteria | 1144 |
| 1239 | Ga0587067_000513 | 3300059640 | Bacteria | 3439 |
| 1240 | Ga0587068_001003 | 3300059641 | Bacteria | 2977 |
| 1241 | Ga0587068_012163 | 3300059641 | Bacteria | 1310 |
| 1242 | Ga0587068_014583 | 3300059641 | Bacteria | 1226 |
| 1243 | Ga0587069_031196 | 3300059642 | Bacteria | 862 |
| 1244 | Ga0587069_032831 | 3300059642 | Bacteria | 849 |
| 1245 | Ga0587072_000076 | 3300059643 | Bacteria | 7309 |
| 1246 | Ga0587072_065694 | 3300059643 | Bacteria | 756 |
| 1247 | Ga0587076_028924 | 3300059645 | Bacteria | 970 |
| 1248 | Ga0587079_011606 | 3300059647 | Bacteria | 1423 |
| 1249 | Ga0587079_064212 | 3300059647 | Bacteria | 803 |
| 1250 | Ga0587079_068725 | 3300059647 | Bacteria | 785 |
| 1251 | Ga0587100_021036 | 3300059648 | Bacteria | 637 |
| 1252 | Ga0587102_002046 | 3300059649 | Bacteria | 1512 |
| 1253 | Ga0587102_021193 | 3300059649 | Bacteria | 735 |
| 1254 | Ga0587105_000215 | 3300059651 | Bacteria | 2067 |
| 1255 | Ga0587124_014557 | 3300059660 | Bacteria | 750 |
| 1256 | Ga0587071_009901 | 3300060344 | Bacteria | 1580 |
| 1257 | Ga0587071_033121 | 3300060344 | Bacteria | 1005 |
| 1258 | Ga0587071_039358 | 3300060344 | Bacteria | 942 |
| 1259 | Ga0587071_075072 | 3300060344 | Bacteria | 743 |
| 1260 | Ga0587111_0008531 | 3300060346 | Bacteria | 1702 |
| 1261 | Ga0587111_0068425 | 3300060346 | Bacteria | 823 |
| 1262 | Ga0466962_0002106 | 3300061719 | Bacteria | 9409 |
| 1263 | Ga0466962_0003684 | 3300061719 | Bacteria | 7303 |
| 1264 | Ga0466962_0009729 | 3300061719 | Bacteria | 4612 |
| 1265 | Ga0466962_0153874 | 3300061719 | Bacteria | 1116 |
| 1266 | Ga0466962_0316164 | 3300061719 | Bacteria | 774 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300048913 | Ga0496110_0993246 | Ga0496110_0993246_13_465 | 148 |
| 2 | 3300028794 | Ga0307515_10040414 | Ga0307515_100404144 | 151 |
| 3 | 3300003316 | rootH1_10070082 | rootH1_100700822 | 154 |
| 4 | 3300013250 | Ga0171462_1021 | Ga0171462_10219 | 158 |
| 5 | iso_pu_bacteria | 2945916053 | 2945917124 | 164 |
| 6 | iso_pu_bacteria | 2928157003 | 2928158001 | 165 |
| 7 | iso_pu_bacteria | 2928163908 | 2928165776 | 165 |
| 8 | iso_pu_bacteria | 2981990288 | 2981991032 | 165 |
| 9 | iso_pu_bacteria | 641736154 | 642414249 | 165 |
| 10 | 3300010375 | Ga0105239_10047907 | Ga0105239_100479072 | 166 |
| 11 | 3300048923 | Ga0496120_0290367 | Ga0496120_0290367_98_616 | 166 |
| 12 | iso_pu_bacteria | 2818991436 | 2819544286 | 166 |
| 13 | iso_pu_bacteria | 2843690924 | 2843692465 | 166 |
| 14 | 3300005719 | Ga0068861_100016273 | Ga0068861_1000162732 | 167 |
| 15 | 3300014326 | Ga0157380_10001066 | Ga0157380_100010663 | 167 |
| 16 | 3300026118 | Ga0207675_100057916 | Ga0207675_1000579162 | 167 |
| 17 | 3300048905 | Ga0496102_0581042 | Ga0496102_0581042_250_780 | 167 |
| 18 | iso_pu_bacteria | 2501025501 | 2501069943 | 167 |
| 19 | iso_pu_bacteria | 2501025504 | 2501412069 | 167 |
| 20 | iso_pu_bacteria | 2508501125 | 2509127725 | 167 |
| 21 | iso_pu_bacteria | 2510065045 | 2510249401 | 167 |
| 22 | iso_pu_bacteria | 2510917014 | 2511101063 | 167 |
| 23 | iso_pu_bacteria | 2510917015 | 2511107193 | 167 |
| 24 | iso_pu_bacteria | 2512047030 | 2512349285 | 167 |
| 25 | iso_pu_bacteria | 2512047030 | 2512350671 | 167 |
| 26 | iso_pu_bacteria | 2513237082 | 2513555172 | 167 |
| 27 | iso_pu_bacteria | 2513237083 | 2513566143 | 167 |
| 28 | iso_pu_bacteria | 2513237151 | 2513962913 | 167 |
| 29 | iso_pu_bacteria | 2513237165 | 2514045208 | 167 |
| 30 | iso_pu_bacteria | 2513237166 | 2514052737 | 167 |
| 31 | iso_pu_bacteria | 2515154122 | 2515682829 | 167 |
| 32 | iso_pu_bacteria | 2515154123 | 2515692268 | 167 |
| 33 | iso_pu_bacteria | 2515154189 | 2516021961 | 167 |
| 34 | iso_pu_bacteria | 2519103095 | 2519460328 | 167 |
| 35 | iso_pu_bacteria | 2526164713 | 2527076401 | 167 |
| 36 | iso_pu_bacteria | 2562617112 | 2563057242 | 167 |
| 37 | iso_pu_bacteria | 2582581311 | 2585292633 | 167 |
| 38 | iso_pu_bacteria | 2599185178 | 2599448563 | 167 |
| 39 | iso_pu_bacteria | 2599185239 | 2599741299 | 167 |
| 40 | iso_pu_bacteria | 2599185240 | 2599747289 | 167 |
| 41 | iso_pu_bacteria | 2599185355 | 2600209086 | 167 |
| 42 | iso_pu_bacteria | 2600255067 | 2600813396 | 167 |
| 43 | iso_pu_bacteria | 2675903129 | 2676745114 | 167 |
| 44 | iso_pu_bacteria | 2711768613 | 2713474064 | 167 |
| 45 | iso_pu_bacteria | 2718217991 | 2719642192 | 167 |
| 46 | iso_pu_bacteria | 2738541296 | 2738824177 | 167 |
| 47 | iso_pu_bacteria | 2738541298 | 2738836948 | 167 |
| 48 | iso_pu_bacteria | 2738541306 | 2738878479 | 167 |
| 49 | iso_pu_bacteria | 2738543002 | 2739190147 | 167 |
| 50 | iso_pu_bacteria | 2738543008 | 2739225072 | 167 |
| 51 | iso_pu_bacteria | 2744054900 | 2746084744 | 167 |
| 52 | iso_pu_bacteria | 2744054901 | 2746093087 | 167 |
| 53 | iso_pu_bacteria | 2751185846 | 2753570488 | 167 |
| 54 | iso_pu_bacteria | 2791355137 | 2792835472 | 167 |
| 55 | iso_pu_bacteria | 2808606384 | 2808972510 | 167 |
| 56 | iso_pu_bacteria | 2808606390 | 2809007497 | 167 |
| 57 | iso_pu_bacteria | 2808606391 | 2809014477 | 167 |
| 58 | iso_pu_bacteria | 2816332253 | 2817257879 | 167 |
| 59 | iso_pu_bacteria | 2816332256 | 2817281730 | 167 |
| 60 | iso_pu_bacteria | 2816332286 | 2817456015 | 167 |
| 61 | iso_pu_bacteria | 2818991450 | 2819622428 | 167 |
| 62 | iso_pu_bacteria | 2818991452 | 2819635221 | 167 |
| 63 | iso_pu_bacteria | 2842324504 | 2842332518 | 167 |
| 64 | iso_pu_bacteria | 2842348783 | 2842356921 | 167 |
| 65 | iso_pu_bacteria | 2842454564 | 2842461385 | 167 |
| 66 | iso_pu_bacteria | 2856287931 | 2856289820 | 167 |
| 67 | iso_pu_bacteria | 2857357740 | 2857363140 | 167 |
| 68 | iso_pu_bacteria | 2858688981 | 2858697552 | 167 |
| 69 | iso_pu_bacteria | 2863421361 | 2863424367 | 167 |
| 70 | iso_pu_bacteria | 2870068957 | 2870073538 | 167 |
| 71 | iso_pu_bacteria | 2883087390 | 2883089279 | 167 |
| 72 | iso_pu_bacteria | 2885270888 | 2885275281 | 167 |
| 73 | iso_pu_bacteria | 2900634093 | 2900641055 | 167 |
| 74 | iso_pu_bacteria | 2901300506 | 2901309056 | 167 |
| 75 | iso_pu_bacteria | 2902682994 | 2902684360 | 167 |
| 76 | iso_pu_bacteria | 2904483920 | 2904485784 | 167 |
| 77 | iso_pu_bacteria | 2904564687 | 2904567533 | 167 |
| 78 | iso_pu_bacteria | 2904571731 | 2904574578 | 167 |
| 79 | iso_pu_bacteria | 2904615490 | 2904617635 | 167 |
| 80 | iso_pu_bacteria | 2919527303 | 2919532566 | 167 |
| 81 | iso_pu_bacteria | 2921643360 | 2921653916 | 167 |
| 82 | iso_pu_bacteria | 2928108538 | 2928111853 | 167 |
| 83 | iso_pu_bacteria | 2928135762 | 2928139092 | 167 |
| 84 | iso_pu_bacteria | 2928157003 | 2928158377 | 167 |
| 85 | iso_pu_bacteria | 2928163908 | 2928167413 | 167 |
| 86 | iso_pu_bacteria | 2928170801 | 2928177042 | 167 |
| 87 | iso_pu_bacteria | 2928503688 | 2928508790 | 167 |
| 88 | iso_pu_bacteria | 2928536128 | 2928540306 | 167 |
| 89 | iso_pu_bacteria | 2939669807 | 2939671977 | 167 |
| 90 | iso_pu_bacteria | 2945934425 | 2945939272 | 167 |
| 91 | iso_pu_bacteria | 2981990288 | 2981991840 | 167 |
| 92 | iso_pu_bacteria | 2990703756 | 2990706611 | 167 |
| 93 | iso_pu_bacteria | 641736151 | 642426487 | 167 |
| 94 | iso_pu_bacteria | 641736154 | 642414207 | 167 |
| 95 | iso_pu_bacteria | 642555112 | 642595091 | 167 |
| 96 | iso_pu_bacteria | 642555113 | 642616156 | 167 |
| 97 | iso_pu_bacteria | 8003955200 | 8003959139 | 167 |
| 98 | iso_pu_bacteria | 8018845410 | 8018850236 | 167 |
| 99 | iso_pu_bacteria | 8020807995 | 8020812223 | 167 |
| 100 | iso_pu_bacteria | 8020938398 | 8020941187 | 167 |
| 101 | iso_pu_bacteria | 8020945358 | 8020946706 | 167 |
| 102 | iso_pu_bacteria | 8020953355 | 8020958321 | 167 |
| 103 | iso_pu_bacteria | 8021120328 | 8021123898 | 167 |
| 104 | iso_pu_bacteria | 8039098773 | 8039100365 | 167 |
| 105 | iso_pu_bacteria | 8040167225 | 8040170742 | 167 |
| 106 | iso_pu_bacteria | 8040173305 | 8040176947 | 167 |
| 107 | iso_pu_bacteria | 8055266321 | 8055272679 | 167 |
| 108 | iso_pu_bacteria | 8055301274 | 8055306583 | 167 |
| 109 | 3300001979 | JGI24740J21852_10025467 | JGI24740J21852_100254673 | 169 |
| 110 | 3300001989 | JGI24739J22299_10002580 | JGI24739J22299_100025807 | 169 |
| 111 | 3300005563 | Ga0068855_101102753 | Ga0068855_1011027532 | 169 |
| 112 | 3300009551 | Ga0105238_10423733 | Ga0105238_104237332 | 169 |
| 113 | 3300013104 | Ga0157370_11275780 | Ga0157370_112757802 | 169 |
| 114 | 3300015265 | Ga0182005_1001429 | Ga0182005_100142911 | 169 |
| 115 | 3300025949 | Ga0207667_10003560 | Ga0207667_100035602 | 169 |
| 116 | 3300044842 | Ga0466957_0008641 | Ga0466957_0008641_1451_1975 | 169 |
| 117 | 3300048903 | Ga0496100_0373084 | Ga0496100_0373084_510_1034 | 169 |
| 118 | 3300048907 | Ga0496104_0172798 | Ga0496104_0172798_109_633 | 169 |
| 119 | 3300048908 | Ga0496105_0214924 | Ga0496105_0214924_924_1448 | 169 |
| 120 | 3300048915 | Ga0496112_0017729 | Ga0496112_0017729_1458_1982 | 169 |
| 121 | 3300048919 | Ga0496116_0008789 | Ga0496116_0008789_7994_8518 | 169 |
| 122 | 3300048921 | Ga0496118_0045495 | Ga0496118_0045495_2431_2955 | 169 |
| 123 | 3300048921 | Ga0496118_0201452 | Ga0496118_0201452_526_1050 | 169 |
| 124 | 3300048921 | Ga0496118_0268957 | Ga0496118_0268957_102_626 | 169 |
| 125 | 3300048925 | Ga0496122_0076528 | Ga0496122_0076528_745_1269 | 169 |
| 126 | 3300048926 | Ga0496123_0056125 | Ga0496123_0056125_236_760 | 169 |
| 127 | iso_pu_bacteria | 2513237087 | 2513591651 | 169 |
| 128 | iso_pu_bacteria | 2917699015 | 2917703657 | 169 |
| 129 | 3300005327 | Ga0070658_10048516 | Ga0070658_100485162 | 170 |
| 130 | 3300005339 | Ga0070660_100067883 | Ga0070660_1000678832 | 170 |
| 131 | 3300005366 | Ga0070659_100273629 | Ga0070659_1002736292 | 170 |
| 132 | 3300005367 | Ga0070667_100914291 | Ga0070667_1009142912 | 170 |
| 133 | 3300005616 | Ga0068852_100081937 | Ga0068852_1000819373 | 170 |
| 134 | 3300006058 | Ga0075432_10021103 | Ga0075432_100211032 | 170 |
| 135 | 3300011119 | Ga0105246_10278998 | Ga0105246_102789982 | 170 |
| 136 | 3300013296 | Ga0157374_10080599 | Ga0157374_100805993 | 170 |
| 137 | 3300015261 | Ga0182006_1009036 | Ga0182006_10090362 | 170 |
| 138 | 3300015262 | Ga0182007_10003364 | Ga0182007_100033642 | 170 |
| 139 | 3300015265 | Ga0182005_1000509 | Ga0182005_10005093 | 170 |
| 140 | 3300025909 | Ga0207705_10052350 | Ga0207705_100523503 | 170 |
| 141 | 3300025919 | Ga0207657_10010571 | Ga0207657_100105713 | 170 |
| 142 | 3300025920 | Ga0207649_10139362 | Ga0207649_101393622 | 170 |
| 143 | 3300025945 | Ga0207679_10194351 | Ga0207679_101943512 | 170 |
| 144 | 3300037312 | Ga0395899_0105700 | Ga0395899_0105700_1379_1897 | 170 |
| 145 | 3300037312 | Ga0395899_0213408 | Ga0395899_0213408_708_1238 | 170 |
| 146 | 3300037418 | Ga0395900_0001922 | Ga0395900_0001922_20749_21267 | 170 |
| 147 | 3300037418 | Ga0395900_0096528 | Ga0395900_0096528_164_694 | 170 |
| 148 | 3300037418 | Ga0395900_0276234 | Ga0395900_0276234_1057_1575 | 170 |
| 149 | 3300037471 | Ga0395905_0000144 | Ga0395905_0000144_62094_62612 | 170 |
| 150 | 3300037471 | Ga0395905_0322946 | Ga0395905_0322946_485_1003 | 170 |
| 151 | 3300037471 | Ga0395905_0437125 | Ga0395905_0437125_64_582 | 170 |
| 152 | 3300037471 | Ga0395905_0571803 | Ga0395905_0571803_221_739 | 170 |
| 153 | 3300038443 | Ga0395901_0422100 | Ga0395901_0422100_650_1168 | 170 |
| 154 | 3300038443 | Ga0395901_0914402 | Ga0395901_0914402_75_593 | 170 |
| 155 | 3300038443 | Ga0395901_1029648 | Ga0395901_1029648_47_565 | 170 |
| 156 | 3300038443 | Ga0395901_1243653 | Ga0395901_1243653_60_578 | 170 |
| 157 | 3300042008 | Ga0439450_018690 | Ga0439450_018690_519_1037 | 170 |
| 158 | 3300042012 | Ga0439455_0085699 | Ga0439455_0085699_220_738 | 170 |
| 159 | 3300042157 | Ga0439458_0013096 | Ga0439458_0013096_43_561 | 170 |
| 160 | 3300044656 | Ga0466969_0004304 | Ga0466969_0004304_3663_4205 | 170 |
| 161 | 3300044694 | Ga0466963_0471545 | Ga0466963_0471545_231_764 | 170 |
| 162 | 3300046462 | Ga0495651_0106421 | Ga0495651_0106421_1520_2044 | 170 |
| 163 | 3300046471 | Ga0495650_0000226 | Ga0495650_0000226_31278_31796 | 170 |
| 164 | 3300046507 | Ga0495606_0000066 | Ga0495606_0000066_41231_41749 | 170 |
| 165 | 3300046524 | Ga0495648_0135471 | Ga0495648_0135471_654_1172 | 170 |
| 166 | 3300046529 | Ga0495652_0104805 | Ga0495652_0104805_888_1412 | 170 |
| 167 | 3300046543 | Ga0495645_0038240 | Ga0495645_0038240_2871_3395 | 170 |
| 168 | 3300046558 | Ga0495633_0308907 | Ga0495633_0308907_83_601 | 170 |
| 169 | 3300046680 | Ga0495646_0013419 | Ga0495646_0013419_708_1232 | 170 |
| 170 | 3300046680 | Ga0495646_0273778 | Ga0495646_0273778_39_563 | 170 |
| 171 | 3300046690 | Ga0495624_0452060 | Ga0495624_0452060_165_689 | 170 |
| 172 | 3300048088 | Ga0495602_0552112 | Ga0495602_0552112_70_594 | 170 |
| 173 | 3300048905 | Ga0496102_0017272 | Ga0496102_0017272_4455_4973 | 170 |
| 174 | 3300048905 | Ga0496102_0528365 | Ga0496102_0528365_344_862 | 170 |
| 175 | 3300048906 | Ga0496103_0102895 | Ga0496103_0102895_1080_1598 | 170 |
| 176 | 3300048910 | Ga0496107_0850547 | Ga0496107_0850547_40_558 | 170 |
| 177 | 3300048914 | Ga0496111_0298479 | Ga0496111_0298479_482_1000 | 170 |
| 178 | 3300048928 | Ga0496125_0148816 | Ga0496125_0148816_826_1344 | 170 |
| 179 | 3300049529 | Ga0501313_028712 | Ga0501313_028712_136_654 | 170 |
| 180 | 3300049573 | Ga0501037_0287122 | Ga0501037_0287122_70_591 | 170 |
| 181 | 3300049574 | Ga0501038_0114085 | Ga0501038_0114085_655_1176 | 170 |
| 182 | 3300049579 | Ga0501043_0020100 | Ga0501043_0020100_4288_4809 | 170 |
| 183 | 3300049653 | Ga0501206_051819 | Ga0501206_051819_81_599 | 170 |
| 184 | 3300049654 | Ga0501207_045306 | Ga0501207_045306_61_579 | 170 |
| 185 | 3300049667 | Ga0501230_020237 | Ga0501230_020237_250_768 | 170 |
| 186 | 3300049822 | Ga0501035_0009489 | Ga0501035_0009489_1961_2482 | 170 |
| 187 | 3300049823 | Ga0501044_0025028 | Ga0501044_0025028_5561_6082 | 170 |
| 188 | 3300053140 | Ga0500573_0450659 | Ga0500573_0450659_23_547 | 170 |
| 189 | 3300059503 | Ga0587080_086051 | Ga0587080_086051_72_590 | 170 |
| 190 | 3300059505 | Ga0587083_0023874 | Ga0587083_0023874_205_723 | 170 |
| 191 | 3300059604 | Ga0587098_001525 | Ga0587098_001525_1186_1704 | 170 |
| 192 | 3300001904 | JGI24736J21556_1004411 | JGI24736J21556_10044112 | 171 |
| 193 | 3300001915 | JGI24741J21665_1013051 | JGI24741J21665_10130512 | 171 |
| 194 | 3300001979 | JGI24740J21852_10000031 | JGI24740J21852_1000003123 | 171 |
| 195 | 3300001979 | JGI24740J21852_10000396 | JGI24740J21852_100003963 | 171 |
| 196 | 3300001979 | JGI24740J21852_10006262 | JGI24740J21852_100062623 | 171 |
| 197 | 3300001989 | JGI24739J22299_10001631 | JGI24739J22299_100016315 | 171 |
| 198 | 3300001989 | JGI24739J22299_10006601 | JGI24739J22299_100066012 | 171 |
| 199 | 3300001989 | JGI24739J22299_10065571 | JGI24739J22299_100655711 | 171 |
| 200 | 3300001990 | JGI24737J22298_10007728 | JGI24737J22298_100077283 | 171 |
| 201 | 3300001990 | JGI24737J22298_10029982 | JGI24737J22298_100299822 | 171 |
| 202 | 3300001990 | JGI24737J22298_10045959 | JGI24737J22298_100459592 | 171 |
| 203 | 3300002067 | JGI24735J21928_10000955 | JGI24735J21928_100009558 | 171 |
| 204 | 3300002067 | JGI24735J21928_10001973 | JGI24735J21928_100019733 | 171 |
| 205 | 3300002067 | JGI24735J21928_10011294 | JGI24735J21928_100112941 | 171 |
| 206 | 3300002067 | JGI24735J21928_10013510 | JGI24735J21928_100135103 | 171 |
| 207 | 3300002067 | JGI24735J21928_10023445 | JGI24735J21928_100234452 | 171 |
| 208 | 3300002067 | JGI24735J21928_10036373 | JGI24735J21928_100363732 | 171 |
| 209 | 3300002075 | JGI24738J21930_10011550 | JGI24738J21930_100115502 | 171 |
| 210 | 3300002705 | JGI25156J39149_1000366 | JGI25156J39149_10003664 | 171 |
| 211 | 3300002705 | JGI25156J39149_1000389 | JGI25156J39149_100038921 | 171 |
| 212 | 3300002705 | JGI25156J39149_1000562 | JGI25156J39149_10005626 | 171 |
| 213 | 3300002705 | JGI25156J39149_1002605 | JGI25156J39149_10026052 | 171 |
| 214 | 3300002705 | JGI25156J39149_1007380 | JGI25156J39149_10073803 | 171 |
| 215 | 3300002738 | JGI25154J39366_1000271 | JGI25154J39366_100027123 | 171 |
| 216 | 3300003187 | JGI25151J46595_10005206 | JGI25151J46595_100052065 | 171 |
| 217 | 3300003214 | JGI25165J46597_1000717 | JGI25165J46597_100071717 | 171 |
| 218 | 3300003316 | rootH1_10075861 | rootH1_100758613 | 171 |
| 219 | 3300003322 | rootL2_10014775 | rootL2_100147752 | 171 |
| 220 | 3300003578 | Ga0006562J51391_1014803 | Ga0006562J51391_10148033 | 171 |
| 221 | 3300003751 | Ga0055538_1000219 | Ga0055538_100021913 | 171 |
| 222 | 3300003752 | Ga0055539_1000233 | Ga0055539_100023318 | 171 |
| 223 | 3300003756 | Ga0055533_1000064 | Ga0055533_100006436 | 171 |
| 224 | 3300003756 | Ga0055533_1000247 | Ga0055533_100024713 | 171 |
| 225 | 3300003756 | Ga0055533_1000835 | Ga0055533_10008356 | 171 |
| 226 | 3300003756 | Ga0055533_1001095 | Ga0055533_10010952 | 171 |
| 227 | 3300003758 | Ga0055532_1000013 | Ga0055532_1000013334 | 171 |
| 228 | 3300003758 | Ga0055532_1000245 | Ga0055532_100024512 | 171 |
| 229 | 3300003758 | Ga0055532_1000292 | Ga0055532_100029222 | 171 |
| 230 | 3300003759 | Ga0055525_1000318 | Ga0055525_100031818 | 171 |
| 231 | 3300003760 | Ga0055527_1000010 | Ga0055527_100001037 | 171 |
| 232 | 3300003760 | Ga0055527_1000159 | Ga0055527_100015945 | 171 |
| 233 | 3300003760 | Ga0055527_1000260 | Ga0055527_100026012 | 171 |
| 234 | 3300003760 | Ga0055527_1006249 | Ga0055527_10062492 | 171 |
| 235 | 3300003761 | Ga0055535_1000010 | Ga0055535_1000010334 | 171 |
| 236 | 3300003761 | Ga0055535_1000315 | Ga0055535_10003154 | 171 |
| 237 | 3300003761 | Ga0055535_1000431 | Ga0055535_100043112 | 171 |
| 238 | 3300003762 | Ga0055542_1000016 | Ga0055542_1000016334 | 171 |
| 239 | 3300003762 | Ga0055542_1000990 | Ga0055542_100099010 | 171 |
| 240 | 3300003762 | Ga0055542_1003449 | Ga0055542_10034493 | 171 |
| 241 | 3300003763 | Ga0055529_1000012 | Ga0055529_1000012334 | 171 |
| 242 | 3300003763 | Ga0055529_1000517 | Ga0055529_100051712 | 171 |
| 243 | 3300003790 | Ga0055528_1002297 | Ga0055528_10022978 | 171 |
| 244 | 3300003841 | Ga0055541_1000113 | Ga0055541_100011326 | 171 |
| 245 | 3300003841 | Ga0055541_1000160 | Ga0055541_100016013 | 171 |
| 246 | 3300003856 | Ga0058692_1002918 | Ga0058692_10029184 | 171 |
| 247 | 3300005262 | Ga0065165_1000810 | Ga0065165_10008107 | 171 |
| 248 | 3300005327 | Ga0070658_10003407 | Ga0070658_100034073 | 171 |
| 249 | 3300005329 | Ga0070683_101118265 | Ga0070683_1011182651 | 171 |
| 250 | 3300005337 | Ga0070682_100103553 | Ga0070682_1001035531 | 171 |
| 251 | 3300005339 | Ga0070660_100000006 | Ga0070660_10000000686 | 171 |
| 252 | 3300005339 | Ga0070660_100000507 | Ga0070660_1000005079 | 171 |
| 253 | 3300005344 | Ga0070661_100000348 | Ga0070661_10000034816 | 171 |
| 254 | 3300005354 | Ga0070675_100483202 | Ga0070675_1004832021 | 171 |
| 255 | 3300005355 | Ga0070671_100440642 | Ga0070671_1004406422 | 171 |
| 256 | 3300005366 | Ga0070659_100000082 | Ga0070659_1000000822 | 171 |
| 257 | 3300005366 | Ga0070659_100002151 | Ga0070659_1000021512 | 171 |
| 258 | 3300005367 | Ga0070667_100551988 | Ga0070667_1005519882 | 171 |
| 259 | 3300005435 | Ga0070714_100582607 | Ga0070714_1005826071 | 171 |
| 260 | 3300005435 | Ga0070714_101115677 | Ga0070714_1011156772 | 171 |
| 261 | 3300005455 | Ga0070663_100000069 | Ga0070663_1000000694 | 171 |
| 262 | 3300005455 | Ga0070663_100000075 | Ga0070663_10000007520 | 171 |
| 263 | 3300005455 | Ga0070663_100205344 | Ga0070663_1002053442 | 171 |
| 264 | 3300005456 | Ga0070678_100281207 | Ga0070678_1002812072 | 171 |
| 265 | 3300005563 | Ga0068855_100013952 | Ga0068855_1000139523 | 171 |
| 266 | 3300005563 | Ga0068855_100028268 | Ga0068855_1000282684 | 171 |
| 267 | 3300005563 | Ga0068855_100040376 | Ga0068855_1000403765 | 171 |
| 268 | 3300005563 | Ga0068855_100690129 | Ga0068855_1006901292 | 171 |
| 269 | 3300005564 | Ga0070664_100000191 | Ga0070664_10000019113 | 171 |
| 270 | 3300005614 | Ga0068856_100000504 | Ga0068856_10000050421 | 171 |
| 271 | 3300005614 | Ga0068856_100076217 | Ga0068856_1000762174 | 171 |
| 272 | 3300005616 | Ga0068852_100015182 | Ga0068852_1000151825 | 171 |
| 273 | 3300005834 | Ga0068851_10136348 | Ga0068851_101363481 | 171 |
| 274 | 3300005834 | Ga0068851_10425110 | Ga0068851_104251101 | 171 |
| 275 | 3300009011 | Ga0105251_10000127 | Ga0105251_1000012715 | 171 |
| 276 | 3300009011 | Ga0105251_10003857 | Ga0105251_100038578 | 171 |
| 277 | 3300009011 | Ga0105251_10116570 | Ga0105251_101165702 | 171 |
| 278 | 3300009036 | Ga0105244_10116648 | Ga0105244_101166481 | 171 |
| 279 | 3300009092 | Ga0105250_10210716 | Ga0105250_102107161 | 171 |
| 280 | 3300009093 | Ga0105240_10004374 | Ga0105240_100043745 | 171 |
| 281 | 3300009093 | Ga0105240_10066046 | Ga0105240_100660462 | 171 |
| 282 | 3300009093 | Ga0105240_10196992 | Ga0105240_101969923 | 171 |
| 283 | 3300009093 | Ga0105240_10442527 | Ga0105240_104425272 | 171 |
| 284 | 3300009098 | Ga0105245_10309157 | Ga0105245_103091571 | 171 |
| 285 | 3300009174 | Ga0105241_10232790 | Ga0105241_102327902 | 171 |
| 286 | 3300009174 | Ga0105241_10703039 | Ga0105241_107030391 | 171 |
| 287 | 3300009545 | Ga0105237_10141691 | Ga0105237_101416912 | 171 |
| 288 | 3300009545 | Ga0105237_10198047 | Ga0105237_101980472 | 171 |
| 289 | 3300009545 | Ga0105237_10239067 | Ga0105237_102390672 | 171 |
| 290 | 3300009545 | Ga0105237_10450867 | Ga0105237_104508672 | 171 |
| 291 | 3300009551 | Ga0105238_10063614 | Ga0105238_100636143 | 171 |
| 292 | 3300010375 | Ga0105239_10003831 | Ga0105239_1000383112 | 171 |
| 293 | 3300010375 | Ga0105239_10485553 | Ga0105239_104855532 | 171 |
| 294 | 3300011119 | Ga0105246_10858619 | Ga0105246_108586191 | 171 |
| 295 | 3300013100 | Ga0157373_10000358 | Ga0157373_1000035816 | 171 |
| 296 | 3300013100 | Ga0157373_10002832 | Ga0157373_1000283211 | 171 |
| 297 | 3300013102 | Ga0157371_10000608 | Ga0157371_1000060820 | 171 |
| 298 | 3300013102 | Ga0157371_10008084 | Ga0157371_100080843 | 171 |
| 299 | 3300013104 | Ga0157370_10000690 | Ga0157370_1000069019 | 171 |
| 300 | 3300013104 | Ga0157370_10000852 | Ga0157370_1000085213 | 171 |
| 301 | 3300013104 | Ga0157370_10001717 | Ga0157370_1000171712 | 171 |
| 302 | 3300013104 | Ga0157370_10253317 | Ga0157370_102533171 | 171 |
| 303 | 3300013105 | Ga0157369_10000120 | Ga0157369_1000012023 | 171 |
| 304 | 3300013105 | Ga0157369_10000743 | Ga0157369_1000074319 | 171 |
| 305 | 3300013105 | Ga0157369_10003555 | Ga0157369_100035558 | 171 |
| 306 | 3300013105 | Ga0157369_10095222 | Ga0157369_100952222 | 171 |
| 307 | 3300013105 | Ga0157369_10123142 | Ga0157369_101231422 | 171 |
| 308 | 3300013296 | Ga0157374_10000976 | Ga0157374_1000097612 | 171 |
| 309 | 3300013296 | Ga0157374_10240568 | Ga0157374_102405682 | 171 |
| 310 | 3300013306 | Ga0163162_10000454 | Ga0163162_1000045415 | 171 |
| 311 | 3300013306 | Ga0163162_11931083 | Ga0163162_119310831 | 171 |
| 312 | 3300013307 | Ga0157372_10000519 | Ga0157372_1000051922 | 171 |
| 313 | 3300013307 | Ga0157372_10003761 | Ga0157372_1000376112 | 171 |
| 314 | 3300013307 | Ga0157372_10152645 | Ga0157372_101526452 | 171 |
| 315 | 3300013308 | Ga0157375_10010236 | Ga0157375_100102364 | 171 |
| 316 | 3300014497 | Ga0182008_10067557 | Ga0182008_100675572 | 171 |
| 317 | 3300014497 | Ga0182008_10245974 | Ga0182008_102459741 | 171 |
| 318 | 3300014969 | Ga0157376_10966044 | Ga0157376_109660442 | 171 |
| 319 | 3300015261 | Ga0182006_1001401 | Ga0182006_10014012 | 171 |
| 320 | 3300015261 | Ga0182006_1017240 | Ga0182006_10172403 | 171 |
| 321 | 3300015262 | Ga0182007_10000795 | Ga0182007_1000079515 | 171 |
| 322 | 3300015262 | Ga0182007_10018828 | Ga0182007_100188282 | 171 |
| 323 | 3300015262 | Ga0182007_10045275 | Ga0182007_100452752 | 171 |
| 324 | 3300016635 | Ga0183361_10038 | Ga0183361_100382 | 171 |
| 325 | 3300021361 | Ga0213872_10133782 | Ga0213872_101337822 | 171 |
| 326 | 3300022467 | Ga0224712_10000332 | Ga0224712_100003322 | 171 |
| 327 | 3300025206 | Ga0209435_102054 | Ga0209435_1020542 | 171 |
| 328 | 3300025206 | Ga0209435_114785 | Ga0209435_1147852 | 171 |
| 329 | 3300025224 | Ga0209784_100215 | Ga0209784_10021517 | 171 |
| 330 | 3300025225 | Ga0209566_100018 | Ga0209566_100018378 | 171 |
| 331 | 3300025225 | Ga0209566_100161 | Ga0209566_10016132 | 171 |
| 332 | 3300025225 | Ga0209566_100215 | Ga0209566_10021529 | 171 |
| 333 | 3300025226 | Ga0209674_100011 | Ga0209674_10001134 | 171 |
| 334 | 3300025226 | Ga0209674_100048 | Ga0209674_100048284 | 171 |
| 335 | 3300025226 | Ga0209674_100183 | Ga0209674_10018345 | 171 |
| 336 | 3300025226 | Ga0209674_100271 | Ga0209674_10027117 | 171 |
| 337 | 3300025226 | Ga0209674_102469 | Ga0209674_1024692 | 171 |
| 338 | 3300025228 | Ga0209672_100002 | Ga0209672_10000234 | 171 |
| 339 | 3300025228 | Ga0209672_100012 | Ga0209672_100012197 | 171 |
| 340 | 3300025228 | Ga0209672_100020 | Ga0209672_100020165 | 171 |
| 341 | 3300025228 | Ga0209672_100066 | Ga0209672_100066105 | 171 |
| 342 | 3300025228 | Ga0209672_100234 | Ga0209672_10023420 | 171 |
| 343 | 3300025228 | Ga0209672_100439 | Ga0209672_10043915 | 171 |
| 344 | 3300025229 | Ga0209147_100003 | Ga0209147_10000334 | 171 |
| 345 | 3300025229 | Ga0209147_100007 | Ga0209147_100007575 | 171 |
| 346 | 3300025229 | Ga0209147_100024 | Ga0209147_100024165 | 171 |
| 347 | 3300025229 | Ga0209147_100084 | Ga0209147_10008462 | 171 |
| 348 | 3300025229 | Ga0209147_100295 | Ga0209147_10029513 | 171 |
| 349 | 3300025230 | Ga0209563_100181 | Ga0209563_10018117 | 171 |
| 350 | 3300025230 | Ga0209563_101061 | Ga0209563_1010614 | 171 |
| 351 | 3300025230 | Ga0209563_104234 | Ga0209563_1042343 | 171 |
| 352 | 3300025231 | Ga0207427_101307 | Ga0207427_1013073 | 171 |
| 353 | 3300025242 | Ga0209258_100014 | Ga0209258_100014128 | 171 |
| 354 | 3300025242 | Ga0209258_100042 | Ga0209258_100042326 | 171 |
| 355 | 3300025242 | Ga0209258_100084 | Ga0209258_100084165 | 171 |
| 356 | 3300025242 | Ga0209258_100117 | Ga0209258_10011762 | 171 |
| 357 | 3300025242 | Ga0209258_100477 | Ga0209258_10047713 | 171 |
| 358 | 3300025246 | Ga0209646_1000046 | Ga0209646_1000046255 | 171 |
| 359 | 3300025250 | Ga0209026_1026636 | Ga0209026_10266362 | 171 |
| 360 | 3300025253 | Ga0209677_100230 | Ga0209677_10023017 | 171 |
| 361 | 3300025253 | Ga0209677_102128 | Ga0209677_1021283 | 171 |
| 362 | 3300025254 | Ga0209148_1000006 | Ga0209148_100000634 | 171 |
| 363 | 3300025254 | Ga0209148_1000148 | Ga0209148_100014874 | 171 |
| 364 | 3300025254 | Ga0209148_1000187 | Ga0209148_100018759 | 171 |
| 365 | 3300025254 | Ga0209148_1000739 | Ga0209148_10007393 | 171 |
| 366 | 3300025254 | Ga0209148_1000785 | Ga0209148_10007855 | 171 |
| 367 | 3300025254 | Ga0209148_1003392 | Ga0209148_10033923 | 171 |
| 368 | 3300025256 | Ga0209759_1000002 | Ga0209759_1000002889 | 171 |
| 369 | 3300025256 | Ga0209759_1000032 | Ga0209759_100003230 | 171 |
| 370 | 3300025256 | Ga0209759_1000210 | Ga0209759_100021034 | 171 |
| 371 | 3300025256 | Ga0209759_1000587 | Ga0209759_100058715 | 171 |
| 372 | 3300025256 | Ga0209759_1003308 | Ga0209759_10033082 | 171 |
| 373 | 3300025256 | Ga0209759_1003547 | Ga0209759_10035476 | 171 |
| 374 | 3300025256 | Ga0209759_1006814 | Ga0209759_10068142 | 171 |
| 375 | 3300025261 | Ga0209233_1000033 | Ga0209233_1000033515 | 171 |
| 376 | 3300025272 | Ga0209455_1000003 | Ga0209455_100000334 | 171 |
| 377 | 3300025272 | Ga0209455_1000110 | Ga0209455_100011062 | 171 |
| 378 | 3300025272 | Ga0209455_1000269 | Ga0209455_10002699 | 171 |
| 379 | 3300025272 | Ga0209455_1000362 | Ga0209455_100036213 | 171 |
| 380 | 3300025272 | Ga0209455_1004621 | Ga0209455_10046213 | 171 |
| 381 | 3300025273 | Ga0209673_1000057 | Ga0209673_100005730 | 171 |
| 382 | 3300025284 | Ga0209130_1004039 | Ga0209130_10040394 | 171 |
| 383 | 3300025294 | Ga0209025_1000123 | Ga0209025_1000123139 | 171 |
| 384 | 3300025295 | Ga0209564_1006643 | Ga0209564_10066433 | 171 |
| 385 | 3300025302 | Ga0207426_1000152 | Ga0207426_1000152133 | 171 |
| 386 | 3300025735 | Ga0207713_1000302 | Ga0207713_100030214 | 171 |
| 387 | 3300025735 | Ga0207713_1004357 | Ga0207713_10043572 | 171 |
| 388 | 3300025903 | Ga0207680_10254216 | Ga0207680_102542162 | 171 |
| 389 | 3300025904 | Ga0207647_10001027 | Ga0207647_1000102714 | 171 |
| 390 | 3300025904 | Ga0207647_10011755 | Ga0207647_100117553 | 171 |
| 391 | 3300025904 | Ga0207647_10019511 | Ga0207647_100195113 | 171 |
| 392 | 3300025904 | Ga0207647_10047244 | Ga0207647_100472441 | 171 |
| 393 | 3300025904 | Ga0207647_10058678 | Ga0207647_100586782 | 171 |
| 394 | 3300025904 | Ga0207647_10078869 | Ga0207647_100788692 | 171 |
| 395 | 3300025909 | Ga0207705_10003789 | Ga0207705_100037893 | 171 |
| 396 | 3300025911 | Ga0207654_10063366 | Ga0207654_100633662 | 171 |
| 397 | 3300025913 | Ga0207695_10001113 | Ga0207695_100011132 | 171 |
| 398 | 3300025913 | Ga0207695_10006823 | Ga0207695_1000682312 | 171 |
| 399 | 3300025913 | Ga0207695_10048057 | Ga0207695_100480572 | 171 |
| 400 | 3300025914 | Ga0207671_10043195 | Ga0207671_100431952 | 171 |
| 401 | 3300025914 | Ga0207671_10084192 | Ga0207671_100841923 | 171 |
| 402 | 3300025914 | Ga0207671_10320464 | Ga0207671_103204642 | 171 |
| 403 | 3300025919 | Ga0207657_10000003 | Ga0207657_10000003170 | 171 |
| 404 | 3300025919 | Ga0207657_10000885 | Ga0207657_1000088522 | 171 |
| 405 | 3300025920 | Ga0207649_10000326 | Ga0207649_1000032613 | 171 |
| 406 | 3300025920 | Ga0207649_10073741 | Ga0207649_100737412 | 171 |
| 407 | 3300025924 | Ga0207694_10016667 | Ga0207694_100166672 | 171 |
| 408 | 3300025924 | Ga0207694_10114426 | Ga0207694_101144262 | 171 |
| 409 | 3300025926 | Ga0207659_10417359 | Ga0207659_104173591 | 171 |
| 410 | 3300025931 | Ga0207644_10034485 | Ga0207644_100344852 | 171 |
| 411 | 3300025932 | Ga0207690_10000007 | Ga0207690_10000007171 | 171 |
| 412 | 3300025932 | Ga0207690_10000380 | Ga0207690_1000038016 | 171 |
| 413 | 3300025934 | Ga0207686_10623740 | Ga0207686_106237402 | 171 |
| 414 | 3300025941 | Ga0207711_10074677 | Ga0207711_100746772 | 171 |
| 415 | 3300025941 | Ga0207711_10085911 | Ga0207711_100859111 | 171 |
| 416 | 3300025945 | Ga0207679_10000002 | Ga0207679_1000000219 | 171 |
| 417 | 3300025949 | Ga0207667_10006579 | Ga0207667_1000657910 | 171 |
| 418 | 3300025949 | Ga0207667_10006899 | Ga0207667_100068996 | 171 |
| 419 | 3300025949 | Ga0207667_10097174 | Ga0207667_100971742 | 171 |
| 420 | 3300025949 | Ga0207667_10155758 | Ga0207667_101557582 | 171 |
| 421 | 3300026067 | Ga0207678_10000319 | Ga0207678_1000031919 | 171 |
| 422 | 3300026067 | Ga0207678_10001465 | Ga0207678_100014654 | 171 |
| 423 | 3300026067 | Ga0207678_10008540 | Ga0207678_100085402 | 171 |
| 424 | 3300026067 | Ga0207678_10391346 | Ga0207678_103913462 | 171 |
| 425 | 3300026078 | Ga0207702_10000504 | Ga0207702_1000050419 | 171 |
| 426 | 3300026078 | Ga0207702_10049899 | Ga0207702_100498992 | 171 |
| 427 | 3300026116 | Ga0207674_10456110 | Ga0207674_104561102 | 171 |
| 428 | 3300026116 | Ga0207674_11209831 | Ga0207674_112098312 | 171 |
| 429 | 3300026121 | Ga0207683_10193050 | Ga0207683_101930502 | 171 |
| 430 | 3300026142 | Ga0207698_10086845 | Ga0207698_100868452 | 171 |
| 431 | 3300027312 | Ga0209371_1000076 | Ga0209371_100007612 | 171 |
| 432 | 3300027312 | Ga0209371_1008067 | Ga0209371_10080673 | 171 |
| 433 | 3300027617 | Ga0210002_1032004 | Ga0210002_10320042 | 171 |
| 434 | 3300028800 | Ga0265338_10296066 | Ga0265338_102960662 | 171 |
| 435 | 3300030500 | Ga0268256_1000087 | Ga0268256_1000087125 | 171 |
| 436 | 3300030500 | Ga0268256_1005103 | Ga0268256_10051034 | 171 |
| 437 | 3300031548 | Ga0307408_100004532 | Ga0307408_1000045324 | 171 |
| 438 | 3300031731 | Ga0307405_10265306 | Ga0307405_102653062 | 171 |
| 439 | 3300031911 | Ga0307412_10000095 | Ga0307412_1000009523 | 171 |
| 440 | 3300031911 | Ga0307412_10373368 | Ga0307412_103733682 | 171 |
| 441 | 3300037312 | Ga0395899_0006229 | Ga0395899_0006229_2099_2620 | 171 |
| 442 | 3300037312 | Ga0395899_0029500 | Ga0395899_0029500_1123_1656 | 171 |
| 443 | 3300037312 | Ga0395899_0068100 | Ga0395899_0068100_1775_2308 | 171 |
| 444 | 3300037312 | Ga0395899_0078539 | Ga0395899_0078539_469_990 | 171 |
| 445 | 3300037312 | Ga0395899_0082115 | Ga0395899_0082115_1743_2276 | 171 |
| 446 | 3300037418 | Ga0395900_0001069 | Ga0395900_0001069_19376_19909 | 171 |
| 447 | 3300037418 | Ga0395900_0101315 | Ga0395900_0101315_144_677 | 171 |
| 448 | 3300037418 | Ga0395900_0164362 | Ga0395900_0164362_12_533 | 171 |
| 449 | 3300037418 | Ga0395900_0268621 | Ga0395900_0268621_345_875 | 171 |
| 450 | 3300037418 | Ga0395900_0306495 | Ga0395900_0306495_1021_1542 | 171 |
| 451 | 3300037418 | Ga0395900_0310588 | Ga0395900_0310588_189_722 | 171 |
| 452 | 3300037418 | Ga0395900_0547016 | Ga0395900_0547016_345_878 | 171 |
| 453 | 3300037466 | Ga0395898_0001705 | Ga0395898_0001705_6709_7242 | 171 |
| 454 | 3300037466 | Ga0395898_0013543 | Ga0395898_0013543_5535_6065 | 171 |
| 455 | 3300037466 | Ga0395898_0091311 | Ga0395898_0091311_491_1021 | 171 |
| 456 | 3300037466 | Ga0395898_0098228 | Ga0395898_0098228_1103_1624 | 171 |
| 457 | 3300037466 | Ga0395898_0113022 | Ga0395898_0113022_184_717 | 171 |
| 458 | 3300037466 | Ga0395898_0155359 | Ga0395898_0155359_527_1060 | 171 |
| 459 | 3300037466 | Ga0395898_0236639 | Ga0395898_0236639_214_747 | 171 |
| 460 | 3300037471 | Ga0395905_0000048 | Ga0395905_0000048_177718_178251 | 171 |
| 461 | 3300037471 | Ga0395905_0007757 | Ga0395905_0007757_6879_7409 | 171 |
| 462 | 3300037471 | Ga0395905_0048375 | Ga0395905_0048375_471_992 | 171 |
| 463 | 3300037471 | Ga0395905_0790484 | Ga0395905_0790484_50_583 | 171 |
| 464 | 3300038443 | Ga0395901_0000081 | Ga0395901_0000081_107999_108532 | 171 |
| 465 | 3300038443 | Ga0395901_0000157 | Ga0395901_0000157_66756_67289 | 171 |
| 466 | 3300038443 | Ga0395901_0014499 | Ga0395901_0014499_214_747 | 171 |
| 467 | 3300038443 | Ga0395901_0046848 | Ga0395901_0046848_3898_4419 | 171 |
| 468 | 3300038443 | Ga0395901_0075354 | Ga0395901_0075354_184_717 | 171 |
| 469 | 3300038443 | Ga0395901_0096738 | Ga0395901_0096738_950_1480 | 171 |
| 470 | 3300039437 | Ga0436365_0041924 | Ga0436365_0041924_1708_2241 | 171 |
| 471 | 3300039438 | Ga0436360_0381606 | Ga0436360_0381606_708_1247 | 171 |
| 472 | 3300039447 | Ga0436361_1016186 | Ga0436361_1016186_2126_2659 | 171 |
| 473 | 3300042005 | Ga0439448_0000277 | Ga0439448_0000277_4701_5231 | 171 |
| 474 | 3300042005 | Ga0439448_0024425 | Ga0439448_0024425_631_1152 | 171 |
| 475 | 3300042008 | Ga0439450_009019 | Ga0439450_009019_1187_1708 | 171 |
| 476 | 3300044656 | Ga0466969_0006179 | Ga0466969_0006179_2827_3363 | 171 |
| 477 | 3300044656 | Ga0466969_0017551 | Ga0466969_0017551_1655_2188 | 171 |
| 478 | 3300044658 | Ga0466972_0010584 | Ga0466972_0010584_1877_2410 | 171 |
| 479 | 3300044659 | Ga0466973_0010148 | Ga0466973_0010148_7335_7871 | 171 |
| 480 | 3300044683 | Ga0466965_0003673 | Ga0466965_0003673_5710_6246 | 171 |
| 481 | 3300044683 | Ga0466965_0015457 | Ga0466965_0015457_2859_3392 | 171 |
| 482 | 3300044684 | Ga0466966_0000009 | Ga0466966_0000009_37025_37558 | 171 |
| 483 | 3300044684 | Ga0466966_0002666 | Ga0466966_0002666_7174_7707 | 171 |
| 484 | 3300044684 | Ga0466966_0446945 | Ga0466966_0446945_92_628 | 171 |
| 485 | 3300044693 | Ga0466961_0001729 | Ga0466961_0001729_8579_9115 | 171 |
| 486 | 3300044693 | Ga0466961_0021964 | Ga0466961_0021964_1694_2227 | 171 |
| 487 | 3300044693 | Ga0466961_0104073 | Ga0466961_0104073_845_1378 | 171 |
| 488 | 3300044693 | Ga0466961_0164022 | Ga0466961_0164022_691_1224 | 171 |
| 489 | 3300044694 | Ga0466963_0004763 | Ga0466963_0004763_604_1140 | 171 |
| 490 | 3300044694 | Ga0466963_0108759 | Ga0466963_0108759_1055_1588 | 171 |
| 491 | 3300044694 | Ga0466963_0351380 | Ga0466963_0351380_368_901 | 171 |
| 492 | 3300044735 | Ga0466968_0376707 | Ga0466968_0376707_60_596 | 171 |
| 493 | 3300044765 | Ga0466970_0007794 | Ga0466970_0007794_996_1529 | 171 |
| 494 | 3300044765 | Ga0466970_0063990 | Ga0466970_0063990_329_871 | 171 |
| 495 | 3300044765 | Ga0466970_0109451 | Ga0466970_0109451_207_743 | 171 |
| 496 | 3300044842 | Ga0466957_0055369 | Ga0466957_0055369_257_790 | 171 |
| 497 | 3300044842 | Ga0466957_0058628 | Ga0466957_0058628_1713_2246 | 171 |
| 498 | 3300044842 | Ga0466957_0137722 | Ga0466957_0137722_930_1460 | 171 |
| 499 | 3300044901 | Ga0466960_0126579 | Ga0466960_0126579_694_1224 | 171 |
| 500 | 3300045049 | Ga0466959_0007139 | Ga0466959_0007139_1880_2413 | 171 |
| 501 | 3300045049 | Ga0466959_0015359 | Ga0466959_0015359_486_1022 | 171 |
| 502 | 3300045049 | Ga0466959_0070837 | Ga0466959_0070837_352_885 | 171 |
| 503 | 3300045836 | Ga0466958_0012698 | Ga0466958_0012698_430_966 | 171 |
| 504 | 3300045836 | Ga0466958_0014712 | Ga0466958_0014712_2381_2914 | 171 |
| 505 | 3300045836 | Ga0466958_0028692 | Ga0466958_0028692_2352_2885 | 171 |
| 506 | 3300045836 | Ga0466958_0051920 | Ga0466958_0051920_1326_1847 | 171 |
| 507 | 3300046454 | Ga0495592_0105775 | Ga0495592_0105775_689_1225 | 171 |
| 508 | 3300046454 | Ga0495592_0124916 | Ga0495592_0124916_486_1022 | 171 |
| 509 | 3300046455 | Ga0495603_0119288 | Ga0495603_0119288_744_1280 | 171 |
| 510 | 3300046457 | Ga0495590_0001159 | Ga0495590_0001159_8450_8980 | 171 |
| 511 | 3300046457 | Ga0495590_0006265 | Ga0495590_0006265_3975_4511 | 171 |
| 512 | 3300046457 | Ga0495590_0045663 | Ga0495590_0045663_979_1515 | 171 |
| 513 | 3300046459 | Ga0495629_0000137 | Ga0495629_0000137_1670_2206 | 171 |
| 514 | 3300046459 | Ga0495629_0000758 | Ga0495629_0000758_6135_6671 | 171 |
| 515 | 3300046459 | Ga0495629_0004710 | Ga0495629_0004710_2675_3211 | 171 |
| 516 | 3300046459 | Ga0495629_0075609 | Ga0495629_0075609_1693_2226 | 171 |
| 517 | 3300046460 | Ga0495638_0045977 | Ga0495638_0045977_1440_1976 | 171 |
| 518 | 3300046460 | Ga0495638_0063705 | Ga0495638_0063705_797_1333 | 171 |
| 519 | 3300046460 | Ga0495638_0253589 | Ga0495638_0253589_119_655 | 171 |
| 520 | 3300046461 | Ga0495641_0052028 | Ga0495641_0052028_700_1236 | 171 |
| 521 | 3300046462 | Ga0495651_0021068 | Ga0495651_0021068_1966_2502 | 171 |
| 522 | 3300046462 | Ga0495651_0289306 | Ga0495651_0289306_521_1057 | 171 |
| 523 | 3300046463 | Ga0495653_0054926 | Ga0495653_0054926_1451_1981 | 171 |
| 524 | 3300046463 | Ga0495653_0153329 | Ga0495653_0153329_1009_1545 | 171 |
| 525 | 3300046471 | Ga0495650_0013190 | Ga0495650_0013190_1958_2494 | 171 |
| 526 | 3300046471 | Ga0495650_0064766 | Ga0495650_0064766_356_892 | 171 |
| 527 | 3300046471 | Ga0495650_0068416 | Ga0495650_0068416_272_808 | 171 |
| 528 | 3300046472 | Ga0495580_0000703 | Ga0495580_0000703_438_974 | 171 |
| 529 | 3300046472 | Ga0495580_0010665 | Ga0495580_0010665_4087_4632 | 171 |
| 530 | 3300046472 | Ga0495580_0016508 | Ga0495580_0016508_3682_4218 | 171 |
| 531 | 3300046472 | Ga0495580_0049717 | Ga0495580_0049717_407_943 | 171 |
| 532 | 3300046472 | Ga0495580_0064624 | Ga0495580_0064624_341_877 | 171 |
| 533 | 3300046472 | Ga0495580_0078208 | Ga0495580_0078208_1193_1729 | 171 |
| 534 | 3300046472 | Ga0495580_0118813 | Ga0495580_0118813_1146_1682 | 171 |
| 535 | 3300046472 | Ga0495580_0360130 | Ga0495580_0360130_407_943 | 171 |
| 536 | 3300046473 | Ga0495582_0071388 | Ga0495582_0071388_982_1518 | 171 |
| 537 | 3300046473 | Ga0495582_0161717 | Ga0495582_0161717_56_592 | 171 |
| 538 | 3300046473 | Ga0495582_0277826 | Ga0495582_0277826_215_751 | 171 |
| 539 | 3300046474 | Ga0495605_0001460 | Ga0495605_0001460_552_1088 | 171 |
| 540 | 3300046474 | Ga0495605_0014706 | Ga0495605_0014706_141_686 | 171 |
| 541 | 3300046474 | Ga0495605_0125302 | Ga0495605_0125302_45_581 | 171 |
| 542 | 3300046477 | Ga0495664_0007353 | Ga0495664_0007353_2116_2646 | 171 |
| 543 | 3300046477 | Ga0495664_0107192 | Ga0495664_0107192_158_694 | 171 |
| 544 | 3300046477 | Ga0495664_0225610 | Ga0495664_0225610_484_1020 | 171 |
| 545 | 3300046491 | Ga0495584_0017445 | Ga0495584_0017445_2440_2970 | 171 |
| 546 | 3300046499 | Ga0495594_0127206 | Ga0495594_0127206_317_853 | 171 |
| 547 | 3300046500 | Ga0495596_0002590 | Ga0495596_0002590_564_1100 | 171 |
| 548 | 3300046500 | Ga0495596_0048064 | Ga0495596_0048064_335_871 | 171 |
| 549 | 3300046500 | Ga0495596_0158162 | Ga0495596_0158162_75_611 | 171 |
| 550 | 3300046506 | Ga0495583_0010285 | Ga0495583_0010285_787_1332 | 171 |
| 551 | 3300046507 | Ga0495606_0031661 | Ga0495606_0031661_1939_2475 | 171 |
| 552 | 3300046507 | Ga0495606_0033155 | Ga0495606_0033155_921_1451 | 171 |
| 553 | 3300046507 | Ga0495606_0129780 | Ga0495606_0129780_290_826 | 171 |
| 554 | 3300046507 | Ga0495606_0160261 | Ga0495606_0160261_29_565 | 171 |
| 555 | 3300046512 | Ga0495610_0000745 | Ga0495610_0000745_17823_18359 | 171 |
| 556 | 3300046513 | Ga0495616_0027863 | Ga0495616_0027863_299_844 | 171 |
| 557 | 3300046513 | Ga0495616_0166841 | Ga0495616_0166841_83_604 | 171 |
| 558 | 3300046514 | Ga0495618_0012697 | Ga0495618_0012697_4439_4975 | 171 |
| 559 | 3300046514 | Ga0495618_0176056 | Ga0495618_0176056_767_1303 | 171 |
| 560 | 3300046514 | Ga0495618_0212213 | Ga0495618_0212213_492_1028 | 171 |
| 561 | 3300046515 | Ga0495620_0061141 | Ga0495620_0061141_750_1280 | 171 |
| 562 | 3300046516 | Ga0495628_0006690 | Ga0495628_0006690_8616_9152 | 171 |
| 563 | 3300046516 | Ga0495628_0077898 | Ga0495628_0077898_883_1419 | 171 |
| 564 | 3300046517 | Ga0495630_0006496 | Ga0495630_0006496_6104_6640 | 171 |
| 565 | 3300046517 | Ga0495630_0075178 | Ga0495630_0075178_1366_1902 | 171 |
| 566 | 3300046517 | Ga0495630_0143959 | Ga0495630_0143959_859_1395 | 171 |
| 567 | 3300046517 | Ga0495630_0174489 | Ga0495630_0174489_1071_1607 | 171 |
| 568 | 3300046524 | Ga0495648_0087115 | Ga0495648_0087115_657_1202 | 171 |
| 569 | 3300046524 | Ga0495648_0099040 | Ga0495648_0099040_931_1467 | 171 |
| 570 | 3300046524 | Ga0495648_0281437 | Ga0495648_0281437_80_616 | 171 |
| 571 | 3300046526 | Ga0495666_0046001 | Ga0495666_0046001_642_1178 | 171 |
| 572 | 3300046526 | Ga0495666_0065631 | Ga0495666_0065631_966_1511 | 171 |
| 573 | 3300046528 | Ga0495642_0105743 | Ga0495642_0105743_320_856 | 171 |
| 574 | 3300046529 | Ga0495652_0013748 | Ga0495652_0013748_3212_3742 | 171 |
| 575 | 3300046529 | Ga0495652_0077639 | Ga0495652_0077639_1772_2308 | 171 |
| 576 | 3300046529 | Ga0495652_0308066 | Ga0495652_0308066_159_695 | 171 |
| 577 | 3300046529 | Ga0495652_0319584 | Ga0495652_0319584_257_793 | 171 |
| 578 | 3300046530 | Ga0495654_0128819 | Ga0495654_0128819_416_952 | 171 |
| 579 | 3300046531 | Ga0495665_0001219 | Ga0495665_0001219_12387_12917 | 171 |
| 580 | 3300046531 | Ga0495665_0002867 | Ga0495665_0002867_310_846 | 171 |
| 581 | 3300046531 | Ga0495665_0012093 | Ga0495665_0012093_1394_1930 | 171 |
| 582 | 3300046531 | Ga0495665_0057582 | Ga0495665_0057582_648_1184 | 171 |
| 583 | 3300046531 | Ga0495665_0103915 | Ga0495665_0103915_139_684 | 171 |
| 584 | 3300046531 | Ga0495665_0225210 | Ga0495665_0225210_268_804 | 171 |
| 585 | 3300046533 | Ga0495640_0009812 | Ga0495640_0009812_1133_1669 | 171 |
| 586 | 3300046533 | Ga0495640_0049346 | Ga0495640_0049346_2210_2746 | 171 |
| 587 | 3300046533 | Ga0495640_0133440 | Ga0495640_0133440_26_562 | 171 |
| 588 | 3300046535 | Ga0495586_0132326 | Ga0495586_0132326_412_948 | 171 |
| 589 | 3300046536 | Ga0495587_0116857 | Ga0495587_0116857_953_1489 | 171 |
| 590 | 3300046536 | Ga0495587_0144163 | Ga0495587_0144163_767_1303 | 171 |
| 591 | 3300046542 | Ga0495597_0038812 | Ga0495597_0038812_847_1377 | 171 |
| 592 | 3300046542 | Ga0495597_0066881 | Ga0495597_0066881_37_573 | 171 |
| 593 | 3300046543 | Ga0495645_0041914 | Ga0495645_0041914_918_1448 | 171 |
| 594 | 3300046543 | Ga0495645_0082632 | Ga0495645_0082632_255_791 | 171 |
| 595 | 3300046543 | Ga0495645_0128508 | Ga0495645_0128508_999_1535 | 171 |
| 596 | 3300046557 | Ga0495622_0000287 | Ga0495622_0000287_24732_25268 | 171 |
| 597 | 3300046559 | Ga0495667_0095636 | Ga0495667_0095636_758_1294 | 171 |
| 598 | 3300046642 | Ga0495634_0096031 | Ga0495634_0096031_145_681 | 171 |
| 599 | 3300046642 | Ga0495634_0155823 | Ga0495634_0155823_743_1279 | 171 |
| 600 | 3300046642 | Ga0495634_0191215 | Ga0495634_0191215_159_695 | 171 |
| 601 | 3300046648 | Ga0495611_0204377 | Ga0495611_0204377_96_632 | 171 |
| 602 | 3300046660 | Ga0495625_0114311 | Ga0495625_0114311_1236_1772 | 171 |
| 603 | 3300046663 | Ga0495635_0003260 | Ga0495635_0003260_882_1418 | 171 |
| 604 | 3300046663 | Ga0495635_0031526 | Ga0495635_0031526_249_779 | 171 |
| 605 | 3300046663 | Ga0495635_0067239 | Ga0495635_0067239_723_1259 | 171 |
| 606 | 3300046665 | Ga0495661_0026657 | Ga0495661_0026657_2086_2622 | 171 |
| 607 | 3300046665 | Ga0495661_0053064 | Ga0495661_0053064_735_1271 | 171 |
| 608 | 3300046678 | Ga0495599_0115987 | Ga0495599_0115987_623_1159 | 171 |
| 609 | 3300046679 | Ga0495623_0005611 | Ga0495623_0005611_423_959 | 171 |
| 610 | 3300046679 | Ga0495623_0086152 | Ga0495623_0086152_876_1412 | 171 |
| 611 | 3300046679 | Ga0495623_0095211 | Ga0495623_0095211_368_898 | 171 |
| 612 | 3300046679 | Ga0495623_0107684 | Ga0495623_0107684_65_601 | 171 |
| 613 | 3300046680 | Ga0495646_0021175 | Ga0495646_0021175_2020_2556 | 171 |
| 614 | 3300046680 | Ga0495646_0045895 | Ga0495646_0045895_430_966 | 171 |
| 615 | 3300046680 | Ga0495646_0083368 | Ga0495646_0083368_1017_1553 | 171 |
| 616 | 3300046684 | Ga0495669_0009043 | Ga0495669_0009043_791_1327 | 171 |
| 617 | 3300046684 | Ga0495669_0028636 | Ga0495669_0028636_1050_1586 | 171 |
| 618 | 3300046689 | Ga0495613_0014252 | Ga0495613_0014252_5004_5540 | 171 |
| 619 | 3300046689 | Ga0495613_0016752 | Ga0495613_0016752_874_1410 | 171 |
| 620 | 3300046690 | Ga0495624_0002935 | Ga0495624_0002935_6442_6978 | 171 |
| 621 | 3300046690 | Ga0495624_0008831 | Ga0495624_0008831_4263_4799 | 171 |
| 622 | 3300046690 | Ga0495624_0016596 | Ga0495624_0016596_3196_3726 | 171 |
| 623 | 3300046690 | Ga0495624_0029501 | Ga0495624_0029501_2159_2695 | 171 |
| 624 | 3300046690 | Ga0495624_0066377 | Ga0495624_0066377_371_907 | 171 |
| 625 | 3300046690 | Ga0495624_0158189 | Ga0495624_0158189_332_868 | 171 |
| 626 | 3300046690 | Ga0495624_0226695 | Ga0495624_0226695_16_552 | 171 |
| 627 | 3300046692 | Ga0495671_0024267 | Ga0495671_0024267_1542_2078 | 171 |
| 628 | 3300046694 | Ga0495649_0004871 | Ga0495649_0004871_846_1382 | 171 |
| 629 | 3300046694 | Ga0495649_0106211 | Ga0495649_0106211_24_560 | 171 |
| 630 | 3300046694 | Ga0495649_0170522 | Ga0495649_0170522_270_806 | 171 |
| 631 | 3300046794 | Ga0495589_0019602 | Ga0495589_0019602_1506_2042 | 171 |
| 632 | 3300046794 | Ga0495589_0058040 | Ga0495589_0058040_1081_1617 | 171 |
| 633 | 3300046794 | Ga0495589_0060027 | Ga0495589_0060027_611_1147 | 171 |
| 634 | 3300046794 | Ga0495589_0099209 | Ga0495589_0099209_322_858 | 171 |
| 635 | 3300046809 | Ga0495600_0018722 | Ga0495600_0018722_256_792 | 171 |
| 636 | 3300046809 | Ga0495600_0071222 | Ga0495600_0071222_1273_1809 | 171 |
| 637 | 3300046810 | Ga0495660_0042998 | Ga0495660_0042998_290_826 | 171 |
| 638 | 3300047315 | Ga0495581_0006112 | Ga0495581_0006112_5599_6135 | 171 |
| 639 | 3300047315 | Ga0495581_0028287 | Ga0495581_0028287_2001_2537 | 171 |
| 640 | 3300047315 | Ga0495581_0102085 | Ga0495581_0102085_646_1182 | 171 |
| 641 | 3300047317 | Ga0495604_0001571 | Ga0495604_0001571_8594_9130 | 171 |
| 642 | 3300047317 | Ga0495604_0025773 | Ga0495604_0025773_1435_1965 | 171 |
| 643 | 3300047317 | Ga0495604_0026260 | Ga0495604_0026260_376_912 | 171 |
| 644 | 3300047317 | Ga0495604_0042301 | Ga0495604_0042301_1337_1873 | 171 |
| 645 | 3300047317 | Ga0495604_0087198 | Ga0495604_0087198_900_1433 | 171 |
| 646 | 3300047317 | Ga0495604_0181992 | Ga0495604_0181992_513_1049 | 171 |
| 647 | 3300047319 | Ga0495674_0003691 | Ga0495674_0003691_14235_14768 | 171 |
| 648 | 3300047319 | Ga0495674_0013082 | Ga0495674_0013082_5926_6462 | 171 |
| 649 | 3300047319 | Ga0495674_0022068 | Ga0495674_0022068_2061_2597 | 171 |
| 650 | 3300047319 | Ga0495674_0045991 | Ga0495674_0045991_1596_2132 | 171 |
| 651 | 3300047319 | Ga0495674_0049855 | Ga0495674_0049855_2851_3387 | 171 |
| 652 | 3300047319 | Ga0495674_0085690 | Ga0495674_0085690_874_1419 | 171 |
| 653 | 3300047319 | Ga0495674_0099233 | Ga0495674_0099233_266_802 | 171 |
| 654 | 3300047319 | Ga0495674_0534688 | Ga0495674_0534688_70_606 | 171 |
| 655 | 3300047320 | Ga0495672_0001027 | Ga0495672_0001027_2649_3185 | 171 |
| 656 | 3300047320 | Ga0495672_0023540 | Ga0495672_0023540_2784_3329 | 171 |
| 657 | 3300047321 | Ga0495676_0098077 | Ga0495676_0098077_589_1125 | 171 |
| 658 | 3300047322 | Ga0495680_0017847 | Ga0495680_0017847_4573_5103 | 171 |
| 659 | 3300047322 | Ga0495680_0076671 | Ga0495680_0076671_629_1165 | 171 |
| 660 | 3300047322 | Ga0495680_0087042 | Ga0495680_0087042_1394_1930 | 171 |
| 661 | 3300047322 | Ga0495680_0188315 | Ga0495680_0188315_444_980 | 171 |
| 662 | 3300047322 | Ga0495680_0578524 | Ga0495680_0578524_201_737 | 171 |
| 663 | 3300047323 | Ga0495683_0008992 | Ga0495683_0008992_469_1005 | 171 |
| 664 | 3300047323 | Ga0495683_0055362 | Ga0495683_0055362_1415_1951 | 171 |
| 665 | 3300047323 | Ga0495683_0090617 | Ga0495683_0090617_14_559 | 171 |
| 666 | 3300047323 | Ga0495683_0132276 | Ga0495683_0132276_128_658 | 171 |
| 667 | 3300047443 | Ga0495687_000021 | Ga0495687_000021_214901_215443 | 171 |
| 668 | 3300047443 | Ga0495687_007444 | Ga0495687_007444_4134_4679 | 171 |
| 669 | 3300047443 | Ga0495687_031541 | Ga0495687_031541_1092_1628 | 171 |
| 670 | 3300047443 | Ga0495687_103383 | Ga0495687_103383_117_653 | 171 |
| 671 | 3300047444 | Ga0495675_0017368 | Ga0495675_0017368_3216_3752 | 171 |
| 672 | 3300047444 | Ga0495675_0046970 | Ga0495675_0046970_1623_2159 | 171 |
| 673 | 3300047444 | Ga0495675_0049921 | Ga0495675_0049921_609_1145 | 171 |
| 674 | 3300047444 | Ga0495675_0057153 | Ga0495675_0057153_1562_2098 | 171 |
| 675 | 3300047444 | Ga0495675_0114040 | Ga0495675_0114040_82_618 | 171 |
| 676 | 3300047446 | Ga0495679_000013 | Ga0495679_000013_301570_302106 | 171 |
| 677 | 3300047446 | Ga0495679_000885 | Ga0495679_000885_12816_13352 | 171 |
| 678 | 3300047446 | Ga0495679_009825 | Ga0495679_009825_581_1117 | 171 |
| 679 | 3300047469 | Ga0495673_0033822 | Ga0495673_0033822_609_1154 | 171 |
| 680 | 3300047469 | Ga0495673_0039418 | Ga0495673_0039418_681_1217 | 171 |
| 681 | 3300047469 | Ga0495673_0129585 | Ga0495673_0129585_134_670 | 171 |
| 682 | 3300047469 | Ga0495673_0158381 | Ga0495673_0158381_250_786 | 171 |
| 683 | 3300047470 | Ga0495681_0158050 | Ga0495681_0158050_52_588 | 171 |
| 684 | 3300047471 | Ga0495684_0013909 | Ga0495684_0013909_5155_5691 | 171 |
| 685 | 3300047471 | Ga0495684_0240650 | Ga0495684_0240650_200_736 | 171 |
| 686 | 3300047471 | Ga0495684_0485152 | Ga0495684_0485152_170_706 | 171 |
| 687 | 3300047472 | Ga0495686_0000081 | Ga0495686_0000081_22698_23234 | 171 |
| 688 | 3300047472 | Ga0495686_0091173 | Ga0495686_0091173_318_854 | 171 |
| 689 | 3300047673 | Ga0495593_0005939 | Ga0495593_0005939_5571_6107 | 171 |
| 690 | 3300047673 | Ga0495593_0008969 | Ga0495593_0008969_802_1338 | 171 |
| 691 | 3300047673 | Ga0495593_0019987 | Ga0495593_0019987_1155_1685 | 171 |
| 692 | 3300047673 | Ga0495593_0026977 | Ga0495593_0026977_2498_3034 | 171 |
| 693 | 3300048088 | Ga0495602_0042153 | Ga0495602_0042153_987_1523 | 171 |
| 694 | 3300048088 | Ga0495602_0045768 | Ga0495602_0045768_3178_3708 | 171 |
| 695 | 3300048088 | Ga0495602_0089662 | Ga0495602_0089662_1394_1930 | 171 |
| 696 | 3300048088 | Ga0495602_0231121 | Ga0495602_0231121_230_766 | 171 |
| 697 | 3300048089 | Ga0495614_0010574 | Ga0495614_0010574_2851_3387 | 171 |
| 698 | 3300048089 | Ga0495614_0028617 | Ga0495614_0028617_835_1371 | 171 |
| 699 | 3300048089 | Ga0495614_0040887 | Ga0495614_0040887_527_1063 | 171 |
| 700 | 3300048091 | Ga0495626_0080088 | Ga0495626_0080088_130_666 | 171 |
| 701 | 3300048091 | Ga0495626_0150132 | Ga0495626_0150132_401_943 | 171 |
| 702 | 3300048903 | Ga0496100_0195637 | Ga0496100_0195637_701_1231 | 171 |
| 703 | 3300048903 | Ga0496100_0205631 | Ga0496100_0205631_188_724 | 171 |
| 704 | 3300048904 | Ga0496101_0005318 | Ga0496101_0005318_223_768 | 171 |
| 705 | 3300048904 | Ga0496101_0005742 | Ga0496101_0005742_5881_6411 | 171 |
| 706 | 3300048904 | Ga0496101_0007002 | Ga0496101_0007002_212_742 | 171 |
| 707 | 3300048904 | Ga0496101_0312314 | Ga0496101_0312314_563_1099 | 171 |
| 708 | 3300048905 | Ga0496102_0001948 | Ga0496102_0001948_12002_12547 | 171 |
| 709 | 3300048905 | Ga0496102_0169031 | Ga0496102_0169031_935_1471 | 171 |
| 710 | 3300048905 | Ga0496102_0402081 | Ga0496102_0402081_518_1048 | 171 |
| 711 | 3300048905 | Ga0496102_0956540 | Ga0496102_0956540_13_534 | 171 |
| 712 | 3300048906 | Ga0496103_0602814 | Ga0496103_0602814_154_684 | 171 |
| 713 | 3300048907 | Ga0496104_0372972 | Ga0496104_0372972_376_921 | 171 |
| 714 | 3300048907 | Ga0496104_0446361 | Ga0496104_0446361_626_1156 | 171 |
| 715 | 3300048908 | Ga0496105_0075444 | Ga0496105_0075444_550_1095 | 171 |
| 716 | 3300048908 | Ga0496105_0583387 | Ga0496105_0583387_227_757 | 171 |
| 717 | 3300048909 | Ga0496106_0009549 | Ga0496106_0009549_5562_6083 | 171 |
| 718 | 3300048909 | Ga0496106_0205462 | Ga0496106_0205462_858_1388 | 171 |
| 719 | 3300048910 | Ga0496107_0114849 | Ga0496107_0114849_1038_1574 | 171 |
| 720 | 3300048911 | Ga0496108_0036849 | Ga0496108_0036849_1813_2343 | 171 |
| 721 | 3300048912 | Ga0496109_1290545 | Ga0496109_1290545_74_604 | 171 |
| 722 | 3300048913 | Ga0496110_0360478 | Ga0496110_0360478_166_687 | 171 |
| 723 | 3300048914 | Ga0496111_0123848 | Ga0496111_0123848_847_1377 | 171 |
| 724 | 3300048915 | Ga0496112_0016884 | Ga0496112_0016884_6146_6676 | 171 |
| 725 | 3300048915 | Ga0496112_0157336 | Ga0496112_0157336_971_1516 | 171 |
| 726 | 3300048916 | Ga0496113_0142375 | Ga0496113_0142375_405_950 | 171 |
| 727 | 3300048916 | Ga0496113_0347556 | Ga0496113_0347556_110_640 | 171 |
| 728 | 3300048917 | Ga0496114_0012267 | Ga0496114_0012267_5491_6027 | 171 |
| 729 | 3300048917 | Ga0496114_0801884 | Ga0496114_0801884_159_695 | 171 |
| 730 | 3300048918 | Ga0496115_0114478 | Ga0496115_0114478_853_1383 | 171 |
| 731 | 3300048918 | Ga0496115_0215959 | Ga0496115_0215959_684_1220 | 171 |
| 732 | 3300048919 | Ga0496116_0034617 | Ga0496116_0034617_1788_2324 | 171 |
| 733 | 3300048919 | Ga0496116_0057918 | Ga0496116_0057918_240_770 | 171 |
| 734 | 3300048920 | Ga0496117_0003808 | Ga0496117_0003808_3447_3992 | 171 |
| 735 | 3300048920 | Ga0496117_0003944 | Ga0496117_0003944_733_1269 | 171 |
| 736 | 3300048920 | Ga0496117_0010066 | Ga0496117_0010066_3243_3779 | 171 |
| 737 | 3300048920 | Ga0496117_0015912 | Ga0496117_0015912_949_1485 | 171 |
| 738 | 3300048920 | Ga0496117_0086561 | Ga0496117_0086561_240_770 | 171 |
| 739 | 3300048921 | Ga0496118_0001751 | Ga0496118_0001751_17696_18232 | 171 |
| 740 | 3300048921 | Ga0496118_0004406 | Ga0496118_0004406_7428_7973 | 171 |
| 741 | 3300048921 | Ga0496118_0022028 | Ga0496118_0022028_1067_1603 | 171 |
| 742 | 3300048921 | Ga0496118_0044323 | Ga0496118_0044323_912_1448 | 171 |
| 743 | 3300048921 | Ga0496118_0139088 | Ga0496118_0139088_961_1497 | 171 |
| 744 | 3300048921 | Ga0496118_0199193 | Ga0496118_0199193_130_660 | 171 |
| 745 | 3300048922 | Ga0496119_0128710 | Ga0496119_0128710_115_645 | 171 |
| 746 | 3300048924 | Ga0496121_0001129 | Ga0496121_0001129_12634_13170 | 171 |
| 747 | 3300048924 | Ga0496121_0005701 | Ga0496121_0005701_6075_6620 | 171 |
| 748 | 3300048924 | Ga0496121_0023755 | Ga0496121_0023755_681_1226 | 171 |
| 749 | 3300048924 | Ga0496121_0025167 | Ga0496121_0025167_2142_2678 | 171 |
| 750 | 3300048924 | Ga0496121_0084888 | Ga0496121_0084888_1725_2255 | 171 |
| 751 | 3300048925 | Ga0496122_0106778 | Ga0496122_0106778_195_725 | 171 |
| 752 | 3300048925 | Ga0496122_0133830 | Ga0496122_0133830_810_1331 | 171 |
| 753 | 3300048926 | Ga0496123_0141072 | Ga0496123_0141072_685_1215 | 171 |
| 754 | 3300048927 | Ga0496124_0237306 | Ga0496124_0237306_687_1217 | 171 |
| 755 | 3300048927 | Ga0496124_0300726 | Ga0496124_0300726_54_575 | 171 |
| 756 | 3300048928 | Ga0496125_0018061 | Ga0496125_0018061_5948_6478 | 171 |
| 757 | 3300048928 | Ga0496125_0192152 | Ga0496125_0192152_319_864 | 171 |
| 758 | 3300048928 | Ga0496125_0426440 | Ga0496125_0426440_158_694 | 171 |
| 759 | 3300048929 | Ga0496126_0004750 | Ga0496126_0004750_1748_2284 | 171 |
| 760 | 3300048929 | Ga0496126_0155464 | Ga0496126_0155464_638_1174 | 171 |
| 761 | 3300049459 | Ga0495678_054133 | Ga0495678_054133_556_1092 | 171 |
| 762 | 3300049460 | Ga0495682_0027727 | Ga0495682_0027727_1315_1860 | 171 |
| 763 | 3300049460 | Ga0495682_0030129 | Ga0495682_0030129_146_682 | 171 |
| 764 | 3300059477 | Ga0587084_007755 | Ga0587084_007755_724_1257 | 171 |
| 765 | 3300059477 | Ga0587084_019179 | Ga0587084_019179_409_954 | 171 |
| 766 | 3300059491 | Ga0587070_018743 | Ga0587070_018743_484_1029 | 171 |
| 767 | 3300059491 | Ga0587070_071260 | Ga0587070_071260_195_728 | 171 |
| 768 | 3300059503 | Ga0587080_038036 | Ga0587080_038036_59_604 | 171 |
| 769 | 3300059503 | Ga0587080_082992 | Ga0587080_082992_51_584 | 171 |
| 770 | 3300059505 | Ga0587083_0001420 | Ga0587083_0001420_1179_1712 | 171 |
| 771 | 3300059505 | Ga0587083_0017588 | Ga0587083_0017588_478_1011 | 171 |
| 772 | 3300059505 | Ga0587083_0058859 | Ga0587083_0058859_172_717 | 171 |
| 773 | 3300059510 | Ga0587090_012317 | Ga0587090_012317_461_1006 | 171 |
| 774 | 3300059511 | Ga0587091_016901 | Ga0587091_016901_73_606 | 171 |
| 775 | 3300059511 | Ga0587091_021107 | Ga0587091_021107_418_951 | 171 |
| 776 | 3300059511 | Ga0587091_088330 | Ga0587091_088330_118_663 | 171 |
| 777 | 3300059513 | Ga0587094_008973 | Ga0587094_008973_645_1178 | 171 |
| 778 | 3300059604 | Ga0587098_003070 | Ga0587098_003070_805_1338 | 171 |
| 779 | 3300059604 | Ga0587098_019425 | Ga0587098_019425_201_746 | 171 |
| 780 | 3300059605 | Ga0587106_047238 | Ga0587106_047238_130_663 | 171 |
| 781 | 3300059605 | Ga0587106_075140 | Ga0587106_075140_97_630 | 171 |
| 782 | 3300059623 | Ga0587101_049214 | Ga0587101_049214_54_587 | 171 |
| 783 | 3300059630 | Ga0587128_013884 | Ga0587128_013884_535_1065 | 171 |
| 784 | 3300059640 | Ga0587067_000513 | Ga0587067_000513_973_1506 | 171 |
| 785 | 3300059641 | Ga0587068_001003 | Ga0587068_001003_1736_2257 | 171 |
| 786 | 3300059641 | Ga0587068_012163 | Ga0587068_012163_669_1202 | 171 |
| 787 | 3300059641 | Ga0587068_014583 | Ga0587068_014583_70_603 | 171 |
| 788 | 3300059642 | Ga0587069_031196 | Ga0587069_031196_240_773 | 171 |
| 789 | 3300059642 | Ga0587069_032831 | Ga0587069_032831_249_794 | 171 |
| 790 | 3300059643 | Ga0587072_000076 | Ga0587072_000076_5847_6380 | 171 |
| 791 | 3300059643 | Ga0587072_065694 | Ga0587072_065694_118_639 | 171 |
| 792 | 3300059645 | Ga0587076_028924 | Ga0587076_028924_351_884 | 171 |
| 793 | 3300059647 | Ga0587079_011606 | Ga0587079_011606_719_1249 | 171 |
| 794 | 3300059647 | Ga0587079_064212 | Ga0587079_064212_113_646 | 171 |
| 795 | 3300059647 | Ga0587079_068725 | Ga0587079_068725_188_733 | 171 |
| 796 | 3300059648 | Ga0587100_021036 | Ga0587100_021036_73_603 | 171 |
| 797 | 3300059649 | Ga0587102_002046 | Ga0587102_002046_94_627 | 171 |
| 798 | 3300059649 | Ga0587102_021193 | Ga0587102_021193_113_646 | 171 |
| 799 | 3300059651 | Ga0587105_000215 | Ga0587105_000215_569_1102 | 171 |
| 800 | 3300059660 | Ga0587124_014557 | Ga0587124_014557_17_550 | 171 |
| 801 | 3300060344 | Ga0587071_009901 | Ga0587071_009901_582_1112 | 171 |
| 802 | 3300060344 | Ga0587071_033121 | Ga0587071_033121_445_978 | 171 |
| 803 | 3300060344 | Ga0587071_039358 | Ga0587071_039358_348_884 | 171 |
| 804 | 3300060344 | Ga0587071_075072 | Ga0587071_075072_82_615 | 171 |
| 805 | 3300060346 | Ga0587111_0008531 | Ga0587111_0008531_91_624 | 171 |
| 806 | 3300060346 | Ga0587111_0068425 | Ga0587111_0068425_209_742 | 171 |
| 807 | 3300061719 | Ga0466962_0002106 | Ga0466962_0002106_5674_6207 | 171 |
| 808 | 3300061719 | Ga0466962_0003684 | Ga0466962_0003684_4138_4671 | 171 |
| 809 | 3300061719 | Ga0466962_0009729 | Ga0466962_0009729_1394_1930 | 171 |
| 810 | 3300061719 | Ga0466962_0153874 | Ga0466962_0153874_471_1004 | 171 |
| 811 | 3300061719 | Ga0466962_0316164 | Ga0466962_0316164_60_590 | 171 |
| 812 | 3300005288 | Ga0065714_10142132 | Ga0065714_101421321 | 172 |
| 813 | 3300031995 | Ga0307409_101390269 | Ga0307409_1013902692 | 172 |
| 814 | 3300037471 | Ga0395905_0032686 | Ga0395905_0032686_3493_4035 | 172 |
| 815 | 3300044656 | Ga0466969_0082322 | Ga0466969_0082322_203_766 | 172 |
| 816 | 3300047447 | Ga0495685_043635 | Ga0495685_043635_696_1223 | 172 |
| 817 | 3300049575 | Ga0501039_0298363 | Ga0501039_0298363_297_830 | 172 |
| 818 | iso_pu_bacteria | 2510065053 | 2510282857 | 172 |
| 819 | iso_pu_bacteria | 2510065055 | 2510293530 | 172 |
| 820 | iso_pu_bacteria | 2510065058 | 2510310863 | 172 |
| 821 | iso_pu_bacteria | 2511231004 | 2511258299 | 172 |
| 822 | iso_pu_bacteria | 2511231006 | 2511265834 | 172 |
| 823 | iso_pu_bacteria | 2511231007 | 2511271749 | 172 |
| 824 | iso_pu_bacteria | 2511231008 | 2511279527 | 172 |
| 825 | iso_pu_bacteria | 2511231010 | 2511292837 | 172 |
| 826 | iso_pu_bacteria | 2511231011 | 2511294568 | 172 |
| 827 | iso_pu_bacteria | 2511231012 | 2511302312 | 172 |
| 828 | iso_pu_bacteria | 2511231014 | 2511313540 | 172 |
| 829 | iso_pu_bacteria | 2511231015 | 2511318036 | 172 |
| 830 | iso_pu_bacteria | 2511231016 | 2511325350 | 172 |
| 831 | iso_pu_bacteria | 2511231017 | 2511333190 | 172 |
| 832 | iso_pu_bacteria | 2511231018 | 2511340537 | 172 |
| 833 | iso_pu_bacteria | 2511231019 | 2511347464 | 172 |
| 834 | iso_pu_bacteria | 2511231020 | 2511349251 | 172 |
| 835 | iso_pu_bacteria | 2511231021 | 2511355336 | 172 |
| 836 | iso_pu_bacteria | 2511231022 | 2511363570 | 172 |
| 837 | iso_pu_bacteria | 2511231023 | 2511369933 | 172 |
| 838 | iso_pu_bacteria | 2511231024 | 2511373834 | 172 |
| 839 | iso_pu_bacteria | 2511231031 | 2511412173 | 172 |
| 840 | iso_pu_bacteria | 2511231156 | 2511827448 | 172 |
| 841 | iso_pu_bacteria | 2512047018 | 2512323831 | 172 |
| 842 | iso_pu_bacteria | 2554235132 | 2554818513 | 172 |
| 843 | iso_pu_bacteria | 2554235231 | 2555247018 | 172 |
| 844 | iso_pu_bacteria | 2554235341 | 2555672638 | 172 |
| 845 | iso_pu_bacteria | 2582580891 | 2583795137 | 172 |
| 846 | iso_pu_bacteria | 2597489887 | 2597860695 | 172 |
| 847 | iso_pu_bacteria | 2597489888 | 2597866434 | 172 |
| 848 | iso_pu_bacteria | 2597489889 | 2597872286 | 172 |
| 849 | iso_pu_bacteria | 2599185155 | 2599330674 | 172 |
| 850 | iso_pu_bacteria | 2599185160 | 2599356158 | 172 |
| 851 | iso_pu_bacteria | 2599185161 | 2599362443 | 172 |
| 852 | iso_pu_bacteria | 2599185162 | 2599369251 | 172 |
| 853 | iso_pu_bacteria | 2599185163 | 2599375552 | 172 |
| 854 | iso_pu_bacteria | 2599185164 | 2599381264 | 172 |
| 855 | iso_pu_bacteria | 2599185165 | 2599387220 | 172 |
| 856 | iso_pu_bacteria | 2599185166 | 2599394410 | 172 |
| 857 | iso_pu_bacteria | 2599185167 | 2599400732 | 172 |
| 858 | iso_pu_bacteria | 2599185168 | 2599406175 | 172 |
| 859 | iso_pu_bacteria | 2599185179 | 2599450059 | 172 |
| 860 | iso_pu_bacteria | 2599185181 | 2599462992 | 172 |
| 861 | iso_pu_bacteria | 2599185182 | 2599467588 | 172 |
| 862 | iso_pu_bacteria | 2599185185 | 2599486072 | 172 |
| 863 | iso_pu_bacteria | 2599185186 | 2599492009 | 172 |
| 864 | iso_pu_bacteria | 2599185188 | 2599502461 | 172 |
| 865 | iso_pu_bacteria | 2599185189 | 2599505567 | 172 |
| 866 | iso_pu_bacteria | 2599185190 | 2599512131 | 172 |
| 867 | iso_pu_bacteria | 2599185191 | 2599517113 | 172 |
| 868 | iso_pu_bacteria | 2599185212 | 2599614206 | 172 |
| 869 | iso_pu_bacteria | 2599185248 | 2599768355 | 172 |
| 870 | iso_pu_bacteria | 2599185257 | 2599804853 | 172 |
| 871 | iso_pu_bacteria | 2599185288 | 2599878852 | 172 |
| 872 | iso_pu_bacteria | 2599185289 | 2599885780 | 172 |
| 873 | iso_pu_bacteria | 2599185290 | 2599892507 | 172 |
| 874 | iso_pu_bacteria | 2599185291 | 2599897494 | 172 |
| 875 | iso_pu_bacteria | 2599185300 | 2599933843 | 172 |
| 876 | iso_pu_bacteria | 2599185302 | 2599942505 | 172 |
| 877 | iso_pu_bacteria | 2599185303 | 2599952320 | 172 |
| 878 | iso_pu_bacteria | 2599185304 | 2599954081 | 172 |
| 879 | iso_pu_bacteria | 2599185305 | 2599961599 | 172 |
| 880 | iso_pu_bacteria | 2599185306 | 2599965623 | 172 |
| 881 | iso_pu_bacteria | 2599185307 | 2599975082 | 172 |
| 882 | iso_pu_bacteria | 2599185308 | 2599979157 | 172 |
| 883 | iso_pu_bacteria | 2599185309 | 2599984743 | 172 |
| 884 | iso_pu_bacteria | 2599185310 | 2599988174 | 172 |
| 885 | iso_pu_bacteria | 2599185311 | 2599993830 | 172 |
| 886 | iso_pu_bacteria | 2599185312 | 2599998961 | 172 |
| 887 | iso_pu_bacteria | 2599185313 | 2600004516 | 172 |
| 888 | iso_pu_bacteria | 2599185314 | 2600013265 | 172 |
| 889 | iso_pu_bacteria | 2599185315 | 2600018600 | 172 |
| 890 | iso_pu_bacteria | 2599185316 | 2600026536 | 172 |
| 891 | iso_pu_bacteria | 2599185317 | 2600030130 | 172 |
| 892 | iso_pu_bacteria | 2599185318 | 2600036478 | 172 |
| 893 | iso_pu_bacteria | 2599185319 | 2600041787 | 172 |
| 894 | iso_pu_bacteria | 2599185320 | 2600046499 | 172 |
| 895 | iso_pu_bacteria | 2599185321 | 2600053228 | 172 |
| 896 | iso_pu_bacteria | 2599185322 | 2600060939 | 172 |
| 897 | iso_pu_bacteria | 2599185323 | 2600068115 | 172 |
| 898 | iso_pu_bacteria | 2599185324 | 2600073015 | 172 |
| 899 | iso_pu_bacteria | 2599185325 | 2600076736 | 172 |
| 900 | iso_pu_bacteria | 2599185356 | 2600215618 | 172 |
| 901 | iso_pu_bacteria | 2600254930 | 2600359585 | 172 |
| 902 | iso_pu_bacteria | 2600254931 | 2600366383 | 172 |
| 903 | iso_pu_bacteria | 2600254954 | 2600443960 | 172 |
| 904 | iso_pu_bacteria | 2600255283 | 2601628432 | 172 |
| 905 | iso_pu_bacteria | 2600255296 | 2601693633 | 172 |
| 906 | iso_pu_bacteria | 2600255313 | 2601775784 | 172 |
| 907 | iso_pu_bacteria | 2600255318 | 2601800979 | 172 |
| 908 | iso_pu_bacteria | 2600255389 | 2602008556 | 172 |
| 909 | iso_pu_bacteria | 2603880185 | 2606073072 | 172 |
| 910 | iso_pu_bacteria | 2603880199 | 2606125866 | 172 |
| 911 | iso_pu_bacteria | 2606217733 | 2608385355 | 172 |
| 912 | iso_pu_bacteria | 2619619299 | 2621297029 | 172 |
| 913 | iso_pu_bacteria | 2623620443 | 2624483217 | 172 |
| 914 | iso_pu_bacteria | 2623620446 | 2624494745 | 172 |
| 915 | iso_pu_bacteria | 2643221565 | 2643842779 | 172 |
| 916 | iso_pu_bacteria | 2643221571 | 2643872069 | 172 |
| 917 | iso_pu_bacteria | 2643221589 | 2643955824 | 172 |
| 918 | iso_pu_bacteria | 2643221602 | 2644020618 | 172 |
| 919 | iso_pu_bacteria | 2643221633 | 2644184678 | 172 |
| 920 | iso_pu_bacteria | 2643221650 | 2644284107 | 172 |
| 921 | iso_pu_bacteria | 2643221713 | 2644619966 | 172 |
| 922 | iso_pu_bacteria | 2651869719 | 2652548433 | 172 |
| 923 | iso_pu_bacteria | 2667528170 | 2671089353 | 172 |
| 924 | iso_pu_bacteria | 2667528171 | 2671099082 | 172 |
| 925 | iso_pu_bacteria | 2667528176 | 2671128851 | 172 |
| 926 | iso_pu_bacteria | 2671180172 | 2671771860 | 172 |
| 927 | iso_pu_bacteria | 2675903420 | 2677896936 | 172 |
| 928 | iso_pu_bacteria | 2675903515 | 2678265949 | 172 |
| 929 | iso_pu_bacteria | 2713897148 | 2715750016 | 172 |
| 930 | iso_pu_bacteria | 2713897149 | 2715756415 | 172 |
| 931 | iso_pu_bacteria | 2718217725 | 2718636421 | 172 |
| 932 | iso_pu_bacteria | 2721755607 | 2723251173 | 172 |
| 933 | iso_pu_bacteria | 2738541265 | 2738671850 | 172 |
| 934 | iso_pu_bacteria | 2738541271 | 2738690222 | 172 |
| 935 | iso_pu_bacteria | 2738541282 | 2738750244 | 172 |
| 936 | iso_pu_bacteria | 2738541294 | 2738807069 | 172 |
| 937 | iso_pu_bacteria | 2738541303 | 2738859284 | 172 |
| 938 | iso_pu_bacteria | 2738541309 | 2738894429 | 172 |
| 939 | iso_pu_bacteria | 2738543004 | 2739198868 | 172 |
| 940 | iso_pu_bacteria | 2738543015 | 2739258812 | 172 |
| 941 | iso_pu_bacteria | 2738543016 | 2739265996 | 172 |
| 942 | iso_pu_bacteria | 2738543020 | 2739285636 | 172 |
| 943 | iso_pu_bacteria | 2738543021 | 2739290949 | 172 |
| 944 | iso_pu_bacteria | 2738543025 | 2739312700 | 172 |
| 945 | iso_pu_bacteria | 2740892503 | 2743740239 | 172 |
| 946 | iso_pu_bacteria | 2744054620 | 2745007181 | 172 |
| 947 | iso_pu_bacteria | 2765235841 | 2765586454 | 172 |
| 948 | iso_pu_bacteria | 2773857670 | 2774118577 | 172 |
| 949 | iso_pu_bacteria | 2773857672 | 2774129344 | 172 |
| 950 | iso_pu_bacteria | 2773857673 | 2774135760 | 172 |
| 951 | iso_pu_bacteria | 2784132063 | 2784262012 | 172 |
| 952 | iso_pu_bacteria | 2784132072 | 2784313250 | 172 |
| 953 | iso_pu_bacteria | 2791355520 | 2794598642 | 172 |
| 954 | iso_pu_bacteria | 2806310737 | 2807406126 | 172 |
| 955 | iso_pu_bacteria | 2806310745 | 2807454478 | 172 |
| 956 | iso_pu_bacteria | 2808606361 | 2808855483 | 172 |
| 957 | iso_pu_bacteria | 2808606376 | 2808925481 | 172 |
| 958 | iso_pu_bacteria | 2808606377 | 2808928639 | 172 |
| 959 | iso_pu_bacteria | 2808606378 | 2808935380 | 172 |
| 960 | iso_pu_bacteria | 2808606379 | 2808942605 | 172 |
| 961 | iso_pu_bacteria | 2808606380 | 2808947636 | 172 |
| 962 | iso_pu_bacteria | 2808606381 | 2808950178 | 172 |
| 963 | iso_pu_bacteria | 2808606382 | 2808958800 | 172 |
| 964 | iso_pu_bacteria | 2808606383 | 2808963988 | 172 |
| 965 | iso_pu_bacteria | 2808606385 | 2808975947 | 172 |
| 966 | iso_pu_bacteria | 2808606388 | 2808993056 | 172 |
| 967 | iso_pu_bacteria | 2808606389 | 2808998876 | 172 |
| 968 | iso_pu_bacteria | 2808606445 | 2809216993 | 172 |
| 969 | iso_pu_bacteria | 2811994881 | 2812369313 | 172 |
| 970 | iso_pu_bacteria | 2816332298 | 2817493857 | 172 |
| 971 | iso_pu_bacteria | 2818991456 | 2819654941 | 172 |
| 972 | iso_pu_bacteria | 2818991464 | 2819704204 | 172 |
| 973 | iso_pu_bacteria | 2823421272 | 2823425585 | 172 |
| 974 | iso_pu_bacteria | 2825651385 | 2825655293 | 172 |
| 975 | iso_pu_bacteria | 2826581358 | 2826586809 | 172 |
| 976 | iso_pu_bacteria | 2834028612 | 2834030760 | 172 |
| 977 | iso_pu_bacteria | 2842805378 | 2842807298 | 172 |
| 978 | iso_pu_bacteria | 2842815866 | 2842819345 | 172 |
| 979 | iso_pu_bacteria | 2842826826 | 2842829196 | 172 |
| 980 | iso_pu_bacteria | 2842832357 | 2842833275 | 172 |
| 981 | iso_pu_bacteria | 2842837860 | 2842842051 | 172 |
| 982 | iso_pu_bacteria | 2842843487 | 2842845506 | 172 |
| 983 | iso_pu_bacteria | 2842849001 | 2842852323 | 172 |
| 984 | iso_pu_bacteria | 2842854478 | 2842855427 | 172 |
| 985 | iso_pu_bacteria | 2844665904 | 2844666811 | 172 |
| 986 | iso_pu_bacteria | 2852612431 | 2852616158 | 172 |
| 987 | iso_pu_bacteria | 2852657418 | 2852661942 | 172 |
| 988 | iso_pu_bacteria | 2852667396 | 2852671126 | 172 |
| 989 | iso_pu_bacteria | 2860339153 | 2860341526 | 172 |
| 990 | iso_pu_bacteria | 2860867994 | 2860872840 | 172 |
| 991 | iso_pu_bacteria | 2878029506 | 2878035156 | 172 |
| 992 | iso_pu_bacteria | 2880230671 | 2880235803 | 172 |
| 993 | iso_pu_bacteria | 2888373701 | 2888377440 | 172 |
| 994 | iso_pu_bacteria | 2904518522 | 2904519145 | 172 |
| 995 | iso_pu_bacteria | 2904550169 | 2904552224 | 172 |
| 996 | iso_pu_bacteria | 2908446538 | 2908452380 | 172 |
| 997 | iso_pu_bacteria | 2912963787 | 2912968725 | 172 |
| 998 | iso_pu_bacteria | 2913036834 | 2913042367 | 172 |
| 999 | iso_pu_bacteria | 2917070673 | 2917076532 | 172 |
| 1000 | iso_pu_bacteria | 2917832318 | 2917836774 | 172 |
| 1001 | iso_pu_bacteria | 2919063839 | 2919065711 | 172 |
| 1002 | iso_pu_bacteria | 2919125081 | 2919125993 | 172 |
| 1003 | iso_pu_bacteria | 2919155634 | 2919155760 | 172 |
| 1004 | iso_pu_bacteria | 2919385768 | 2919389384 | 172 |
| 1005 | iso_pu_bacteria | 2919456309 | 2919457358 | 172 |
| 1006 | iso_pu_bacteria | 2919481497 | 2919486797 | 172 |
| 1007 | iso_pu_bacteria | 2919487758 | 2919488350 | 172 |
| 1008 | iso_pu_bacteria | 2919501602 | 2919502322 | 172 |
| 1009 | iso_pu_bacteria | 2919697872 | 2919700762 | 172 |
| 1010 | iso_pu_bacteria | 2923153595 | 2923159331 | 172 |
| 1011 | iso_pu_bacteria | 2923519811 | 2923523398 | 172 |
| 1012 | iso_pu_bacteria | 2923586266 | 2923592231 | 172 |
| 1013 | iso_pu_bacteria | 2926063275 | 2926063995 | 172 |
| 1014 | iso_pu_bacteria | 2929144301 | 2929149752 | 172 |
| 1015 | iso_pu_bacteria | 2929189879 | 2929194952 | 172 |
| 1016 | iso_pu_bacteria | 2931369376 | 2931372844 | 172 |
| 1017 | iso_pu_bacteria | 2931390751 | 2931396226 | 172 |
| 1018 | iso_pu_bacteria | 2931396565 | 2931397879 | 172 |
| 1019 | iso_pu_bacteria | 2935353572 | 2935358499 | 172 |
| 1020 | iso_pu_bacteria | 2939636861 | 2939642060 | 172 |
| 1021 | iso_pu_bacteria | 2939651529 | 2939654065 | 172 |
| 1022 | iso_pu_bacteria | 2945928738 | 2945931103 | 172 |
| 1023 | iso_pu_bacteria | 2945961074 | 2945966650 | 172 |
| 1024 | iso_pu_bacteria | 2946006987 | 2946007127 | 172 |
| 1025 | iso_pu_bacteria | 2946027586 | 2946027715 | 172 |
| 1026 | iso_pu_bacteria | 2947233263 | 2947234229 | 172 |
| 1027 | iso_pu_bacteria | 2952252522 | 2952254554 | 172 |
| 1028 | iso_pu_bacteria | 2969304461 | 2969309981 | 172 |
| 1029 | iso_pu_bacteria | 2974289157 | 2974294267 | 172 |
| 1030 | iso_pu_bacteria | 2974298342 | 2974302485 | 172 |
| 1031 | iso_pu_bacteria | 2984286254 | 2984286810 | 172 |
| 1032 | iso_pu_bacteria | 2984499530 | 2984499966 | 172 |
| 1033 | iso_pu_bacteria | 2984504281 | 2984506384 | 172 |
| 1034 | iso_pu_bacteria | 2988728565 | 2988731298 | 172 |
| 1035 | iso_pu_bacteria | 2998139840 | 2998145206 | 172 |
| 1036 | iso_pu_bacteria | 3007252601 | 3007254796 | 172 |
| 1037 | iso_pu_bacteria | 3007315729 | 3007316494 | 172 |
| 1038 | iso_pu_bacteria | 3007395558 | 3007399588 | 172 |
| 1039 | iso_pu_bacteria | 3007419365 | 3007425549 | 172 |
| 1040 | iso_pu_bacteria | 3007511990 | 3007516999 | 172 |
| 1041 | iso_pu_bacteria | 3007614139 | 3007617753 | 172 |
| 1042 | iso_pu_bacteria | 3007619802 | 3007622135 | 172 |
| 1043 | iso_pu_bacteria | 3007718800 | 3007722109 | 172 |
| 1044 | iso_pu_bacteria | 3007803356 | 3007805344 | 172 |
| 1045 | iso_pu_bacteria | 3007855910 | 3007858086 | 172 |
| 1046 | iso_pu_bacteria | 3007861166 | 3007865292 | 172 |
| 1047 | iso_pu_bacteria | 3007866637 | 3007866945 | 172 |
| 1048 | iso_pu_bacteria | 3007872151 | 3007873187 | 172 |
| 1049 | iso_pu_bacteria | 637000220 | 637323076 | 172 |
| 1050 | iso_pu_bacteria | 8002745576 | 8002748791 | 172 |
| 1051 | iso_pu_bacteria | 8011350971 | 8011354551 | 172 |
| 1052 | iso_pu_bacteria | 8015687852 | 8015693427 | 172 |
| 1053 | iso_pu_bacteria | 8016728285 | 8016731613 | 172 |
| 1054 | iso_pu_bacteria | 8019769354 | 8019769961 | 172 |
| 1055 | iso_pu_bacteria | 8019775933 | 8019777870 | 172 |
| 1056 | iso_pu_bacteria | 8029995093 | 8029995690 | 172 |
| 1057 | iso_pu_bacteria | 8034962539 | 8034963532 | 172 |
| 1058 | iso_pu_bacteria | 8052494512 | 8052499657 | 172 |
| 1059 | iso_pu_bacteria | 8054285046 | 8054286823 | 172 |
| 1060 | iso_pu_bacteria | 8054347763 | 8054349766 | 172 |
| 1061 | iso_pu_bacteria | 8054503363 | 8054508742 | 172 |
| 1062 | iso_pu_bacteria | 8054929484 | 8054934165 | 172 |
| 1063 | iso_pu_bacteria | 8055770955 | 8055776674 | 172 |
| 1064 | iso_pu_bacteria | 8055817908 | 8055823703 | 172 |
| 1065 | iso_pu_bacteria | 8055878733 | 8055883157 | 172 |
| 1066 | iso_pu_bacteria | 8056115690 | 8056115978 | 172 |
| 1067 | iso_pu_bacteria | 8056120720 | 8056121058 | 172 |
| 1068 | iso_pu_bacteria | 8056125926 | 8056131417 | 172 |
| 1069 | iso_pu_bacteria | 8056131705 | 8056137123 | 172 |
| 1070 | iso_pu_bacteria | 8056137416 | 8056137775 | 172 |
| 1071 | iso_pu_bacteria | 8056143049 | 8056148573 | 172 |
| 1072 | iso_pu_bacteria | 8056148874 | 8056151691 | 172 |
| 1073 | iso_pu_bacteria | 8056155041 | 8056160654 | 172 |
| 1074 | iso_pu_bacteria | 8056161164 | 8056163428 | 172 |
| 1075 | iso_pu_bacteria | 8056166840 | 8056171361 | 172 |
| 1076 | iso_pu_bacteria | 8056172158 | 8056177603 | 172 |
| 1077 | iso_pu_bacteria | 8056177738 | 8056181815 | 172 |
| 1078 | iso_pu_bacteria | 8056569372 | 8056570276 | 172 |
| 1079 | iso_pu_bacteria | 8057798959 | 8057801743 | 172 |
| 1080 | 3300009177 | Ga0105248_10640824 | Ga0105248_106408242 | 173 |
| 1081 | 3300010375 | Ga0105239_10002079 | Ga0105239_1000207913 | 173 |
| 1082 | 3300014325 | Ga0163163_10671412 | Ga0163163_106714122 | 173 |
| 1083 | 3300027666 | Ga0209282_1109673 | Ga0209282_11096732 | 173 |
| 1084 | 3300039447 | Ga0436361_1024429 | Ga0436361_1024429_159_731 | 173 |
| 1085 | 3300044656 | Ga0466969_0068969 | Ga0466969_0068969_553_1140 | 174 |
| 1086 | 3300044693 | Ga0466961_0144769 | Ga0466961_0144769_651_1238 | 174 |
| 1087 | 3300045049 | Ga0466959_0001367 | Ga0466959_0001367_13750_14337 | 174 |
| 1088 | 3300009036 | Ga0105244_10002181 | Ga0105244_1000218113 | 175 |
| 1089 | 3300013307 | Ga0157372_10063189 | Ga0157372_100631893 | 175 |
| 1090 | 3300013307 | Ga0157372_10090525 | Ga0157372_100905252 | 175 |
| 1091 | 3300025728 | Ga0207655_1000007 | Ga0207655_1000007384 | 175 |
| 1092 | 3300025728 | Ga0207655_1164587 | Ga0207655_11645871 | 175 |
| 1093 | 3300048919 | Ga0496116_0001275 | Ga0496116_0001275_25213_25740 | 175 |
| 1094 | 3300048923 | Ga0496120_0000126 | Ga0496120_0000126_58509_59036 | 175 |
| 1095 | 3300048927 | Ga0496124_0000967 | Ga0496124_0000967_6559_7086 | 175 |
| 1096 | 2124908027 | MRS2a_Contig_111 | MRS2a_00013820 | 176 |
| 1097 | 3300002737 | JGI25162J39368_1000076 | JGI25162J39368_100007639 | 176 |
| 1098 | 3300002738 | JGI25154J39366_1015861 | JGI25154J39366_10158612 | 176 |
| 1099 | 3300002771 | JGI25163J39215_1001848 | JGI25163J39215_10018482 | 176 |
| 1100 | 3300002772 | JGI25164J39214_1000083 | JGI25164J39214_100008345 | 176 |
| 1101 | 3300002772 | JGI25164J39214_1000084 | JGI25164J39214_100008439 | 176 |
| 1102 | 3300003214 | JGI25165J46597_1000140 | JGI25165J46597_100014066 | 176 |
| 1103 | 3300003214 | JGI25165J46597_1000186 | JGI25165J46597_100018642 | 176 |
| 1104 | 3300003578 | Ga0006562J51391_1006636 | Ga0006562J51391_10066362 | 176 |
| 1105 | 3300003751 | Ga0055538_1000095 | Ga0055538_10000959 | 176 |
| 1106 | 3300003752 | Ga0055539_1000139 | Ga0055539_10001399 | 176 |
| 1107 | 3300003756 | Ga0055533_1000145 | Ga0055533_10001459 | 176 |
| 1108 | 3300003758 | Ga0055532_1000128 | Ga0055532_100012857 | 176 |
| 1109 | 3300003759 | Ga0055525_1000190 | Ga0055525_10001909 | 176 |
| 1110 | 3300003761 | Ga0055535_1004327 | Ga0055535_10043273 | 176 |
| 1111 | 3300003781 | Ga0055536_1000764 | Ga0055536_10007642 | 176 |
| 1112 | 3300003781 | Ga0055536_1011893 | Ga0055536_10118932 | 176 |
| 1113 | 3300003791 | Ga0055530_10009302 | Ga0055530_100093023 | 176 |
| 1114 | 3300003792 | Ga0055540_1000452 | Ga0055540_10004522 | 176 |
| 1115 | 3300003794 | Ga0055531_10000109 | Ga0055531_1000010935 | 176 |
| 1116 | 3300003841 | Ga0055541_1000093 | Ga0055541_100009357 | 176 |
| 1117 | 3300005288 | Ga0065714_10000596 | Ga0065714_100005964 | 176 |
| 1118 | 3300005288 | Ga0065714_10002541 | Ga0065714_100025417 | 176 |
| 1119 | 3300005288 | Ga0065714_10006685 | Ga0065714_100066852 | 176 |
| 1120 | 3300005288 | Ga0065714_10051673 | Ga0065714_100516731 | 176 |
| 1121 | 3300005288 | Ga0065714_10066645 | Ga0065714_100666452 | 176 |
| 1122 | 3300005288 | Ga0065714_10117165 | Ga0065714_101171651 | 176 |
| 1123 | 3300005288 | Ga0065714_10223962 | Ga0065714_102239622 | 176 |
| 1124 | 3300005288 | Ga0065714_10288258 | Ga0065714_102882581 | 176 |
| 1125 | 3300005289 | Ga0065704_10000995 | Ga0065704_100009952 | 176 |
| 1126 | 3300005289 | Ga0065704_10034078 | Ga0065704_100340781 | 176 |
| 1127 | 3300005289 | Ga0065704_10201950 | Ga0065704_102019502 | 176 |
| 1128 | 3300005289 | Ga0065704_10424606 | Ga0065704_104246061 | 176 |
| 1129 | 3300005290 | Ga0065712_10067838 | Ga0065712_1006783812 | 176 |
| 1130 | 3300005293 | Ga0065715_10007584 | Ga0065715_100075842 | 176 |
| 1131 | 3300005328 | Ga0070676_10180759 | Ga0070676_101807592 | 176 |
| 1132 | 3300005331 | Ga0070670_100007436 | Ga0070670_1000074362 | 176 |
| 1133 | 3300005344 | Ga0070661_100000038 | Ga0070661_10000003821 | 176 |
| 1134 | 3300005353 | Ga0070669_100000248 | Ga0070669_10000024843 | 176 |
| 1135 | 3300005353 | Ga0070669_100066159 | Ga0070669_1000661592 | 176 |
| 1136 | 3300005366 | Ga0070659_100239763 | Ga0070659_1002397632 | 176 |
| 1137 | 3300005435 | Ga0070714_100629501 | Ga0070714_1006295012 | 176 |
| 1138 | 3300005457 | Ga0070662_100000423 | Ga0070662_1000004237 | 176 |
| 1139 | 3300005457 | Ga0070662_100088025 | Ga0070662_1000880252 | 176 |
| 1140 | 3300005539 | Ga0068853_100000155 | Ga0068853_1000001559 | 176 |
| 1141 | 3300005548 | Ga0070665_100492023 | Ga0070665_1004920232 | 176 |
| 1142 | 3300005548 | Ga0070665_101072000 | Ga0070665_1010720002 | 176 |
| 1143 | 3300005548 | Ga0070665_101945906 | Ga0070665_1019459061 | 176 |
| 1144 | 3300005564 | Ga0070664_100002818 | Ga0070664_1000028182 | 176 |
| 1145 | 3300005578 | Ga0068854_100004356 | Ga0068854_1000043562 | 176 |
| 1146 | 3300005834 | Ga0068851_10000012 | Ga0068851_1000001264 | 176 |
| 1147 | 3300006048 | Ga0075363_100202386 | Ga0075363_1002023862 | 176 |
| 1148 | 3300006058 | Ga0075432_10040746 | Ga0075432_100407462 | 176 |
| 1149 | 3300006058 | Ga0075432_10059931 | Ga0075432_100599312 | 176 |
| 1150 | 3300006058 | Ga0075432_10122923 | Ga0075432_101229232 | 176 |
| 1151 | 3300006058 | Ga0075432_10149183 | Ga0075432_101491832 | 176 |
| 1152 | 3300006058 | Ga0075432_10152952 | Ga0075432_101529521 | 176 |
| 1153 | 3300006177 | Ga0075362_10077500 | Ga0075362_100775001 | 176 |
| 1154 | 3300006186 | Ga0075369_10276721 | Ga0075369_102767211 | 176 |
| 1155 | 3300006194 | Ga0075427_10052499 | Ga0075427_100524991 | 176 |
| 1156 | 3300006914 | Ga0075436_100479195 | Ga0075436_1004791952 | 176 |
| 1157 | 3300006944 | Ga0099823_1000137 | Ga0099823_100013722 | 176 |
| 1158 | 3300006944 | Ga0099823_1051170 | Ga0099823_10511702 | 176 |
| 1159 | 3300006946 | Ga0079104_1000322 | Ga0079104_100032231 | 176 |
| 1160 | 3300006946 | Ga0079104_1000338 | Ga0079104_100033836 | 176 |
| 1161 | 3300009011 | Ga0105251_10000019 | Ga0105251_1000001990 | 176 |
| 1162 | 3300009011 | Ga0105251_10000542 | Ga0105251_100005422 | 176 |
| 1163 | 3300009011 | Ga0105251_10006346 | Ga0105251_100063462 | 176 |
| 1164 | 3300009011 | Ga0105251_10006467 | Ga0105251_100064677 | 176 |
| 1165 | 3300009011 | Ga0105251_10012349 | Ga0105251_100123492 | 176 |
| 1166 | 3300009011 | Ga0105251_10023834 | Ga0105251_100238342 | 176 |
| 1167 | 3300009011 | Ga0105251_10027925 | Ga0105251_100279252 | 176 |
| 1168 | 3300009011 | Ga0105251_10065832 | Ga0105251_100658322 | 176 |
| 1169 | 3300009011 | Ga0105251_10077797 | Ga0105251_100777972 | 176 |
| 1170 | 3300009011 | Ga0105251_10154236 | Ga0105251_101542361 | 176 |
| 1171 | 3300009011 | Ga0105251_10214615 | Ga0105251_102146152 | 176 |
| 1172 | 3300009011 | Ga0105251_10234814 | Ga0105251_102348142 | 176 |
| 1173 | 3300009036 | Ga0105244_10000417 | Ga0105244_100004176 | 176 |
| 1174 | 3300009036 | Ga0105244_10006408 | Ga0105244_100064082 | 176 |
| 1175 | 3300009036 | Ga0105244_10006864 | Ga0105244_100068642 | 176 |
| 1176 | 3300009036 | Ga0105244_10021397 | Ga0105244_100213972 | 176 |
| 1177 | 3300009036 | Ga0105244_10044510 | Ga0105244_100445102 | 176 |
| 1178 | 3300009036 | Ga0105244_10062006 | Ga0105244_100620062 | 176 |
| 1179 | 3300009036 | Ga0105244_10074841 | Ga0105244_100748412 | 176 |
| 1180 | 3300009036 | Ga0105244_10113371 | Ga0105244_101133712 | 176 |
| 1181 | 3300009036 | Ga0105244_10125489 | Ga0105244_101254892 | 176 |
| 1182 | 3300009036 | Ga0105244_10151667 | Ga0105244_101516672 | 176 |
| 1183 | 3300009036 | Ga0105244_10179832 | Ga0105244_101798322 | 176 |
| 1184 | 3300009036 | Ga0105244_10196762 | Ga0105244_101967622 | 176 |
| 1185 | 3300009036 | Ga0105244_10209653 | Ga0105244_102096532 | 176 |
| 1186 | 3300009036 | Ga0105244_10212566 | Ga0105244_102125662 | 176 |
| 1187 | 3300009036 | Ga0105244_10326496 | Ga0105244_103264961 | 176 |
| 1188 | 3300009092 | Ga0105250_10000563 | Ga0105250_1000056313 | 176 |
| 1189 | 3300009092 | Ga0105250_10000709 | Ga0105250_1000070919 | 176 |
| 1190 | 3300009092 | Ga0105250_10025779 | Ga0105250_100257792 | 176 |
| 1191 | 3300009092 | Ga0105250_10083222 | Ga0105250_100832222 | 176 |
| 1192 | 3300009092 | Ga0105250_10090213 | Ga0105250_100902131 | 176 |
| 1193 | 3300009092 | Ga0105250_10167291 | Ga0105250_101672911 | 176 |
| 1194 | 3300009092 | Ga0105250_10197655 | Ga0105250_101976552 | 176 |
| 1195 | 3300009092 | Ga0105250_10198210 | Ga0105250_101982101 | 176 |
| 1196 | 3300009148 | Ga0105243_10000325 | Ga0105243_1000032531 | 176 |
| 1197 | 3300009148 | Ga0105243_10003183 | Ga0105243_1000318311 | 176 |
| 1198 | 3300009148 | Ga0105243_10007615 | Ga0105243_100076152 | 176 |
| 1199 | 3300009148 | Ga0105243_10020292 | Ga0105243_100202926 | 176 |
| 1200 | 3300009148 | Ga0105243_10377983 | Ga0105243_103779831 | 176 |
| 1201 | 3300009148 | Ga0105243_10558101 | Ga0105243_105581012 | 176 |
| 1202 | 3300009148 | Ga0105243_11119613 | Ga0105243_111196132 | 176 |
| 1203 | 3300009148 | Ga0105243_11859999 | Ga0105243_118599991 | 176 |
| 1204 | 3300009176 | Ga0105242_10000846 | Ga0105242_100008466 | 176 |
| 1205 | 3300009176 | Ga0105242_11060105 | Ga0105242_110601051 | 176 |
| 1206 | 3300009545 | Ga0105237_10000756 | Ga0105237_1000075614 | 176 |
| 1207 | 3300009553 | Ga0105249_10253643 | Ga0105249_102536432 | 176 |
| 1208 | 3300011119 | Ga0105246_10005716 | Ga0105246_100057162 | 176 |
| 1209 | 3300011119 | Ga0105246_10072921 | Ga0105246_100729211 | 176 |
| 1210 | 3300011119 | Ga0105246_10272649 | Ga0105246_102726492 | 176 |
| 1211 | 3300011119 | Ga0105246_10716170 | Ga0105246_107161701 | 176 |
| 1212 | 3300012498 | Ga0157345_1000797 | Ga0157345_10007972 | 176 |
| 1213 | 3300013100 | Ga0157373_10048867 | Ga0157373_100488674 | 176 |
| 1214 | 3300013100 | Ga0157373_10184475 | Ga0157373_101844752 | 176 |
| 1215 | 3300013100 | Ga0157373_10591262 | Ga0157373_105912622 | 176 |
| 1216 | 3300013100 | Ga0157373_11060393 | Ga0157373_110603931 | 176 |
| 1217 | 3300013102 | Ga0157371_10192771 | Ga0157371_101927712 | 176 |
| 1218 | 3300013102 | Ga0157371_10212686 | Ga0157371_102126862 | 176 |
| 1219 | 3300013102 | Ga0157371_10413781 | Ga0157371_104137811 | 176 |
| 1220 | 3300013102 | Ga0157371_10456965 | Ga0157371_104569652 | 176 |
| 1221 | 3300013104 | Ga0157370_10000086 | Ga0157370_1000008638 | 176 |
| 1222 | 3300013104 | Ga0157370_10155885 | Ga0157370_101558852 | 176 |
| 1223 | 3300013104 | Ga0157370_10708071 | Ga0157370_107080712 | 176 |
| 1224 | 3300013104 | Ga0157370_10835041 | Ga0157370_108350412 | 176 |
| 1225 | 3300013105 | Ga0157369_10004872 | Ga0157369_100048723 | 176 |
| 1226 | 3300013105 | Ga0157369_10743561 | Ga0157369_107435612 | 176 |
| 1227 | 3300013105 | Ga0157369_10808121 | Ga0157369_108081212 | 176 |
| 1228 | 3300013105 | Ga0157369_11829878 | Ga0157369_118298781 | 176 |
| 1229 | 3300013297 | Ga0157378_10471771 | Ga0157378_104717712 | 176 |
| 1230 | 3300013306 | Ga0163162_10436994 | Ga0163162_104369942 | 176 |
| 1231 | 3300013307 | Ga0157372_10001060 | Ga0157372_1000106020 | 176 |
| 1232 | 3300013307 | Ga0157372_10143368 | Ga0157372_101433683 | 176 |
| 1233 | 3300013307 | Ga0157372_10325218 | Ga0157372_103252182 | 176 |
| 1234 | 3300013308 | Ga0157375_10365139 | Ga0157375_103651392 | 176 |
| 1235 | 3300014497 | Ga0182008_10001464 | Ga0182008_100014641 | 176 |
| 1236 | 3300014497 | Ga0182008_10291886 | Ga0182008_102918862 | 176 |
| 1237 | 3300015261 | Ga0182006_1003771 | Ga0182006_10037712 | 176 |
| 1238 | 3300015261 | Ga0182006_1078932 | Ga0182006_10789322 | 176 |
| 1239 | 3300015261 | Ga0182006_1106463 | Ga0182006_11064632 | 176 |
| 1240 | 3300015262 | Ga0182007_10121479 | Ga0182007_101214791 | 176 |
| 1241 | 3300015265 | Ga0182005_1190854 | Ga0182005_11908541 | 176 |
| 1242 | 3300017792 | Ga0163161_10151963 | Ga0163161_101519632 | 176 |
| 1243 | 3300017792 | Ga0163161_10907523 | Ga0163161_109075232 | 176 |
| 1244 | 3300017792 | Ga0163161_11032598 | Ga0163161_110325982 | 176 |
| 1245 | 3300025206 | Ga0209435_100436 | Ga0209435_1004362 | 176 |
| 1246 | 3300025207 | Ga0209760_100098 | Ga0209760_10009834 | 176 |
| 1247 | 3300025207 | Ga0209760_100101 | Ga0209760_10010117 | 176 |
| 1248 | 3300025224 | Ga0209784_100007 | Ga0209784_100007572 | 176 |
| 1249 | 3300025225 | Ga0209566_100062 | Ga0209566_10006257 | 176 |
| 1250 | 3300025226 | Ga0209674_100021 | Ga0209674_100021572 | 176 |
| 1251 | 3300025229 | Ga0209147_100009 | Ga0209147_100009572 | 176 |
| 1252 | 3300025230 | Ga0209563_100018 | Ga0209563_100018572 | 176 |
| 1253 | 3300025230 | Ga0209563_100395 | Ga0209563_1003956 | 176 |
| 1254 | 3300025231 | Ga0207427_100005 | Ga0207427_100005135 | 176 |
| 1255 | 3300025231 | Ga0207427_100006 | Ga0207427_100006626 | 176 |
| 1256 | 3300025231 | Ga0207427_110510 | Ga0207427_1105101 | 176 |
| 1257 | 3300025233 | Ga0209437_100013 | Ga0209437_100013626 | 176 |
| 1258 | 3300025233 | Ga0209437_100018 | Ga0209437_10001845 | 176 |
| 1259 | 3300025233 | Ga0209437_104789 | Ga0209437_1047892 | 176 |
| 1260 | 3300025242 | Ga0209258_100330 | Ga0209258_10033016 | 176 |
| 1261 | 3300025246 | Ga0209646_1000400 | Ga0209646_10004009 | 176 |
| 1262 | 3300025253 | Ga0209677_100056 | Ga0209677_10005657 | 176 |
| 1263 | 3300025256 | Ga0209759_1018458 | Ga0209759_10184582 | 176 |
| 1264 | 3300025256 | Ga0209759_1021767 | Ga0209759_10217672 | 176 |
| 1265 | 3300025261 | Ga0209233_1000021 | Ga0209233_1000021135 | 176 |
| 1266 | 3300025261 | Ga0209233_1000022 | Ga0209233_1000022626 | 176 |
| 1267 | 3300025291 | Ga0209675_1006697 | Ga0209675_10066973 | 176 |
| 1268 | 3300025292 | Ga0209676_1000015 | Ga0209676_1000015603 | 176 |
| 1269 | 3300025292 | Ga0209676_1000030 | Ga0209676_100003080 | 176 |
| 1270 | 3300025292 | Ga0209676_1000041 | Ga0209676_1000041355 | 176 |
| 1271 | 3300025292 | Ga0209676_1000548 | Ga0209676_10005482 | 176 |
| 1272 | 3300025292 | Ga0209676_1004486 | Ga0209676_10044861 | 176 |
| 1273 | 3300025298 | Ga0209050_1000024 | Ga0209050_1000024371 | 176 |
| 1274 | 3300025298 | Ga0209050_1000075 | Ga0209050_100007590 | 176 |
| 1275 | 3300025298 | Ga0209050_1000128 | Ga0209050_1000128125 | 176 |
| 1276 | 3300025298 | Ga0209050_1002450 | Ga0209050_100245014 | 176 |
| 1277 | 3300025303 | Ga0209051_1000012 | Ga0209051_100001280 | 176 |
| 1278 | 3300025303 | Ga0209051_1000023 | Ga0209051_1000023287 | 176 |
| 1279 | 3300025303 | Ga0209051_1000041 | Ga0209051_1000041123 | 176 |
| 1280 | 3300025303 | Ga0209051_1007648 | Ga0209051_10076482 | 176 |
| 1281 | 3300025304 | Ga0209257_1000069 | Ga0209257_1000069186 | 176 |
| 1282 | 3300025304 | Ga0209257_1007474 | Ga0209257_10074747 | 176 |
| 1283 | 3300025321 | Ga0207656_10000006 | Ga0207656_10000006253 | 176 |
| 1284 | 3300025711 | Ga0207696_1000031 | Ga0207696_100003144 | 176 |
| 1285 | 3300025711 | Ga0207696_1000064 | Ga0207696_100006464 | 176 |
| 1286 | 3300025711 | Ga0207696_1000094 | Ga0207696_1000094132 | 176 |
| 1287 | 3300025711 | Ga0207696_1000095 | Ga0207696_100009564 | 176 |
| 1288 | 3300025711 | Ga0207696_1000149 | Ga0207696_100014929 | 176 |
| 1289 | 3300025711 | Ga0207696_1004438 | Ga0207696_10044386 | 176 |
| 1290 | 3300025711 | Ga0207696_1004760 | Ga0207696_10047607 | 176 |
| 1291 | 3300025711 | Ga0207696_1006915 | Ga0207696_10069151 | 176 |
| 1292 | 3300025711 | Ga0207696_1013636 | Ga0207696_10136361 | 176 |
| 1293 | 3300025711 | Ga0207696_1059603 | Ga0207696_10596032 | 176 |
| 1294 | 3300025728 | Ga0207655_1000068 | Ga0207655_1000068126 | 176 |
| 1295 | 3300025728 | Ga0207655_1000107 | Ga0207655_100010719 | 176 |
| 1296 | 3300025728 | Ga0207655_1000455 | Ga0207655_100045536 | 176 |
| 1297 | 3300025728 | Ga0207655_1001758 | Ga0207655_10017587 | 176 |
| 1298 | 3300025728 | Ga0207655_1002516 | Ga0207655_10025162 | 176 |
| 1299 | 3300025728 | Ga0207655_1002730 | Ga0207655_10027301 | 176 |
| 1300 | 3300025728 | Ga0207655_1002939 | Ga0207655_10029398 | 176 |
| 1301 | 3300025728 | Ga0207655_1005320 | Ga0207655_10053205 | 176 |
| 1302 | 3300025728 | Ga0207655_1005323 | Ga0207655_10053237 | 176 |
| 1303 | 3300025728 | Ga0207655_1009161 | Ga0207655_10091614 | 176 |
| 1304 | 3300025728 | Ga0207655_1018841 | Ga0207655_10188413 | 176 |
| 1305 | 3300025728 | Ga0207655_1028195 | Ga0207655_10281951 | 176 |
| 1306 | 3300025728 | Ga0207655_1053962 | Ga0207655_10539622 | 176 |
| 1307 | 3300025728 | Ga0207655_1178649 | Ga0207655_11786491 | 176 |
| 1308 | 3300025728 | Ga0207655_1208568 | Ga0207655_12085681 | 176 |
| 1309 | 3300025735 | Ga0207713_1000010 | Ga0207713_1000010138 | 176 |
| 1310 | 3300025735 | Ga0207713_1000081 | Ga0207713_100008162 | 176 |
| 1311 | 3300025735 | Ga0207713_1000307 | Ga0207713_100030721 | 176 |
| 1312 | 3300025735 | Ga0207713_1000511 | Ga0207713_10005119 | 176 |
| 1313 | 3300025735 | Ga0207713_1001808 | Ga0207713_10018082 | 176 |
| 1314 | 3300025735 | Ga0207713_1002377 | Ga0207713_10023776 | 176 |
| 1315 | 3300025735 | Ga0207713_1004870 | Ga0207713_10048702 | 176 |
| 1316 | 3300025735 | Ga0207713_1006244 | Ga0207713_10062443 | 176 |
| 1317 | 3300025735 | Ga0207713_1011807 | Ga0207713_10118074 | 176 |
| 1318 | 3300025735 | Ga0207713_1017287 | Ga0207713_10172872 | 176 |
| 1319 | 3300025735 | Ga0207713_1018158 | Ga0207713_10181582 | 176 |
| 1320 | 3300025735 | Ga0207713_1018668 | Ga0207713_10186682 | 176 |
| 1321 | 3300025735 | Ga0207713_1020156 | Ga0207713_10201562 | 176 |
| 1322 | 3300025735 | Ga0207713_1026512 | Ga0207713_10265124 | 176 |
| 1323 | 3300025735 | Ga0207713_1031868 | Ga0207713_10318682 | 176 |
| 1324 | 3300025735 | Ga0207713_1045297 | Ga0207713_10452972 | 176 |
| 1325 | 3300025735 | Ga0207713_1048313 | Ga0207713_10483132 | 176 |
| 1326 | 3300025735 | Ga0207713_1050074 | Ga0207713_10500742 | 176 |
| 1327 | 3300025911 | Ga0207654_10507425 | Ga0207654_105074251 | 176 |
| 1328 | 3300025914 | Ga0207671_10000299 | Ga0207671_1000029925 | 176 |
| 1329 | 3300025920 | Ga0207649_10000022 | Ga0207649_1000002291 | 176 |
| 1330 | 3300025923 | Ga0207681_10000384 | Ga0207681_100003849 | 176 |
| 1331 | 3300025923 | Ga0207681_10013092 | Ga0207681_100130922 | 176 |
| 1332 | 3300025925 | Ga0207650_10000138 | Ga0207650_1000013815 | 176 |
| 1333 | 3300025925 | Ga0207650_10000735 | Ga0207650_1000073520 | 176 |
| 1334 | 3300025929 | Ga0207664_10970221 | Ga0207664_109702212 | 176 |
| 1335 | 3300025932 | Ga0207690_10602187 | Ga0207690_106021872 | 176 |
| 1336 | 3300025933 | Ga0207706_10000290 | Ga0207706_1000029013 | 176 |
| 1337 | 3300025933 | Ga0207706_10059986 | Ga0207706_100599863 | 176 |
| 1338 | 3300025934 | Ga0207686_10019741 | Ga0207686_100197415 | 176 |
| 1339 | 3300025934 | Ga0207686_10071769 | Ga0207686_100717692 | 176 |
| 1340 | 3300025935 | Ga0207709_10000086 | Ga0207709_1000008638 | 176 |
| 1341 | 3300025935 | Ga0207709_10000096 | Ga0207709_1000009641 | 176 |
| 1342 | 3300025935 | Ga0207709_10002767 | Ga0207709_100027673 | 176 |
| 1343 | 3300025935 | Ga0207709_10005890 | Ga0207709_100058907 | 176 |
| 1344 | 3300025935 | Ga0207709_10153078 | Ga0207709_101530782 | 176 |
| 1345 | 3300025935 | Ga0207709_10273361 | Ga0207709_102733612 | 176 |
| 1346 | 3300025937 | Ga0207669_10265808 | Ga0207669_102658081 | 176 |
| 1347 | 3300025945 | Ga0207679_10000027 | Ga0207679_1000002743 | 176 |
| 1348 | 3300025961 | Ga0207712_10136731 | Ga0207712_101367312 | 176 |
| 1349 | 3300025981 | Ga0207640_10035401 | Ga0207640_100354013 | 176 |
| 1350 | 3300026041 | Ga0207639_10000442 | Ga0207639_1000044216 | 176 |
| 1351 | 3300027111 | Ga0209281_1000016 | Ga0209281_1000016127 | 176 |
| 1352 | 3300027111 | Ga0209281_1000019 | Ga0209281_1000019409 | 176 |
| 1353 | 3300027111 | Ga0209281_1015383 | Ga0209281_10153832 | 176 |
| 1354 | 3300027296 | Ga0209389_1000195 | Ga0209389_100019520 | 176 |
| 1355 | 3300027296 | Ga0209389_1044274 | Ga0209389_10442743 | 176 |
| 1356 | 3300027312 | Ga0209371_1000066 | Ga0209371_1000066150 | 176 |
| 1357 | 3300027312 | Ga0209371_1003220 | Ga0209371_10032208 | 176 |
| 1358 | 3300027378 | Ga0209981_1017575 | Ga0209981_10175751 | 176 |
| 1359 | 3300027552 | Ga0209982_1018467 | Ga0209982_10184672 | 176 |
| 1360 | 3300027614 | Ga0209970_1015628 | Ga0209970_10156282 | 176 |
| 1361 | 3300027876 | Ga0209974_10058877 | Ga0209974_100588772 | 176 |
| 1362 | 3300027907 | Ga0207428_10009753 | Ga0207428_100097536 | 176 |
| 1363 | 3300027907 | Ga0207428_10349858 | Ga0207428_103498581 | 176 |
| 1364 | 3300027907 | Ga0207428_10448691 | Ga0207428_104486912 | 176 |
| 1365 | 3300028379 | Ga0268266_10114843 | Ga0268266_101148432 | 176 |
| 1366 | 3300028379 | Ga0268266_10823950 | Ga0268266_108239502 | 176 |
| 1367 | 3300030500 | Ga0268256_1000063 | Ga0268256_1000063150 | 176 |
| 1368 | 3300030500 | Ga0268256_1001416 | Ga0268256_10014165 | 176 |
| 1369 | 3300030732 | Ga0316176_1139831 | Ga0316176_11398312 | 176 |
| 1370 | 3300030733 | Ga0314311_1125624 | Ga0314311_11256242 | 176 |
| 1371 | 3300030734 | Ga0316179_1002808 | Ga0316179_10028082 | 176 |
| 1372 | 3300030735 | Ga0316178_1083275 | Ga0316178_108327523 | 176 |
| 1373 | 3300030744 | Ga0316181_1005751 | Ga0316181_10057512 | 176 |
| 1374 | 3300031548 | Ga0307408_100000002 | Ga0307408_100000002272 | 176 |
| 1375 | 3300031548 | Ga0307408_100736009 | Ga0307408_1007360091 | 176 |
| 1376 | 3300031548 | Ga0307408_101320937 | Ga0307408_1013209371 | 176 |
| 1377 | 3300031731 | Ga0307405_10657798 | Ga0307405_106577982 | 176 |
| 1378 | 3300031824 | Ga0307413_10163090 | Ga0307413_101630902 | 176 |
| 1379 | 3300031901 | Ga0307406_10991834 | Ga0307406_109918342 | 176 |
| 1380 | 3300031911 | Ga0307412_10267713 | Ga0307412_102677132 | 176 |
| 1381 | 3300032002 | Ga0307416_100182275 | Ga0307416_1001822751 | 176 |
| 1382 | 3300032004 | Ga0307414_10460059 | Ga0307414_104600592 | 176 |
| 1383 | 3300032005 | Ga0307411_10280699 | Ga0307411_102806992 | 176 |
| 1384 | 3300033180 | Ga0307510_10035520 | Ga0307510_100355203 | 176 |
| 1385 | 3300037471 | Ga0395905_0215767 | Ga0395905_0215767_616_1191 | 176 |
| 1386 | 3300038705 | Ga0237819_03039 | Ga0237819_03039_1445_1975 | 176 |
| 1387 | 3300041404 | Ga0439436_0042762 | Ga0439436_0042762_565_1095 | 176 |
| 1388 | 3300041405 | Ga0439438_015011 | Ga0439438_015011_1125_1655 | 176 |
| 1389 | 3300041405 | Ga0439438_024273 | Ga0439438_024273_114_644 | 176 |
| 1390 | 3300041405 | Ga0439438_088737 | Ga0439438_088737_21_551 | 176 |
| 1391 | 3300041407 | Ga0439447_008617 | Ga0439447_008617_1893_2423 | 176 |
| 1392 | 3300041407 | Ga0439447_011715 | Ga0439447_011715_300_830 | 176 |
| 1393 | 3300041411 | Ga0439466_0005646 | Ga0439466_0005646_1592_2122 | 176 |
| 1394 | 3300041411 | Ga0439466_0026215 | Ga0439466_0026215_1362_1892 | 176 |
| 1395 | 3300041411 | Ga0439466_0033891 | Ga0439466_0033891_316_846 | 176 |
| 1396 | 3300041411 | Ga0439466_0043859 | Ga0439466_0043859_636_1166 | 176 |
| 1397 | 3300041486 | Ga0451807_2026621 | Ga0451807_2026621_209_739 | 176 |
| 1398 | 3300041509 | Ga0451843_0886000 | Ga0451843_0886000_314_844 | 176 |
| 1399 | 3300042006 | Ga0439432_023353 | Ga0439432_023353_68_598 | 176 |
| 1400 | 3300042009 | Ga0439451_016205 | Ga0439451_016205_637_1167 | 176 |
| 1401 | 3300042010 | Ga0439452_000728 | Ga0439452_000728_14260_14790 | 176 |
| 1402 | 3300042010 | Ga0439452_009508 | Ga0439452_009508_1695_2225 | 176 |
| 1403 | 3300042010 | Ga0439452_033599 | Ga0439452_033599_602_1132 | 176 |
| 1404 | 3300042010 | Ga0439452_089382 | Ga0439452_089382_51_581 | 176 |
| 1405 | 3300042013 | Ga0439456_010104 | Ga0439456_010104_1238_1768 | 176 |
| 1406 | 3300042013 | Ga0439456_029395 | Ga0439456_029395_345_875 | 176 |
| 1407 | 3300042013 | Ga0439456_098190 | Ga0439456_098190_21_551 | 176 |
| 1408 | 3300042016 | Ga0439463_018423 | Ga0439463_018423_907_1437 | 176 |
| 1409 | 3300042016 | Ga0439463_071792 | Ga0439463_071792_332_862 | 176 |
| 1410 | 3300042115 | Ga0450911_004367 | Ga0450911_004367_773_1303 | 176 |
| 1411 | 3300042115 | Ga0450911_017530 | Ga0450911_017530_139_669 | 176 |
| 1412 | 3300042127 | Ga0450890_002721 | Ga0450890_002721_1450_1980 | 176 |
| 1413 | 3300042136 | Ga0450900_014225 | Ga0450900_014225_394_924 | 176 |
| 1414 | 3300042138 | Ga0450903_005417 | Ga0450903_005417_138_668 | 176 |
| 1415 | 3300042139 | Ga0450904_003726 | Ga0450904_003726_794_1324 | 176 |
| 1416 | 3300042142 | Ga0450905_005260 | Ga0450905_005260_514_1044 | 176 |
| 1417 | 3300042145 | Ga0450906_006219 | Ga0450906_006219_1623_2153 | 176 |
| 1418 | 3300042146 | Ga0450907_000587 | Ga0450907_000587_216_746 | 176 |
| 1419 | 3300042146 | Ga0450907_002130 | Ga0450907_002130_2655_3185 | 176 |
| 1420 | 3300042156 | Ga0439446_0006010 | Ga0439446_0006010_2348_2878 | 176 |
| 1421 | 3300042156 | Ga0439446_0055313 | Ga0439446_0055313_382_912 | 176 |
| 1422 | 3300042184 | Ga0450908_038983 | Ga0450908_038983_208_738 | 176 |
| 1423 | 3300042185 | Ga0450909_011634 | Ga0450909_011634_706_1236 | 176 |
| 1424 | 3300042439 | Ga0439464_0013453 | Ga0439464_0013453_1038_1568 | 176 |
| 1425 | 3300042439 | Ga0439464_0107026 | Ga0439464_0107026_115_645 | 176 |
| 1426 | 3300042461 | Ga0439460_0009609 | Ga0439460_0009609_1623_2153 | 176 |
| 1427 | 3300042531 | Ga0450918_022186 | Ga0450918_022186_508_1038 | 176 |
| 1428 | 3300042533 | Ga0450901_007013 | Ga0450901_007013_455_985 | 176 |
| 1429 | 3300046452 | Ga0495617_077854 | Ga0495617_077854_486_1016 | 176 |
| 1430 | 3300046453 | Ga0495627_000073 | Ga0495627_000073_29741_30271 | 176 |
| 1431 | 3300046453 | Ga0495627_001834 | Ga0495627_001834_6375_6905 | 176 |
| 1432 | 3300046453 | Ga0495627_006045 | Ga0495627_006045_4009_4539 | 176 |
| 1433 | 3300046453 | Ga0495627_017519 | Ga0495627_017519_1394_1924 | 176 |
| 1434 | 3300046458 | Ga0495591_001276 | Ga0495591_001276_3678_4208 | 176 |
| 1435 | 3300046458 | Ga0495591_007032 | Ga0495591_007032_2170_2700 | 176 |
| 1436 | 3300046458 | Ga0495591_029212 | Ga0495591_029212_769_1299 | 176 |
| 1437 | 3300046458 | Ga0495591_050877 | Ga0495591_050877_83_613 | 176 |
| 1438 | 3300046460 | Ga0495638_0110718 | Ga0495638_0110718_351_881 | 176 |
| 1439 | 3300046460 | Ga0495638_0283298 | Ga0495638_0283298_89_619 | 176 |
| 1440 | 3300046463 | Ga0495653_0071418 | Ga0495653_0071418_262_792 | 176 |
| 1441 | 3300046463 | Ga0495653_0089718 | Ga0495653_0089718_172_702 | 176 |
| 1442 | 3300046471 | Ga0495650_0005961 | Ga0495650_0005961_1187_1717 | 176 |
| 1443 | 3300046471 | Ga0495650_0027642 | Ga0495650_0027642_1806_2336 | 176 |
| 1444 | 3300046474 | Ga0495605_0000019 | Ga0495605_0000019_129577_130107 | 176 |
| 1445 | 3300046474 | Ga0495605_0000342 | Ga0495605_0000342_18367_18897 | 176 |
| 1446 | 3300046474 | Ga0495605_0016413 | Ga0495605_0016413_2399_2929 | 176 |
| 1447 | 3300046474 | Ga0495605_0116059 | Ga0495605_0116059_31_561 | 176 |
| 1448 | 3300046474 | Ga0495605_0175880 | Ga0495605_0175880_130_660 | 176 |
| 1449 | 3300046491 | Ga0495584_0001972 | Ga0495584_0001972_10832_11362 | 176 |
| 1450 | 3300046491 | Ga0495584_0246831 | Ga0495584_0246831_59_589 | 176 |
| 1451 | 3300046492 | Ga0495585_0112494 | Ga0495585_0112494_748_1278 | 176 |
| 1452 | 3300046492 | Ga0495585_0241404 | Ga0495585_0241404_329_859 | 176 |
| 1453 | 3300046499 | Ga0495594_0001675 | Ga0495594_0001675_5866_6396 | 176 |
| 1454 | 3300046500 | Ga0495596_0153768 | Ga0495596_0153768_104_634 | 176 |
| 1455 | 3300046501 | Ga0495607_0000773 | Ga0495607_0000773_1252_1782 | 176 |
| 1456 | 3300046501 | Ga0495607_0001163 | Ga0495607_0001163_22413_22976 | 176 |
| 1457 | 3300046501 | Ga0495607_0002362 | Ga0495607_0002362_13945_14475 | 176 |
| 1458 | 3300046501 | Ga0495607_0005030 | Ga0495607_0005030_8858_9388 | 176 |
| 1459 | 3300046501 | Ga0495607_0030889 | Ga0495607_0030889_432_962 | 176 |
| 1460 | 3300046501 | Ga0495607_0032490 | Ga0495607_0032490_1623_2153 | 176 |
| 1461 | 3300046501 | Ga0495607_0043713 | Ga0495607_0043713_909_1439 | 176 |
| 1462 | 3300046501 | Ga0495607_0052720 | Ga0495607_0052720_1609_2139 | 176 |
| 1463 | 3300046501 | Ga0495607_0077872 | Ga0495607_0077872_114_644 | 176 |
| 1464 | 3300046501 | Ga0495607_0104069 | Ga0495607_0104069_206_736 | 176 |
| 1465 | 3300046501 | Ga0495607_0164793 | Ga0495607_0164793_202_732 | 176 |
| 1466 | 3300046501 | Ga0495607_0244881 | Ga0495607_0244881_131_661 | 176 |
| 1467 | 3300046506 | Ga0495583_0000097 | Ga0495583_0000097_19763_20293 | 176 |
| 1468 | 3300046506 | Ga0495583_0002802 | Ga0495583_0002802_13029_13559 | 176 |
| 1469 | 3300046506 | Ga0495583_0030641 | Ga0495583_0030641_395_925 | 176 |
| 1470 | 3300046507 | Ga0495606_0000862 | Ga0495606_0000862_27507_28037 | 176 |
| 1471 | 3300046507 | Ga0495606_0017374 | Ga0495606_0017374_854_1384 | 176 |
| 1472 | 3300046507 | Ga0495606_0025160 | Ga0495606_0025160_3253_3783 | 176 |
| 1473 | 3300046507 | Ga0495606_0025587 | Ga0495606_0025587_2504_3034 | 176 |
| 1474 | 3300046507 | Ga0495606_0200446 | Ga0495606_0200446_322_852 | 176 |
| 1475 | 3300046507 | Ga0495606_0388850 | Ga0495606_0388850_132_662 | 176 |
| 1476 | 3300046512 | Ga0495610_0005941 | Ga0495610_0005941_4393_4923 | 176 |
| 1477 | 3300046512 | Ga0495610_0008139 | Ga0495610_0008139_250_780 | 176 |
| 1478 | 3300046512 | Ga0495610_0034706 | Ga0495610_0034706_1601_2131 | 176 |
| 1479 | 3300046512 | Ga0495610_0135980 | Ga0495610_0135980_30_560 | 176 |
| 1480 | 3300046513 | Ga0495616_0016126 | Ga0495616_0016126_306_836 | 176 |
| 1481 | 3300046513 | Ga0495616_0058525 | Ga0495616_0058525_1097_1627 | 176 |
| 1482 | 3300046513 | Ga0495616_0211290 | Ga0495616_0211290_257_787 | 176 |
| 1483 | 3300046515 | Ga0495620_0000199 | Ga0495620_0000199_19867_20397 | 176 |
| 1484 | 3300046515 | Ga0495620_0012809 | Ga0495620_0012809_1304_1834 | 176 |
| 1485 | 3300046515 | Ga0495620_0060575 | Ga0495620_0060575_379_909 | 176 |
| 1486 | 3300046515 | Ga0495620_0105447 | Ga0495620_0105447_279_809 | 176 |
| 1487 | 3300046518 | Ga0495631_0002478 | Ga0495631_0002478_542_1072 | 176 |
| 1488 | 3300046519 | Ga0495632_0011402 | Ga0495632_0011402_195_725 | 176 |
| 1489 | 3300046519 | Ga0495632_0059407 | Ga0495632_0059407_700_1230 | 176 |
| 1490 | 3300046519 | Ga0495632_0122816 | Ga0495632_0122816_492_1022 | 176 |
| 1491 | 3300046520 | Ga0495637_0000695 | Ga0495637_0000695_20211_20741 | 176 |
| 1492 | 3300046520 | Ga0495637_0018892 | Ga0495637_0018892_244_774 | 176 |
| 1493 | 3300046520 | Ga0495637_0033292 | Ga0495637_0033292_1023_1553 | 176 |
| 1494 | 3300046520 | Ga0495637_0089247 | Ga0495637_0089247_420_950 | 176 |
| 1495 | 3300046520 | Ga0495637_0140378 | Ga0495637_0140378_210_740 | 176 |
| 1496 | 3300046522 | Ga0495643_0000778 | Ga0495643_0000778_14486_15016 | 176 |
| 1497 | 3300046522 | Ga0495643_0011876 | Ga0495643_0011876_320_850 | 176 |
| 1498 | 3300046522 | Ga0495643_0086585 | Ga0495643_0086585_1062_1592 | 176 |
| 1499 | 3300046523 | Ga0495644_0001886 | Ga0495644_0001886_7254_7784 | 176 |
| 1500 | 3300046523 | Ga0495644_0043389 | Ga0495644_0043389_252_782 | 176 |
| 1501 | 3300046524 | Ga0495648_0023932 | Ga0495648_0023932_3035_3565 | 176 |
| 1502 | 3300046524 | Ga0495648_0143350 | Ga0495648_0143350_470_1000 | 176 |
| 1503 | 3300046524 | Ga0495648_0169697 | Ga0495648_0169697_71_601 | 176 |
| 1504 | 3300046524 | Ga0495648_0229511 | Ga0495648_0229511_246_776 | 176 |
| 1505 | 3300046526 | Ga0495666_0096618 | Ga0495666_0096618_839_1369 | 176 |
| 1506 | 3300046526 | Ga0495666_0157182 | Ga0495666_0157182_344_874 | 176 |
| 1507 | 3300046530 | Ga0495654_0002890 | Ga0495654_0002890_947_1477 | 176 |
| 1508 | 3300046530 | Ga0495654_0020248 | Ga0495654_0020248_2790_3320 | 176 |
| 1509 | 3300046530 | Ga0495654_0032212 | Ga0495654_0032212_1167_1697 | 176 |
| 1510 | 3300046530 | Ga0495654_0037996 | Ga0495654_0037996_1626_2156 | 176 |
| 1511 | 3300046530 | Ga0495654_0044327 | Ga0495654_0044327_1342_1872 | 176 |
| 1512 | 3300046530 | Ga0495654_0045050 | Ga0495654_0045050_1069_1599 | 176 |
| 1513 | 3300046530 | Ga0495654_0069121 | Ga0495654_0069121_238_768 | 176 |
| 1514 | 3300046530 | Ga0495654_0070608 | Ga0495654_0070608_872_1402 | 176 |
| 1515 | 3300046530 | Ga0495654_0229886 | Ga0495654_0229886_48_578 | 176 |
| 1516 | 3300046536 | Ga0495587_0014233 | Ga0495587_0014233_4122_4652 | 176 |
| 1517 | 3300046538 | Ga0495609_0000057 | Ga0495609_0000057_19763_20293 | 176 |
| 1518 | 3300046538 | Ga0495609_0000076 | Ga0495609_0000076_20200_20730 | 176 |
| 1519 | 3300046538 | Ga0495609_0000223 | Ga0495609_0000223_21055_21585 | 176 |
| 1520 | 3300046538 | Ga0495609_0121495 | Ga0495609_0121495_191_721 | 176 |
| 1521 | 3300046542 | Ga0495597_0000202 | Ga0495597_0000202_53115_53678 | 176 |
| 1522 | 3300046542 | Ga0495597_0061070 | Ga0495597_0061070_246_776 | 176 |
| 1523 | 3300046542 | Ga0495597_0094157 | Ga0495597_0094157_670_1200 | 176 |
| 1524 | 3300046542 | Ga0495597_0200856 | Ga0495597_0200856_31_561 | 176 |
| 1525 | 3300046558 | Ga0495633_0000038 | Ga0495633_0000038_19839_20369 | 176 |
| 1526 | 3300046616 | Ga0495668_0023511 | Ga0495668_0023511_1827_2357 | 176 |
| 1527 | 3300046648 | Ga0495611_0004652 | Ga0495611_0004652_971_1501 | 176 |
| 1528 | 3300046648 | Ga0495611_0034588 | Ga0495611_0034588_658_1188 | 176 |
| 1529 | 3300046660 | Ga0495625_0000027 | Ga0495625_0000027_128987_129517 | 176 |
| 1530 | 3300046665 | Ga0495661_0000027 | Ga0495661_0000027_62904_63434 | 176 |
| 1531 | 3300046665 | Ga0495661_0000174 | Ga0495661_0000174_11357_11887 | 176 |
| 1532 | 3300046665 | Ga0495661_0000605 | Ga0495661_0000605_6332_6862 | 176 |
| 1533 | 3300046665 | Ga0495661_0011245 | Ga0495661_0011245_169_699 | 176 |
| 1534 | 3300046665 | Ga0495661_0057156 | Ga0495661_0057156_1714_2244 | 176 |
| 1535 | 3300046680 | Ga0495646_0114856 | Ga0495646_0114856_564_1094 | 176 |
| 1536 | 3300046690 | Ga0495624_0017350 | Ga0495624_0017350_247_777 | 176 |
| 1537 | 3300046691 | Ga0495670_0007385 | Ga0495670_0007385_2515_3045 | 176 |
| 1538 | 3300046691 | Ga0495670_0028245 | Ga0495670_0028245_1810_2340 | 176 |
| 1539 | 3300046691 | Ga0495670_0045036 | Ga0495670_0045036_1432_1962 | 176 |
| 1540 | 3300046692 | Ga0495671_0009807 | Ga0495671_0009807_3426_3956 | 176 |
| 1541 | 3300046692 | Ga0495671_0014512 | Ga0495671_0014512_1029_1559 | 176 |
| 1542 | 3300046692 | Ga0495671_0105447 | Ga0495671_0105447_233_763 | 176 |
| 1543 | 3300046692 | Ga0495671_0118954 | Ga0495671_0118954_385_915 | 176 |
| 1544 | 3300046694 | Ga0495649_0028311 | Ga0495649_0028311_57_587 | 176 |
| 1545 | 3300046694 | Ga0495649_0033152 | Ga0495649_0033152_1723_2253 | 176 |
| 1546 | 3300046694 | Ga0495649_0037820 | Ga0495649_0037820_328_858 | 176 |
| 1547 | 3300046694 | Ga0495649_0217058 | Ga0495649_0217058_312_842 | 176 |
| 1548 | 3300046694 | Ga0495649_0220327 | Ga0495649_0220327_89_619 | 176 |
| 1549 | 3300046794 | Ga0495589_0121620 | Ga0495589_0121620_382_912 | 176 |
| 1550 | 3300046810 | Ga0495660_0076166 | Ga0495660_0076166_887_1417 | 176 |
| 1551 | 3300046810 | Ga0495660_0115848 | Ga0495660_0115848_456_986 | 176 |
| 1552 | 3300046810 | Ga0495660_0116171 | Ga0495660_0116171_807_1337 | 176 |
| 1553 | 3300047317 | Ga0495604_0110489 | Ga0495604_0110489_1280_1810 | 176 |
| 1554 | 3300047320 | Ga0495672_0004381 | Ga0495672_0004381_11006_11536 | 176 |
| 1555 | 3300047320 | Ga0495672_0062662 | Ga0495672_0062662_193_723 | 176 |
| 1556 | 3300047320 | Ga0495672_0074855 | Ga0495672_0074855_1063_1593 | 176 |
| 1557 | 3300047320 | Ga0495672_0175249 | Ga0495672_0175249_64_594 | 176 |
| 1558 | 3300047320 | Ga0495672_0248515 | Ga0495672_0248515_86_616 | 176 |
| 1559 | 3300047321 | Ga0495676_0000012 | Ga0495676_0000012_125799_126329 | 176 |
| 1560 | 3300047321 | Ga0495676_0016588 | Ga0495676_0016588_235_765 | 176 |
| 1561 | 3300047321 | Ga0495676_0083100 | Ga0495676_0083100_264_794 | 176 |
| 1562 | 3300047322 | Ga0495680_0062652 | Ga0495680_0062652_348_878 | 176 |
| 1563 | 3300047322 | Ga0495680_0297571 | Ga0495680_0297571_241_771 | 176 |
| 1564 | 3300047323 | Ga0495683_0000032 | Ga0495683_0000032_129268_129798 | 176 |
| 1565 | 3300047323 | Ga0495683_0000299 | Ga0495683_0000299_968_1573 | 176 |
| 1566 | 3300047446 | Ga0495679_000716 | Ga0495679_000716_6233_6763 | 176 |
| 1567 | 3300047446 | Ga0495679_005818 | Ga0495679_005818_3707_4237 | 176 |
| 1568 | 3300047469 | Ga0495673_0007429 | Ga0495673_0007429_1374_1904 | 176 |
| 1569 | 3300047469 | Ga0495673_0029989 | Ga0495673_0029989_351_881 | 176 |
| 1570 | 3300047469 | Ga0495673_0042121 | Ga0495673_0042121_1292_1822 | 176 |
| 1571 | 3300047469 | Ga0495673_0068027 | Ga0495673_0068027_198_728 | 176 |
| 1572 | 3300047470 | Ga0495681_0011056 | Ga0495681_0011056_4833_5363 | 176 |
| 1573 | 3300047470 | Ga0495681_0015894 | Ga0495681_0015894_3141_3671 | 176 |
| 1574 | 3300047470 | Ga0495681_0019129 | Ga0495681_0019129_3151_3681 | 176 |
| 1575 | 3300047470 | Ga0495681_0044276 | Ga0495681_0044276_1332_1862 | 176 |
| 1576 | 3300047673 | Ga0495593_0046642 | Ga0495593_0046642_81_611 | 176 |
| 1577 | 3300048088 | Ga0495602_0099043 | Ga0495602_0099043_1598_2128 | 176 |
| 1578 | 3300048091 | Ga0495626_0000545 | Ga0495626_0000545_34253_34783 | 176 |
| 1579 | 3300048091 | Ga0495626_0012629 | Ga0495626_0012629_255_785 | 176 |
| 1580 | 3300048905 | Ga0496102_0012587 | Ga0496102_0012587_3677_4207 | 176 |
| 1581 | 3300048913 | Ga0496110_0210860 | Ga0496110_0210860_376_906 | 176 |
| 1582 | 3300048913 | Ga0496110_0629122 | Ga0496110_0629122_331_861 | 176 |
| 1583 | 3300048919 | Ga0496116_0000698 | Ga0496116_0000698_18230_18760 | 176 |
| 1584 | 3300048919 | Ga0496116_0017048 | Ga0496116_0017048_4061_4591 | 176 |
| 1585 | 3300048920 | Ga0496117_0003200 | Ga0496117_0003200_279_809 | 176 |
| 1586 | 3300048920 | Ga0496117_0133523 | Ga0496117_0133523_193_723 | 176 |
| 1587 | 3300048920 | Ga0496117_0191463 | Ga0496117_0191463_32_562 | 176 |
| 1588 | 3300048921 | Ga0496118_0074998 | Ga0496118_0074998_816_1346 | 176 |
| 1589 | 3300048921 | Ga0496118_0261770 | Ga0496118_0261770_272_802 | 176 |
| 1590 | 3300048921 | Ga0496118_0318146 | Ga0496118_0318146_263_793 | 176 |
| 1591 | 3300048922 | Ga0496119_0000071 | Ga0496119_0000071_144506_145036 | 176 |
| 1592 | 3300048924 | Ga0496121_0003930 | Ga0496121_0003930_19062_19592 | 176 |
| 1593 | 3300048924 | Ga0496121_0005413 | Ga0496121_0005413_284_814 | 176 |
| 1594 | 3300048924 | Ga0496121_0032774 | Ga0496121_0032774_2732_3262 | 176 |
| 1595 | 3300048924 | Ga0496121_0045649 | Ga0496121_0045649_3185_3715 | 176 |
| 1596 | 3300048924 | Ga0496121_0159913 | Ga0496121_0159913_54_584 | 176 |
| 1597 | 3300048925 | Ga0496122_0000370 | Ga0496122_0000370_64481_65011 | 176 |
| 1598 | 3300048925 | Ga0496122_0004026 | Ga0496122_0004026_6044_6574 | 176 |
| 1599 | 3300048925 | Ga0496122_0031791 | Ga0496122_0031791_1717_2247 | 176 |
| 1600 | 3300048926 | Ga0496123_0000135 | Ga0496123_0000135_117718_118248 | 176 |
| 1601 | 3300048926 | Ga0496123_0012095 | Ga0496123_0012095_5140_5670 | 176 |
| 1602 | 3300048926 | Ga0496123_0013389 | Ga0496123_0013389_1451_1981 | 176 |
| 1603 | 3300048926 | Ga0496123_0141790 | Ga0496123_0141790_585_1115 | 176 |
| 1604 | 3300048926 | Ga0496123_0227234 | Ga0496123_0227234_211_741 | 176 |
| 1605 | 3300048926 | Ga0496123_0257552 | Ga0496123_0257552_289_819 | 176 |
| 1606 | 3300048927 | Ga0496124_0000144 | Ga0496124_0000144_22750_23280 | 176 |
| 1607 | 3300048927 | Ga0496124_0003720 | Ga0496124_0003720_17775_18305 | 176 |
| 1608 | 3300048927 | Ga0496124_0066416 | Ga0496124_0066416_2157_2687 | 176 |
| 1609 | 3300048927 | Ga0496124_0465688 | Ga0496124_0465688_33_563 | 176 |
| 1610 | 3300048927 | Ga0496124_0492305 | Ga0496124_0492305_265_795 | 176 |
| 1611 | 3300048928 | Ga0496125_0097534 | Ga0496125_0097534_321_851 | 176 |
| 1612 | 3300048928 | Ga0496125_0287061 | Ga0496125_0287061_316_846 | 176 |
| 1613 | 3300048928 | Ga0496125_0325484 | Ga0496125_0325484_175_705 | 176 |
| 1614 | 3300048929 | Ga0496126_0154013 | Ga0496126_0154013_1264_1794 | 176 |
| 1615 | 3300048929 | Ga0496126_0240172 | Ga0496126_0240172_284_814 | 176 |
| 1616 | 3300048929 | Ga0496126_0617030 | Ga0496126_0617030_282_812 | 176 |
| 1617 | 3300048929 | Ga0496126_0975102 | Ga0496126_0975102_58_588 | 176 |
| 1618 | 3300049459 | Ga0495678_000046 | Ga0495678_000046_151336_151866 | 176 |
| 1619 | 3300049459 | Ga0495678_005322 | Ga0495678_005322_298_828 | 176 |
| 1620 | 3300049459 | Ga0495678_009603 | Ga0495678_009603_282_812 | 176 |
| 1621 | 3300049459 | Ga0495678_027079 | Ga0495678_027079_1696_2226 | 176 |
| 1622 | 3300049460 | Ga0495682_0004456 | Ga0495682_0004456_1904_2434 | 176 |
| 1623 | 3300049460 | Ga0495682_0038206 | Ga0495682_0038206_296_826 | 176 |
| 1624 | 3300049571 | Ga0501034_0151855 | Ga0501034_0151855_742_1272 | 176 |
| 1625 | 3300049571 | Ga0501034_0453220 | Ga0501034_0453220_348_878 | 176 |
| 1626 | 3300049574 | Ga0501038_0405531 | Ga0501038_0405531_170_700 | 176 |
| 1627 | 3300049758 | Ga0501241_011072 | Ga0501241_011072_768_1298 | 176 |
| 1628 | 3300053161 | Ga0500634_0167092 | Ga0500634_0167092_335_865 | 176 |
| 1629 | iso_pu_bacteria | 8057160832 | 8057162233 | 176 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6iy8-assembly1.cif.gz_B | dmpr-phenol complex of pseudomonas putida | 0.8385 | 10 | 175 |
| 7vqf-assembly1.cif.gz_A | phenol binding protein, mopr | 0.8204 | 10 | 174 |
| 5kbe-assembly1.cif.gz_A | crystal structure of the aromatic sensor domain of mopr in complex with phenol | 0.8193 | 10 | 175 |
| 5kbh-assembly1.cif.gz_A | crystal structure of the aromatic sensor domain of mopr in complex with 3-chloro-phenol | 0.8193 | 10 | 175 |
| 5kbi-assembly1.cif.gz_A | crystal structure of the aromatic sensor domain of mopr in complex with catachol | 0.818 | 10 | 174 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q57614_9_172_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.8377 | 27 | 175 | 3.30.1380.20 |
| af_Q58265_65_225_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7977 | 26 | 175 | 3.30.1380.20 |
| af_Q57660_5_148_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7504 | 28 | 171 | 3.30.1380.20 |
| af_Q58149_3_150_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7315 | 22 | 175 | 3.30.1380.20 |
| af_Q59036_1_138_3.30.1380.20 | Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 | 0.7151 | 26 | 175 | 3.30.1380.20 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A4Q3HWT0-F1-model_v4 | deleted | 1.006 | 55 | 175 |
|
| AF-A0A2W5V0F5-F1-model_v4 | deleted | 1.004 | 35 | 175 |
|
| AF-A0A3M5UY60-F1-model_v4 | 4-vinyl reductase 4VR domain-containing protein | 0.9974 | 81 | 175 |
|
| AF-A0A370RAR4-F1-model_v4 | deleted | 0.983 | 6 | 175 |
|
| AF-A0A2W5V0F5-F1-model_v4 | deleted | 0.9827 | 35 | 175 |
|
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar