F495123

General Info

Members Datasets Scaffolds Average Seq Length
1629 763 1266 176

Family's Representative Sequence

Representative Sequence 3300047323|Ga0495683_0000299|Ga0495683_0000299_968_1573
Length 201
Sequence MLLFIEKQSSTPLLQRIMNFRSLDPMAKIAPQLPIEVDSETGVWTSDALPMLYVPRHFFVNNHMGIEEVLGADAYAEILYKAGYKSAWHWCEKEAECHGIEGVAVFEHYMKRLSQRGWGLFKIQDIDLDKGTCSVKLEHSCFVYVYGKVGRKVDYMFTGWFAGAMDQILAAKGSSVRTVAEQVYGGSEEGHEDGLFTVKPL

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2501025501 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
3 2501025504 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
4 2508501125 Burkholderia sp. WSM2232 Isolate Nodule
5 2510065045 Paraburkholderia sprentiae WSM5005 Isolate Nodule
6 2510065053 Pseudomonas sp. MOIL14HWK12:I1 Isolate Rhizosphere
7 2510065055 Pseudomonas sp. MOIL14HWK12:I2 Isolate Rhizosphere
8 2510065058 Pseudomonas oleovorans MOIL14HWK12 Isolate Rhizosphere
9 2510917014 Paraburkholderia silvatlantica SRMrh-20 Isolate Unclassified
10 2510917015 Paraburkholderia silvatlantica PVA5 Isolate Unclassified
11 2511231004 Pseudomonas sp. GM102 Isolate Nodule
12 2511231006 Pseudomonas sp. GM17 Isolate Nodule
13 2511231007 Pseudomonas sp. GM18 Isolate Nodule
14 2511231008 Pseudomonas sp. GM21 Isolate Nodule
15 2511231010 Pseudomonas sp. GM25 Isolate Nodule
16 2511231011 Pseudomonas sp. GM30 Isolate Nodule
17 2511231012 Pseudomonas sp. GM33 Isolate Nodule
18 2511231014 Pseudomonas sp. GM48 Isolate Nodule
19 2511231015 Pseudomonas sp. GM49 Isolate Nodule
20 2511231016 Pseudomonas sp. GM50 Isolate Nodule
21 2511231017 Pseudomonas sp. GM55 Isolate Nodule
22 2511231018 Pseudomonas sp. GM60 Isolate Nodule
23 2511231019 Pseudomonas sp. GM67 Isolate Nodule
24 2511231020 Pseudomonas sp. GM74 Isolate Nodule
25 2511231021 Pseudomonas sp. GM78 Isolate Nodule
26 2511231022 Pseudomonas sp. GM79 Isolate Nodule
27 2511231023 Pseudomonas sp. GM80 Isolate Nodule
28 2511231024 Pseudomonas sp. GM84 Isolate Nodule
29 2511231031 Pseudomonas sp. GM16 Isolate Nodule
30 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
31 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
32 2512047030 Paraburkholderia tuberum STM678 Isolate Nodule
33 2513237082 Paraburkholderia mimosarum STM3621 Isolate Nodule
34 2513237083 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
35 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
36 2513237151 Burkholderia sp. WSM2230 Isolate Nodule
37 2513237165 Cupriavidus neocaledonicus STM6070 Isolate Nodule
38 2513237166 Paraburkholderia azotifigens UYPR1.413 Isolate Nodule
39 2515154122 Paraburkholderia atlantica JPY251 Isolate Nodule
40 2515154123 Trinickia symbiotica JPY347 Isolate Nodule
41 2515154189 Paraburkholderia nodosa DSM 21604 Isolate Unclassified
42 2519103095 Burkholderia sp. KJ006 Isolate Nodule
43 2526164713 Paraburkholderia phenoliruptrix JPY366 Isolate Nodule
44 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
45 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
46 2554235341 Pseudomonas protegens CHA0 Isolate Rhizosphere
47 2562617112 Burkholderia sp. BT03 Isolate Rhizosphere
48 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
49 2582581311 Burkholderia sp. WP42 Isolate Rhizosphere
50 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
51 2597489888 Pseudomonas fluorescens SS101 Isolate Rhizosphere
52 2597489889 Pseudomonas synxantha BG33R Isolate Rhizosphere
53 2599185155 Pseudomonas sp. NFACC10-1 Isolate Rhizoplane
54 2599185160 Pseudomonas sp. NFPP25 Isolate Rhizoplane
55 2599185161 Pseudomonas sp. NFPP09 Isolate Rhizoplane
56 2599185162 Pseudomonas sp. NFPP10 Isolate Rhizoplane
57 2599185163 Pseudomonas sp. NFPP12 Isolate Rhizoplane
58 2599185164 Pseudomonas sp. NFPP13 Isolate Rhizoplane
59 2599185165 Pseudomonas sp. NFPP18 Isolate Rhizoplane
60 2599185166 Pseudomonas sp. NFPP08 Isolate Rhizoplane
61 2599185167 Pseudomonas sp. NFPP28 Isolate Rhizoplane
62 2599185168 Pseudomonas sp. NFPP05 Isolate Rhizoplane
63 2599185178 Ralstonia sp. NFACC01 Isolate Rhizoplane
64 2599185179 Pseudomonas sp. NFR09 Isolate Rhizoplane
65 2599185181 Pseudomonas sp. NFPP17 Isolate Rhizoplane
66 2599185182 Pseudomonas sp. NFPP19 Isolate Rhizoplane
67 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
68 2599185186 Pseudomonas sp. NFPP15 Isolate Rhizoplane
69 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
70 2599185189 Pseudomonas sp. NFPP02 Isolate Rhizoplane
71 2599185190 Pseudomonas sp. NFPP04 Isolate Rhizoplane
72 2599185191 Pseudomonas sp. NFPP24 Isolate Rhizoplane
73 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
74 2599185239 Burkholderia sp. NFACC38-1 Isolate Rhizoplane
75 2599185240 Burkholderia sp. NFPP32 Isolate Rhizoplane
76 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
77 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
78 2599185288 Pseudomonas sp. NFACC25 Isolate Rhizoplane
79 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
80 2599185290 Pseudomonas sp. NFPP11 Isolate Rhizoplane
81 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
82 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
83 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
84 2599185303 Pseudomonas sp. NFACC42-2 Isolate Rhizoplane
85 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
86 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
87 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
88 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
89 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
90 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
91 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
92 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
93 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
94 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
95 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
96 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
97 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
98 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
99 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
100 2599185319 Pseudomonas sp. NFACC24-1 Isolate Rhizoplane
101 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
102 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
103 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
104 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
105 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
106 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
107 2599185355 Burkholderia sp. NFACC33-1 Isolate Rhizoplane
108 2599185356 Pseudomonas sp. NFPP14 Isolate Rhizoplane
109 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
110 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
111 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
112 2600255067 Paraburkholderia kururiensis thiooxydans NBRC 107107 Isolate Unclassified
113 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
114 2600255296 Pseudomonas sp. NFR02 Isolate Rhizoplane
115 2600255313 Pseudomonas sp. NFPP16 Isolate Rhizoplane
116 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
117 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
118 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
119 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
120 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
121 2619619299 Pseudomonas veronii R4 Genome sequencing Isolate Unclassified
122 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
123 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
124 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
125 2643221571 Pseudomonas sp. Root569 Isolate Unclassified
126 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
127 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
128 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
129 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
130 2643221713 Pseudomonas sp. Root9 Isolate Unclassified
131 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
132 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
133 2667528171 Pseudomonas sp. NFPP22 Isolate Rhizoplane
134 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
135 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
136 2675903129 Burkholderia pyrrocinia NFIX32 Isolate Rhizoplane
137 2675903420 Pseudomonas fluorescens Ps006 Isolate Unclassified
138 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
139 2711768613 Burkholderia sp. BT03 Isolate Rhizosphere
140 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
141 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
142 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
143 2718217991 Paraburkholderia sprentiae WSM5005 Isolate Nodule
144 2721755607 Pseudomonas fluorescens Pt14 Isolate Rhizosphere
145 2738541265 Pseudomonas sp. GV077 Isolate Unclassified
146 2738541271 Pseudomonas sp. GV021 Isolate Unclassified
147 2738541282 Pseudomonas sp. GV058 Isolate Unclassified
148 2738541294 Pseudomonas sp. GV087 Isolate Unclassified
149 2738541296 Paraburkholderia sp. GV073 Isolate Unclassified
150 2738541298 Paraburkholderia sp. GV068 Isolate Unclassified
151 2738541303 Pseudomonas sp. GV105 Isolate Unclassified
152 2738541306 Paraburkholderia sp. GV052 Isolate Unclassified
153 2738541309 Pseudomonas sp. GV047 Isolate Unclassified
154 2738543002 Paraburkholderia sp. GV072 Isolate Unclassified
155 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
156 2738543008 Paraburkholderia sp. GV060 Isolate Unclassified
157 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
158 2738543016 Pseudomonas sp. GV012 Isolate Unclassified
159 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
160 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
161 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
162 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
163 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
164 2744054900 Paraburkholderia ginsengiterrae DCY85-1 Isolate Unclassified
165 2744054901 Paraburkholderia ginsengiterrae DCY85 Isolate Unclassified
166 2751185846 Paraburkholderia ribeironis STM 7296 Isolate Unclassified
167 2765235841 Pseudomonas putida AA7 Isolate Unclassified
168 2773857670 Pseudomonas sp. 478 Isolate Unclassified
169 2773857672 Pseudomonas sp. 1766 Isolate Unclassified
170 2773857673 Pseudomonas sp. 443 Isolate Unclassified
171 2784132063 Pseudomonas sp. 424 Isolate Unclassified
172 2784132072 Pseudomonas sp. 460 Isolate Unclassified
173 2791355137 Paraburkholderia piptadeniae STM7183 Isolate Unclassified
174 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
175 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
176 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
177 2808606361 Pseudomonas sp. SJZ075 Isolate Rhizosphere
178 2808606376 Pseudomonas sp. SJZ074 Isolate Rhizosphere
179 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
180 2808606378 Pseudomonas sp. SJZ078 Isolate Rhizosphere
181 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
182 2808606380 Pseudomonas sp. SJZ085 Isolate Rhizosphere
183 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
184 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
185 2808606383 Pseudomonas sp. SJZ124 Isolate Rhizosphere
186 2808606384 Burkholderia sp. SJZ089 Isolate Rhizosphere
187 2808606385 Pseudomonas sp. SJZ103 Isolate Rhizosphere
188 2808606388 Pseudomonas sp. SJZ094 Isolate Rhizosphere
189 2808606389 Pseudomonas sp. SJZ101 Isolate Rhizosphere
190 2808606390 Burkholderia sp. SJZ115 Isolate Rhizosphere
191 2808606391 Burkholderia sp. SJZ091 Isolate Rhizosphere
192 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
193 2811994881 Pseudomonas sp. SLBN-26 Isolate Unclassified
194 2816332253 Burkholderia vietnamiensis HI2297 Isolate Unclassified
195 2816332256 Burkholderia vietnamiensis MSMB608WGS Isolate Unclassified
196 2816332286 Burkholderia vietnamiensis HI2221 Isolate Rhizosphere
197 2816332298 Pseudomonas veronii R02 Isolate Rhizosphere
198 2818991436 Collimonas arenae 515 Isolate Unclassified
199 2818991450 Burkholderia sp. 604 Isolate Unclassified
200 2818991452 Burkholderia cepacia 561 Isolate Unclassified
201 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
202 2818991464 Pseudomonas protegens 3295 Isolate Rhizosphere
203 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
204 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
205 2826581358 Pseudomonas viridiflava CDRTc14 Isolate Unclassified
206 2834028612 Pseudomonas fluorescens 513 Isolate Unclassified
207 2842324504 Paraburkholderia fungorum SEMIA 4007 Isolate Nodule
208 2842348783 Paraburkholderia fungorum SEMIA 4013 Isolate Nodule
209 2842454564 Paraburkholderia fungorum SEMIA 4056 Isolate Nodule
210 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
211 2842815866 Pseudomonas sp. R-72210 Isolate Unclassified
212 2842826826 Pseudomonas sp. R-72172 Isolate Unclassified
213 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
214 2842837860 Pseudomonas sp. R-72102 Isolate Unclassified
215 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
216 2842849001 Pseudomonas sp. R-72008 Isolate Unclassified
217 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
218 2843690924 Chromobacterium rhizoryzae JP2-74 Isolate Rhizosphere
219 2844665904 Pseudomonas protegens H1F10C Isolate Unclassified
220 2852612431 Pseudomonas sp. SJZ073 Isolate Rhizosphere
221 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
222 2852667396 Pseudomonas sp. JAI120 Isolate Rhizosphere
223 2856287931 Paraburkholderia bannensis BE22 Isolate Rhizosphere
224 2857357740 Paraburkholderia tropica BE15 Isolate Rhizosphere
225 2858688981 Cupriavidus sp. UYMMa02A Isolate Unclassified
226 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
227 2860867994 Pseudomonas sp. R1-43-08 Isolate Rhizosphere
228 2863421361 Burkholderia cenocepacia CACua-24 Isolate Rhizosphere
229 2870068957 Burkholderia sp. JP2-270 Isolate Unclassified
230 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
231 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
232 2883087390 Paraburkholderia guartelaensis CNPSo 3008 Isolate Unclassified
233 2885270888 Paraburkholderia sp. UYCPa14C Isolate Unclassified
234 2888373701 Serratia rhizosphaerae KUDC3025 Isolate Rhizosphere
235 2900634093 Paraburkholderia dipogonis ICMP 19430 Isolate Unclassified
236 2901300506 Cupriavidus sp. UYMSc13B Isolate Unclassified
237 2902682994 Paraburkholderia atlantica CNPSo 3155 Isolate Unclassified
238 2904483920 Paraburkholderia caledonica 575 Isolate Unclassified
239 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
240 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
241 2904564687 Burkholderia sp. 571 Isolate Unclassified
242 2904571731 Burkholderia cenocepacia 574 Isolate Unclassified
243 2904615490 Paraburkholderia franconis CNPSo 3157 Isolate Unclassified
244 2908446538 Pseudomonas sp. R76 Isolate Rhizosphere
245 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
246 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
247 2917070673 Pseudomonas protegens CHA0 Isolate Rhizosphere
248 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
249 2917832318 Pseudomonas rhizoryzae RY24 Isolate Unclassified
250 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
251 2919125081 Pseudomonas psychrotolerans 1545 Isolate Rhizosphere
252 2919155634 Pseudomonas fulva 1992 Isolate Unclassified
253 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
254 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
255 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
256 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
257 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
258 2919527303 Paraburkholderia strydomiana 3827 Isolate Unclassified
259 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
260 2921643360 Paraburkholderia steynii HC1.1ba Isolate Nodule
261 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
262 2923519811 Pseudomonas otitidis SLBN-103 Isolate Rhizosphere
263 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
264 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
265 2928108538 Paraburkholderia terricola 1595 Isolate Rhizosphere
266 2928135762 Paraburkholderia terricola 1988 Isolate Unclassified
267 2928157003 Burkholderia ambifaria 566 Isolate Unclassified
268 2928163908 Burkholderia sp. 567 Isolate Unclassified
269 2928170801 Burkholderia sp. 572 Isolate Unclassified
270 2928503688 Paraburkholderia terricola 1263 Isolate Rhizosphere
271 2928536128 Burkholderia sola 565 Isolate Unclassified
272 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
273 2929189879 Pseudomonas sp. R-71842 Hybrid assembly Isolate Unclassified
274 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
275 2931390751 Pseudomonas sp. DR208 Isolate Rhizosphere
276 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
277 2935353572 Pseudomonas protegens TECH19 Isolate Unclassified
278 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
279 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
280 2939669807 Kaistia defluvii 3207 Isolate Rhizosphere
281 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
282 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
283 2945934425 Paraburkholderia graminis W1I13 Isolate Rhizosphere
284 2945961074 Pseudomonas sp. W2I6 Isolate Rhizosphere
285 2946006987 Pseudomonas sp. W3I7 Isolate Rhizosphere
286 2946027586 Pseudomonas sp. W4I3 Isolate Rhizosphere
287 2947233263 Pseudomonas synxantha W2I4 Isolate Rhizosphere
288 2952252522 Salinicola sp. DM10 Isolate Unclassified
289 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
290 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
291 2974298342 Pseudomonas sp. SORGH_AS 211 Isolate Unclassified
292 2981990288 Burkholderia sp. PvR073 Isolate Rhizosphere
293 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
294 2984499530 Pseudomonas sp. SORGH_AS199 Isolate Aerial Root
295 2984504281 Pseudomonas psychrotolerans SORGH_AS201 Isolate Aerial Root
296 2988728565 Pseudomonas corrugata RM1-1-4 Isolate Rhizosphere
297 2990703756 Paraburkholderia graminis SLBN-33 Isolate Rhizosphere
298 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
299 3007252601 Pseudomonas punonensis D1-6 Isolate Unclassified
300 3007315729 Pseudomonas argentinensis SA190 Isolate Unclassified
301 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
302 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
303 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
304 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
305 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
306 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
307 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
308 3007855910 Pseudomonas khorasanensis SWRI153 Isolate Rhizosphere
309 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
310 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
311 3007872151 Pseudomonas sp. SWRI51 Isolate Rhizosphere
312 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
313 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
314 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
315 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
316 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
317 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
318 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
319 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
320 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
321 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
322 3300002771 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB Metagenome Endosphere
323 3300002772 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS Metagenome Endosphere
324 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
325 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
326 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
327 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
328 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
329 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
330 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
331 3300003756 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 Metagenome Endosphere
332 3300003758 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 Metagenome Endosphere
333 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
334 3300003760 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 Metagenome Endosphere
335 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
336 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
337 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
338 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
339 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
340 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
341 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
342 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
343 3300003841 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 Metagenome Endosphere
344 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
345 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
346 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
347 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
348 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
349 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
350 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
351 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
352 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
353 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
354 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
355 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
356 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
357 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
358 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
359 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
360 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
361 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
362 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
363 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
364 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
365 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
366 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
367 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
368 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
369 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
370 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
371 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
372 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
373 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
374 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
375 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
376 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
377 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
378 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
379 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
380 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
381 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
382 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
383 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
384 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
385 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
386 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
387 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
388 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
389 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
390 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
391 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
392 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
393 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
394 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
395 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
396 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
397 3300012498 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.yng.090410 Metagenome Rhizosphere
398 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
399 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
400 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
401 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
402 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
403 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
404 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
405 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
406 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
407 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
408 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
409 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
410 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
411 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
412 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
413 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
414 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
415 3300016635 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10 Metagenome Rhizosphere
416 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
417 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
418 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
419 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
420 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
421 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
422 3300025225 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
423 3300025226 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
424 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
425 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
426 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
427 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
428 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
429 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
430 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
431 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
432 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
433 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
434 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
435 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
436 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
437 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
438 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
439 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
440 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
441 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
442 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
443 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
444 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
445 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
446 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
447 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
449 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
450 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
454 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
455 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
456 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
458 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
459 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
460 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
461 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
462 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
464 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
465 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
466 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
467 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
468 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
469 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
470 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
471 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
472 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
473 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
474 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
475 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
476 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
477 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
478 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
479 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
480 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
481 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
482 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
483 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
484 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
485 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
486 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
487 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
488 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
489 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
490 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
491 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
492 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
493 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
494 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
495 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
496 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
497 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
498 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
499 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
500 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
501 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
502 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
503 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
504 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
505 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
506 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
507 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
508 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
509 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
510 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
511 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
512 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
513 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
514 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
515 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
516 3300038705 Coralloid root microbial communities from Raymundo Flores, Chiapas, Mexico - RF1-T1 Metagenome Unclassified
517 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
518 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
519 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
520 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
521 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
522 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
523 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
524 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
525 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
526 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
527 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
528 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
529 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
530 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
531 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
532 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
533 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
534 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
535 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
536 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
537 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
538 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
539 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
540 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
541 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
542 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
543 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
544 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
545 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
546 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
547 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
548 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
549 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
550 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
551 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
552 3300044659 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E Metagenome Unclassified
553 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
554 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
555 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
556 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
557 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
558 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
559 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
560 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
561 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
562 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
563 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
564 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
565 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
566 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
567 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
568 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
569 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
570 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
571 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
572 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
573 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
574 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
575 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
576 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
577 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
578 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
579 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
580 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
581 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
582 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
583 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
584 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
585 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
586 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
587 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
588 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
589 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
590 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
591 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
592 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
593 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
594 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
595 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
596 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
597 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
598 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
599 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
600 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
601 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
602 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
603 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
604 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
605 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
606 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
607 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
608 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
609 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
610 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
611 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
612 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
613 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
614 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
615 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
616 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
617 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
618 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
619 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
620 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
621 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
622 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
623 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
624 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
625 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
626 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
627 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
628 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
629 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
630 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
631 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
632 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
633 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
634 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
635 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
636 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
637 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
638 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
639 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
640 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
641 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
642 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
643 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
644 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
645 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
646 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
647 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
648 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
649 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
650 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
651 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
652 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
653 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
654 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
655 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
656 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
657 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
658 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
659 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
660 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
661 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
662 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
663 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
664 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
665 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
666 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
667 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
668 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
669 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
670 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
671 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
672 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
673 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
674 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
675 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
676 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
677 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
678 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
679 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
680 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
681 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
682 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
683 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
684 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
685 3300049654 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_A_0_control Metagenome Rhizosphere
686 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
687 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
688 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
689 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
690 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
691 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
692 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
693 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
694 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
695 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
696 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
697 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
698 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
699 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
700 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
701 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
702 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
703 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
704 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
705 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
706 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
707 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
708 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
709 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
710 3300059649 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 68R_SW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
711 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
712 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
713 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
714 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
715 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
716 637000220 Pseudomonas protegens Pf-5 Isolate Rhizoplane
717 641736151 Paraburkholderia graminis C4D1M Isolate Rhizoplane
718 641736154 Burkholderia ambifaria IOP40-10 Isolate Rhizosphere
719 642555112 Paraburkholderia phymatum STM815 Isolate Nodule
720 642555113 Paraburkholderia phytofirmans PsJN Isolate Unclassified
721 8002745576 Marinomonas spartinae USM8 Isolate Rhizosphere
722 8003955200 Paraburkholderia mimosarum LMG 23256 Isolate Nodule
723 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
724 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
725 8016728285 Pseudomonas psychrotolerans SORGH_AS 227 Isolate Unclassified
726 8018845410 Burkholderia reimsis BE51 Isolate Rhizosphere
727 8019769354 Pseudomonas sp. MSSRFD41 Isolate Rhizosphere
728 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
729 8020807995 Burkholderia sp. B10 Isolate Rhizosphere
730 8020938398 Burkholderia sp. BE12 Isolate Rhizosphere
731 8020945358 Burkholderia sp. BE17 Isolate Rhizosphere
732 8020953355 Burkholderia sp. BE24 Isolate Rhizosphere
733 8021120328 Burkholderia sp. LS-044 Isolate Rhizosphere
734 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
735 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
736 8039098773 Burkholderia multivorans MSMB612WGS Isolate Unclassified
737 8040167225 Burkholderia vietnamiensis RS1 Isolate Unclassified
738 8040173305 Burkholderia vietnamiensis BE10 Isolate Rhizosphere
739 8052494512 Pseudomonas putida LD6 Isolate Unclassified
740 8054285046 Pseudomonas petroselini MAFF 311096 Isolate Nodule
741 8054347763 Pseudomonas carnis NWU Be30 Isolate Unclassified
742 8054503363 Pseudomonas sivasensis BsEB-1 Isolate Unclassified
743 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
744 8055266321 Paraburkholderia rhynchosiae LMG 27174 Isolate Nodule
745 8055301274 Paraburkholderia kirstenboschensis LMG 28727 Isolate Nodule
746 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
747 8055817908 Pseudomonas pergaminensis 1008 Isolate Rhizosphere
748 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
749 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
750 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
751 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
752 8056131705 Pseudomonas asgharzadehiana SWRI132 Isolate Rhizosphere
753 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
754 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
755 8056148874 Pseudomonas khavaziana SWRI124 Isolate Rhizosphere
756 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
757 8056161164 Pseudomonas azadiae SWRI103 Isolate Rhizosphere
758 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
759 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
760 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
761 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere
762 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere
763 8057798959 Pseudomonas piscis BW16M1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 74.65
Metatranscriptomes 3.07
Isolates 22.28

Biome Distribution

Category Percentage (%)
Aerial Root 0.12
Bulb 0
Endosphere 8.16
Nodule 3.25
Rhizoplane 7.37
Rhizosphere 67.22
Stem 0
Stem Tuber 0
Unclassified 13.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_111 2124908027 Bacteria 7788
2 JGI24736J21556_1004411 3300001904 Bacteria 2404
3 JGI24741J21665_1013051 3300001915 Bacteria 1416
4 JGI24740J21852_10000031 3300001979 Bacteria 46967
5 JGI24740J21852_10000396 3300001979 Bacteria 18681
6 JGI24740J21852_10006262 3300001979 Bacteria 4946
7 JGI24740J21852_10025467 3300001979 Bacteria 1993
8 JGI24739J22299_10001631 3300001989 Bacteria 8513
9 JGI24739J22299_10002580 3300001989 Bacteria 6985
10 JGI24739J22299_10006601 3300001989 Bacteria 4373
11 JGI24739J22299_10065571 3300001989 Bacteria 1138
12 JGI24737J22298_10007728 3300001990 Bacteria 3624
13 JGI24737J22298_10029982 3300001990 Bacteria 1704
14 JGI24737J22298_10045959 3300001990 Bacteria 1333
15 JGI24735J21928_10000955 3300002067 Bacteria 10329
16 JGI24735J21928_10001973 3300002067 Bacteria 7209
17 JGI24735J21928_10011294 3300002067 Bacteria 2834
18 JGI24735J21928_10013510 3300002067 Bacteria 2566
19 JGI24735J21928_10023445 3300002067 Bacteria 1872
20 JGI24735J21928_10036373 3300002067 Bacteria 1444
21 JGI24738J21930_10011550 3300002075 Bacteria 1940
22 JGI25156J39149_1000366 3300002705 Bacteria 29011
23 JGI25156J39149_1000389 3300002705 Bacteria 27572
24 JGI25156J39149_1000562 3300002705 Bacteria 21189
25 JGI25156J39149_1002605 3300002705 Bacteria 6357
26 JGI25156J39149_1007380 3300002705 Bacteria 2895
27 JGI25162J39368_1000076 3300002737 Bacteria 120246
28 JGI25154J39366_1000271 3300002738 Bacteria 32100
29 JGI25154J39366_1015861 3300002738 Bacteria 770
30 JGI25163J39215_1001848 3300002771 Bacteria 2796
31 JGI25164J39214_1000083 3300002772 Bacteria 93706
32 JGI25164J39214_1000084 3300002772 Bacteria 93684
33 JGI25151J46595_10005206 3300003187 Bacteria 6745
34 JGI25165J46597_1000140 3300003214 Bacteria 120246
35 JGI25165J46597_1000186 3300003214 Bacteria 93706
36 JGI25165J46597_1000717 3300003214 Bacteria 26046
37 rootH1_10070082 3300003316 Bacteria 1403
38 rootH1_10075861 3300003316 Bacteria 3600
39 rootL2_10014775 3300003322 Bacteria 1483
40 Ga0006562J51391_1006636 3300003578 Bacteria 3648
41 Ga0006562J51391_1014803 3300003578 Bacteria 2891
42 Ga0055538_1000095 3300003751 Bacteria 75040
43 Ga0055538_1000219 3300003751 Bacteria 33042
44 Ga0055539_1000139 3300003752 Bacteria 75040
45 Ga0055539_1000233 3300003752 Bacteria 38473
46 Ga0055533_1000064 3300003756 Bacteria 169672
47 Ga0055533_1000145 3300003756 Bacteria 75040
48 Ga0055533_1000247 3300003756 Bacteria 33939
49 Ga0055533_1000835 3300003756 Bacteria 9483
50 Ga0055533_1001095 3300003756 Bacteria 7758
51 Ga0055532_1000013 3300003758 Bacteria 380677
52 Ga0055532_1000128 3300003758 Bacteria 75040
53 Ga0055532_1000245 3300003758 Bacteria 39120
54 Ga0055532_1000292 3300003758 Bacteria 31681
55 Ga0055525_1000190 3300003759 Bacteria 75040
56 Ga0055525_1000318 3300003759 Bacteria 38473
57 Ga0055527_1000010 3300003760 Bacteria 380677
58 Ga0055527_1000159 3300003760 Bacteria 47732
59 Ga0055527_1000260 3300003760 Bacteria 32074
60 Ga0055527_1006249 3300003760 Bacteria 1498
61 Ga0055535_1000010 3300003761 Bacteria 380677
62 Ga0055535_1000315 3300003761 Bacteria 48887
63 Ga0055535_1000431 3300003761 Bacteria 39120
64 Ga0055535_1004327 3300003761 Bacteria 3493
65 Ga0055542_1000016 3300003762 Bacteria 380677
66 Ga0055542_1000990 3300003762 Bacteria 18375
67 Ga0055542_1003449 3300003762 Bacteria 4275
68 Ga0055529_1000012 3300003763 Bacteria 380677
69 Ga0055529_1000517 3300003763 Bacteria 33886
70 Ga0055536_1000764 3300003781 Bacteria 21428
71 Ga0055536_1011893 3300003781 Bacteria 3283
72 Ga0055528_1002297 3300003790 Bacteria 10350
73 Ga0055530_10009302 3300003791 Bacteria 3795
74 Ga0055540_1000452 3300003792 Bacteria 31985
75 Ga0055531_10000109 3300003794 Bacteria 89901
76 Ga0055541_1000093 3300003841 Bacteria 75040
77 Ga0055541_1000113 3300003841 Bacteria 58560
78 Ga0055541_1000160 3300003841 Bacteria 33042
79 Ga0058692_1002918 3300003856 Bacteria 5516
80 Ga0065165_1000810 3300005262 Bacteria 41615
81 Ga0065714_10000596 3300005288 Bacteria 3551
82 Ga0065714_10002541 3300005288 Bacteria 25727
83 Ga0065714_10006685 3300005288 Bacteria 3184
84 Ga0065714_10051673 3300005288 Bacteria 591
85 Ga0065714_10066645 3300005288 Bacteria 6512
86 Ga0065714_10117165 3300005288 Bacteria 1394
87 Ga0065714_10142132 3300005288 Bacteria 1162
88 Ga0065714_10223962 3300005288 Bacteria 829
89 Ga0065714_10288258 3300005288 Bacteria 709
90 Ga0065704_10000995 3300005289 Bacteria 10453
91 Ga0065704_10034078 3300005289 Bacteria 971
92 Ga0065704_10201950 3300005289 Bacteria 1142
93 Ga0065704_10424606 3300005289 Bacteria 729
94 Ga0065712_10067838 3300005290 Bacteria 26755
95 Ga0065715_10007584 3300005293 Bacteria 3036
96 Ga0070658_10003407 3300005327 Bacteria 13079
97 Ga0070658_10048516 3300005327 Bacteria 3438
98 Ga0070676_10180759 3300005328 Bacteria 1371
99 Ga0070683_101118265 3300005329 Bacteria 757
100 Ga0070670_100007436 3300005331 Bacteria 9304
101 Ga0070682_100103553 3300005337 Bacteria 1883
102 Ga0070660_100000006 3300005339 Bacteria 166714
103 Ga0070660_100000507 3300005339 Bacteria 26032
104 Ga0070660_100067883 3300005339 Bacteria 2778
105 Ga0070661_100000038 3300005344 Bacteria 104775
106 Ga0070661_100000348 3300005344 Bacteria 36613
107 Ga0070669_100000248 3300005353 Bacteria 44834
108 Ga0070669_100066159 3300005353 Bacteria 2664
109 Ga0070675_100483202 3300005354 Bacteria 1114
110 Ga0070671_100440642 3300005355 Bacteria 1117
111 Ga0070659_100000082 3300005366 Bacteria 71707
112 Ga0070659_100002151 3300005366 Bacteria 14041
113 Ga0070659_100239763 3300005366 Bacteria 1500
114 Ga0070659_100273629 3300005366 Bacteria 1404
115 Ga0070667_100551988 3300005367 Bacteria 1059
116 Ga0070667_100914291 3300005367 Bacteria 817
117 Ga0070714_100582607 3300005435 Bacteria 1073
118 Ga0070714_100629501 3300005435 Bacteria 1032
119 Ga0070714_101115677 3300005435 Bacteria 769
120 Ga0070663_100000069 3300005455 Bacteria 44710
121 Ga0070663_100000075 3300005455 Bacteria 43381
122 Ga0070663_100205344 3300005455 Bacteria 1540
123 Ga0070678_100281207 3300005456 Bacteria 1407
124 Ga0070662_100000423 3300005457 Bacteria 25105
125 Ga0070662_100088025 3300005457 Bacteria 2327
126 Ga0068853_100000155 3300005539 Bacteria 46420
127 Ga0070665_100492023 3300005548 Bacteria 1237
128 Ga0070665_101072000 3300005548 Bacteria 817
129 Ga0070665_101945906 3300005548 Bacteria 593
130 Ga0068855_100013952 3300005563 Bacteria 9688
131 Ga0068855_100028268 3300005563 Bacteria 6707
132 Ga0068855_100040376 3300005563 Bacteria 5539
133 Ga0068855_100690129 3300005563 Bacteria 1093
134 Ga0068855_101102753 3300005563 Bacteria 830
135 Ga0070664_100000191 3300005564 Bacteria 43340
136 Ga0070664_100002818 3300005564 Bacteria 14062
137 Ga0068854_100004356 3300005578 Bacteria 8926
138 Ga0068856_100000504 3300005614 Bacteria 43340
139 Ga0068856_100076217 3300005614 Bacteria 3323
140 Ga0068852_100015182 3300005616 Bacteria 5961
141 Ga0068852_100081937 3300005616 Bacteria 2866
142 Ga0068861_100016273 3300005719 Bacteria 5259
143 Ga0068851_10000012 3300005834 Bacteria 175130
144 Ga0068851_10136348 3300005834 Bacteria 1331
145 Ga0068851_10425110 3300005834 Bacteria 785
146 Ga0075363_100202386 3300006048 Bacteria 1135
147 Ga0075432_10021103 3300006058 Bacteria 2228
148 Ga0075432_10040746 3300006058 Bacteria 1621
149 Ga0075432_10059931 3300006058 Bacteria 1353
150 Ga0075432_10122923 3300006058 Bacteria 976
151 Ga0075432_10149183 3300006058 Bacteria 897
152 Ga0075432_10152952 3300006058 Bacteria 887
153 Ga0075362_10077500 3300006177 Bacteria 1527
154 Ga0075369_10276721 3300006186 Bacteria 781
155 Ga0075427_10052499 3300006194 Bacteria 704
156 Ga0075436_100479195 3300006914 Bacteria 908
157 Ga0099823_1000137 3300006944 Bacteria 37992
158 Ga0099823_1051170 3300006944 Bacteria 2513
159 Ga0079104_1000322 3300006946 Bacteria 60025
160 Ga0079104_1000338 3300006946 Bacteria 57315
161 Ga0105251_10000019 3300009011 Bacteria 141884
162 Ga0105251_10000127 3300009011 Bacteria 76233
163 Ga0105251_10000542 3300009011 Bacteria 35584
164 Ga0105251_10003857 3300009011 Bacteria 10680
165 Ga0105251_10006346 3300009011 Bacteria 7555
166 Ga0105251_10006467 3300009011 Bacteria 7457
167 Ga0105251_10012349 3300009011 Bacteria 4835
168 Ga0105251_10023834 3300009011 Bacteria 3151
169 Ga0105251_10027925 3300009011 Bacteria 2855
170 Ga0105251_10065832 3300009011 Bacteria 1695
171 Ga0105251_10077797 3300009011 Bacteria 1537
172 Ga0105251_10116570 3300009011 Bacteria 1214
173 Ga0105251_10154236 3300009011 Bacteria 1036
174 Ga0105251_10214615 3300009011 Bacteria 866
175 Ga0105251_10234814 3300009011 Bacteria 826
176 Ga0105244_10000417 3300009036 Bacteria 39564
177 Ga0105244_10002181 3300009036 Bacteria 15009
178 Ga0105244_10006408 3300009036 Bacteria 7626
179 Ga0105244_10006864 3300009036 Bacteria 7309
180 Ga0105244_10021397 3300009036 Bacteria 3577
181 Ga0105244_10044510 3300009036 Bacteria 2287
182 Ga0105244_10062006 3300009036 Bacteria 1880
183 Ga0105244_10074841 3300009036 Bacteria 1684
184 Ga0105244_10113371 3300009036 Bacteria 1317
185 Ga0105244_10116648 3300009036 Bacteria 1295
186 Ga0105244_10125489 3300009036 Bacteria 1241
187 Ga0105244_10151667 3300009036 Bacteria 1110
188 Ga0105244_10179832 3300009036 Bacteria 1003
189 Ga0105244_10196762 3300009036 Bacteria 951
190 Ga0105244_10209653 3300009036 Bacteria 917
191 Ga0105244_10212566 3300009036 Bacteria 909
192 Ga0105244_10326496 3300009036 Bacteria 708
193 Ga0105250_10000563 3300009092 Bacteria 24835
194 Ga0105250_10000709 3300009092 Bacteria 20531
195 Ga0105250_10025779 3300009092 Bacteria 2369
196 Ga0105250_10083222 3300009092 Bacteria 1298
197 Ga0105250_10090213 3300009092 Bacteria 1246
198 Ga0105250_10167291 3300009092 Bacteria 919
199 Ga0105250_10197655 3300009092 Bacteria 848
200 Ga0105250_10198210 3300009092 Bacteria 846
201 Ga0105250_10210716 3300009092 Bacteria 821
202 Ga0105240_10004374 3300009093 Bacteria 21565
203 Ga0105240_10066046 3300009093 Bacteria 4490
204 Ga0105240_10196992 3300009093 Bacteria 2364
205 Ga0105240_10442527 3300009093 Bacteria 1456
206 Ga0105245_10309157 3300009098 Bacteria 1554
207 Ga0105243_10000325 3300009148 Bacteria 52234
208 Ga0105243_10003183 3300009148 Bacteria 13445
209 Ga0105243_10007615 3300009148 Bacteria 8323
210 Ga0105243_10020292 3300009148 Bacteria 5039
211 Ga0105243_10377983 3300009148 Bacteria 1309
212 Ga0105243_10558101 3300009148 Bacteria 1095
213 Ga0105243_11119613 3300009148 Bacteria 797
214 Ga0105243_11859999 3300009148 Bacteria 634
215 Ga0105241_10232790 3300009174 Bacteria 1554
216 Ga0105241_10703039 3300009174 Bacteria 923
217 Ga0105242_10000846 3300009176 Bacteria 23789
218 Ga0105242_11060105 3300009176 Bacteria 822
219 Ga0105248_10640824 3300009177 Bacteria 1199
220 Ga0105237_10000756 3300009545 Bacteria 44299
221 Ga0105237_10141691 3300009545 Bacteria 2398
222 Ga0105237_10198047 3300009545 Bacteria 2008
223 Ga0105237_10239067 3300009545 Bacteria 1817
224 Ga0105237_10450867 3300009545 Bacteria 1292
225 Ga0105238_10063614 3300009551 Bacteria 3690
226 Ga0105238_10423733 3300009551 Bacteria 1326
227 Ga0105249_10253643 3300009553 Bacteria 1745
228 Ga0105239_10002079 3300010375 Bacteria 25954
229 Ga0105239_10003831 3300010375 Bacteria 18277
230 Ga0105239_10047907 3300010375 Bacteria 4684
231 Ga0105239_10485553 3300010375 Bacteria 1404
232 Ga0105246_10005716 3300011119 Bacteria 7593
233 Ga0105246_10072921 3300011119 Bacteria 2422
234 Ga0105246_10272649 3300011119 Bacteria 1353
235 Ga0105246_10278998 3300011119 Bacteria 1339
236 Ga0105246_10716170 3300011119 Bacteria 879
237 Ga0105246_10858619 3300011119 Bacteria 810
238 Ga0157345_1000797 3300012498 Bacteria 2413
239 Ga0157373_10000358 3300013100 Bacteria 36729
240 Ga0157373_10002832 3300013100 Bacteria 13112
241 Ga0157373_10048867 3300013100 Bacteria 3016
242 Ga0157373_10184475 3300013100 Bacteria 1469
243 Ga0157373_10591262 3300013100 Bacteria 807
244 Ga0157373_11060393 3300013100 Bacteria 607
245 Ga0157371_10000608 3300013102 Bacteria 42626
246 Ga0157371_10008084 3300013102 Bacteria 8411
247 Ga0157371_10192771 3300013102 Bacteria 1459
248 Ga0157371_10212686 3300013102 Bacteria 1388
249 Ga0157371_10413781 3300013102 Bacteria 988
250 Ga0157371_10456965 3300013102 Bacteria 939
251 Ga0157370_10000086 3300013104 Bacteria 103729
252 Ga0157370_10000690 3300013104 Bacteria 42091
253 Ga0157370_10000852 3300013104 Bacteria 38700
254 Ga0157370_10001717 3300013104 Bacteria 26975
255 Ga0157370_10155885 3300013104 Bacteria 2125
256 Ga0157370_10253317 3300013104 Bacteria 1628
257 Ga0157370_10708071 3300013104 Bacteria 919
258 Ga0157370_10835041 3300013104 Bacteria 838
259 Ga0157370_11275780 3300013104 Bacteria 662
260 Ga0157369_10000120 3300013105 Bacteria 111290
261 Ga0157369_10000743 3300013105 Bacteria 42070
262 Ga0157369_10003555 3300013105 Bacteria 18512
263 Ga0157369_10004872 3300013105 Bacteria 15751
264 Ga0157369_10095222 3300013105 Bacteria 3178
265 Ga0157369_10123142 3300013105 Bacteria 2751
266 Ga0157369_10743561 3300013105 Bacteria 1009
267 Ga0157369_10808121 3300013105 Bacteria 963
268 Ga0157369_11829878 3300013105 Bacteria 617
269 Ga0171462_1021 3300013250 Bacteria 141297
270 Ga0157374_10000976 3300013296 Bacteria 24794
271 Ga0157374_10080599 3300013296 Bacteria 3088
272 Ga0157374_10240568 3300013296 Bacteria 1780
273 Ga0157378_10471771 3300013297 Bacteria 1249
274 Ga0163162_10000454 3300013306 Bacteria 37941
275 Ga0163162_10436994 3300013306 Bacteria 1441
276 Ga0163162_11931083 3300013306 Bacteria 676
277 Ga0157372_10000519 3300013307 Bacteria 42478
278 Ga0157372_10001060 3300013307 Bacteria 30037
279 Ga0157372_10003761 3300013307 Bacteria 16301
280 Ga0157372_10063189 3300013307 Bacteria 4150
281 Ga0157372_10090525 3300013307 Bacteria 3478
282 Ga0157372_10143368 3300013307 Bacteria 2754
283 Ga0157372_10152645 3300013307 Bacteria 2666
284 Ga0157372_10325218 3300013307 Bacteria 1790
285 Ga0157375_10010236 3300013308 Bacteria 8249
286 Ga0157375_10365139 3300013308 Bacteria 1610
287 Ga0163163_10671412 3300014325 Bacteria 1100
288 Ga0157380_10001066 3300014326 Bacteria 17591
289 Ga0182008_10001464 3300014497 Bacteria 15783
290 Ga0182008_10067557 3300014497 Bacteria 1759
291 Ga0182008_10245974 3300014497 Bacteria 921
292 Ga0182008_10291886 3300014497 Bacteria 851
293 Ga0157376_10966044 3300014969 Bacteria 873
294 Ga0182006_1001401 3300015261 Bacteria 14627
295 Ga0182006_1003771 3300015261 Bacteria 7645
296 Ga0182006_1009036 3300015261 Bacteria 4484
297 Ga0182006_1017240 3300015261 Bacteria 3070
298 Ga0182006_1078932 3300015261 Bacteria 1204
299 Ga0182006_1106463 3300015261 Bacteria 989
300 Ga0182007_10000795 3300015262 Bacteria 17642
301 Ga0182007_10003364 3300015262 Bacteria 7557
302 Ga0182007_10018828 3300015262 Bacteria 2495
303 Ga0182007_10045275 3300015262 Bacteria 1459
304 Ga0182007_10121479 3300015262 Bacteria 874
305 Ga0182005_1000509 3300015265 Bacteria 19915
306 Ga0182005_1001429 3300015265 Bacteria 9616
307 Ga0182005_1190854 3300015265 Bacteria 612
308 Ga0183361_10038 3300016635 Bacteria 26120
309 Ga0163161_10151963 3300017792 Bacteria 1760
310 Ga0163161_10907523 3300017792 Bacteria 747
311 Ga0163161_11032598 3300017792 Bacteria 703
312 Ga0213872_10133782 3300021361 Bacteria 1091
313 Ga0224712_10000332 3300022467 Bacteria 8963
314 Ga0209435_100436 3300025206 Bacteria 8636
315 Ga0209435_102054 3300025206 Bacteria 2417
316 Ga0209435_114785 3300025206 Bacteria 821
317 Ga0209760_100098 3300025207 Bacteria 66801
318 Ga0209760_100101 3300025207 Bacteria 65719
319 Ga0209784_100007 3300025224 Bacteria 747715
320 Ga0209784_100215 3300025224 Bacteria 39580
321 Ga0209566_100018 3300025225 Bacteria 448638
322 Ga0209566_100062 3300025225 Bacteria 193033
323 Ga0209566_100161 3300025225 Bacteria 75269
324 Ga0209566_100215 3300025225 Bacteria 58348
325 Ga0209674_100011 3300025226 Bacteria 997175
326 Ga0209674_100021 3300025226 Bacteria 629811
327 Ga0209674_100048 3300025226 Bacteria 353032
328 Ga0209674_100183 3300025226 Bacteria 71751
329 Ga0209674_100271 3300025226 Bacteria 39580
330 Ga0209674_102469 3300025226 Bacteria 3952
331 Ga0209672_100002 3300025228 Bacteria 1733325
332 Ga0209672_100012 3300025228 Bacteria 795742
333 Ga0209672_100020 3300025228 Bacteria 429003
334 Ga0209672_100066 3300025228 Bacteria 189828
335 Ga0209672_100234 3300025228 Bacteria 42161
336 Ga0209672_100439 3300025228 Bacteria 23788
337 Ga0209147_100003 3300025229 Bacteria 1733325
338 Ga0209147_100007 3300025229 Bacteria 795684
339 Ga0209147_100009 3300025229 Bacteria 747409
340 Ga0209147_100024 3300025229 Bacteria 429003
341 Ga0209147_100084 3300025229 Bacteria 189828
342 Ga0209147_100295 3300025229 Bacteria 42161
343 Ga0209563_100018 3300025230 Bacteria 747850
344 Ga0209563_100181 3300025230 Bacteria 39580
345 Ga0209563_100395 3300025230 Bacteria 15618
346 Ga0209563_101061 3300025230 Bacteria 7950
347 Ga0209563_104234 3300025230 Bacteria 2778
348 Ga0207427_100005 3300025231 Bacteria 797999
349 Ga0207427_100006 3300025231 Bacteria 785415
350 Ga0207427_101307 3300025231 Bacteria 9356
351 Ga0207427_110510 3300025231 Bacteria 962
352 Ga0209437_100013 3300025233 Bacteria 785457
353 Ga0209437_100018 3300025233 Bacteria 694400
354 Ga0209437_104789 3300025233 Bacteria 2354
355 Ga0209258_100014 3300025242 Bacteria 720132
356 Ga0209258_100042 3300025242 Bacteria 380729
357 Ga0209258_100084 3300025242 Bacteria 244783
358 Ga0209258_100117 3300025242 Bacteria 189828
359 Ga0209258_100330 3300025242 Bacteria 71644
360 Ga0209258_100477 3300025242 Bacteria 42161
361 Ga0209646_1000046 3300025246 Bacteria 332737
362 Ga0209646_1000400 3300025246 Bacteria 25870
363 Ga0209026_1026636 3300025250 Bacteria 868
364 Ga0209677_100056 3300025253 Bacteria 165557
365 Ga0209677_100230 3300025253 Bacteria 39580
366 Ga0209677_102128 3300025253 Bacteria 7768
367 Ga0209148_1000006 3300025254 Bacteria 1733325
368 Ga0209148_1000148 3300025254 Bacteria 159642
369 Ga0209148_1000187 3300025254 Bacteria 117659
370 Ga0209148_1000739 3300025254 Bacteria 25313
371 Ga0209148_1000785 3300025254 Bacteria 23584
372 Ga0209148_1003392 3300025254 Bacteria 4445
373 Ga0209759_1000002 3300025256 Bacteria 1027596
374 Ga0209759_1000032 3300025256 Bacteria 278697
375 Ga0209759_1000210 3300025256 Bacteria 90325
376 Ga0209759_1000587 3300025256 Bacteria 35659
377 Ga0209759_1003308 3300025256 Bacteria 6485
378 Ga0209759_1003547 3300025256 Bacteria 6177
379 Ga0209759_1006814 3300025256 Bacteria 3781
380 Ga0209759_1018458 3300025256 Bacteria 1683
381 Ga0209759_1021767 3300025256 Bacteria 1450
382 Ga0209233_1000021 3300025261 Bacteria 798078
383 Ga0209233_1000022 3300025261 Bacteria 785415
384 Ga0209233_1000033 3300025261 Bacteria 596094
385 Ga0209455_1000003 3300025272 Bacteria 1471893
386 Ga0209455_1000110 3300025272 Bacteria 189828
387 Ga0209455_1000269 3300025272 Bacteria 58101
388 Ga0209455_1000362 3300025272 Bacteria 42161
389 Ga0209455_1004621 3300025272 Bacteria 4449
390 Ga0209673_1000057 3300025273 Bacteria 270150
391 Ga0209130_1004039 3300025284 Bacteria 5826
392 Ga0209675_1006697 3300025291 Bacteria 4568
393 Ga0209676_1000015 3300025292 Bacteria 784458
394 Ga0209676_1000030 3300025292 Bacteria 506421
395 Ga0209676_1000041 3300025292 Bacteria 424583
396 Ga0209676_1000548 3300025292 Bacteria 57446
397 Ga0209676_1004486 3300025292 Bacteria 7750
398 Ga0209025_1000123 3300025294 Bacteria 204125
399 Ga0209564_1006643 3300025295 Bacteria 6176
400 Ga0209050_1000024 3300025298 Bacteria 533389
401 Ga0209050_1000075 3300025298 Bacteria 286562
402 Ga0209050_1000128 3300025298 Bacteria 187432
403 Ga0209050_1002450 3300025298 Bacteria 15871
404 Ga0207426_1000152 3300025302 Bacteria 183514
405 Ga0209051_1000012 3300025303 Bacteria 595474
406 Ga0209051_1000023 3300025303 Bacteria 437371
407 Ga0209051_1000041 3300025303 Bacteria 311155
408 Ga0209051_1007648 3300025303 Bacteria 5875
409 Ga0209257_1000069 3300025304 Bacteria 339826
410 Ga0209257_1007474 3300025304 Bacteria 6584
411 Ga0207656_10000006 3300025321 Bacteria 395044
412 Ga0207696_1000031 3300025711 Bacteria 384169
413 Ga0207696_1000064 3300025711 Bacteria 238379
414 Ga0207696_1000094 3300025711 Bacteria 184065
415 Ga0207696_1000095 3300025711 Bacteria 179123
416 Ga0207696_1000149 3300025711 Bacteria 120461
417 Ga0207696_1004438 3300025711 Bacteria 6047
418 Ga0207696_1004760 3300025711 Bacteria 5775
419 Ga0207696_1006915 3300025711 Bacteria 4505
420 Ga0207696_1013636 3300025711 Bacteria 2820
421 Ga0207696_1059603 3300025711 Bacteria 1075
422 Ga0207655_1000007 3300025728 Bacteria 773492
423 Ga0207655_1000068 3300025728 Bacteria 241705
424 Ga0207655_1000107 3300025728 Bacteria 178758
425 Ga0207655_1000455 3300025728 Bacteria 53605
426 Ga0207655_1001758 3300025728 Bacteria 18989
427 Ga0207655_1002516 3300025728 Bacteria 14758
428 Ga0207655_1002730 3300025728 Bacteria 13789
429 Ga0207655_1002939 3300025728 Bacteria 13102
430 Ga0207655_1005320 3300025728 Bacteria 8800
431 Ga0207655_1005323 3300025728 Bacteria 8797
432 Ga0207655_1009161 3300025728 Bacteria 6184
433 Ga0207655_1018841 3300025728 Bacteria 3639
434 Ga0207655_1028195 3300025728 Bacteria 2654
435 Ga0207655_1053962 3300025728 Bacteria 1602
436 Ga0207655_1164587 3300025728 Bacteria 690
437 Ga0207655_1178649 3300025728 Bacteria 650
438 Ga0207655_1208568 3300025728 Bacteria 578
439 Ga0207713_1000010 3300025735 Bacteria 528374
440 Ga0207713_1000081 3300025735 Bacteria 166910
441 Ga0207713_1000302 3300025735 Bacteria 56383
442 Ga0207713_1000307 3300025735 Bacteria 55987
443 Ga0207713_1000511 3300025735 Bacteria 39537
444 Ga0207713_1001808 3300025735 Bacteria 16343
445 Ga0207713_1002377 3300025735 Bacteria 13751
446 Ga0207713_1004357 3300025735 Bacteria 9202
447 Ga0207713_1004870 3300025735 Bacteria 8597
448 Ga0207713_1006244 3300025735 Bacteria 7294
449 Ga0207713_1011807 3300025735 Bacteria 4717
450 Ga0207713_1017287 3300025735 Bacteria 3625
451 Ga0207713_1018158 3300025735 Bacteria 3490
452 Ga0207713_1018668 3300025735 Bacteria 3426
453 Ga0207713_1020156 3300025735 Bacteria 3240
454 Ga0207713_1026512 3300025735 Bacteria 2653
455 Ga0207713_1031868 3300025735 Bacteria 2323
456 Ga0207713_1045297 3300025735 Bacteria 1798
457 Ga0207713_1048313 3300025735 Bacteria 1714
458 Ga0207713_1050074 3300025735 Bacteria 1669
459 Ga0207680_10254216 3300025903 Bacteria 1214
460 Ga0207647_10001027 3300025904 Bacteria 21661
461 Ga0207647_10011755 3300025904 Bacteria 6123
462 Ga0207647_10019511 3300025904 Bacteria 4558
463 Ga0207647_10047244 3300025904 Bacteria 2678
464 Ga0207647_10058678 3300025904 Bacteria 2356
465 Ga0207647_10078869 3300025904 Bacteria 1978
466 Ga0207705_10003789 3300025909 Bacteria 11515
467 Ga0207705_10052350 3300025909 Bacteria 2939
468 Ga0207654_10063366 3300025911 Bacteria 2169
469 Ga0207654_10507425 3300025911 Bacteria 852
470 Ga0207695_10001113 3300025913 Bacteria 46732
471 Ga0207695_10006823 3300025913 Bacteria 14704
472 Ga0207695_10048057 3300025913 Bacteria 4509
473 Ga0207671_10000299 3300025914 Bacteria 73023
474 Ga0207671_10043195 3300025914 Bacteria 3333
475 Ga0207671_10084192 3300025914 Bacteria 2388
476 Ga0207671_10320464 3300025914 Bacteria 1226
477 Ga0207657_10000003 3300025919 Bacteria 263148
478 Ga0207657_10000885 3300025919 Bacteria 31657
479 Ga0207657_10010571 3300025919 Bacteria 9203
480 Ga0207649_10000022 3300025920 Bacteria 188959
481 Ga0207649_10000326 3300025920 Bacteria 36079
482 Ga0207649_10073741 3300025920 Bacteria 2187
483 Ga0207649_10139362 3300025920 Bacteria 1657
484 Ga0207681_10000384 3300025923 Bacteria 30968
485 Ga0207681_10013092 3300025923 Bacteria 5128
486 Ga0207694_10016667 3300025924 Bacteria 5553
487 Ga0207694_10114426 3300025924 Bacteria 2148
488 Ga0207650_10000138 3300025925 Bacteria 88802
489 Ga0207650_10000735 3300025925 Bacteria 25242
490 Ga0207659_10417359 3300025926 Bacteria 1125
491 Ga0207664_10970221 3300025929 Bacteria 762
492 Ga0207644_10034485 3300025931 Bacteria 3542
493 Ga0207690_10000007 3300025932 Bacteria 388533
494 Ga0207690_10000380 3300025932 Bacteria 29474
495 Ga0207690_10602187 3300025932 Bacteria 897
496 Ga0207706_10000290 3300025933 Bacteria 54761
497 Ga0207706_10059986 3300025933 Bacteria 3351
498 Ga0207686_10019741 3300025934 Bacteria 3839
499 Ga0207686_10071769 3300025934 Bacteria 2229
500 Ga0207686_10623740 3300025934 Bacteria 851
501 Ga0207709_10000086 3300025935 Bacteria 156177
502 Ga0207709_10000096 3300025935 Bacteria 136585
503 Ga0207709_10002767 3300025935 Bacteria 10809
504 Ga0207709_10005890 3300025935 Bacteria 6919
505 Ga0207709_10153078 3300025935 Bacteria 1599
506 Ga0207709_10273361 3300025935 Bacteria 1245
507 Ga0207669_10265808 3300025937 Bacteria 1286
508 Ga0207711_10074677 3300025941 Bacteria 2949
509 Ga0207711_10085911 3300025941 Bacteria 2757
510 Ga0207679_10000002 3300025945 Bacteria 634491
511 Ga0207679_10000027 3300025945 Bacteria 196811
512 Ga0207679_10194351 3300025945 Bacteria 1690
513 Ga0207667_10003560 3300025949 Bacteria 19249
514 Ga0207667_10006579 3300025949 Bacteria 14061
515 Ga0207667_10006899 3300025949 Bacteria 13718
516 Ga0207667_10097174 3300025949 Bacteria 3040
517 Ga0207667_10155758 3300025949 Bacteria 2351
518 Ga0207712_10136731 3300025961 Bacteria 1875
519 Ga0207640_10035401 3300025981 Bacteria 3124
520 Ga0207639_10000442 3300026041 Bacteria 28717
521 Ga0207678_10000319 3300026067 Bacteria 43404
522 Ga0207678_10001465 3300026067 Bacteria 21657
523 Ga0207678_10008540 3300026067 Bacteria 9025
524 Ga0207678_10391346 3300026067 Bacteria 1202
525 Ga0207702_10000504 3300026078 Bacteria 44031
526 Ga0207702_10049899 3300026078 Bacteria 3532
527 Ga0207674_10456110 3300026116 Bacteria 1235
528 Ga0207674_11209831 3300026116 Bacteria 725
529 Ga0207675_100057916 3300026118 Bacteria 3616
530 Ga0207683_10193050 3300026121 Bacteria 1849
531 Ga0207698_10086845 3300026142 Bacteria 2545
532 Ga0209281_1000016 3300027111 Bacteria 588107
533 Ga0209281_1000019 3300027111 Bacteria 576164
534 Ga0209281_1015383 3300027111 Bacteria 1597
535 Ga0209389_1000195 3300027296 Bacteria 44002
536 Ga0209389_1044274 3300027296 Bacteria 3307
537 Ga0209371_1000066 3300027312 Bacteria 212660
538 Ga0209371_1000076 3300027312 Bacteria 195166
539 Ga0209371_1003220 3300027312 Bacteria 8200
540 Ga0209371_1008067 3300027312 Bacteria 3557
541 Ga0209981_1017575 3300027378 Bacteria 1010
542 Ga0209982_1018467 3300027552 Bacteria 1066
543 Ga0209970_1015628 3300027614 Bacteria 1264
544 Ga0210002_1032004 3300027617 Bacteria 876
545 Ga0209282_1109673 3300027666 Bacteria 1403
546 Ga0209974_10058877 3300027876 Bacteria 1299
547 Ga0207428_10009753 3300027907 Bacteria 8605
548 Ga0207428_10349858 3300027907 Bacteria 1087
549 Ga0207428_10448691 3300027907 Bacteria 941
550 Ga0268266_10114843 3300028379 Bacteria 2389
551 Ga0268266_10823950 3300028379 Bacteria 896
552 Ga0307515_10040414 3300028794 Bacteria 7374
553 Ga0265338_10296066 3300028800 Bacteria 1178
554 Ga0268256_1000063 3300030500 Bacteria 212660
555 Ga0268256_1000087 3300030500 Bacteria 157659
556 Ga0268256_1001416 3300030500 Bacteria 14539
557 Ga0268256_1005103 3300030500 Bacteria 5238
558 Ga0316176_1139831 3300030732 Bacteria 812
559 Ga0314311_1125624 3300030733 Bacteria 2082
560 Ga0316179_1002808 3300030734 Bacteria 2185
561 Ga0316178_1083275 3300030735 Bacteria 51744
562 Ga0316181_1005751 3300030744 Bacteria 2730
563 Ga0307408_100000002 3300031548 Bacteria 827227
564 Ga0307408_100004532 3300031548 Bacteria 9417
565 Ga0307408_100736009 3300031548 Bacteria 889
566 Ga0307408_101320937 3300031548 Bacteria 676
567 Ga0307405_10265306 3300031731 Bacteria 1285
568 Ga0307405_10657798 3300031731 Bacteria 862
569 Ga0307413_10163090 3300031824 Bacteria 1568
570 Ga0307406_10991834 3300031901 Bacteria 720
571 Ga0307412_10000095 3300031911 Bacteria 75002
572 Ga0307412_10267713 3300031911 Bacteria 1335
573 Ga0307412_10373368 3300031911 Bacteria 1152
574 Ga0307409_101390269 3300031995 Bacteria 728
575 Ga0307416_100182275 3300032002 Bacteria 1969
576 Ga0307414_10460059 3300032004 Bacteria 1118
577 Ga0307411_10280699 3300032005 Bacteria 1325
578 Ga0307510_10035520 3300033180 Bacteria 5564
579 Ga0395899_0006229 3300037312 Bacteria 9242
580 Ga0395899_0029500 3300037312 Bacteria 4126
581 Ga0395899_0068100 3300037312 Bacteria 2611
582 Ga0395899_0078539 3300037312 Bacteria 2405
583 Ga0395899_0082115 3300037312 Bacteria 2344
584 Ga0395899_0105700 3300037312 Bacteria 2027
585 Ga0395899_0213408 3300037312 Bacteria 1340
586 Ga0395900_0001069 3300037418 Bacteria 34842
587 Ga0395900_0001922 3300037418 Bacteria 23569
588 Ga0395900_0096528 3300037418 Bacteria 3037
589 Ga0395900_0101315 3300037418 Bacteria 2958
590 Ga0395900_0164362 3300037418 Bacteria 2262
591 Ga0395900_0268621 3300037418 Bacteria 1701
592 Ga0395900_0276234 3300037418 Bacteria 1673
593 Ga0395900_0306495 3300037418 Bacteria 1572
594 Ga0395900_0310588 3300037418 Bacteria 1560
595 Ga0395900_0547016 3300037418 Bacteria 1103
596 Ga0395898_0001705 3300037466 Bacteria 29237
597 Ga0395898_0013543 3300037466 Bacteria 8397
598 Ga0395898_0091311 3300037466 Bacteria 2930
599 Ga0395898_0098228 3300037466 Bacteria 2811
600 Ga0395898_0113022 3300037466 Bacteria 2602
601 Ga0395898_0155359 3300037466 Bacteria 2188
602 Ga0395898_0236639 3300037466 Bacteria 1741
603 Ga0395905_0000048 3300037471 Bacteria 236537
604 Ga0395905_0000144 3300037471 Bacteria 117622
605 Ga0395905_0007757 3300037471 Bacteria 10646
606 Ga0395905_0032686 3300037471 Bacteria 4892
607 Ga0395905_0048375 3300037471 Bacteria 3985
608 Ga0395905_0215767 3300037471 Bacteria 1797
609 Ga0395905_0322946 3300037471 Bacteria 1433
610 Ga0395905_0437125 3300037471 Bacteria 1205
611 Ga0395905_0571803 3300037471 Bacteria 1031
612 Ga0395905_0790484 3300037471 Bacteria 852
613 Ga0395901_0000081 3300038443 Bacteria 130244
614 Ga0395901_0000157 3300038443 Bacteria 88435
615 Ga0395901_0014499 3300038443 Bacteria 8015
616 Ga0395901_0046848 3300038443 Bacteria 4491
617 Ga0395901_0075354 3300038443 Bacteria 3519
618 Ga0395901_0096738 3300038443 Bacteria 3094
619 Ga0395901_0422100 3300038443 Bacteria 1367
620 Ga0395901_0914402 3300038443 Bacteria 858
621 Ga0395901_1029648 3300038443 Bacteria 797
622 Ga0395901_1243653 3300038443 Bacteria 708
623 Ga0237819_03039 3300038705 Bacteria 3111
624 Ga0436365_0041924 3300039437 Bacteria 4210
625 Ga0436360_0381606 3300039438 Bacteria 1293
626 Ga0436361_1016186 3300039447 Bacteria 5055
627 Ga0436361_1024429 3300039447 Bacteria 2114
628 Ga0439436_0042762 3300041404 Bacteria 1294
629 Ga0439438_015011 3300041405 Bacteria 2290
630 Ga0439438_024273 3300041405 Bacteria 1660
631 Ga0439438_088737 3300041405 Bacteria 754
632 Ga0439447_008617 3300041407 Bacteria 3148
633 Ga0439447_011715 3300041407 Bacteria 2544
634 Ga0439466_0005646 3300041411 Bacteria 4769
635 Ga0439466_0026215 3300041411 Bacteria 2028
636 Ga0439466_0033891 3300041411 Bacteria 1733
637 Ga0439466_0043859 3300041411 Bacteria 1484
638 Ga0451807_2026621 3300041486 Bacteria 767
639 Ga0451843_0886000 3300041509 Bacteria 1096
640 Ga0439448_0000277 3300042005 Bacteria 11224
641 Ga0439448_0024425 3300042005 Bacteria 1890
642 Ga0439432_023353 3300042006 Bacteria 2037
643 Ga0439450_009019 3300042008 Bacteria 1880
644 Ga0439450_018690 3300042008 Bacteria 1459
645 Ga0439451_016205 3300042009 Bacteria 1502
646 Ga0439452_000728 3300042010 Bacteria 15897
647 Ga0439452_009508 3300042010 Bacteria 2860
648 Ga0439452_033599 3300042010 Bacteria 1244
649 Ga0439452_089382 3300042010 Bacteria 666
650 Ga0439455_0085699 3300042012 Bacteria 860
651 Ga0439456_010104 3300042013 Bacteria 1949
652 Ga0439456_029395 3300042013 Bacteria 1173
653 Ga0439456_098190 3300042013 Bacteria 661
654 Ga0439463_018423 3300042016 Bacteria 1737
655 Ga0439463_071792 3300042016 Bacteria 887
656 Ga0450911_004367 3300042115 Bacteria 2325
657 Ga0450911_017530 3300042115 Bacteria 942
658 Ga0450890_002721 3300042127 Bacteria 2400
659 Ga0450900_014225 3300042136 Bacteria 1060
660 Ga0450903_005417 3300042138 Bacteria 2136
661 Ga0450904_003726 3300042139 Bacteria 1626
662 Ga0450905_005260 3300042142 Bacteria 1737
663 Ga0450906_006219 3300042145 Bacteria 2418
664 Ga0450907_000587 3300042146 Bacteria 9757
665 Ga0450907_002130 3300042146 Bacteria 3896
666 Ga0439446_0006010 3300042156 Bacteria 3145
667 Ga0439446_0055313 3300042156 Bacteria 1191
668 Ga0439458_0013096 3300042157 Bacteria 1865
669 Ga0450908_038983 3300042184 Bacteria 823
670 Ga0450909_011634 3300042185 Bacteria 1289
671 Ga0439464_0013453 3300042439 Bacteria 2191
672 Ga0439464_0107026 3300042439 Bacteria 853
673 Ga0439460_0009609 3300042461 Bacteria 2457
674 Ga0450918_022186 3300042531 Bacteria 1109
675 Ga0450901_007013 3300042533 Bacteria 1161
676 Ga0466969_0004304 3300044656 Bacteria 7573
677 Ga0466969_0006179 3300044656 Bacteria 6375
678 Ga0466969_0017551 3300044656 Bacteria 3734
679 Ga0466969_0068969 3300044656 Bacteria 1703
680 Ga0466969_0082322 3300044656 Bacteria 1534
681 Ga0466972_0010584 3300044658 Bacteria 4628
682 Ga0466973_0010148 3300044659 Bacteria 8683
683 Ga0466965_0003673 3300044683 Bacteria 6771
684 Ga0466965_0015457 3300044683 Bacteria 3626
685 Ga0466966_0000009 3300044684 Bacteria 150954
686 Ga0466966_0002666 3300044684 Bacteria 11694
687 Ga0466966_0446945 3300044684 Bacteria 777
688 Ga0466961_0001729 3300044693 Bacteria 13578
689 Ga0466961_0021964 3300044693 Bacteria 4106
690 Ga0466961_0104073 3300044693 Bacteria 1787
691 Ga0466961_0144769 3300044693 Bacteria 1486
692 Ga0466961_0164022 3300044693 Bacteria 1384
693 Ga0466963_0004763 3300044694 Bacteria 7911
694 Ga0466963_0108759 3300044694 Bacteria 1901
695 Ga0466963_0351380 3300044694 Bacteria 1038
696 Ga0466963_0471545 3300044694 Bacteria 886
697 Ga0466968_0376707 3300044735 Bacteria 693
698 Ga0466970_0007794 3300044765 Bacteria 5372
699 Ga0466970_0063990 3300044765 Bacteria 1972
700 Ga0466970_0109451 3300044765 Bacteria 1508
701 Ga0466957_0008641 3300044842 Bacteria 5798
702 Ga0466957_0055369 3300044842 Bacteria 2424
703 Ga0466957_0058628 3300044842 Bacteria 2359
704 Ga0466957_0137722 3300044842 Bacteria 1570
705 Ga0466960_0126579 3300044901 Bacteria 1343
706 Ga0466959_0001367 3300045049 Bacteria 14894
707 Ga0466959_0007139 3300045049 Bacteria 7818
708 Ga0466959_0015359 3300045049 Bacteria 5576
709 Ga0466959_0070837 3300045049 Bacteria 2525
710 Ga0466958_0012698 3300045836 Bacteria 4776
711 Ga0466958_0014712 3300045836 Bacteria 4469
712 Ga0466958_0028692 3300045836 Bacteria 3300
713 Ga0466958_0051920 3300045836 Bacteria 2484
714 Ga0495617_077854 3300046452 Bacteria 1087
715 Ga0495627_000073 3300046453 Bacteria 123319
716 Ga0495627_001834 3300046453 Bacteria 11297
717 Ga0495627_006045 3300046453 Bacteria 4790
718 Ga0495627_017519 3300046453 Bacteria 2433
719 Ga0495592_0105775 3300046454 Bacteria 1998
720 Ga0495592_0124916 3300046454 Bacteria 1807
721 Ga0495603_0119288 3300046455 Bacteria 1537
722 Ga0495590_0001159 3300046457 Bacteria 11537
723 Ga0495590_0006265 3300046457 Bacteria 4657
724 Ga0495590_0045663 3300046457 Bacteria 1528
725 Ga0495591_001276 3300046458 Bacteria 16086
726 Ga0495591_007032 3300046458 Bacteria 4852
727 Ga0495591_029212 3300046458 Bacteria 1677
728 Ga0495591_050877 3300046458 Bacteria 1132
729 Ga0495629_0000137 3300046459 Bacteria 64048
730 Ga0495629_0000758 3300046459 Bacteria 26094
731 Ga0495629_0004710 3300046459 Bacteria 10227
732 Ga0495629_0075609 3300046459 Bacteria 2352
733 Ga0495638_0045977 3300046460 Bacteria 2744
734 Ga0495638_0063705 3300046460 Bacteria 2272
735 Ga0495638_0110718 3300046460 Bacteria 1631
736 Ga0495638_0253589 3300046460 Bacteria 969
737 Ga0495638_0283298 3300046460 Bacteria 899
738 Ga0495641_0052028 3300046461 Bacteria 1868
739 Ga0495651_0021068 3300046462 Bacteria 5063
740 Ga0495651_0106421 3300046462 Bacteria 2079
741 Ga0495651_0289306 3300046462 Bacteria 1103
742 Ga0495653_0054926 3300046463 Bacteria 3041
743 Ga0495653_0071418 3300046463 Bacteria 2595
744 Ga0495653_0089718 3300046463 Bacteria 2251
745 Ga0495653_0153329 3300046463 Bacteria 1607
746 Ga0495650_0000226 3300046471 Bacteria 115930
747 Ga0495650_0005961 3300046471 Bacteria 7727
748 Ga0495650_0013190 3300046471 Bacteria 4388
749 Ga0495650_0027642 3300046471 Bacteria 2617
750 Ga0495650_0064766 3300046471 Bacteria 1452
751 Ga0495650_0068416 3300046471 Bacteria 1401
752 Ga0495580_0000703 3300046472 Bacteria 28614
753 Ga0495580_0010665 3300046472 Bacteria 7138
754 Ga0495580_0016508 3300046472 Bacteria 5538
755 Ga0495580_0049717 3300046472 Bacteria 2966
756 Ga0495580_0064624 3300046472 Bacteria 2565
757 Ga0495580_0078208 3300046472 Bacteria 2307
758 Ga0495580_0118813 3300046472 Bacteria 1835
759 Ga0495580_0360130 3300046472 Bacteria 984
760 Ga0495582_0071388 3300046473 Bacteria 1921
761 Ga0495582_0161717 3300046473 Bacteria 1273
762 Ga0495582_0277826 3300046473 Bacteria 962
763 Ga0495605_0000019 3300046474 Bacteria 270010
764 Ga0495605_0000342 3300046474 Bacteria 45965
765 Ga0495605_0001460 3300046474 Bacteria 15450
766 Ga0495605_0014706 3300046474 Bacteria 4278
767 Ga0495605_0016413 3300046474 Bacteria 4008
768 Ga0495605_0116059 3300046474 Bacteria 1217
769 Ga0495605_0125302 3300046474 Bacteria 1162
770 Ga0495605_0175880 3300046474 Bacteria 943
771 Ga0495664_0007353 3300046477 Bacteria 6116
772 Ga0495664_0107192 3300046477 Bacteria 1685
773 Ga0495664_0225610 3300046477 Bacteria 1134
774 Ga0495584_0001972 3300046491 Bacteria 11805
775 Ga0495584_0017445 3300046491 Bacteria 3655
776 Ga0495584_0246831 3300046491 Bacteria 908
777 Ga0495585_0112494 3300046492 Bacteria 1446
778 Ga0495585_0241404 3300046492 Bacteria 904
779 Ga0495594_0001675 3300046499 Bacteria 11522
780 Ga0495594_0127206 3300046499 Bacteria 1442
781 Ga0495596_0002590 3300046500 Bacteria 9610
782 Ga0495596_0048064 3300046500 Bacteria 1673
783 Ga0495596_0153768 3300046500 Bacteria 893
784 Ga0495596_0158162 3300046500 Bacteria 880
785 Ga0495607_0000773 3300046501 Bacteria 30620
786 Ga0495607_0001163 3300046501 Bacteria 23816
787 Ga0495607_0002362 3300046501 Bacteria 15412
788 Ga0495607_0005030 3300046501 Bacteria 9587
789 Ga0495607_0030889 3300046501 Bacteria 3283
790 Ga0495607_0032490 3300046501 Bacteria 3185
791 Ga0495607_0043713 3300046501 Bacteria 2647
792 Ga0495607_0052720 3300046501 Bacteria 2354
793 Ga0495607_0077872 3300046501 Bacteria 1830
794 Ga0495607_0104069 3300046501 Bacteria 1515
795 Ga0495607_0164793 3300046501 Bacteria 1123
796 Ga0495607_0244881 3300046501 Bacteria 865
797 Ga0495583_0000097 3300046506 Bacteria 149533
798 Ga0495583_0002802 3300046506 Bacteria 14305
799 Ga0495583_0010285 3300046506 Bacteria 5474
800 Ga0495583_0030641 3300046506 Bacteria 2616
801 Ga0495606_0000066 3300046507 Bacteria 181028
802 Ga0495606_0000862 3300046507 Bacteria 45436
803 Ga0495606_0017374 3300046507 Bacteria 5440
804 Ga0495606_0025160 3300046507 Bacteria 4270
805 Ga0495606_0025587 3300046507 Bacteria 4222
806 Ga0495606_0031661 3300046507 Bacteria 3673
807 Ga0495606_0033155 3300046507 Bacteria 3566
808 Ga0495606_0129780 3300046507 Bacteria 1499
809 Ga0495606_0160261 3300046507 Bacteria 1313
810 Ga0495606_0200446 3300046507 Bacteria 1138
811 Ga0495606_0388850 3300046507 Bacteria 730
812 Ga0495610_0000745 3300046512 Bacteria 30877
813 Ga0495610_0005941 3300046512 Bacteria 8548
814 Ga0495610_0008139 3300046512 Bacteria 6847
815 Ga0495610_0034706 3300046512 Bacteria 2595
816 Ga0495610_0135980 3300046512 Bacteria 1062
817 Ga0495616_0016126 3300046513 Bacteria 4140
818 Ga0495616_0027863 3300046513 Bacteria 2995
819 Ga0495616_0058525 3300046513 Bacteria 1897
820 Ga0495616_0166841 3300046513 Bacteria 987
821 Ga0495616_0211290 3300046513 Bacteria 848
822 Ga0495618_0012697 3300046514 Bacteria 5119
823 Ga0495618_0176056 3300046514 Bacteria 1360
824 Ga0495618_0212213 3300046514 Bacteria 1223
825 Ga0495620_0000199 3300046515 Bacteria 46081
826 Ga0495620_0012809 3300046515 Bacteria 4313
827 Ga0495620_0060575 3300046515 Bacteria 1577
828 Ga0495620_0061141 3300046515 Bacteria 1568
829 Ga0495620_0105447 3300046515 Bacteria 1120
830 Ga0495628_0006690 3300046516 Bacteria 10051
831 Ga0495628_0077898 3300046516 Bacteria 2578
832 Ga0495630_0006496 3300046517 Bacteria 8324
833 Ga0495630_0075178 3300046517 Bacteria 2545
834 Ga0495630_0143959 3300046517 Bacteria 1812
835 Ga0495630_0174489 3300046517 Bacteria 1638
836 Ga0495631_0002478 3300046518 Bacteria 10389
837 Ga0495632_0011402 3300046519 Bacteria 5187
838 Ga0495632_0059407 3300046519 Bacteria 1860
839 Ga0495632_0122816 3300046519 Bacteria 1212
840 Ga0495637_0000695 3300046520 Bacteria 23132
841 Ga0495637_0018892 3300046520 Bacteria 3192
842 Ga0495637_0033292 3300046520 Bacteria 2264
843 Ga0495637_0089247 3300046520 Bacteria 1218
844 Ga0495637_0140378 3300046520 Bacteria 917
845 Ga0495643_0000778 3300046522 Bacteria 35560
846 Ga0495643_0011876 3300046522 Bacteria 5279
847 Ga0495643_0086585 3300046522 Bacteria 1622
848 Ga0495644_0001886 3300046523 Bacteria 8443
849 Ga0495644_0043389 3300046523 Bacteria 1692
850 Ga0495648_0023932 3300046524 Bacteria 4170
851 Ga0495648_0087115 3300046524 Bacteria 1759
852 Ga0495648_0099040 3300046524 Bacteria 1613
853 Ga0495648_0135471 3300046524 Bacteria 1303
854 Ga0495648_0143350 3300046524 Bacteria 1254
855 Ga0495648_0169697 3300046524 Bacteria 1119
856 Ga0495648_0229511 3300046524 Bacteria 910
857 Ga0495648_0281437 3300046524 Bacteria 788
858 Ga0495666_0046001 3300046526 Bacteria 2105
859 Ga0495666_0065631 3300046526 Bacteria 1731
860 Ga0495666_0096618 3300046526 Bacteria 1392
861 Ga0495666_0157182 3300046526 Bacteria 1055
862 Ga0495642_0105743 3300046528 Bacteria 1201
863 Ga0495652_0013748 3300046529 Bacteria 7283
864 Ga0495652_0077639 3300046529 Bacteria 2751
865 Ga0495652_0104805 3300046529 Bacteria 2286
866 Ga0495652_0308066 3300046529 Bacteria 1148
867 Ga0495652_0319584 3300046529 Bacteria 1122
868 Ga0495654_0002890 3300046530 Bacteria 10774
869 Ga0495654_0020248 3300046530 Bacteria 3469
870 Ga0495654_0032212 3300046530 Bacteria 2657
871 Ga0495654_0037996 3300046530 Bacteria 2410
872 Ga0495654_0044327 3300046530 Bacteria 2200
873 Ga0495654_0045050 3300046530 Bacteria 2177
874 Ga0495654_0069121 3300046530 Bacteria 1677
875 Ga0495654_0070608 3300046530 Bacteria 1656
876 Ga0495654_0128819 3300046530 Bacteria 1138
877 Ga0495654_0229886 3300046530 Bacteria 780
878 Ga0495665_0001219 3300046531 Bacteria 13732
879 Ga0495665_0002867 3300046531 Bacteria 9321
880 Ga0495665_0012093 3300046531 Bacteria 4672
881 Ga0495665_0057582 3300046531 Bacteria 2051
882 Ga0495665_0103915 3300046531 Bacteria 1490
883 Ga0495665_0225210 3300046531 Bacteria 969
884 Ga0495640_0009812 3300046533 Bacteria 7432
885 Ga0495640_0049346 3300046533 Bacteria 2903
886 Ga0495640_0133440 3300046533 Bacteria 1605
887 Ga0495586_0132326 3300046535 Bacteria 1397
888 Ga0495587_0014233 3300046536 Bacteria 4993
889 Ga0495587_0116857 3300046536 Bacteria 1529
890 Ga0495587_0144163 3300046536 Bacteria 1358
891 Ga0495609_0000057 3300046538 Bacteria 143793
892 Ga0495609_0000076 3300046538 Bacteria 120170
893 Ga0495609_0000223 3300046538 Bacteria 55773
894 Ga0495609_0121495 3300046538 Bacteria 1122
895 Ga0495597_0000202 3300046542 Bacteria 54803
896 Ga0495597_0038812 3300046542 Bacteria 2133
897 Ga0495597_0061070 3300046542 Bacteria 1642
898 Ga0495597_0066881 3300046542 Bacteria 1556
899 Ga0495597_0094157 3300046542 Bacteria 1268
900 Ga0495597_0200856 3300046542 Bacteria 798
901 Ga0495645_0038240 3300046543 Bacteria 3500
902 Ga0495645_0041914 3300046543 Bacteria 3337
903 Ga0495645_0082632 3300046543 Bacteria 2303
904 Ga0495645_0128508 3300046543 Bacteria 1778
905 Ga0495622_0000287 3300046557 Bacteria 38482
906 Ga0495633_0000038 3300046558 Bacteria 182144
907 Ga0495633_0308907 3300046558 Bacteria 718
908 Ga0495667_0095636 3300046559 Bacteria 1923
909 Ga0495668_0023511 3300046616 Bacteria 3512
910 Ga0495634_0096031 3300046642 Bacteria 1919
911 Ga0495634_0155823 3300046642 Bacteria 1442
912 Ga0495634_0191215 3300046642 Bacteria 1276
913 Ga0495611_0004652 3300046648 Bacteria 5898
914 Ga0495611_0034588 3300046648 Bacteria 2234
915 Ga0495611_0204377 3300046648 Bacteria 921
916 Ga0495625_0000027 3300046660 Bacteria 258545
917 Ga0495625_0114311 3300046660 Bacteria 1843
918 Ga0495635_0003260 3300046663 Bacteria 11194
919 Ga0495635_0031526 3300046663 Bacteria 3679
920 Ga0495635_0067239 3300046663 Bacteria 2458
921 Ga0495661_0000027 3300046665 Bacteria 184297
922 Ga0495661_0000174 3300046665 Bacteria 74521
923 Ga0495661_0000605 3300046665 Bacteria 36676
924 Ga0495661_0011245 3300046665 Bacteria 6073
925 Ga0495661_0026657 3300046665 Bacteria 3720
926 Ga0495661_0053064 3300046665 Bacteria 2440
927 Ga0495661_0057156 3300046665 Bacteria 2330
928 Ga0495599_0115987 3300046678 Bacteria 1666
929 Ga0495623_0005611 3300046679 Bacteria 8191
930 Ga0495623_0086152 3300046679 Bacteria 1936
931 Ga0495623_0095211 3300046679 Bacteria 1820
932 Ga0495623_0107684 3300046679 Bacteria 1692
933 Ga0495646_0013419 3300046680 Bacteria 5209
934 Ga0495646_0021175 3300046680 Bacteria 4110
935 Ga0495646_0045895 3300046680 Bacteria 2666
936 Ga0495646_0083368 3300046680 Bacteria 1858
937 Ga0495646_0114856 3300046680 Bacteria 1529
938 Ga0495646_0273778 3300046680 Bacteria 899
939 Ga0495669_0009043 3300046684 Bacteria 4198
940 Ga0495669_0028636 3300046684 Bacteria 2440
941 Ga0495613_0014252 3300046689 Bacteria 5900
942 Ga0495613_0016752 3300046689 Bacteria 5457
943 Ga0495624_0002935 3300046690 Bacteria 12761
944 Ga0495624_0008831 3300046690 Bacteria 7006
945 Ga0495624_0016596 3300046690 Bacteria 4956
946 Ga0495624_0017350 3300046690 Bacteria 4834
947 Ga0495624_0029501 3300046690 Bacteria 3578
948 Ga0495624_0066377 3300046690 Bacteria 2252
949 Ga0495624_0158189 3300046690 Bacteria 1384
950 Ga0495624_0226695 3300046690 Bacteria 1132
951 Ga0495624_0452060 3300046690 Bacteria 770
952 Ga0495670_0007385 3300046691 Bacteria 5401
953 Ga0495670_0028245 3300046691 Bacteria 2781
954 Ga0495670_0045036 3300046691 Bacteria 2202
955 Ga0495671_0009807 3300046692 Bacteria 5333
956 Ga0495671_0014512 3300046692 Bacteria 4238
957 Ga0495671_0024267 3300046692 Bacteria 3159
958 Ga0495671_0105447 3300046692 Bacteria 1376
959 Ga0495671_0118954 3300046692 Bacteria 1289
960 Ga0495649_0004871 3300046694 Bacteria 8674
961 Ga0495649_0028311 3300046694 Bacteria 3105
962 Ga0495649_0033152 3300046694 Bacteria 2842
963 Ga0495649_0037820 3300046694 Bacteria 2648
964 Ga0495649_0106211 3300046694 Bacteria 1490
965 Ga0495649_0170522 3300046694 Bacteria 1139
966 Ga0495649_0217058 3300046694 Bacteria 990
967 Ga0495649_0220327 3300046694 Bacteria 981
968 Ga0495589_0019602 3300046794 Bacteria 3463
969 Ga0495589_0058040 3300046794 Bacteria 1903
970 Ga0495589_0060027 3300046794 Bacteria 1868
971 Ga0495589_0099209 3300046794 Bacteria 1410
972 Ga0495589_0121620 3300046794 Bacteria 1256
973 Ga0495600_0018722 3300046809 Bacteria 4416
974 Ga0495600_0071222 3300046809 Bacteria 2271
975 Ga0495660_0042998 3300046810 Bacteria 2494
976 Ga0495660_0076166 3300046810 Bacteria 1767
977 Ga0495660_0115848 3300046810 Bacteria 1362
978 Ga0495660_0116171 3300046810 Bacteria 1359
979 Ga0495581_0006112 3300047315 Bacteria 6979
980 Ga0495581_0028287 3300047315 Bacteria 3250
981 Ga0495581_0102085 3300047315 Bacteria 1666
982 Ga0495604_0001571 3300047317 Bacteria 18805
983 Ga0495604_0025773 3300047317 Bacteria 4683
984 Ga0495604_0026260 3300047317 Bacteria 4637
985 Ga0495604_0042301 3300047317 Bacteria 3571
986 Ga0495604_0087198 3300047317 Bacteria 2325
987 Ga0495604_0110489 3300047317 Bacteria 2005
988 Ga0495604_0181992 3300047317 Bacteria 1469
989 Ga0495674_0003691 3300047319 Bacteria 14890
990 Ga0495674_0013082 3300047319 Bacteria 7807
991 Ga0495674_0022068 3300047319 Bacteria 5875
992 Ga0495674_0045991 3300047319 Bacteria 3875
993 Ga0495674_0049855 3300047319 Bacteria 3696
994 Ga0495674_0085690 3300047319 Bacteria 2698
995 Ga0495674_0099233 3300047319 Bacteria 2479
996 Ga0495674_0534688 3300047319 Bacteria 934
997 Ga0495672_0001027 3300047320 Bacteria 28668
998 Ga0495672_0004381 3300047320 Bacteria 11594
999 Ga0495672_0023540 3300047320 Bacteria 3985
1000 Ga0495672_0062662 3300047320 Bacteria 2137
1001 Ga0495672_0074855 3300047320 Bacteria 1905
1002 Ga0495672_0175249 3300047320 Bacteria 1090
1003 Ga0495672_0248515 3300047320 Bacteria 864
1004 Ga0495676_0000012 3300047321 Bacteria 230043
1005 Ga0495676_0016588 3300047321 Bacteria 6529
1006 Ga0495676_0083100 3300047321 Bacteria 2421
1007 Ga0495676_0098077 3300047321 Bacteria 2175
1008 Ga0495680_0017847 3300047322 Bacteria 6040
1009 Ga0495680_0062652 3300047322 Bacteria 2859
1010 Ga0495680_0076671 3300047322 Bacteria 2534
1011 Ga0495680_0087042 3300047322 Bacteria 2350
1012 Ga0495680_0188315 3300047322 Bacteria 1485
1013 Ga0495680_0297571 3300047322 Bacteria 1133
1014 Ga0495680_0578524 3300047322 Bacteria 753
1015 Ga0495683_0000032 3300047323 Bacteria 149612
1016 Ga0495683_0000299 3300047323 Bacteria 42246
1017 Ga0495683_0008992 3300047323 Bacteria 5331
1018 Ga0495683_0055362 3300047323 Bacteria 1974
1019 Ga0495683_0090617 3300047323 Bacteria 1481
1020 Ga0495683_0132276 3300047323 Bacteria 1175
1021 Ga0495687_000021 3300047443 Bacteria 334681
1022 Ga0495687_007444 3300047443 Bacteria 6445
1023 Ga0495687_031541 3300047443 Bacteria 2430
1024 Ga0495687_103383 3300047443 Bacteria 1063
1025 Ga0495675_0017368 3300047444 Bacteria 4559
1026 Ga0495675_0046970 3300047444 Bacteria 2748
1027 Ga0495675_0049921 3300047444 Bacteria 2659
1028 Ga0495675_0057153 3300047444 Bacteria 2473
1029 Ga0495675_0114040 3300047444 Bacteria 1685
1030 Ga0495679_000013 3300047446 Bacteria 313222
1031 Ga0495679_000716 3300047446 Bacteria 21459
1032 Ga0495679_000885 3300047446 Bacteria 18761
1033 Ga0495679_005818 3300047446 Bacteria 5423
1034 Ga0495679_009825 3300047446 Bacteria 3798
1035 Ga0495685_043635 3300047447 Bacteria 1530
1036 Ga0495673_0007429 3300047469 Bacteria 6301
1037 Ga0495673_0029989 3300047469 Bacteria 2561
1038 Ga0495673_0033822 3300047469 Bacteria 2368
1039 Ga0495673_0039418 3300047469 Bacteria 2143
1040 Ga0495673_0042121 3300047469 Bacteria 2051
1041 Ga0495673_0068027 3300047469 Bacteria 1506
1042 Ga0495673_0129585 3300047469 Bacteria 992
1043 Ga0495673_0158381 3300047469 Bacteria 870
1044 Ga0495681_0011056 3300047470 Bacteria 5411
1045 Ga0495681_0015894 3300047470 Bacteria 4246
1046 Ga0495681_0019129 3300047470 Bacteria 3748
1047 Ga0495681_0044276 3300047470 Bacteria 2140
1048 Ga0495681_0158050 3300047470 Bacteria 946
1049 Ga0495684_0013909 3300047471 Bacteria 6190
1050 Ga0495684_0240650 3300047471 Bacteria 1320
1051 Ga0495684_0485152 3300047471 Bacteria 853
1052 Ga0495686_0000081 3300047472 Bacteria 201295
1053 Ga0495686_0091173 3300047472 Bacteria 1850
1054 Ga0495593_0005939 3300047673 Bacteria 7193
1055 Ga0495593_0008969 3300047673 Bacteria 5805
1056 Ga0495593_0019987 3300047673 Bacteria 3750
1057 Ga0495593_0026977 3300047673 Bacteria 3165
1058 Ga0495593_0046642 3300047673 Bacteria 2307
1059 Ga0495602_0042153 3300048088 Bacteria 4161
1060 Ga0495602_0045768 3300048088 Bacteria 3957
1061 Ga0495602_0089662 3300048088 Bacteria 2556
1062 Ga0495602_0099043 3300048088 Bacteria 2397
1063 Ga0495602_0231121 3300048088 Bacteria 1389
1064 Ga0495602_0552112 3300048088 Bacteria 798
1065 Ga0495614_0010574 3300048089 Bacteria 4069
1066 Ga0495614_0028617 3300048089 Bacteria 2399
1067 Ga0495614_0040887 3300048089 Bacteria 1989
1068 Ga0495626_0000545 3300048091 Bacteria 37397
1069 Ga0495626_0012629 3300048091 Bacteria 4417
1070 Ga0495626_0080088 3300048091 Bacteria 1452
1071 Ga0495626_0150132 3300048091 Bacteria 983
1072 Ga0496100_0195637 3300048903 Bacteria 1470
1073 Ga0496100_0205631 3300048903 Bacteria 1437
1074 Ga0496100_0373084 3300048903 Bacteria 1082
1075 Ga0496101_0005318 3300048904 Bacteria 8197
1076 Ga0496101_0005742 3300048904 Bacteria 7927
1077 Ga0496101_0007002 3300048904 Bacteria 7282
1078 Ga0496101_0312314 3300048904 Bacteria 1232
1079 Ga0496102_0001948 3300048905 Bacteria 17797
1080 Ga0496102_0012587 3300048905 Bacteria 7328
1081 Ga0496102_0017272 3300048905 Bacteria 6320
1082 Ga0496102_0169031 3300048905 Bacteria 2058
1083 Ga0496102_0402081 3300048905 Bacteria 1287
1084 Ga0496102_0528365 3300048905 Bacteria 1102
1085 Ga0496102_0581042 3300048905 Bacteria 1043
1086 Ga0496102_0956540 3300048905 Bacteria 777
1087 Ga0496103_0102895 3300048906 Bacteria 1809
1088 Ga0496103_0602814 3300048906 Bacteria 699
1089 Ga0496104_0172798 3300048907 Bacteria 2071
1090 Ga0496104_0372972 3300048907 Bacteria 1339
1091 Ga0496104_0446361 3300048907 Bacteria 1205
1092 Ga0496105_0075444 3300048908 Bacteria 2784
1093 Ga0496105_0214924 3300048908 Bacteria 1566
1094 Ga0496105_0583387 3300048908 Bacteria 869
1095 Ga0496106_0009549 3300048909 Bacteria 7165
1096 Ga0496106_0205462 3300048909 Bacteria 1568
1097 Ga0496107_0114849 3300048910 Bacteria 1981
1098 Ga0496107_0850547 3300048910 Bacteria 666
1099 Ga0496108_0036849 3300048911 Bacteria 4071
1100 Ga0496109_1290545 3300048912 Bacteria 666
1101 Ga0496110_0210860 3300048913 Bacteria 1766
1102 Ga0496110_0360478 3300048913 Bacteria 1325
1103 Ga0496110_0629122 3300048913 Bacteria 972
1104 Ga0496110_0993246 3300048913 Bacteria 747
1105 Ga0496111_0123848 3300048914 Bacteria 1910
1106 Ga0496111_0298479 3300048914 Bacteria 1194
1107 Ga0496112_0016884 3300048915 Bacteria 6849
1108 Ga0496112_0017729 3300048915 Bacteria 6701
1109 Ga0496112_0157336 3300048915 Bacteria 2239
1110 Ga0496113_0142375 3300048916 Bacteria 1887
1111 Ga0496113_0347556 3300048916 Bacteria 1189
1112 Ga0496114_0012267 3300048917 Bacteria 6858
1113 Ga0496114_0801884 3300048917 Bacteria 820
1114 Ga0496115_0114478 3300048918 Bacteria 2217
1115 Ga0496115_0215959 3300048918 Bacteria 1583
1116 Ga0496116_0000698 3300048919 Bacteria 43460
1117 Ga0496116_0001275 3300048919 Bacteria 28966
1118 Ga0496116_0008789 3300048919 Bacteria 8712
1119 Ga0496116_0017048 3300048919 Bacteria 5657
1120 Ga0496116_0034617 3300048919 Bacteria 3561
1121 Ga0496116_0057918 3300048919 Bacteria 2529
1122 Ga0496117_0003200 3300048920 Bacteria 19382
1123 Ga0496117_0003808 3300048920 Bacteria 17184
1124 Ga0496117_0003944 3300048920 Bacteria 16784
1125 Ga0496117_0010066 3300048920 Bacteria 8686
1126 Ga0496117_0015912 3300048920 Bacteria 6373
1127 Ga0496117_0086561 3300048920 Bacteria 2035
1128 Ga0496117_0133523 3300048920 Bacteria 1499
1129 Ga0496117_0191463 3300048920 Bacteria 1164
1130 Ga0496118_0001751 3300048921 Bacteria 31501
1131 Ga0496118_0004406 3300048921 Bacteria 16720
1132 Ga0496118_0022028 3300048921 Bacteria 5587
1133 Ga0496118_0044323 3300048921 Bacteria 3484
1134 Ga0496118_0045495 3300048921 Bacteria 3425
1135 Ga0496118_0074998 3300048921 Bacteria 2415
1136 Ga0496118_0139088 3300048921 Bacteria 1543
1137 Ga0496118_0199193 3300048921 Bacteria 1188
1138 Ga0496118_0201452 3300048921 Bacteria 1178
1139 Ga0496118_0261770 3300048921 Bacteria 975
1140 Ga0496118_0268957 3300048921 Bacteria 956
1141 Ga0496118_0318146 3300048921 Bacteria 846
1142 Ga0496119_0000071 3300048922 Bacteria 153652
1143 Ga0496119_0128710 3300048922 Bacteria 1382
1144 Ga0496120_0000126 3300048923 Bacteria 128689
1145 Ga0496120_0290367 3300048923 Bacteria 753
1146 Ga0496121_0001129 3300048924 Bacteria 46851
1147 Ga0496121_0003930 3300048924 Bacteria 20584
1148 Ga0496121_0005413 3300048924 Bacteria 16389
1149 Ga0496121_0005701 3300048924 Bacteria 15822
1150 Ga0496121_0023755 3300048924 Bacteria 5890
1151 Ga0496121_0025167 3300048924 Bacteria 5661
1152 Ga0496121_0032774 3300048924 Bacteria 4715
1153 Ga0496121_0045649 3300048924 Bacteria 3762
1154 Ga0496121_0084888 3300048924 Bacteria 2494
1155 Ga0496121_0159913 3300048924 Bacteria 1648
1156 Ga0496122_0000370 3300048925 Bacteria 96422
1157 Ga0496122_0004026 3300048925 Bacteria 18685
1158 Ga0496122_0031791 3300048925 Bacteria 4381
1159 Ga0496122_0076528 3300048925 Bacteria 2354
1160 Ga0496122_0106778 3300048925 Bacteria 1852
1161 Ga0496122_0133830 3300048925 Bacteria 1568
1162 Ga0496123_0000135 3300048926 Bacteria 153056
1163 Ga0496123_0012095 3300048926 Bacteria 7398
1164 Ga0496123_0013389 3300048926 Bacteria 6890
1165 Ga0496123_0056125 3300048926 Bacteria 2577
1166 Ga0496123_0141072 3300048926 Bacteria 1317
1167 Ga0496123_0141790 3300048926 Bacteria 1312
1168 Ga0496123_0227234 3300048926 Bacteria 937
1169 Ga0496123_0257552 3300048926 Bacteria 857
1170 Ga0496124_0000144 3300048927 Bacteria 146921
1171 Ga0496124_0000967 3300048927 Bacteria 45780
1172 Ga0496124_0003720 3300048927 Bacteria 18402
1173 Ga0496124_0066416 3300048927 Bacteria 3003
1174 Ga0496124_0237306 3300048927 Bacteria 1358
1175 Ga0496124_0300726 3300048927 Bacteria 1159
1176 Ga0496124_0465688 3300048927 Bacteria 857
1177 Ga0496124_0492305 3300048927 Bacteria 824
1178 Ga0496125_0018061 3300048928 Bacteria 6704
1179 Ga0496125_0097534 3300048928 Bacteria 2178
1180 Ga0496125_0148816 3300048928 Bacteria 1613
1181 Ga0496125_0192152 3300048928 Bacteria 1347
1182 Ga0496125_0287061 3300048928 Bacteria 1015
1183 Ga0496125_0325484 3300048928 Bacteria 929
1184 Ga0496125_0426440 3300048928 Bacteria 767
1185 Ga0496126_0004750 3300048929 Bacteria 16019
1186 Ga0496126_0154013 3300048929 Bacteria 1968
1187 Ga0496126_0155464 3300048929 Bacteria 1957
1188 Ga0496126_0240172 3300048929 Bacteria 1514
1189 Ga0496126_0617030 3300048929 Bacteria 852
1190 Ga0496126_0975102 3300048929 Bacteria 638
1191 Ga0495678_000046 3300049459 Bacteria 171703
1192 Ga0495678_005322 3300049459 Bacteria 7140
1193 Ga0495678_009603 3300049459 Bacteria 4770
1194 Ga0495678_027079 3300049459 Bacteria 2437
1195 Ga0495678_054133 3300049459 Bacteria 1537
1196 Ga0495682_0004456 3300049460 Bacteria 5987
1197 Ga0495682_0027727 3300049460 Bacteria 2100
1198 Ga0495682_0030129 3300049460 Bacteria 2008
1199 Ga0495682_0038206 3300049460 Bacteria 1764
1200 Ga0501313_028712 3300049529 Bacteria 714
1201 Ga0501034_0151855 3300049571 Bacteria 2291
1202 Ga0501034_0453220 3300049571 Bacteria 1200
1203 Ga0501037_0287122 3300049573 Bacteria 1145
1204 Ga0501038_0114085 3300049574 Bacteria 2235
1205 Ga0501038_0405531 3300049574 Bacteria 1054
1206 Ga0501039_0298363 3300049575 Bacteria 1267
1207 Ga0501043_0020100 3300049579 Bacteria 5242
1208 Ga0501206_051819 3300049653 Bacteria 655
1209 Ga0501207_045306 3300049654 Bacteria 774
1210 Ga0501230_020237 3300049667 Bacteria 1155
1211 Ga0501241_011072 3300049758 Bacteria 1638
1212 Ga0501035_0009489 3300049822 Bacteria 9048
1213 Ga0501044_0025028 3300049823 Bacteria 6329
1214 Ga0500573_0450659 3300053140 Bacteria 595
1215 Ga0500634_0167092 3300053161 Bacteria 1007
1216 Ga0587084_007755 3300059477 Bacteria 1342
1217 Ga0587084_019179 3300059477 Bacteria 1005
1218 Ga0587070_018743 3300059491 Bacteria 1138
1219 Ga0587070_071260 3300059491 Bacteria 742
1220 Ga0587080_038036 3300059503 Bacteria 866
1221 Ga0587080_082992 3300059503 Bacteria 661
1222 Ga0587080_086051 3300059503 Bacteria 653
1223 Ga0587083_0001420 3300059505 Bacteria 2682
1224 Ga0587083_0017588 3300059505 Bacteria 1281
1225 Ga0587083_0023874 3300059505 Bacteria 1158
1226 Ga0587083_0058859 3300059505 Bacteria 860
1227 Ga0587090_012317 3300059510 Bacteria 1218
1228 Ga0587091_016901 3300059511 Bacteria 1222
1229 Ga0587091_021107 3300059511 Bacteria 1137
1230 Ga0587091_088330 3300059511 Bacteria 708
1231 Ga0587094_008973 3300059513 Bacteria 1265
1232 Ga0587098_001525 3300059604 Bacteria 1794
1233 Ga0587098_003070 3300059604 Bacteria 1472
1234 Ga0587098_019425 3300059604 Bacteria 850
1235 Ga0587106_047238 3300059605 Bacteria 752
1236 Ga0587106_075140 3300059605 Bacteria 648
1237 Ga0587101_049214 3300059623 Bacteria 721
1238 Ga0587128_013884 3300059630 Bacteria 1144
1239 Ga0587067_000513 3300059640 Bacteria 3439
1240 Ga0587068_001003 3300059641 Bacteria 2977
1241 Ga0587068_012163 3300059641 Bacteria 1310
1242 Ga0587068_014583 3300059641 Bacteria 1226
1243 Ga0587069_031196 3300059642 Bacteria 862
1244 Ga0587069_032831 3300059642 Bacteria 849
1245 Ga0587072_000076 3300059643 Bacteria 7309
1246 Ga0587072_065694 3300059643 Bacteria 756
1247 Ga0587076_028924 3300059645 Bacteria 970
1248 Ga0587079_011606 3300059647 Bacteria 1423
1249 Ga0587079_064212 3300059647 Bacteria 803
1250 Ga0587079_068725 3300059647 Bacteria 785
1251 Ga0587100_021036 3300059648 Bacteria 637
1252 Ga0587102_002046 3300059649 Bacteria 1512
1253 Ga0587102_021193 3300059649 Bacteria 735
1254 Ga0587105_000215 3300059651 Bacteria 2067
1255 Ga0587124_014557 3300059660 Bacteria 750
1256 Ga0587071_009901 3300060344 Bacteria 1580
1257 Ga0587071_033121 3300060344 Bacteria 1005
1258 Ga0587071_039358 3300060344 Bacteria 942
1259 Ga0587071_075072 3300060344 Bacteria 743
1260 Ga0587111_0008531 3300060346 Bacteria 1702
1261 Ga0587111_0068425 3300060346 Bacteria 823
1262 Ga0466962_0002106 3300061719 Bacteria 9409
1263 Ga0466962_0003684 3300061719 Bacteria 7303
1264 Ga0466962_0009729 3300061719 Bacteria 4612
1265 Ga0466962_0153874 3300061719 Bacteria 1116
1266 Ga0466962_0316164 3300061719 Bacteria 774

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300048913 Ga0496110_0993246 Ga0496110_0993246_13_465 148
2 3300028794 Ga0307515_10040414 Ga0307515_100404144 151
3 3300003316 rootH1_10070082 rootH1_100700822 154
4 3300013250 Ga0171462_1021 Ga0171462_10219 158
5 iso_pu_bacteria 2945916053 2945917124 164
6 iso_pu_bacteria 2928157003 2928158001 165
7 iso_pu_bacteria 2928163908 2928165776 165
8 iso_pu_bacteria 2981990288 2981991032 165
9 iso_pu_bacteria 641736154 642414249 165
10 3300010375 Ga0105239_10047907 Ga0105239_100479072 166
11 3300048923 Ga0496120_0290367 Ga0496120_0290367_98_616 166
12 iso_pu_bacteria 2818991436 2819544286 166
13 iso_pu_bacteria 2843690924 2843692465 166
14 3300005719 Ga0068861_100016273 Ga0068861_1000162732 167
15 3300014326 Ga0157380_10001066 Ga0157380_100010663 167
16 3300026118 Ga0207675_100057916 Ga0207675_1000579162 167
17 3300048905 Ga0496102_0581042 Ga0496102_0581042_250_780 167
18 iso_pu_bacteria 2501025501 2501069943 167
19 iso_pu_bacteria 2501025504 2501412069 167
20 iso_pu_bacteria 2508501125 2509127725 167
21 iso_pu_bacteria 2510065045 2510249401 167
22 iso_pu_bacteria 2510917014 2511101063 167
23 iso_pu_bacteria 2510917015 2511107193 167
24 iso_pu_bacteria 2512047030 2512349285 167
25 iso_pu_bacteria 2512047030 2512350671 167
26 iso_pu_bacteria 2513237082 2513555172 167
27 iso_pu_bacteria 2513237083 2513566143 167
28 iso_pu_bacteria 2513237151 2513962913 167
29 iso_pu_bacteria 2513237165 2514045208 167
30 iso_pu_bacteria 2513237166 2514052737 167
31 iso_pu_bacteria 2515154122 2515682829 167
32 iso_pu_bacteria 2515154123 2515692268 167
33 iso_pu_bacteria 2515154189 2516021961 167
34 iso_pu_bacteria 2519103095 2519460328 167
35 iso_pu_bacteria 2526164713 2527076401 167
36 iso_pu_bacteria 2562617112 2563057242 167
37 iso_pu_bacteria 2582581311 2585292633 167
38 iso_pu_bacteria 2599185178 2599448563 167
39 iso_pu_bacteria 2599185239 2599741299 167
40 iso_pu_bacteria 2599185240 2599747289 167
41 iso_pu_bacteria 2599185355 2600209086 167
42 iso_pu_bacteria 2600255067 2600813396 167
43 iso_pu_bacteria 2675903129 2676745114 167
44 iso_pu_bacteria 2711768613 2713474064 167
45 iso_pu_bacteria 2718217991 2719642192 167
46 iso_pu_bacteria 2738541296 2738824177 167
47 iso_pu_bacteria 2738541298 2738836948 167
48 iso_pu_bacteria 2738541306 2738878479 167
49 iso_pu_bacteria 2738543002 2739190147 167
50 iso_pu_bacteria 2738543008 2739225072 167
51 iso_pu_bacteria 2744054900 2746084744 167
52 iso_pu_bacteria 2744054901 2746093087 167
53 iso_pu_bacteria 2751185846 2753570488 167
54 iso_pu_bacteria 2791355137 2792835472 167
55 iso_pu_bacteria 2808606384 2808972510 167
56 iso_pu_bacteria 2808606390 2809007497 167
57 iso_pu_bacteria 2808606391 2809014477 167
58 iso_pu_bacteria 2816332253 2817257879 167
59 iso_pu_bacteria 2816332256 2817281730 167
60 iso_pu_bacteria 2816332286 2817456015 167
61 iso_pu_bacteria 2818991450 2819622428 167
62 iso_pu_bacteria 2818991452 2819635221 167
63 iso_pu_bacteria 2842324504 2842332518 167
64 iso_pu_bacteria 2842348783 2842356921 167
65 iso_pu_bacteria 2842454564 2842461385 167
66 iso_pu_bacteria 2856287931 2856289820 167
67 iso_pu_bacteria 2857357740 2857363140 167
68 iso_pu_bacteria 2858688981 2858697552 167
69 iso_pu_bacteria 2863421361 2863424367 167
70 iso_pu_bacteria 2870068957 2870073538 167
71 iso_pu_bacteria 2883087390 2883089279 167
72 iso_pu_bacteria 2885270888 2885275281 167
73 iso_pu_bacteria 2900634093 2900641055 167
74 iso_pu_bacteria 2901300506 2901309056 167
75 iso_pu_bacteria 2902682994 2902684360 167
76 iso_pu_bacteria 2904483920 2904485784 167
77 iso_pu_bacteria 2904564687 2904567533 167
78 iso_pu_bacteria 2904571731 2904574578 167
79 iso_pu_bacteria 2904615490 2904617635 167
80 iso_pu_bacteria 2919527303 2919532566 167
81 iso_pu_bacteria 2921643360 2921653916 167
82 iso_pu_bacteria 2928108538 2928111853 167
83 iso_pu_bacteria 2928135762 2928139092 167
84 iso_pu_bacteria 2928157003 2928158377 167
85 iso_pu_bacteria 2928163908 2928167413 167
86 iso_pu_bacteria 2928170801 2928177042 167
87 iso_pu_bacteria 2928503688 2928508790 167
88 iso_pu_bacteria 2928536128 2928540306 167
89 iso_pu_bacteria 2939669807 2939671977 167
90 iso_pu_bacteria 2945934425 2945939272 167
91 iso_pu_bacteria 2981990288 2981991840 167
92 iso_pu_bacteria 2990703756 2990706611 167
93 iso_pu_bacteria 641736151 642426487 167
94 iso_pu_bacteria 641736154 642414207 167
95 iso_pu_bacteria 642555112 642595091 167
96 iso_pu_bacteria 642555113 642616156 167
97 iso_pu_bacteria 8003955200 8003959139 167
98 iso_pu_bacteria 8018845410 8018850236 167
99 iso_pu_bacteria 8020807995 8020812223 167
100 iso_pu_bacteria 8020938398 8020941187 167
101 iso_pu_bacteria 8020945358 8020946706 167
102 iso_pu_bacteria 8020953355 8020958321 167
103 iso_pu_bacteria 8021120328 8021123898 167
104 iso_pu_bacteria 8039098773 8039100365 167
105 iso_pu_bacteria 8040167225 8040170742 167
106 iso_pu_bacteria 8040173305 8040176947 167
107 iso_pu_bacteria 8055266321 8055272679 167
108 iso_pu_bacteria 8055301274 8055306583 167
109 3300001979 JGI24740J21852_10025467 JGI24740J21852_100254673 169
110 3300001989 JGI24739J22299_10002580 JGI24739J22299_100025807 169
111 3300005563 Ga0068855_101102753 Ga0068855_1011027532 169
112 3300009551 Ga0105238_10423733 Ga0105238_104237332 169
113 3300013104 Ga0157370_11275780 Ga0157370_112757802 169
114 3300015265 Ga0182005_1001429 Ga0182005_100142911 169
115 3300025949 Ga0207667_10003560 Ga0207667_100035602 169
116 3300044842 Ga0466957_0008641 Ga0466957_0008641_1451_1975 169
117 3300048903 Ga0496100_0373084 Ga0496100_0373084_510_1034 169
118 3300048907 Ga0496104_0172798 Ga0496104_0172798_109_633 169
119 3300048908 Ga0496105_0214924 Ga0496105_0214924_924_1448 169
120 3300048915 Ga0496112_0017729 Ga0496112_0017729_1458_1982 169
121 3300048919 Ga0496116_0008789 Ga0496116_0008789_7994_8518 169
122 3300048921 Ga0496118_0045495 Ga0496118_0045495_2431_2955 169
123 3300048921 Ga0496118_0201452 Ga0496118_0201452_526_1050 169
124 3300048921 Ga0496118_0268957 Ga0496118_0268957_102_626 169
125 3300048925 Ga0496122_0076528 Ga0496122_0076528_745_1269 169
126 3300048926 Ga0496123_0056125 Ga0496123_0056125_236_760 169
127 iso_pu_bacteria 2513237087 2513591651 169
128 iso_pu_bacteria 2917699015 2917703657 169
129 3300005327 Ga0070658_10048516 Ga0070658_100485162 170
130 3300005339 Ga0070660_100067883 Ga0070660_1000678832 170
131 3300005366 Ga0070659_100273629 Ga0070659_1002736292 170
132 3300005367 Ga0070667_100914291 Ga0070667_1009142912 170
133 3300005616 Ga0068852_100081937 Ga0068852_1000819373 170
134 3300006058 Ga0075432_10021103 Ga0075432_100211032 170
135 3300011119 Ga0105246_10278998 Ga0105246_102789982 170
136 3300013296 Ga0157374_10080599 Ga0157374_100805993 170
137 3300015261 Ga0182006_1009036 Ga0182006_10090362 170
138 3300015262 Ga0182007_10003364 Ga0182007_100033642 170
139 3300015265 Ga0182005_1000509 Ga0182005_10005093 170
140 3300025909 Ga0207705_10052350 Ga0207705_100523503 170
141 3300025919 Ga0207657_10010571 Ga0207657_100105713 170
142 3300025920 Ga0207649_10139362 Ga0207649_101393622 170
143 3300025945 Ga0207679_10194351 Ga0207679_101943512 170
144 3300037312 Ga0395899_0105700 Ga0395899_0105700_1379_1897 170
145 3300037312 Ga0395899_0213408 Ga0395899_0213408_708_1238 170
146 3300037418 Ga0395900_0001922 Ga0395900_0001922_20749_21267 170
147 3300037418 Ga0395900_0096528 Ga0395900_0096528_164_694 170
148 3300037418 Ga0395900_0276234 Ga0395900_0276234_1057_1575 170
149 3300037471 Ga0395905_0000144 Ga0395905_0000144_62094_62612 170
150 3300037471 Ga0395905_0322946 Ga0395905_0322946_485_1003 170
151 3300037471 Ga0395905_0437125 Ga0395905_0437125_64_582 170
152 3300037471 Ga0395905_0571803 Ga0395905_0571803_221_739 170
153 3300038443 Ga0395901_0422100 Ga0395901_0422100_650_1168 170
154 3300038443 Ga0395901_0914402 Ga0395901_0914402_75_593 170
155 3300038443 Ga0395901_1029648 Ga0395901_1029648_47_565 170
156 3300038443 Ga0395901_1243653 Ga0395901_1243653_60_578 170
157 3300042008 Ga0439450_018690 Ga0439450_018690_519_1037 170
158 3300042012 Ga0439455_0085699 Ga0439455_0085699_220_738 170
159 3300042157 Ga0439458_0013096 Ga0439458_0013096_43_561 170
160 3300044656 Ga0466969_0004304 Ga0466969_0004304_3663_4205 170
161 3300044694 Ga0466963_0471545 Ga0466963_0471545_231_764 170
162 3300046462 Ga0495651_0106421 Ga0495651_0106421_1520_2044 170
163 3300046471 Ga0495650_0000226 Ga0495650_0000226_31278_31796 170
164 3300046507 Ga0495606_0000066 Ga0495606_0000066_41231_41749 170
165 3300046524 Ga0495648_0135471 Ga0495648_0135471_654_1172 170
166 3300046529 Ga0495652_0104805 Ga0495652_0104805_888_1412 170
167 3300046543 Ga0495645_0038240 Ga0495645_0038240_2871_3395 170
168 3300046558 Ga0495633_0308907 Ga0495633_0308907_83_601 170
169 3300046680 Ga0495646_0013419 Ga0495646_0013419_708_1232 170
170 3300046680 Ga0495646_0273778 Ga0495646_0273778_39_563 170
171 3300046690 Ga0495624_0452060 Ga0495624_0452060_165_689 170
172 3300048088 Ga0495602_0552112 Ga0495602_0552112_70_594 170
173 3300048905 Ga0496102_0017272 Ga0496102_0017272_4455_4973 170
174 3300048905 Ga0496102_0528365 Ga0496102_0528365_344_862 170
175 3300048906 Ga0496103_0102895 Ga0496103_0102895_1080_1598 170
176 3300048910 Ga0496107_0850547 Ga0496107_0850547_40_558 170
177 3300048914 Ga0496111_0298479 Ga0496111_0298479_482_1000 170
178 3300048928 Ga0496125_0148816 Ga0496125_0148816_826_1344 170
179 3300049529 Ga0501313_028712 Ga0501313_028712_136_654 170
180 3300049573 Ga0501037_0287122 Ga0501037_0287122_70_591 170
181 3300049574 Ga0501038_0114085 Ga0501038_0114085_655_1176 170
182 3300049579 Ga0501043_0020100 Ga0501043_0020100_4288_4809 170
183 3300049653 Ga0501206_051819 Ga0501206_051819_81_599 170
184 3300049654 Ga0501207_045306 Ga0501207_045306_61_579 170
185 3300049667 Ga0501230_020237 Ga0501230_020237_250_768 170
186 3300049822 Ga0501035_0009489 Ga0501035_0009489_1961_2482 170
187 3300049823 Ga0501044_0025028 Ga0501044_0025028_5561_6082 170
188 3300053140 Ga0500573_0450659 Ga0500573_0450659_23_547 170
189 3300059503 Ga0587080_086051 Ga0587080_086051_72_590 170
190 3300059505 Ga0587083_0023874 Ga0587083_0023874_205_723 170
191 3300059604 Ga0587098_001525 Ga0587098_001525_1186_1704 170
192 3300001904 JGI24736J21556_1004411 JGI24736J21556_10044112 171
193 3300001915 JGI24741J21665_1013051 JGI24741J21665_10130512 171
194 3300001979 JGI24740J21852_10000031 JGI24740J21852_1000003123 171
195 3300001979 JGI24740J21852_10000396 JGI24740J21852_100003963 171
196 3300001979 JGI24740J21852_10006262 JGI24740J21852_100062623 171
197 3300001989 JGI24739J22299_10001631 JGI24739J22299_100016315 171
198 3300001989 JGI24739J22299_10006601 JGI24739J22299_100066012 171
199 3300001989 JGI24739J22299_10065571 JGI24739J22299_100655711 171
200 3300001990 JGI24737J22298_10007728 JGI24737J22298_100077283 171
201 3300001990 JGI24737J22298_10029982 JGI24737J22298_100299822 171
202 3300001990 JGI24737J22298_10045959 JGI24737J22298_100459592 171
203 3300002067 JGI24735J21928_10000955 JGI24735J21928_100009558 171
204 3300002067 JGI24735J21928_10001973 JGI24735J21928_100019733 171
205 3300002067 JGI24735J21928_10011294 JGI24735J21928_100112941 171
206 3300002067 JGI24735J21928_10013510 JGI24735J21928_100135103 171
207 3300002067 JGI24735J21928_10023445 JGI24735J21928_100234452 171
208 3300002067 JGI24735J21928_10036373 JGI24735J21928_100363732 171
209 3300002075 JGI24738J21930_10011550 JGI24738J21930_100115502 171
210 3300002705 JGI25156J39149_1000366 JGI25156J39149_10003664 171
211 3300002705 JGI25156J39149_1000389 JGI25156J39149_100038921 171
212 3300002705 JGI25156J39149_1000562 JGI25156J39149_10005626 171
213 3300002705 JGI25156J39149_1002605 JGI25156J39149_10026052 171
214 3300002705 JGI25156J39149_1007380 JGI25156J39149_10073803 171
215 3300002738 JGI25154J39366_1000271 JGI25154J39366_100027123 171
216 3300003187 JGI25151J46595_10005206 JGI25151J46595_100052065 171
217 3300003214 JGI25165J46597_1000717 JGI25165J46597_100071717 171
218 3300003316 rootH1_10075861 rootH1_100758613 171
219 3300003322 rootL2_10014775 rootL2_100147752 171
220 3300003578 Ga0006562J51391_1014803 Ga0006562J51391_10148033 171
221 3300003751 Ga0055538_1000219 Ga0055538_100021913 171
222 3300003752 Ga0055539_1000233 Ga0055539_100023318 171
223 3300003756 Ga0055533_1000064 Ga0055533_100006436 171
224 3300003756 Ga0055533_1000247 Ga0055533_100024713 171
225 3300003756 Ga0055533_1000835 Ga0055533_10008356 171
226 3300003756 Ga0055533_1001095 Ga0055533_10010952 171
227 3300003758 Ga0055532_1000013 Ga0055532_1000013334 171
228 3300003758 Ga0055532_1000245 Ga0055532_100024512 171
229 3300003758 Ga0055532_1000292 Ga0055532_100029222 171
230 3300003759 Ga0055525_1000318 Ga0055525_100031818 171
231 3300003760 Ga0055527_1000010 Ga0055527_100001037 171
232 3300003760 Ga0055527_1000159 Ga0055527_100015945 171
233 3300003760 Ga0055527_1000260 Ga0055527_100026012 171
234 3300003760 Ga0055527_1006249 Ga0055527_10062492 171
235 3300003761 Ga0055535_1000010 Ga0055535_1000010334 171
236 3300003761 Ga0055535_1000315 Ga0055535_10003154 171
237 3300003761 Ga0055535_1000431 Ga0055535_100043112 171
238 3300003762 Ga0055542_1000016 Ga0055542_1000016334 171
239 3300003762 Ga0055542_1000990 Ga0055542_100099010 171
240 3300003762 Ga0055542_1003449 Ga0055542_10034493 171
241 3300003763 Ga0055529_1000012 Ga0055529_1000012334 171
242 3300003763 Ga0055529_1000517 Ga0055529_100051712 171
243 3300003790 Ga0055528_1002297 Ga0055528_10022978 171
244 3300003841 Ga0055541_1000113 Ga0055541_100011326 171
245 3300003841 Ga0055541_1000160 Ga0055541_100016013 171
246 3300003856 Ga0058692_1002918 Ga0058692_10029184 171
247 3300005262 Ga0065165_1000810 Ga0065165_10008107 171
248 3300005327 Ga0070658_10003407 Ga0070658_100034073 171
249 3300005329 Ga0070683_101118265 Ga0070683_1011182651 171
250 3300005337 Ga0070682_100103553 Ga0070682_1001035531 171
251 3300005339 Ga0070660_100000006 Ga0070660_10000000686 171
252 3300005339 Ga0070660_100000507 Ga0070660_1000005079 171
253 3300005344 Ga0070661_100000348 Ga0070661_10000034816 171
254 3300005354 Ga0070675_100483202 Ga0070675_1004832021 171
255 3300005355 Ga0070671_100440642 Ga0070671_1004406422 171
256 3300005366 Ga0070659_100000082 Ga0070659_1000000822 171
257 3300005366 Ga0070659_100002151 Ga0070659_1000021512 171
258 3300005367 Ga0070667_100551988 Ga0070667_1005519882 171
259 3300005435 Ga0070714_100582607 Ga0070714_1005826071 171
260 3300005435 Ga0070714_101115677 Ga0070714_1011156772 171
261 3300005455 Ga0070663_100000069 Ga0070663_1000000694 171
262 3300005455 Ga0070663_100000075 Ga0070663_10000007520 171
263 3300005455 Ga0070663_100205344 Ga0070663_1002053442 171
264 3300005456 Ga0070678_100281207 Ga0070678_1002812072 171
265 3300005563 Ga0068855_100013952 Ga0068855_1000139523 171
266 3300005563 Ga0068855_100028268 Ga0068855_1000282684 171
267 3300005563 Ga0068855_100040376 Ga0068855_1000403765 171
268 3300005563 Ga0068855_100690129 Ga0068855_1006901292 171
269 3300005564 Ga0070664_100000191 Ga0070664_10000019113 171
270 3300005614 Ga0068856_100000504 Ga0068856_10000050421 171
271 3300005614 Ga0068856_100076217 Ga0068856_1000762174 171
272 3300005616 Ga0068852_100015182 Ga0068852_1000151825 171
273 3300005834 Ga0068851_10136348 Ga0068851_101363481 171
274 3300005834 Ga0068851_10425110 Ga0068851_104251101 171
275 3300009011 Ga0105251_10000127 Ga0105251_1000012715 171
276 3300009011 Ga0105251_10003857 Ga0105251_100038578 171
277 3300009011 Ga0105251_10116570 Ga0105251_101165702 171
278 3300009036 Ga0105244_10116648 Ga0105244_101166481 171
279 3300009092 Ga0105250_10210716 Ga0105250_102107161 171
280 3300009093 Ga0105240_10004374 Ga0105240_100043745 171
281 3300009093 Ga0105240_10066046 Ga0105240_100660462 171
282 3300009093 Ga0105240_10196992 Ga0105240_101969923 171
283 3300009093 Ga0105240_10442527 Ga0105240_104425272 171
284 3300009098 Ga0105245_10309157 Ga0105245_103091571 171
285 3300009174 Ga0105241_10232790 Ga0105241_102327902 171
286 3300009174 Ga0105241_10703039 Ga0105241_107030391 171
287 3300009545 Ga0105237_10141691 Ga0105237_101416912 171
288 3300009545 Ga0105237_10198047 Ga0105237_101980472 171
289 3300009545 Ga0105237_10239067 Ga0105237_102390672 171
290 3300009545 Ga0105237_10450867 Ga0105237_104508672 171
291 3300009551 Ga0105238_10063614 Ga0105238_100636143 171
292 3300010375 Ga0105239_10003831 Ga0105239_1000383112 171
293 3300010375 Ga0105239_10485553 Ga0105239_104855532 171
294 3300011119 Ga0105246_10858619 Ga0105246_108586191 171
295 3300013100 Ga0157373_10000358 Ga0157373_1000035816 171
296 3300013100 Ga0157373_10002832 Ga0157373_1000283211 171
297 3300013102 Ga0157371_10000608 Ga0157371_1000060820 171
298 3300013102 Ga0157371_10008084 Ga0157371_100080843 171
299 3300013104 Ga0157370_10000690 Ga0157370_1000069019 171
300 3300013104 Ga0157370_10000852 Ga0157370_1000085213 171
301 3300013104 Ga0157370_10001717 Ga0157370_1000171712 171
302 3300013104 Ga0157370_10253317 Ga0157370_102533171 171
303 3300013105 Ga0157369_10000120 Ga0157369_1000012023 171
304 3300013105 Ga0157369_10000743 Ga0157369_1000074319 171
305 3300013105 Ga0157369_10003555 Ga0157369_100035558 171
306 3300013105 Ga0157369_10095222 Ga0157369_100952222 171
307 3300013105 Ga0157369_10123142 Ga0157369_101231422 171
308 3300013296 Ga0157374_10000976 Ga0157374_1000097612 171
309 3300013296 Ga0157374_10240568 Ga0157374_102405682 171
310 3300013306 Ga0163162_10000454 Ga0163162_1000045415 171
311 3300013306 Ga0163162_11931083 Ga0163162_119310831 171
312 3300013307 Ga0157372_10000519 Ga0157372_1000051922 171
313 3300013307 Ga0157372_10003761 Ga0157372_1000376112 171
314 3300013307 Ga0157372_10152645 Ga0157372_101526452 171
315 3300013308 Ga0157375_10010236 Ga0157375_100102364 171
316 3300014497 Ga0182008_10067557 Ga0182008_100675572 171
317 3300014497 Ga0182008_10245974 Ga0182008_102459741 171
318 3300014969 Ga0157376_10966044 Ga0157376_109660442 171
319 3300015261 Ga0182006_1001401 Ga0182006_10014012 171
320 3300015261 Ga0182006_1017240 Ga0182006_10172403 171
321 3300015262 Ga0182007_10000795 Ga0182007_1000079515 171
322 3300015262 Ga0182007_10018828 Ga0182007_100188282 171
323 3300015262 Ga0182007_10045275 Ga0182007_100452752 171
324 3300016635 Ga0183361_10038 Ga0183361_100382 171
325 3300021361 Ga0213872_10133782 Ga0213872_101337822 171
326 3300022467 Ga0224712_10000332 Ga0224712_100003322 171
327 3300025206 Ga0209435_102054 Ga0209435_1020542 171
328 3300025206 Ga0209435_114785 Ga0209435_1147852 171
329 3300025224 Ga0209784_100215 Ga0209784_10021517 171
330 3300025225 Ga0209566_100018 Ga0209566_100018378 171
331 3300025225 Ga0209566_100161 Ga0209566_10016132 171
332 3300025225 Ga0209566_100215 Ga0209566_10021529 171
333 3300025226 Ga0209674_100011 Ga0209674_10001134 171
334 3300025226 Ga0209674_100048 Ga0209674_100048284 171
335 3300025226 Ga0209674_100183 Ga0209674_10018345 171
336 3300025226 Ga0209674_100271 Ga0209674_10027117 171
337 3300025226 Ga0209674_102469 Ga0209674_1024692 171
338 3300025228 Ga0209672_100002 Ga0209672_10000234 171
339 3300025228 Ga0209672_100012 Ga0209672_100012197 171
340 3300025228 Ga0209672_100020 Ga0209672_100020165 171
341 3300025228 Ga0209672_100066 Ga0209672_100066105 171
342 3300025228 Ga0209672_100234 Ga0209672_10023420 171
343 3300025228 Ga0209672_100439 Ga0209672_10043915 171
344 3300025229 Ga0209147_100003 Ga0209147_10000334 171
345 3300025229 Ga0209147_100007 Ga0209147_100007575 171
346 3300025229 Ga0209147_100024 Ga0209147_100024165 171
347 3300025229 Ga0209147_100084 Ga0209147_10008462 171
348 3300025229 Ga0209147_100295 Ga0209147_10029513 171
349 3300025230 Ga0209563_100181 Ga0209563_10018117 171
350 3300025230 Ga0209563_101061 Ga0209563_1010614 171
351 3300025230 Ga0209563_104234 Ga0209563_1042343 171
352 3300025231 Ga0207427_101307 Ga0207427_1013073 171
353 3300025242 Ga0209258_100014 Ga0209258_100014128 171
354 3300025242 Ga0209258_100042 Ga0209258_100042326 171
355 3300025242 Ga0209258_100084 Ga0209258_100084165 171
356 3300025242 Ga0209258_100117 Ga0209258_10011762 171
357 3300025242 Ga0209258_100477 Ga0209258_10047713 171
358 3300025246 Ga0209646_1000046 Ga0209646_1000046255 171
359 3300025250 Ga0209026_1026636 Ga0209026_10266362 171
360 3300025253 Ga0209677_100230 Ga0209677_10023017 171
361 3300025253 Ga0209677_102128 Ga0209677_1021283 171
362 3300025254 Ga0209148_1000006 Ga0209148_100000634 171
363 3300025254 Ga0209148_1000148 Ga0209148_100014874 171
364 3300025254 Ga0209148_1000187 Ga0209148_100018759 171
365 3300025254 Ga0209148_1000739 Ga0209148_10007393 171
366 3300025254 Ga0209148_1000785 Ga0209148_10007855 171
367 3300025254 Ga0209148_1003392 Ga0209148_10033923 171
368 3300025256 Ga0209759_1000002 Ga0209759_1000002889 171
369 3300025256 Ga0209759_1000032 Ga0209759_100003230 171
370 3300025256 Ga0209759_1000210 Ga0209759_100021034 171
371 3300025256 Ga0209759_1000587 Ga0209759_100058715 171
372 3300025256 Ga0209759_1003308 Ga0209759_10033082 171
373 3300025256 Ga0209759_1003547 Ga0209759_10035476 171
374 3300025256 Ga0209759_1006814 Ga0209759_10068142 171
375 3300025261 Ga0209233_1000033 Ga0209233_1000033515 171
376 3300025272 Ga0209455_1000003 Ga0209455_100000334 171
377 3300025272 Ga0209455_1000110 Ga0209455_100011062 171
378 3300025272 Ga0209455_1000269 Ga0209455_10002699 171
379 3300025272 Ga0209455_1000362 Ga0209455_100036213 171
380 3300025272 Ga0209455_1004621 Ga0209455_10046213 171
381 3300025273 Ga0209673_1000057 Ga0209673_100005730 171
382 3300025284 Ga0209130_1004039 Ga0209130_10040394 171
383 3300025294 Ga0209025_1000123 Ga0209025_1000123139 171
384 3300025295 Ga0209564_1006643 Ga0209564_10066433 171
385 3300025302 Ga0207426_1000152 Ga0207426_1000152133 171
386 3300025735 Ga0207713_1000302 Ga0207713_100030214 171
387 3300025735 Ga0207713_1004357 Ga0207713_10043572 171
388 3300025903 Ga0207680_10254216 Ga0207680_102542162 171
389 3300025904 Ga0207647_10001027 Ga0207647_1000102714 171
390 3300025904 Ga0207647_10011755 Ga0207647_100117553 171
391 3300025904 Ga0207647_10019511 Ga0207647_100195113 171
392 3300025904 Ga0207647_10047244 Ga0207647_100472441 171
393 3300025904 Ga0207647_10058678 Ga0207647_100586782 171
394 3300025904 Ga0207647_10078869 Ga0207647_100788692 171
395 3300025909 Ga0207705_10003789 Ga0207705_100037893 171
396 3300025911 Ga0207654_10063366 Ga0207654_100633662 171
397 3300025913 Ga0207695_10001113 Ga0207695_100011132 171
398 3300025913 Ga0207695_10006823 Ga0207695_1000682312 171
399 3300025913 Ga0207695_10048057 Ga0207695_100480572 171
400 3300025914 Ga0207671_10043195 Ga0207671_100431952 171
401 3300025914 Ga0207671_10084192 Ga0207671_100841923 171
402 3300025914 Ga0207671_10320464 Ga0207671_103204642 171
403 3300025919 Ga0207657_10000003 Ga0207657_10000003170 171
404 3300025919 Ga0207657_10000885 Ga0207657_1000088522 171
405 3300025920 Ga0207649_10000326 Ga0207649_1000032613 171
406 3300025920 Ga0207649_10073741 Ga0207649_100737412 171
407 3300025924 Ga0207694_10016667 Ga0207694_100166672 171
408 3300025924 Ga0207694_10114426 Ga0207694_101144262 171
409 3300025926 Ga0207659_10417359 Ga0207659_104173591 171
410 3300025931 Ga0207644_10034485 Ga0207644_100344852 171
411 3300025932 Ga0207690_10000007 Ga0207690_10000007171 171
412 3300025932 Ga0207690_10000380 Ga0207690_1000038016 171
413 3300025934 Ga0207686_10623740 Ga0207686_106237402 171
414 3300025941 Ga0207711_10074677 Ga0207711_100746772 171
415 3300025941 Ga0207711_10085911 Ga0207711_100859111 171
416 3300025945 Ga0207679_10000002 Ga0207679_1000000219 171
417 3300025949 Ga0207667_10006579 Ga0207667_1000657910 171
418 3300025949 Ga0207667_10006899 Ga0207667_100068996 171
419 3300025949 Ga0207667_10097174 Ga0207667_100971742 171
420 3300025949 Ga0207667_10155758 Ga0207667_101557582 171
421 3300026067 Ga0207678_10000319 Ga0207678_1000031919 171
422 3300026067 Ga0207678_10001465 Ga0207678_100014654 171
423 3300026067 Ga0207678_10008540 Ga0207678_100085402 171
424 3300026067 Ga0207678_10391346 Ga0207678_103913462 171
425 3300026078 Ga0207702_10000504 Ga0207702_1000050419 171
426 3300026078 Ga0207702_10049899 Ga0207702_100498992 171
427 3300026116 Ga0207674_10456110 Ga0207674_104561102 171
428 3300026116 Ga0207674_11209831 Ga0207674_112098312 171
429 3300026121 Ga0207683_10193050 Ga0207683_101930502 171
430 3300026142 Ga0207698_10086845 Ga0207698_100868452 171
431 3300027312 Ga0209371_1000076 Ga0209371_100007612 171
432 3300027312 Ga0209371_1008067 Ga0209371_10080673 171
433 3300027617 Ga0210002_1032004 Ga0210002_10320042 171
434 3300028800 Ga0265338_10296066 Ga0265338_102960662 171
435 3300030500 Ga0268256_1000087 Ga0268256_1000087125 171
436 3300030500 Ga0268256_1005103 Ga0268256_10051034 171
437 3300031548 Ga0307408_100004532 Ga0307408_1000045324 171
438 3300031731 Ga0307405_10265306 Ga0307405_102653062 171
439 3300031911 Ga0307412_10000095 Ga0307412_1000009523 171
440 3300031911 Ga0307412_10373368 Ga0307412_103733682 171
441 3300037312 Ga0395899_0006229 Ga0395899_0006229_2099_2620 171
442 3300037312 Ga0395899_0029500 Ga0395899_0029500_1123_1656 171
443 3300037312 Ga0395899_0068100 Ga0395899_0068100_1775_2308 171
444 3300037312 Ga0395899_0078539 Ga0395899_0078539_469_990 171
445 3300037312 Ga0395899_0082115 Ga0395899_0082115_1743_2276 171
446 3300037418 Ga0395900_0001069 Ga0395900_0001069_19376_19909 171
447 3300037418 Ga0395900_0101315 Ga0395900_0101315_144_677 171
448 3300037418 Ga0395900_0164362 Ga0395900_0164362_12_533 171
449 3300037418 Ga0395900_0268621 Ga0395900_0268621_345_875 171
450 3300037418 Ga0395900_0306495 Ga0395900_0306495_1021_1542 171
451 3300037418 Ga0395900_0310588 Ga0395900_0310588_189_722 171
452 3300037418 Ga0395900_0547016 Ga0395900_0547016_345_878 171
453 3300037466 Ga0395898_0001705 Ga0395898_0001705_6709_7242 171
454 3300037466 Ga0395898_0013543 Ga0395898_0013543_5535_6065 171
455 3300037466 Ga0395898_0091311 Ga0395898_0091311_491_1021 171
456 3300037466 Ga0395898_0098228 Ga0395898_0098228_1103_1624 171
457 3300037466 Ga0395898_0113022 Ga0395898_0113022_184_717 171
458 3300037466 Ga0395898_0155359 Ga0395898_0155359_527_1060 171
459 3300037466 Ga0395898_0236639 Ga0395898_0236639_214_747 171
460 3300037471 Ga0395905_0000048 Ga0395905_0000048_177718_178251 171
461 3300037471 Ga0395905_0007757 Ga0395905_0007757_6879_7409 171
462 3300037471 Ga0395905_0048375 Ga0395905_0048375_471_992 171
463 3300037471 Ga0395905_0790484 Ga0395905_0790484_50_583 171
464 3300038443 Ga0395901_0000081 Ga0395901_0000081_107999_108532 171
465 3300038443 Ga0395901_0000157 Ga0395901_0000157_66756_67289 171
466 3300038443 Ga0395901_0014499 Ga0395901_0014499_214_747 171
467 3300038443 Ga0395901_0046848 Ga0395901_0046848_3898_4419 171
468 3300038443 Ga0395901_0075354 Ga0395901_0075354_184_717 171
469 3300038443 Ga0395901_0096738 Ga0395901_0096738_950_1480 171
470 3300039437 Ga0436365_0041924 Ga0436365_0041924_1708_2241 171
471 3300039438 Ga0436360_0381606 Ga0436360_0381606_708_1247 171
472 3300039447 Ga0436361_1016186 Ga0436361_1016186_2126_2659 171
473 3300042005 Ga0439448_0000277 Ga0439448_0000277_4701_5231 171
474 3300042005 Ga0439448_0024425 Ga0439448_0024425_631_1152 171
475 3300042008 Ga0439450_009019 Ga0439450_009019_1187_1708 171
476 3300044656 Ga0466969_0006179 Ga0466969_0006179_2827_3363 171
477 3300044656 Ga0466969_0017551 Ga0466969_0017551_1655_2188 171
478 3300044658 Ga0466972_0010584 Ga0466972_0010584_1877_2410 171
479 3300044659 Ga0466973_0010148 Ga0466973_0010148_7335_7871 171
480 3300044683 Ga0466965_0003673 Ga0466965_0003673_5710_6246 171
481 3300044683 Ga0466965_0015457 Ga0466965_0015457_2859_3392 171
482 3300044684 Ga0466966_0000009 Ga0466966_0000009_37025_37558 171
483 3300044684 Ga0466966_0002666 Ga0466966_0002666_7174_7707 171
484 3300044684 Ga0466966_0446945 Ga0466966_0446945_92_628 171
485 3300044693 Ga0466961_0001729 Ga0466961_0001729_8579_9115 171
486 3300044693 Ga0466961_0021964 Ga0466961_0021964_1694_2227 171
487 3300044693 Ga0466961_0104073 Ga0466961_0104073_845_1378 171
488 3300044693 Ga0466961_0164022 Ga0466961_0164022_691_1224 171
489 3300044694 Ga0466963_0004763 Ga0466963_0004763_604_1140 171
490 3300044694 Ga0466963_0108759 Ga0466963_0108759_1055_1588 171
491 3300044694 Ga0466963_0351380 Ga0466963_0351380_368_901 171
492 3300044735 Ga0466968_0376707 Ga0466968_0376707_60_596 171
493 3300044765 Ga0466970_0007794 Ga0466970_0007794_996_1529 171
494 3300044765 Ga0466970_0063990 Ga0466970_0063990_329_871 171
495 3300044765 Ga0466970_0109451 Ga0466970_0109451_207_743 171
496 3300044842 Ga0466957_0055369 Ga0466957_0055369_257_790 171
497 3300044842 Ga0466957_0058628 Ga0466957_0058628_1713_2246 171
498 3300044842 Ga0466957_0137722 Ga0466957_0137722_930_1460 171
499 3300044901 Ga0466960_0126579 Ga0466960_0126579_694_1224 171
500 3300045049 Ga0466959_0007139 Ga0466959_0007139_1880_2413 171
501 3300045049 Ga0466959_0015359 Ga0466959_0015359_486_1022 171
502 3300045049 Ga0466959_0070837 Ga0466959_0070837_352_885 171
503 3300045836 Ga0466958_0012698 Ga0466958_0012698_430_966 171
504 3300045836 Ga0466958_0014712 Ga0466958_0014712_2381_2914 171
505 3300045836 Ga0466958_0028692 Ga0466958_0028692_2352_2885 171
506 3300045836 Ga0466958_0051920 Ga0466958_0051920_1326_1847 171
507 3300046454 Ga0495592_0105775 Ga0495592_0105775_689_1225 171
508 3300046454 Ga0495592_0124916 Ga0495592_0124916_486_1022 171
509 3300046455 Ga0495603_0119288 Ga0495603_0119288_744_1280 171
510 3300046457 Ga0495590_0001159 Ga0495590_0001159_8450_8980 171
511 3300046457 Ga0495590_0006265 Ga0495590_0006265_3975_4511 171
512 3300046457 Ga0495590_0045663 Ga0495590_0045663_979_1515 171
513 3300046459 Ga0495629_0000137 Ga0495629_0000137_1670_2206 171
514 3300046459 Ga0495629_0000758 Ga0495629_0000758_6135_6671 171
515 3300046459 Ga0495629_0004710 Ga0495629_0004710_2675_3211 171
516 3300046459 Ga0495629_0075609 Ga0495629_0075609_1693_2226 171
517 3300046460 Ga0495638_0045977 Ga0495638_0045977_1440_1976 171
518 3300046460 Ga0495638_0063705 Ga0495638_0063705_797_1333 171
519 3300046460 Ga0495638_0253589 Ga0495638_0253589_119_655 171
520 3300046461 Ga0495641_0052028 Ga0495641_0052028_700_1236 171
521 3300046462 Ga0495651_0021068 Ga0495651_0021068_1966_2502 171
522 3300046462 Ga0495651_0289306 Ga0495651_0289306_521_1057 171
523 3300046463 Ga0495653_0054926 Ga0495653_0054926_1451_1981 171
524 3300046463 Ga0495653_0153329 Ga0495653_0153329_1009_1545 171
525 3300046471 Ga0495650_0013190 Ga0495650_0013190_1958_2494 171
526 3300046471 Ga0495650_0064766 Ga0495650_0064766_356_892 171
527 3300046471 Ga0495650_0068416 Ga0495650_0068416_272_808 171
528 3300046472 Ga0495580_0000703 Ga0495580_0000703_438_974 171
529 3300046472 Ga0495580_0010665 Ga0495580_0010665_4087_4632 171
530 3300046472 Ga0495580_0016508 Ga0495580_0016508_3682_4218 171
531 3300046472 Ga0495580_0049717 Ga0495580_0049717_407_943 171
532 3300046472 Ga0495580_0064624 Ga0495580_0064624_341_877 171
533 3300046472 Ga0495580_0078208 Ga0495580_0078208_1193_1729 171
534 3300046472 Ga0495580_0118813 Ga0495580_0118813_1146_1682 171
535 3300046472 Ga0495580_0360130 Ga0495580_0360130_407_943 171
536 3300046473 Ga0495582_0071388 Ga0495582_0071388_982_1518 171
537 3300046473 Ga0495582_0161717 Ga0495582_0161717_56_592 171
538 3300046473 Ga0495582_0277826 Ga0495582_0277826_215_751 171
539 3300046474 Ga0495605_0001460 Ga0495605_0001460_552_1088 171
540 3300046474 Ga0495605_0014706 Ga0495605_0014706_141_686 171
541 3300046474 Ga0495605_0125302 Ga0495605_0125302_45_581 171
542 3300046477 Ga0495664_0007353 Ga0495664_0007353_2116_2646 171
543 3300046477 Ga0495664_0107192 Ga0495664_0107192_158_694 171
544 3300046477 Ga0495664_0225610 Ga0495664_0225610_484_1020 171
545 3300046491 Ga0495584_0017445 Ga0495584_0017445_2440_2970 171
546 3300046499 Ga0495594_0127206 Ga0495594_0127206_317_853 171
547 3300046500 Ga0495596_0002590 Ga0495596_0002590_564_1100 171
548 3300046500 Ga0495596_0048064 Ga0495596_0048064_335_871 171
549 3300046500 Ga0495596_0158162 Ga0495596_0158162_75_611 171
550 3300046506 Ga0495583_0010285 Ga0495583_0010285_787_1332 171
551 3300046507 Ga0495606_0031661 Ga0495606_0031661_1939_2475 171
552 3300046507 Ga0495606_0033155 Ga0495606_0033155_921_1451 171
553 3300046507 Ga0495606_0129780 Ga0495606_0129780_290_826 171
554 3300046507 Ga0495606_0160261 Ga0495606_0160261_29_565 171
555 3300046512 Ga0495610_0000745 Ga0495610_0000745_17823_18359 171
556 3300046513 Ga0495616_0027863 Ga0495616_0027863_299_844 171
557 3300046513 Ga0495616_0166841 Ga0495616_0166841_83_604 171
558 3300046514 Ga0495618_0012697 Ga0495618_0012697_4439_4975 171
559 3300046514 Ga0495618_0176056 Ga0495618_0176056_767_1303 171
560 3300046514 Ga0495618_0212213 Ga0495618_0212213_492_1028 171
561 3300046515 Ga0495620_0061141 Ga0495620_0061141_750_1280 171
562 3300046516 Ga0495628_0006690 Ga0495628_0006690_8616_9152 171
563 3300046516 Ga0495628_0077898 Ga0495628_0077898_883_1419 171
564 3300046517 Ga0495630_0006496 Ga0495630_0006496_6104_6640 171
565 3300046517 Ga0495630_0075178 Ga0495630_0075178_1366_1902 171
566 3300046517 Ga0495630_0143959 Ga0495630_0143959_859_1395 171
567 3300046517 Ga0495630_0174489 Ga0495630_0174489_1071_1607 171
568 3300046524 Ga0495648_0087115 Ga0495648_0087115_657_1202 171
569 3300046524 Ga0495648_0099040 Ga0495648_0099040_931_1467 171
570 3300046524 Ga0495648_0281437 Ga0495648_0281437_80_616 171
571 3300046526 Ga0495666_0046001 Ga0495666_0046001_642_1178 171
572 3300046526 Ga0495666_0065631 Ga0495666_0065631_966_1511 171
573 3300046528 Ga0495642_0105743 Ga0495642_0105743_320_856 171
574 3300046529 Ga0495652_0013748 Ga0495652_0013748_3212_3742 171
575 3300046529 Ga0495652_0077639 Ga0495652_0077639_1772_2308 171
576 3300046529 Ga0495652_0308066 Ga0495652_0308066_159_695 171
577 3300046529 Ga0495652_0319584 Ga0495652_0319584_257_793 171
578 3300046530 Ga0495654_0128819 Ga0495654_0128819_416_952 171
579 3300046531 Ga0495665_0001219 Ga0495665_0001219_12387_12917 171
580 3300046531 Ga0495665_0002867 Ga0495665_0002867_310_846 171
581 3300046531 Ga0495665_0012093 Ga0495665_0012093_1394_1930 171
582 3300046531 Ga0495665_0057582 Ga0495665_0057582_648_1184 171
583 3300046531 Ga0495665_0103915 Ga0495665_0103915_139_684 171
584 3300046531 Ga0495665_0225210 Ga0495665_0225210_268_804 171
585 3300046533 Ga0495640_0009812 Ga0495640_0009812_1133_1669 171
586 3300046533 Ga0495640_0049346 Ga0495640_0049346_2210_2746 171
587 3300046533 Ga0495640_0133440 Ga0495640_0133440_26_562 171
588 3300046535 Ga0495586_0132326 Ga0495586_0132326_412_948 171
589 3300046536 Ga0495587_0116857 Ga0495587_0116857_953_1489 171
590 3300046536 Ga0495587_0144163 Ga0495587_0144163_767_1303 171
591 3300046542 Ga0495597_0038812 Ga0495597_0038812_847_1377 171
592 3300046542 Ga0495597_0066881 Ga0495597_0066881_37_573 171
593 3300046543 Ga0495645_0041914 Ga0495645_0041914_918_1448 171
594 3300046543 Ga0495645_0082632 Ga0495645_0082632_255_791 171
595 3300046543 Ga0495645_0128508 Ga0495645_0128508_999_1535 171
596 3300046557 Ga0495622_0000287 Ga0495622_0000287_24732_25268 171
597 3300046559 Ga0495667_0095636 Ga0495667_0095636_758_1294 171
598 3300046642 Ga0495634_0096031 Ga0495634_0096031_145_681 171
599 3300046642 Ga0495634_0155823 Ga0495634_0155823_743_1279 171
600 3300046642 Ga0495634_0191215 Ga0495634_0191215_159_695 171
601 3300046648 Ga0495611_0204377 Ga0495611_0204377_96_632 171
602 3300046660 Ga0495625_0114311 Ga0495625_0114311_1236_1772 171
603 3300046663 Ga0495635_0003260 Ga0495635_0003260_882_1418 171
604 3300046663 Ga0495635_0031526 Ga0495635_0031526_249_779 171
605 3300046663 Ga0495635_0067239 Ga0495635_0067239_723_1259 171
606 3300046665 Ga0495661_0026657 Ga0495661_0026657_2086_2622 171
607 3300046665 Ga0495661_0053064 Ga0495661_0053064_735_1271 171
608 3300046678 Ga0495599_0115987 Ga0495599_0115987_623_1159 171
609 3300046679 Ga0495623_0005611 Ga0495623_0005611_423_959 171
610 3300046679 Ga0495623_0086152 Ga0495623_0086152_876_1412 171
611 3300046679 Ga0495623_0095211 Ga0495623_0095211_368_898 171
612 3300046679 Ga0495623_0107684 Ga0495623_0107684_65_601 171
613 3300046680 Ga0495646_0021175 Ga0495646_0021175_2020_2556 171
614 3300046680 Ga0495646_0045895 Ga0495646_0045895_430_966 171
615 3300046680 Ga0495646_0083368 Ga0495646_0083368_1017_1553 171
616 3300046684 Ga0495669_0009043 Ga0495669_0009043_791_1327 171
617 3300046684 Ga0495669_0028636 Ga0495669_0028636_1050_1586 171
618 3300046689 Ga0495613_0014252 Ga0495613_0014252_5004_5540 171
619 3300046689 Ga0495613_0016752 Ga0495613_0016752_874_1410 171
620 3300046690 Ga0495624_0002935 Ga0495624_0002935_6442_6978 171
621 3300046690 Ga0495624_0008831 Ga0495624_0008831_4263_4799 171
622 3300046690 Ga0495624_0016596 Ga0495624_0016596_3196_3726 171
623 3300046690 Ga0495624_0029501 Ga0495624_0029501_2159_2695 171
624 3300046690 Ga0495624_0066377 Ga0495624_0066377_371_907 171
625 3300046690 Ga0495624_0158189 Ga0495624_0158189_332_868 171
626 3300046690 Ga0495624_0226695 Ga0495624_0226695_16_552 171
627 3300046692 Ga0495671_0024267 Ga0495671_0024267_1542_2078 171
628 3300046694 Ga0495649_0004871 Ga0495649_0004871_846_1382 171
629 3300046694 Ga0495649_0106211 Ga0495649_0106211_24_560 171
630 3300046694 Ga0495649_0170522 Ga0495649_0170522_270_806 171
631 3300046794 Ga0495589_0019602 Ga0495589_0019602_1506_2042 171
632 3300046794 Ga0495589_0058040 Ga0495589_0058040_1081_1617 171
633 3300046794 Ga0495589_0060027 Ga0495589_0060027_611_1147 171
634 3300046794 Ga0495589_0099209 Ga0495589_0099209_322_858 171
635 3300046809 Ga0495600_0018722 Ga0495600_0018722_256_792 171
636 3300046809 Ga0495600_0071222 Ga0495600_0071222_1273_1809 171
637 3300046810 Ga0495660_0042998 Ga0495660_0042998_290_826 171
638 3300047315 Ga0495581_0006112 Ga0495581_0006112_5599_6135 171
639 3300047315 Ga0495581_0028287 Ga0495581_0028287_2001_2537 171
640 3300047315 Ga0495581_0102085 Ga0495581_0102085_646_1182 171
641 3300047317 Ga0495604_0001571 Ga0495604_0001571_8594_9130 171
642 3300047317 Ga0495604_0025773 Ga0495604_0025773_1435_1965 171
643 3300047317 Ga0495604_0026260 Ga0495604_0026260_376_912 171
644 3300047317 Ga0495604_0042301 Ga0495604_0042301_1337_1873 171
645 3300047317 Ga0495604_0087198 Ga0495604_0087198_900_1433 171
646 3300047317 Ga0495604_0181992 Ga0495604_0181992_513_1049 171
647 3300047319 Ga0495674_0003691 Ga0495674_0003691_14235_14768 171
648 3300047319 Ga0495674_0013082 Ga0495674_0013082_5926_6462 171
649 3300047319 Ga0495674_0022068 Ga0495674_0022068_2061_2597 171
650 3300047319 Ga0495674_0045991 Ga0495674_0045991_1596_2132 171
651 3300047319 Ga0495674_0049855 Ga0495674_0049855_2851_3387 171
652 3300047319 Ga0495674_0085690 Ga0495674_0085690_874_1419 171
653 3300047319 Ga0495674_0099233 Ga0495674_0099233_266_802 171
654 3300047319 Ga0495674_0534688 Ga0495674_0534688_70_606 171
655 3300047320 Ga0495672_0001027 Ga0495672_0001027_2649_3185 171
656 3300047320 Ga0495672_0023540 Ga0495672_0023540_2784_3329 171
657 3300047321 Ga0495676_0098077 Ga0495676_0098077_589_1125 171
658 3300047322 Ga0495680_0017847 Ga0495680_0017847_4573_5103 171
659 3300047322 Ga0495680_0076671 Ga0495680_0076671_629_1165 171
660 3300047322 Ga0495680_0087042 Ga0495680_0087042_1394_1930 171
661 3300047322 Ga0495680_0188315 Ga0495680_0188315_444_980 171
662 3300047322 Ga0495680_0578524 Ga0495680_0578524_201_737 171
663 3300047323 Ga0495683_0008992 Ga0495683_0008992_469_1005 171
664 3300047323 Ga0495683_0055362 Ga0495683_0055362_1415_1951 171
665 3300047323 Ga0495683_0090617 Ga0495683_0090617_14_559 171
666 3300047323 Ga0495683_0132276 Ga0495683_0132276_128_658 171
667 3300047443 Ga0495687_000021 Ga0495687_000021_214901_215443 171
668 3300047443 Ga0495687_007444 Ga0495687_007444_4134_4679 171
669 3300047443 Ga0495687_031541 Ga0495687_031541_1092_1628 171
670 3300047443 Ga0495687_103383 Ga0495687_103383_117_653 171
671 3300047444 Ga0495675_0017368 Ga0495675_0017368_3216_3752 171
672 3300047444 Ga0495675_0046970 Ga0495675_0046970_1623_2159 171
673 3300047444 Ga0495675_0049921 Ga0495675_0049921_609_1145 171
674 3300047444 Ga0495675_0057153 Ga0495675_0057153_1562_2098 171
675 3300047444 Ga0495675_0114040 Ga0495675_0114040_82_618 171
676 3300047446 Ga0495679_000013 Ga0495679_000013_301570_302106 171
677 3300047446 Ga0495679_000885 Ga0495679_000885_12816_13352 171
678 3300047446 Ga0495679_009825 Ga0495679_009825_581_1117 171
679 3300047469 Ga0495673_0033822 Ga0495673_0033822_609_1154 171
680 3300047469 Ga0495673_0039418 Ga0495673_0039418_681_1217 171
681 3300047469 Ga0495673_0129585 Ga0495673_0129585_134_670 171
682 3300047469 Ga0495673_0158381 Ga0495673_0158381_250_786 171
683 3300047470 Ga0495681_0158050 Ga0495681_0158050_52_588 171
684 3300047471 Ga0495684_0013909 Ga0495684_0013909_5155_5691 171
685 3300047471 Ga0495684_0240650 Ga0495684_0240650_200_736 171
686 3300047471 Ga0495684_0485152 Ga0495684_0485152_170_706 171
687 3300047472 Ga0495686_0000081 Ga0495686_0000081_22698_23234 171
688 3300047472 Ga0495686_0091173 Ga0495686_0091173_318_854 171
689 3300047673 Ga0495593_0005939 Ga0495593_0005939_5571_6107 171
690 3300047673 Ga0495593_0008969 Ga0495593_0008969_802_1338 171
691 3300047673 Ga0495593_0019987 Ga0495593_0019987_1155_1685 171
692 3300047673 Ga0495593_0026977 Ga0495593_0026977_2498_3034 171
693 3300048088 Ga0495602_0042153 Ga0495602_0042153_987_1523 171
694 3300048088 Ga0495602_0045768 Ga0495602_0045768_3178_3708 171
695 3300048088 Ga0495602_0089662 Ga0495602_0089662_1394_1930 171
696 3300048088 Ga0495602_0231121 Ga0495602_0231121_230_766 171
697 3300048089 Ga0495614_0010574 Ga0495614_0010574_2851_3387 171
698 3300048089 Ga0495614_0028617 Ga0495614_0028617_835_1371 171
699 3300048089 Ga0495614_0040887 Ga0495614_0040887_527_1063 171
700 3300048091 Ga0495626_0080088 Ga0495626_0080088_130_666 171
701 3300048091 Ga0495626_0150132 Ga0495626_0150132_401_943 171
702 3300048903 Ga0496100_0195637 Ga0496100_0195637_701_1231 171
703 3300048903 Ga0496100_0205631 Ga0496100_0205631_188_724 171
704 3300048904 Ga0496101_0005318 Ga0496101_0005318_223_768 171
705 3300048904 Ga0496101_0005742 Ga0496101_0005742_5881_6411 171
706 3300048904 Ga0496101_0007002 Ga0496101_0007002_212_742 171
707 3300048904 Ga0496101_0312314 Ga0496101_0312314_563_1099 171
708 3300048905 Ga0496102_0001948 Ga0496102_0001948_12002_12547 171
709 3300048905 Ga0496102_0169031 Ga0496102_0169031_935_1471 171
710 3300048905 Ga0496102_0402081 Ga0496102_0402081_518_1048 171
711 3300048905 Ga0496102_0956540 Ga0496102_0956540_13_534 171
712 3300048906 Ga0496103_0602814 Ga0496103_0602814_154_684 171
713 3300048907 Ga0496104_0372972 Ga0496104_0372972_376_921 171
714 3300048907 Ga0496104_0446361 Ga0496104_0446361_626_1156 171
715 3300048908 Ga0496105_0075444 Ga0496105_0075444_550_1095 171
716 3300048908 Ga0496105_0583387 Ga0496105_0583387_227_757 171
717 3300048909 Ga0496106_0009549 Ga0496106_0009549_5562_6083 171
718 3300048909 Ga0496106_0205462 Ga0496106_0205462_858_1388 171
719 3300048910 Ga0496107_0114849 Ga0496107_0114849_1038_1574 171
720 3300048911 Ga0496108_0036849 Ga0496108_0036849_1813_2343 171
721 3300048912 Ga0496109_1290545 Ga0496109_1290545_74_604 171
722 3300048913 Ga0496110_0360478 Ga0496110_0360478_166_687 171
723 3300048914 Ga0496111_0123848 Ga0496111_0123848_847_1377 171
724 3300048915 Ga0496112_0016884 Ga0496112_0016884_6146_6676 171
725 3300048915 Ga0496112_0157336 Ga0496112_0157336_971_1516 171
726 3300048916 Ga0496113_0142375 Ga0496113_0142375_405_950 171
727 3300048916 Ga0496113_0347556 Ga0496113_0347556_110_640 171
728 3300048917 Ga0496114_0012267 Ga0496114_0012267_5491_6027 171
729 3300048917 Ga0496114_0801884 Ga0496114_0801884_159_695 171
730 3300048918 Ga0496115_0114478 Ga0496115_0114478_853_1383 171
731 3300048918 Ga0496115_0215959 Ga0496115_0215959_684_1220 171
732 3300048919 Ga0496116_0034617 Ga0496116_0034617_1788_2324 171
733 3300048919 Ga0496116_0057918 Ga0496116_0057918_240_770 171
734 3300048920 Ga0496117_0003808 Ga0496117_0003808_3447_3992 171
735 3300048920 Ga0496117_0003944 Ga0496117_0003944_733_1269 171
736 3300048920 Ga0496117_0010066 Ga0496117_0010066_3243_3779 171
737 3300048920 Ga0496117_0015912 Ga0496117_0015912_949_1485 171
738 3300048920 Ga0496117_0086561 Ga0496117_0086561_240_770 171
739 3300048921 Ga0496118_0001751 Ga0496118_0001751_17696_18232 171
740 3300048921 Ga0496118_0004406 Ga0496118_0004406_7428_7973 171
741 3300048921 Ga0496118_0022028 Ga0496118_0022028_1067_1603 171
742 3300048921 Ga0496118_0044323 Ga0496118_0044323_912_1448 171
743 3300048921 Ga0496118_0139088 Ga0496118_0139088_961_1497 171
744 3300048921 Ga0496118_0199193 Ga0496118_0199193_130_660 171
745 3300048922 Ga0496119_0128710 Ga0496119_0128710_115_645 171
746 3300048924 Ga0496121_0001129 Ga0496121_0001129_12634_13170 171
747 3300048924 Ga0496121_0005701 Ga0496121_0005701_6075_6620 171
748 3300048924 Ga0496121_0023755 Ga0496121_0023755_681_1226 171
749 3300048924 Ga0496121_0025167 Ga0496121_0025167_2142_2678 171
750 3300048924 Ga0496121_0084888 Ga0496121_0084888_1725_2255 171
751 3300048925 Ga0496122_0106778 Ga0496122_0106778_195_725 171
752 3300048925 Ga0496122_0133830 Ga0496122_0133830_810_1331 171
753 3300048926 Ga0496123_0141072 Ga0496123_0141072_685_1215 171
754 3300048927 Ga0496124_0237306 Ga0496124_0237306_687_1217 171
755 3300048927 Ga0496124_0300726 Ga0496124_0300726_54_575 171
756 3300048928 Ga0496125_0018061 Ga0496125_0018061_5948_6478 171
757 3300048928 Ga0496125_0192152 Ga0496125_0192152_319_864 171
758 3300048928 Ga0496125_0426440 Ga0496125_0426440_158_694 171
759 3300048929 Ga0496126_0004750 Ga0496126_0004750_1748_2284 171
760 3300048929 Ga0496126_0155464 Ga0496126_0155464_638_1174 171
761 3300049459 Ga0495678_054133 Ga0495678_054133_556_1092 171
762 3300049460 Ga0495682_0027727 Ga0495682_0027727_1315_1860 171
763 3300049460 Ga0495682_0030129 Ga0495682_0030129_146_682 171
764 3300059477 Ga0587084_007755 Ga0587084_007755_724_1257 171
765 3300059477 Ga0587084_019179 Ga0587084_019179_409_954 171
766 3300059491 Ga0587070_018743 Ga0587070_018743_484_1029 171
767 3300059491 Ga0587070_071260 Ga0587070_071260_195_728 171
768 3300059503 Ga0587080_038036 Ga0587080_038036_59_604 171
769 3300059503 Ga0587080_082992 Ga0587080_082992_51_584 171
770 3300059505 Ga0587083_0001420 Ga0587083_0001420_1179_1712 171
771 3300059505 Ga0587083_0017588 Ga0587083_0017588_478_1011 171
772 3300059505 Ga0587083_0058859 Ga0587083_0058859_172_717 171
773 3300059510 Ga0587090_012317 Ga0587090_012317_461_1006 171
774 3300059511 Ga0587091_016901 Ga0587091_016901_73_606 171
775 3300059511 Ga0587091_021107 Ga0587091_021107_418_951 171
776 3300059511 Ga0587091_088330 Ga0587091_088330_118_663 171
777 3300059513 Ga0587094_008973 Ga0587094_008973_645_1178 171
778 3300059604 Ga0587098_003070 Ga0587098_003070_805_1338 171
779 3300059604 Ga0587098_019425 Ga0587098_019425_201_746 171
780 3300059605 Ga0587106_047238 Ga0587106_047238_130_663 171
781 3300059605 Ga0587106_075140 Ga0587106_075140_97_630 171
782 3300059623 Ga0587101_049214 Ga0587101_049214_54_587 171
783 3300059630 Ga0587128_013884 Ga0587128_013884_535_1065 171
784 3300059640 Ga0587067_000513 Ga0587067_000513_973_1506 171
785 3300059641 Ga0587068_001003 Ga0587068_001003_1736_2257 171
786 3300059641 Ga0587068_012163 Ga0587068_012163_669_1202 171
787 3300059641 Ga0587068_014583 Ga0587068_014583_70_603 171
788 3300059642 Ga0587069_031196 Ga0587069_031196_240_773 171
789 3300059642 Ga0587069_032831 Ga0587069_032831_249_794 171
790 3300059643 Ga0587072_000076 Ga0587072_000076_5847_6380 171
791 3300059643 Ga0587072_065694 Ga0587072_065694_118_639 171
792 3300059645 Ga0587076_028924 Ga0587076_028924_351_884 171
793 3300059647 Ga0587079_011606 Ga0587079_011606_719_1249 171
794 3300059647 Ga0587079_064212 Ga0587079_064212_113_646 171
795 3300059647 Ga0587079_068725 Ga0587079_068725_188_733 171
796 3300059648 Ga0587100_021036 Ga0587100_021036_73_603 171
797 3300059649 Ga0587102_002046 Ga0587102_002046_94_627 171
798 3300059649 Ga0587102_021193 Ga0587102_021193_113_646 171
799 3300059651 Ga0587105_000215 Ga0587105_000215_569_1102 171
800 3300059660 Ga0587124_014557 Ga0587124_014557_17_550 171
801 3300060344 Ga0587071_009901 Ga0587071_009901_582_1112 171
802 3300060344 Ga0587071_033121 Ga0587071_033121_445_978 171
803 3300060344 Ga0587071_039358 Ga0587071_039358_348_884 171
804 3300060344 Ga0587071_075072 Ga0587071_075072_82_615 171
805 3300060346 Ga0587111_0008531 Ga0587111_0008531_91_624 171
806 3300060346 Ga0587111_0068425 Ga0587111_0068425_209_742 171
807 3300061719 Ga0466962_0002106 Ga0466962_0002106_5674_6207 171
808 3300061719 Ga0466962_0003684 Ga0466962_0003684_4138_4671 171
809 3300061719 Ga0466962_0009729 Ga0466962_0009729_1394_1930 171
810 3300061719 Ga0466962_0153874 Ga0466962_0153874_471_1004 171
811 3300061719 Ga0466962_0316164 Ga0466962_0316164_60_590 171
812 3300005288 Ga0065714_10142132 Ga0065714_101421321 172
813 3300031995 Ga0307409_101390269 Ga0307409_1013902692 172
814 3300037471 Ga0395905_0032686 Ga0395905_0032686_3493_4035 172
815 3300044656 Ga0466969_0082322 Ga0466969_0082322_203_766 172
816 3300047447 Ga0495685_043635 Ga0495685_043635_696_1223 172
817 3300049575 Ga0501039_0298363 Ga0501039_0298363_297_830 172
818 iso_pu_bacteria 2510065053 2510282857 172
819 iso_pu_bacteria 2510065055 2510293530 172
820 iso_pu_bacteria 2510065058 2510310863 172
821 iso_pu_bacteria 2511231004 2511258299 172
822 iso_pu_bacteria 2511231006 2511265834 172
823 iso_pu_bacteria 2511231007 2511271749 172
824 iso_pu_bacteria 2511231008 2511279527 172
825 iso_pu_bacteria 2511231010 2511292837 172
826 iso_pu_bacteria 2511231011 2511294568 172
827 iso_pu_bacteria 2511231012 2511302312 172
828 iso_pu_bacteria 2511231014 2511313540 172
829 iso_pu_bacteria 2511231015 2511318036 172
830 iso_pu_bacteria 2511231016 2511325350 172
831 iso_pu_bacteria 2511231017 2511333190 172
832 iso_pu_bacteria 2511231018 2511340537 172
833 iso_pu_bacteria 2511231019 2511347464 172
834 iso_pu_bacteria 2511231020 2511349251 172
835 iso_pu_bacteria 2511231021 2511355336 172
836 iso_pu_bacteria 2511231022 2511363570 172
837 iso_pu_bacteria 2511231023 2511369933 172
838 iso_pu_bacteria 2511231024 2511373834 172
839 iso_pu_bacteria 2511231031 2511412173 172
840 iso_pu_bacteria 2511231156 2511827448 172
841 iso_pu_bacteria 2512047018 2512323831 172
842 iso_pu_bacteria 2554235132 2554818513 172
843 iso_pu_bacteria 2554235231 2555247018 172
844 iso_pu_bacteria 2554235341 2555672638 172
845 iso_pu_bacteria 2582580891 2583795137 172
846 iso_pu_bacteria 2597489887 2597860695 172
847 iso_pu_bacteria 2597489888 2597866434 172
848 iso_pu_bacteria 2597489889 2597872286 172
849 iso_pu_bacteria 2599185155 2599330674 172
850 iso_pu_bacteria 2599185160 2599356158 172
851 iso_pu_bacteria 2599185161 2599362443 172
852 iso_pu_bacteria 2599185162 2599369251 172
853 iso_pu_bacteria 2599185163 2599375552 172
854 iso_pu_bacteria 2599185164 2599381264 172
855 iso_pu_bacteria 2599185165 2599387220 172
856 iso_pu_bacteria 2599185166 2599394410 172
857 iso_pu_bacteria 2599185167 2599400732 172
858 iso_pu_bacteria 2599185168 2599406175 172
859 iso_pu_bacteria 2599185179 2599450059 172
860 iso_pu_bacteria 2599185181 2599462992 172
861 iso_pu_bacteria 2599185182 2599467588 172
862 iso_pu_bacteria 2599185185 2599486072 172
863 iso_pu_bacteria 2599185186 2599492009 172
864 iso_pu_bacteria 2599185188 2599502461 172
865 iso_pu_bacteria 2599185189 2599505567 172
866 iso_pu_bacteria 2599185190 2599512131 172
867 iso_pu_bacteria 2599185191 2599517113 172
868 iso_pu_bacteria 2599185212 2599614206 172
869 iso_pu_bacteria 2599185248 2599768355 172
870 iso_pu_bacteria 2599185257 2599804853 172
871 iso_pu_bacteria 2599185288 2599878852 172
872 iso_pu_bacteria 2599185289 2599885780 172
873 iso_pu_bacteria 2599185290 2599892507 172
874 iso_pu_bacteria 2599185291 2599897494 172
875 iso_pu_bacteria 2599185300 2599933843 172
876 iso_pu_bacteria 2599185302 2599942505 172
877 iso_pu_bacteria 2599185303 2599952320 172
878 iso_pu_bacteria 2599185304 2599954081 172
879 iso_pu_bacteria 2599185305 2599961599 172
880 iso_pu_bacteria 2599185306 2599965623 172
881 iso_pu_bacteria 2599185307 2599975082 172
882 iso_pu_bacteria 2599185308 2599979157 172
883 iso_pu_bacteria 2599185309 2599984743 172
884 iso_pu_bacteria 2599185310 2599988174 172
885 iso_pu_bacteria 2599185311 2599993830 172
886 iso_pu_bacteria 2599185312 2599998961 172
887 iso_pu_bacteria 2599185313 2600004516 172
888 iso_pu_bacteria 2599185314 2600013265 172
889 iso_pu_bacteria 2599185315 2600018600 172
890 iso_pu_bacteria 2599185316 2600026536 172
891 iso_pu_bacteria 2599185317 2600030130 172
892 iso_pu_bacteria 2599185318 2600036478 172
893 iso_pu_bacteria 2599185319 2600041787 172
894 iso_pu_bacteria 2599185320 2600046499 172
895 iso_pu_bacteria 2599185321 2600053228 172
896 iso_pu_bacteria 2599185322 2600060939 172
897 iso_pu_bacteria 2599185323 2600068115 172
898 iso_pu_bacteria 2599185324 2600073015 172
899 iso_pu_bacteria 2599185325 2600076736 172
900 iso_pu_bacteria 2599185356 2600215618 172
901 iso_pu_bacteria 2600254930 2600359585 172
902 iso_pu_bacteria 2600254931 2600366383 172
903 iso_pu_bacteria 2600254954 2600443960 172
904 iso_pu_bacteria 2600255283 2601628432 172
905 iso_pu_bacteria 2600255296 2601693633 172
906 iso_pu_bacteria 2600255313 2601775784 172
907 iso_pu_bacteria 2600255318 2601800979 172
908 iso_pu_bacteria 2600255389 2602008556 172
909 iso_pu_bacteria 2603880185 2606073072 172
910 iso_pu_bacteria 2603880199 2606125866 172
911 iso_pu_bacteria 2606217733 2608385355 172
912 iso_pu_bacteria 2619619299 2621297029 172
913 iso_pu_bacteria 2623620443 2624483217 172
914 iso_pu_bacteria 2623620446 2624494745 172
915 iso_pu_bacteria 2643221565 2643842779 172
916 iso_pu_bacteria 2643221571 2643872069 172
917 iso_pu_bacteria 2643221589 2643955824 172
918 iso_pu_bacteria 2643221602 2644020618 172
919 iso_pu_bacteria 2643221633 2644184678 172
920 iso_pu_bacteria 2643221650 2644284107 172
921 iso_pu_bacteria 2643221713 2644619966 172
922 iso_pu_bacteria 2651869719 2652548433 172
923 iso_pu_bacteria 2667528170 2671089353 172
924 iso_pu_bacteria 2667528171 2671099082 172
925 iso_pu_bacteria 2667528176 2671128851 172
926 iso_pu_bacteria 2671180172 2671771860 172
927 iso_pu_bacteria 2675903420 2677896936 172
928 iso_pu_bacteria 2675903515 2678265949 172
929 iso_pu_bacteria 2713897148 2715750016 172
930 iso_pu_bacteria 2713897149 2715756415 172
931 iso_pu_bacteria 2718217725 2718636421 172
932 iso_pu_bacteria 2721755607 2723251173 172
933 iso_pu_bacteria 2738541265 2738671850 172
934 iso_pu_bacteria 2738541271 2738690222 172
935 iso_pu_bacteria 2738541282 2738750244 172
936 iso_pu_bacteria 2738541294 2738807069 172
937 iso_pu_bacteria 2738541303 2738859284 172
938 iso_pu_bacteria 2738541309 2738894429 172
939 iso_pu_bacteria 2738543004 2739198868 172
940 iso_pu_bacteria 2738543015 2739258812 172
941 iso_pu_bacteria 2738543016 2739265996 172
942 iso_pu_bacteria 2738543020 2739285636 172
943 iso_pu_bacteria 2738543021 2739290949 172
944 iso_pu_bacteria 2738543025 2739312700 172
945 iso_pu_bacteria 2740892503 2743740239 172
946 iso_pu_bacteria 2744054620 2745007181 172
947 iso_pu_bacteria 2765235841 2765586454 172
948 iso_pu_bacteria 2773857670 2774118577 172
949 iso_pu_bacteria 2773857672 2774129344 172
950 iso_pu_bacteria 2773857673 2774135760 172
951 iso_pu_bacteria 2784132063 2784262012 172
952 iso_pu_bacteria 2784132072 2784313250 172
953 iso_pu_bacteria 2791355520 2794598642 172
954 iso_pu_bacteria 2806310737 2807406126 172
955 iso_pu_bacteria 2806310745 2807454478 172
956 iso_pu_bacteria 2808606361 2808855483 172
957 iso_pu_bacteria 2808606376 2808925481 172
958 iso_pu_bacteria 2808606377 2808928639 172
959 iso_pu_bacteria 2808606378 2808935380 172
960 iso_pu_bacteria 2808606379 2808942605 172
961 iso_pu_bacteria 2808606380 2808947636 172
962 iso_pu_bacteria 2808606381 2808950178 172
963 iso_pu_bacteria 2808606382 2808958800 172
964 iso_pu_bacteria 2808606383 2808963988 172
965 iso_pu_bacteria 2808606385 2808975947 172
966 iso_pu_bacteria 2808606388 2808993056 172
967 iso_pu_bacteria 2808606389 2808998876 172
968 iso_pu_bacteria 2808606445 2809216993 172
969 iso_pu_bacteria 2811994881 2812369313 172
970 iso_pu_bacteria 2816332298 2817493857 172
971 iso_pu_bacteria 2818991456 2819654941 172
972 iso_pu_bacteria 2818991464 2819704204 172
973 iso_pu_bacteria 2823421272 2823425585 172
974 iso_pu_bacteria 2825651385 2825655293 172
975 iso_pu_bacteria 2826581358 2826586809 172
976 iso_pu_bacteria 2834028612 2834030760 172
977 iso_pu_bacteria 2842805378 2842807298 172
978 iso_pu_bacteria 2842815866 2842819345 172
979 iso_pu_bacteria 2842826826 2842829196 172
980 iso_pu_bacteria 2842832357 2842833275 172
981 iso_pu_bacteria 2842837860 2842842051 172
982 iso_pu_bacteria 2842843487 2842845506 172
983 iso_pu_bacteria 2842849001 2842852323 172
984 iso_pu_bacteria 2842854478 2842855427 172
985 iso_pu_bacteria 2844665904 2844666811 172
986 iso_pu_bacteria 2852612431 2852616158 172
987 iso_pu_bacteria 2852657418 2852661942 172
988 iso_pu_bacteria 2852667396 2852671126 172
989 iso_pu_bacteria 2860339153 2860341526 172
990 iso_pu_bacteria 2860867994 2860872840 172
991 iso_pu_bacteria 2878029506 2878035156 172
992 iso_pu_bacteria 2880230671 2880235803 172
993 iso_pu_bacteria 2888373701 2888377440 172
994 iso_pu_bacteria 2904518522 2904519145 172
995 iso_pu_bacteria 2904550169 2904552224 172
996 iso_pu_bacteria 2908446538 2908452380 172
997 iso_pu_bacteria 2912963787 2912968725 172
998 iso_pu_bacteria 2913036834 2913042367 172
999 iso_pu_bacteria 2917070673 2917076532 172
1000 iso_pu_bacteria 2917832318 2917836774 172
1001 iso_pu_bacteria 2919063839 2919065711 172
1002 iso_pu_bacteria 2919125081 2919125993 172
1003 iso_pu_bacteria 2919155634 2919155760 172
1004 iso_pu_bacteria 2919385768 2919389384 172
1005 iso_pu_bacteria 2919456309 2919457358 172
1006 iso_pu_bacteria 2919481497 2919486797 172
1007 iso_pu_bacteria 2919487758 2919488350 172
1008 iso_pu_bacteria 2919501602 2919502322 172
1009 iso_pu_bacteria 2919697872 2919700762 172
1010 iso_pu_bacteria 2923153595 2923159331 172
1011 iso_pu_bacteria 2923519811 2923523398 172
1012 iso_pu_bacteria 2923586266 2923592231 172
1013 iso_pu_bacteria 2926063275 2926063995 172
1014 iso_pu_bacteria 2929144301 2929149752 172
1015 iso_pu_bacteria 2929189879 2929194952 172
1016 iso_pu_bacteria 2931369376 2931372844 172
1017 iso_pu_bacteria 2931390751 2931396226 172
1018 iso_pu_bacteria 2931396565 2931397879 172
1019 iso_pu_bacteria 2935353572 2935358499 172
1020 iso_pu_bacteria 2939636861 2939642060 172
1021 iso_pu_bacteria 2939651529 2939654065 172
1022 iso_pu_bacteria 2945928738 2945931103 172
1023 iso_pu_bacteria 2945961074 2945966650 172
1024 iso_pu_bacteria 2946006987 2946007127 172
1025 iso_pu_bacteria 2946027586 2946027715 172
1026 iso_pu_bacteria 2947233263 2947234229 172
1027 iso_pu_bacteria 2952252522 2952254554 172
1028 iso_pu_bacteria 2969304461 2969309981 172
1029 iso_pu_bacteria 2974289157 2974294267 172
1030 iso_pu_bacteria 2974298342 2974302485 172
1031 iso_pu_bacteria 2984286254 2984286810 172
1032 iso_pu_bacteria 2984499530 2984499966 172
1033 iso_pu_bacteria 2984504281 2984506384 172
1034 iso_pu_bacteria 2988728565 2988731298 172
1035 iso_pu_bacteria 2998139840 2998145206 172
1036 iso_pu_bacteria 3007252601 3007254796 172
1037 iso_pu_bacteria 3007315729 3007316494 172
1038 iso_pu_bacteria 3007395558 3007399588 172
1039 iso_pu_bacteria 3007419365 3007425549 172
1040 iso_pu_bacteria 3007511990 3007516999 172
1041 iso_pu_bacteria 3007614139 3007617753 172
1042 iso_pu_bacteria 3007619802 3007622135 172
1043 iso_pu_bacteria 3007718800 3007722109 172
1044 iso_pu_bacteria 3007803356 3007805344 172
1045 iso_pu_bacteria 3007855910 3007858086 172
1046 iso_pu_bacteria 3007861166 3007865292 172
1047 iso_pu_bacteria 3007866637 3007866945 172
1048 iso_pu_bacteria 3007872151 3007873187 172
1049 iso_pu_bacteria 637000220 637323076 172
1050 iso_pu_bacteria 8002745576 8002748791 172
1051 iso_pu_bacteria 8011350971 8011354551 172
1052 iso_pu_bacteria 8015687852 8015693427 172
1053 iso_pu_bacteria 8016728285 8016731613 172
1054 iso_pu_bacteria 8019769354 8019769961 172
1055 iso_pu_bacteria 8019775933 8019777870 172
1056 iso_pu_bacteria 8029995093 8029995690 172
1057 iso_pu_bacteria 8034962539 8034963532 172
1058 iso_pu_bacteria 8052494512 8052499657 172
1059 iso_pu_bacteria 8054285046 8054286823 172
1060 iso_pu_bacteria 8054347763 8054349766 172
1061 iso_pu_bacteria 8054503363 8054508742 172
1062 iso_pu_bacteria 8054929484 8054934165 172
1063 iso_pu_bacteria 8055770955 8055776674 172
1064 iso_pu_bacteria 8055817908 8055823703 172
1065 iso_pu_bacteria 8055878733 8055883157 172
1066 iso_pu_bacteria 8056115690 8056115978 172
1067 iso_pu_bacteria 8056120720 8056121058 172
1068 iso_pu_bacteria 8056125926 8056131417 172
1069 iso_pu_bacteria 8056131705 8056137123 172
1070 iso_pu_bacteria 8056137416 8056137775 172
1071 iso_pu_bacteria 8056143049 8056148573 172
1072 iso_pu_bacteria 8056148874 8056151691 172
1073 iso_pu_bacteria 8056155041 8056160654 172
1074 iso_pu_bacteria 8056161164 8056163428 172
1075 iso_pu_bacteria 8056166840 8056171361 172
1076 iso_pu_bacteria 8056172158 8056177603 172
1077 iso_pu_bacteria 8056177738 8056181815 172
1078 iso_pu_bacteria 8056569372 8056570276 172
1079 iso_pu_bacteria 8057798959 8057801743 172
1080 3300009177 Ga0105248_10640824 Ga0105248_106408242 173
1081 3300010375 Ga0105239_10002079 Ga0105239_1000207913 173
1082 3300014325 Ga0163163_10671412 Ga0163163_106714122 173
1083 3300027666 Ga0209282_1109673 Ga0209282_11096732 173
1084 3300039447 Ga0436361_1024429 Ga0436361_1024429_159_731 173
1085 3300044656 Ga0466969_0068969 Ga0466969_0068969_553_1140 174
1086 3300044693 Ga0466961_0144769 Ga0466961_0144769_651_1238 174
1087 3300045049 Ga0466959_0001367 Ga0466959_0001367_13750_14337 174
1088 3300009036 Ga0105244_10002181 Ga0105244_1000218113 175
1089 3300013307 Ga0157372_10063189 Ga0157372_100631893 175
1090 3300013307 Ga0157372_10090525 Ga0157372_100905252 175
1091 3300025728 Ga0207655_1000007 Ga0207655_1000007384 175
1092 3300025728 Ga0207655_1164587 Ga0207655_11645871 175
1093 3300048919 Ga0496116_0001275 Ga0496116_0001275_25213_25740 175
1094 3300048923 Ga0496120_0000126 Ga0496120_0000126_58509_59036 175
1095 3300048927 Ga0496124_0000967 Ga0496124_0000967_6559_7086 175
1096 2124908027 MRS2a_Contig_111 MRS2a_00013820 176
1097 3300002737 JGI25162J39368_1000076 JGI25162J39368_100007639 176
1098 3300002738 JGI25154J39366_1015861 JGI25154J39366_10158612 176
1099 3300002771 JGI25163J39215_1001848 JGI25163J39215_10018482 176
1100 3300002772 JGI25164J39214_1000083 JGI25164J39214_100008345 176
1101 3300002772 JGI25164J39214_1000084 JGI25164J39214_100008439 176
1102 3300003214 JGI25165J46597_1000140 JGI25165J46597_100014066 176
1103 3300003214 JGI25165J46597_1000186 JGI25165J46597_100018642 176
1104 3300003578 Ga0006562J51391_1006636 Ga0006562J51391_10066362 176
1105 3300003751 Ga0055538_1000095 Ga0055538_10000959 176
1106 3300003752 Ga0055539_1000139 Ga0055539_10001399 176
1107 3300003756 Ga0055533_1000145 Ga0055533_10001459 176
1108 3300003758 Ga0055532_1000128 Ga0055532_100012857 176
1109 3300003759 Ga0055525_1000190 Ga0055525_10001909 176
1110 3300003761 Ga0055535_1004327 Ga0055535_10043273 176
1111 3300003781 Ga0055536_1000764 Ga0055536_10007642 176
1112 3300003781 Ga0055536_1011893 Ga0055536_10118932 176
1113 3300003791 Ga0055530_10009302 Ga0055530_100093023 176
1114 3300003792 Ga0055540_1000452 Ga0055540_10004522 176
1115 3300003794 Ga0055531_10000109 Ga0055531_1000010935 176
1116 3300003841 Ga0055541_1000093 Ga0055541_100009357 176
1117 3300005288 Ga0065714_10000596 Ga0065714_100005964 176
1118 3300005288 Ga0065714_10002541 Ga0065714_100025417 176
1119 3300005288 Ga0065714_10006685 Ga0065714_100066852 176
1120 3300005288 Ga0065714_10051673 Ga0065714_100516731 176
1121 3300005288 Ga0065714_10066645 Ga0065714_100666452 176
1122 3300005288 Ga0065714_10117165 Ga0065714_101171651 176
1123 3300005288 Ga0065714_10223962 Ga0065714_102239622 176
1124 3300005288 Ga0065714_10288258 Ga0065714_102882581 176
1125 3300005289 Ga0065704_10000995 Ga0065704_100009952 176
1126 3300005289 Ga0065704_10034078 Ga0065704_100340781 176
1127 3300005289 Ga0065704_10201950 Ga0065704_102019502 176
1128 3300005289 Ga0065704_10424606 Ga0065704_104246061 176
1129 3300005290 Ga0065712_10067838 Ga0065712_1006783812 176
1130 3300005293 Ga0065715_10007584 Ga0065715_100075842 176
1131 3300005328 Ga0070676_10180759 Ga0070676_101807592 176
1132 3300005331 Ga0070670_100007436 Ga0070670_1000074362 176
1133 3300005344 Ga0070661_100000038 Ga0070661_10000003821 176
1134 3300005353 Ga0070669_100000248 Ga0070669_10000024843 176
1135 3300005353 Ga0070669_100066159 Ga0070669_1000661592 176
1136 3300005366 Ga0070659_100239763 Ga0070659_1002397632 176
1137 3300005435 Ga0070714_100629501 Ga0070714_1006295012 176
1138 3300005457 Ga0070662_100000423 Ga0070662_1000004237 176
1139 3300005457 Ga0070662_100088025 Ga0070662_1000880252 176
1140 3300005539 Ga0068853_100000155 Ga0068853_1000001559 176
1141 3300005548 Ga0070665_100492023 Ga0070665_1004920232 176
1142 3300005548 Ga0070665_101072000 Ga0070665_1010720002 176
1143 3300005548 Ga0070665_101945906 Ga0070665_1019459061 176
1144 3300005564 Ga0070664_100002818 Ga0070664_1000028182 176
1145 3300005578 Ga0068854_100004356 Ga0068854_1000043562 176
1146 3300005834 Ga0068851_10000012 Ga0068851_1000001264 176
1147 3300006048 Ga0075363_100202386 Ga0075363_1002023862 176
1148 3300006058 Ga0075432_10040746 Ga0075432_100407462 176
1149 3300006058 Ga0075432_10059931 Ga0075432_100599312 176
1150 3300006058 Ga0075432_10122923 Ga0075432_101229232 176
1151 3300006058 Ga0075432_10149183 Ga0075432_101491832 176
1152 3300006058 Ga0075432_10152952 Ga0075432_101529521 176
1153 3300006177 Ga0075362_10077500 Ga0075362_100775001 176
1154 3300006186 Ga0075369_10276721 Ga0075369_102767211 176
1155 3300006194 Ga0075427_10052499 Ga0075427_100524991 176
1156 3300006914 Ga0075436_100479195 Ga0075436_1004791952 176
1157 3300006944 Ga0099823_1000137 Ga0099823_100013722 176
1158 3300006944 Ga0099823_1051170 Ga0099823_10511702 176
1159 3300006946 Ga0079104_1000322 Ga0079104_100032231 176
1160 3300006946 Ga0079104_1000338 Ga0079104_100033836 176
1161 3300009011 Ga0105251_10000019 Ga0105251_1000001990 176
1162 3300009011 Ga0105251_10000542 Ga0105251_100005422 176
1163 3300009011 Ga0105251_10006346 Ga0105251_100063462 176
1164 3300009011 Ga0105251_10006467 Ga0105251_100064677 176
1165 3300009011 Ga0105251_10012349 Ga0105251_100123492 176
1166 3300009011 Ga0105251_10023834 Ga0105251_100238342 176
1167 3300009011 Ga0105251_10027925 Ga0105251_100279252 176
1168 3300009011 Ga0105251_10065832 Ga0105251_100658322 176
1169 3300009011 Ga0105251_10077797 Ga0105251_100777972 176
1170 3300009011 Ga0105251_10154236 Ga0105251_101542361 176
1171 3300009011 Ga0105251_10214615 Ga0105251_102146152 176
1172 3300009011 Ga0105251_10234814 Ga0105251_102348142 176
1173 3300009036 Ga0105244_10000417 Ga0105244_100004176 176
1174 3300009036 Ga0105244_10006408 Ga0105244_100064082 176
1175 3300009036 Ga0105244_10006864 Ga0105244_100068642 176
1176 3300009036 Ga0105244_10021397 Ga0105244_100213972 176
1177 3300009036 Ga0105244_10044510 Ga0105244_100445102 176
1178 3300009036 Ga0105244_10062006 Ga0105244_100620062 176
1179 3300009036 Ga0105244_10074841 Ga0105244_100748412 176
1180 3300009036 Ga0105244_10113371 Ga0105244_101133712 176
1181 3300009036 Ga0105244_10125489 Ga0105244_101254892 176
1182 3300009036 Ga0105244_10151667 Ga0105244_101516672 176
1183 3300009036 Ga0105244_10179832 Ga0105244_101798322 176
1184 3300009036 Ga0105244_10196762 Ga0105244_101967622 176
1185 3300009036 Ga0105244_10209653 Ga0105244_102096532 176
1186 3300009036 Ga0105244_10212566 Ga0105244_102125662 176
1187 3300009036 Ga0105244_10326496 Ga0105244_103264961 176
1188 3300009092 Ga0105250_10000563 Ga0105250_1000056313 176
1189 3300009092 Ga0105250_10000709 Ga0105250_1000070919 176
1190 3300009092 Ga0105250_10025779 Ga0105250_100257792 176
1191 3300009092 Ga0105250_10083222 Ga0105250_100832222 176
1192 3300009092 Ga0105250_10090213 Ga0105250_100902131 176
1193 3300009092 Ga0105250_10167291 Ga0105250_101672911 176
1194 3300009092 Ga0105250_10197655 Ga0105250_101976552 176
1195 3300009092 Ga0105250_10198210 Ga0105250_101982101 176
1196 3300009148 Ga0105243_10000325 Ga0105243_1000032531 176
1197 3300009148 Ga0105243_10003183 Ga0105243_1000318311 176
1198 3300009148 Ga0105243_10007615 Ga0105243_100076152 176
1199 3300009148 Ga0105243_10020292 Ga0105243_100202926 176
1200 3300009148 Ga0105243_10377983 Ga0105243_103779831 176
1201 3300009148 Ga0105243_10558101 Ga0105243_105581012 176
1202 3300009148 Ga0105243_11119613 Ga0105243_111196132 176
1203 3300009148 Ga0105243_11859999 Ga0105243_118599991 176
1204 3300009176 Ga0105242_10000846 Ga0105242_100008466 176
1205 3300009176 Ga0105242_11060105 Ga0105242_110601051 176
1206 3300009545 Ga0105237_10000756 Ga0105237_1000075614 176
1207 3300009553 Ga0105249_10253643 Ga0105249_102536432 176
1208 3300011119 Ga0105246_10005716 Ga0105246_100057162 176
1209 3300011119 Ga0105246_10072921 Ga0105246_100729211 176
1210 3300011119 Ga0105246_10272649 Ga0105246_102726492 176
1211 3300011119 Ga0105246_10716170 Ga0105246_107161701 176
1212 3300012498 Ga0157345_1000797 Ga0157345_10007972 176
1213 3300013100 Ga0157373_10048867 Ga0157373_100488674 176
1214 3300013100 Ga0157373_10184475 Ga0157373_101844752 176
1215 3300013100 Ga0157373_10591262 Ga0157373_105912622 176
1216 3300013100 Ga0157373_11060393 Ga0157373_110603931 176
1217 3300013102 Ga0157371_10192771 Ga0157371_101927712 176
1218 3300013102 Ga0157371_10212686 Ga0157371_102126862 176
1219 3300013102 Ga0157371_10413781 Ga0157371_104137811 176
1220 3300013102 Ga0157371_10456965 Ga0157371_104569652 176
1221 3300013104 Ga0157370_10000086 Ga0157370_1000008638 176
1222 3300013104 Ga0157370_10155885 Ga0157370_101558852 176
1223 3300013104 Ga0157370_10708071 Ga0157370_107080712 176
1224 3300013104 Ga0157370_10835041 Ga0157370_108350412 176
1225 3300013105 Ga0157369_10004872 Ga0157369_100048723 176
1226 3300013105 Ga0157369_10743561 Ga0157369_107435612 176
1227 3300013105 Ga0157369_10808121 Ga0157369_108081212 176
1228 3300013105 Ga0157369_11829878 Ga0157369_118298781 176
1229 3300013297 Ga0157378_10471771 Ga0157378_104717712 176
1230 3300013306 Ga0163162_10436994 Ga0163162_104369942 176
1231 3300013307 Ga0157372_10001060 Ga0157372_1000106020 176
1232 3300013307 Ga0157372_10143368 Ga0157372_101433683 176
1233 3300013307 Ga0157372_10325218 Ga0157372_103252182 176
1234 3300013308 Ga0157375_10365139 Ga0157375_103651392 176
1235 3300014497 Ga0182008_10001464 Ga0182008_100014641 176
1236 3300014497 Ga0182008_10291886 Ga0182008_102918862 176
1237 3300015261 Ga0182006_1003771 Ga0182006_10037712 176
1238 3300015261 Ga0182006_1078932 Ga0182006_10789322 176
1239 3300015261 Ga0182006_1106463 Ga0182006_11064632 176
1240 3300015262 Ga0182007_10121479 Ga0182007_101214791 176
1241 3300015265 Ga0182005_1190854 Ga0182005_11908541 176
1242 3300017792 Ga0163161_10151963 Ga0163161_101519632 176
1243 3300017792 Ga0163161_10907523 Ga0163161_109075232 176
1244 3300017792 Ga0163161_11032598 Ga0163161_110325982 176
1245 3300025206 Ga0209435_100436 Ga0209435_1004362 176
1246 3300025207 Ga0209760_100098 Ga0209760_10009834 176
1247 3300025207 Ga0209760_100101 Ga0209760_10010117 176
1248 3300025224 Ga0209784_100007 Ga0209784_100007572 176
1249 3300025225 Ga0209566_100062 Ga0209566_10006257 176
1250 3300025226 Ga0209674_100021 Ga0209674_100021572 176
1251 3300025229 Ga0209147_100009 Ga0209147_100009572 176
1252 3300025230 Ga0209563_100018 Ga0209563_100018572 176
1253 3300025230 Ga0209563_100395 Ga0209563_1003956 176
1254 3300025231 Ga0207427_100005 Ga0207427_100005135 176
1255 3300025231 Ga0207427_100006 Ga0207427_100006626 176
1256 3300025231 Ga0207427_110510 Ga0207427_1105101 176
1257 3300025233 Ga0209437_100013 Ga0209437_100013626 176
1258 3300025233 Ga0209437_100018 Ga0209437_10001845 176
1259 3300025233 Ga0209437_104789 Ga0209437_1047892 176
1260 3300025242 Ga0209258_100330 Ga0209258_10033016 176
1261 3300025246 Ga0209646_1000400 Ga0209646_10004009 176
1262 3300025253 Ga0209677_100056 Ga0209677_10005657 176
1263 3300025256 Ga0209759_1018458 Ga0209759_10184582 176
1264 3300025256 Ga0209759_1021767 Ga0209759_10217672 176
1265 3300025261 Ga0209233_1000021 Ga0209233_1000021135 176
1266 3300025261 Ga0209233_1000022 Ga0209233_1000022626 176
1267 3300025291 Ga0209675_1006697 Ga0209675_10066973 176
1268 3300025292 Ga0209676_1000015 Ga0209676_1000015603 176
1269 3300025292 Ga0209676_1000030 Ga0209676_100003080 176
1270 3300025292 Ga0209676_1000041 Ga0209676_1000041355 176
1271 3300025292 Ga0209676_1000548 Ga0209676_10005482 176
1272 3300025292 Ga0209676_1004486 Ga0209676_10044861 176
1273 3300025298 Ga0209050_1000024 Ga0209050_1000024371 176
1274 3300025298 Ga0209050_1000075 Ga0209050_100007590 176
1275 3300025298 Ga0209050_1000128 Ga0209050_1000128125 176
1276 3300025298 Ga0209050_1002450 Ga0209050_100245014 176
1277 3300025303 Ga0209051_1000012 Ga0209051_100001280 176
1278 3300025303 Ga0209051_1000023 Ga0209051_1000023287 176
1279 3300025303 Ga0209051_1000041 Ga0209051_1000041123 176
1280 3300025303 Ga0209051_1007648 Ga0209051_10076482 176
1281 3300025304 Ga0209257_1000069 Ga0209257_1000069186 176
1282 3300025304 Ga0209257_1007474 Ga0209257_10074747 176
1283 3300025321 Ga0207656_10000006 Ga0207656_10000006253 176
1284 3300025711 Ga0207696_1000031 Ga0207696_100003144 176
1285 3300025711 Ga0207696_1000064 Ga0207696_100006464 176
1286 3300025711 Ga0207696_1000094 Ga0207696_1000094132 176
1287 3300025711 Ga0207696_1000095 Ga0207696_100009564 176
1288 3300025711 Ga0207696_1000149 Ga0207696_100014929 176
1289 3300025711 Ga0207696_1004438 Ga0207696_10044386 176
1290 3300025711 Ga0207696_1004760 Ga0207696_10047607 176
1291 3300025711 Ga0207696_1006915 Ga0207696_10069151 176
1292 3300025711 Ga0207696_1013636 Ga0207696_10136361 176
1293 3300025711 Ga0207696_1059603 Ga0207696_10596032 176
1294 3300025728 Ga0207655_1000068 Ga0207655_1000068126 176
1295 3300025728 Ga0207655_1000107 Ga0207655_100010719 176
1296 3300025728 Ga0207655_1000455 Ga0207655_100045536 176
1297 3300025728 Ga0207655_1001758 Ga0207655_10017587 176
1298 3300025728 Ga0207655_1002516 Ga0207655_10025162 176
1299 3300025728 Ga0207655_1002730 Ga0207655_10027301 176
1300 3300025728 Ga0207655_1002939 Ga0207655_10029398 176
1301 3300025728 Ga0207655_1005320 Ga0207655_10053205 176
1302 3300025728 Ga0207655_1005323 Ga0207655_10053237 176
1303 3300025728 Ga0207655_1009161 Ga0207655_10091614 176
1304 3300025728 Ga0207655_1018841 Ga0207655_10188413 176
1305 3300025728 Ga0207655_1028195 Ga0207655_10281951 176
1306 3300025728 Ga0207655_1053962 Ga0207655_10539622 176
1307 3300025728 Ga0207655_1178649 Ga0207655_11786491 176
1308 3300025728 Ga0207655_1208568 Ga0207655_12085681 176
1309 3300025735 Ga0207713_1000010 Ga0207713_1000010138 176
1310 3300025735 Ga0207713_1000081 Ga0207713_100008162 176
1311 3300025735 Ga0207713_1000307 Ga0207713_100030721 176
1312 3300025735 Ga0207713_1000511 Ga0207713_10005119 176
1313 3300025735 Ga0207713_1001808 Ga0207713_10018082 176
1314 3300025735 Ga0207713_1002377 Ga0207713_10023776 176
1315 3300025735 Ga0207713_1004870 Ga0207713_10048702 176
1316 3300025735 Ga0207713_1006244 Ga0207713_10062443 176
1317 3300025735 Ga0207713_1011807 Ga0207713_10118074 176
1318 3300025735 Ga0207713_1017287 Ga0207713_10172872 176
1319 3300025735 Ga0207713_1018158 Ga0207713_10181582 176
1320 3300025735 Ga0207713_1018668 Ga0207713_10186682 176
1321 3300025735 Ga0207713_1020156 Ga0207713_10201562 176
1322 3300025735 Ga0207713_1026512 Ga0207713_10265124 176
1323 3300025735 Ga0207713_1031868 Ga0207713_10318682 176
1324 3300025735 Ga0207713_1045297 Ga0207713_10452972 176
1325 3300025735 Ga0207713_1048313 Ga0207713_10483132 176
1326 3300025735 Ga0207713_1050074 Ga0207713_10500742 176
1327 3300025911 Ga0207654_10507425 Ga0207654_105074251 176
1328 3300025914 Ga0207671_10000299 Ga0207671_1000029925 176
1329 3300025920 Ga0207649_10000022 Ga0207649_1000002291 176
1330 3300025923 Ga0207681_10000384 Ga0207681_100003849 176
1331 3300025923 Ga0207681_10013092 Ga0207681_100130922 176
1332 3300025925 Ga0207650_10000138 Ga0207650_1000013815 176
1333 3300025925 Ga0207650_10000735 Ga0207650_1000073520 176
1334 3300025929 Ga0207664_10970221 Ga0207664_109702212 176
1335 3300025932 Ga0207690_10602187 Ga0207690_106021872 176
1336 3300025933 Ga0207706_10000290 Ga0207706_1000029013 176
1337 3300025933 Ga0207706_10059986 Ga0207706_100599863 176
1338 3300025934 Ga0207686_10019741 Ga0207686_100197415 176
1339 3300025934 Ga0207686_10071769 Ga0207686_100717692 176
1340 3300025935 Ga0207709_10000086 Ga0207709_1000008638 176
1341 3300025935 Ga0207709_10000096 Ga0207709_1000009641 176
1342 3300025935 Ga0207709_10002767 Ga0207709_100027673 176
1343 3300025935 Ga0207709_10005890 Ga0207709_100058907 176
1344 3300025935 Ga0207709_10153078 Ga0207709_101530782 176
1345 3300025935 Ga0207709_10273361 Ga0207709_102733612 176
1346 3300025937 Ga0207669_10265808 Ga0207669_102658081 176
1347 3300025945 Ga0207679_10000027 Ga0207679_1000002743 176
1348 3300025961 Ga0207712_10136731 Ga0207712_101367312 176
1349 3300025981 Ga0207640_10035401 Ga0207640_100354013 176
1350 3300026041 Ga0207639_10000442 Ga0207639_1000044216 176
1351 3300027111 Ga0209281_1000016 Ga0209281_1000016127 176
1352 3300027111 Ga0209281_1000019 Ga0209281_1000019409 176
1353 3300027111 Ga0209281_1015383 Ga0209281_10153832 176
1354 3300027296 Ga0209389_1000195 Ga0209389_100019520 176
1355 3300027296 Ga0209389_1044274 Ga0209389_10442743 176
1356 3300027312 Ga0209371_1000066 Ga0209371_1000066150 176
1357 3300027312 Ga0209371_1003220 Ga0209371_10032208 176
1358 3300027378 Ga0209981_1017575 Ga0209981_10175751 176
1359 3300027552 Ga0209982_1018467 Ga0209982_10184672 176
1360 3300027614 Ga0209970_1015628 Ga0209970_10156282 176
1361 3300027876 Ga0209974_10058877 Ga0209974_100588772 176
1362 3300027907 Ga0207428_10009753 Ga0207428_100097536 176
1363 3300027907 Ga0207428_10349858 Ga0207428_103498581 176
1364 3300027907 Ga0207428_10448691 Ga0207428_104486912 176
1365 3300028379 Ga0268266_10114843 Ga0268266_101148432 176
1366 3300028379 Ga0268266_10823950 Ga0268266_108239502 176
1367 3300030500 Ga0268256_1000063 Ga0268256_1000063150 176
1368 3300030500 Ga0268256_1001416 Ga0268256_10014165 176
1369 3300030732 Ga0316176_1139831 Ga0316176_11398312 176
1370 3300030733 Ga0314311_1125624 Ga0314311_11256242 176
1371 3300030734 Ga0316179_1002808 Ga0316179_10028082 176
1372 3300030735 Ga0316178_1083275 Ga0316178_108327523 176
1373 3300030744 Ga0316181_1005751 Ga0316181_10057512 176
1374 3300031548 Ga0307408_100000002 Ga0307408_100000002272 176
1375 3300031548 Ga0307408_100736009 Ga0307408_1007360091 176
1376 3300031548 Ga0307408_101320937 Ga0307408_1013209371 176
1377 3300031731 Ga0307405_10657798 Ga0307405_106577982 176
1378 3300031824 Ga0307413_10163090 Ga0307413_101630902 176
1379 3300031901 Ga0307406_10991834 Ga0307406_109918342 176
1380 3300031911 Ga0307412_10267713 Ga0307412_102677132 176
1381 3300032002 Ga0307416_100182275 Ga0307416_1001822751 176
1382 3300032004 Ga0307414_10460059 Ga0307414_104600592 176
1383 3300032005 Ga0307411_10280699 Ga0307411_102806992 176
1384 3300033180 Ga0307510_10035520 Ga0307510_100355203 176
1385 3300037471 Ga0395905_0215767 Ga0395905_0215767_616_1191 176
1386 3300038705 Ga0237819_03039 Ga0237819_03039_1445_1975 176
1387 3300041404 Ga0439436_0042762 Ga0439436_0042762_565_1095 176
1388 3300041405 Ga0439438_015011 Ga0439438_015011_1125_1655 176
1389 3300041405 Ga0439438_024273 Ga0439438_024273_114_644 176
1390 3300041405 Ga0439438_088737 Ga0439438_088737_21_551 176
1391 3300041407 Ga0439447_008617 Ga0439447_008617_1893_2423 176
1392 3300041407 Ga0439447_011715 Ga0439447_011715_300_830 176
1393 3300041411 Ga0439466_0005646 Ga0439466_0005646_1592_2122 176
1394 3300041411 Ga0439466_0026215 Ga0439466_0026215_1362_1892 176
1395 3300041411 Ga0439466_0033891 Ga0439466_0033891_316_846 176
1396 3300041411 Ga0439466_0043859 Ga0439466_0043859_636_1166 176
1397 3300041486 Ga0451807_2026621 Ga0451807_2026621_209_739 176
1398 3300041509 Ga0451843_0886000 Ga0451843_0886000_314_844 176
1399 3300042006 Ga0439432_023353 Ga0439432_023353_68_598 176
1400 3300042009 Ga0439451_016205 Ga0439451_016205_637_1167 176
1401 3300042010 Ga0439452_000728 Ga0439452_000728_14260_14790 176
1402 3300042010 Ga0439452_009508 Ga0439452_009508_1695_2225 176
1403 3300042010 Ga0439452_033599 Ga0439452_033599_602_1132 176
1404 3300042010 Ga0439452_089382 Ga0439452_089382_51_581 176
1405 3300042013 Ga0439456_010104 Ga0439456_010104_1238_1768 176
1406 3300042013 Ga0439456_029395 Ga0439456_029395_345_875 176
1407 3300042013 Ga0439456_098190 Ga0439456_098190_21_551 176
1408 3300042016 Ga0439463_018423 Ga0439463_018423_907_1437 176
1409 3300042016 Ga0439463_071792 Ga0439463_071792_332_862 176
1410 3300042115 Ga0450911_004367 Ga0450911_004367_773_1303 176
1411 3300042115 Ga0450911_017530 Ga0450911_017530_139_669 176
1412 3300042127 Ga0450890_002721 Ga0450890_002721_1450_1980 176
1413 3300042136 Ga0450900_014225 Ga0450900_014225_394_924 176
1414 3300042138 Ga0450903_005417 Ga0450903_005417_138_668 176
1415 3300042139 Ga0450904_003726 Ga0450904_003726_794_1324 176
1416 3300042142 Ga0450905_005260 Ga0450905_005260_514_1044 176
1417 3300042145 Ga0450906_006219 Ga0450906_006219_1623_2153 176
1418 3300042146 Ga0450907_000587 Ga0450907_000587_216_746 176
1419 3300042146 Ga0450907_002130 Ga0450907_002130_2655_3185 176
1420 3300042156 Ga0439446_0006010 Ga0439446_0006010_2348_2878 176
1421 3300042156 Ga0439446_0055313 Ga0439446_0055313_382_912 176
1422 3300042184 Ga0450908_038983 Ga0450908_038983_208_738 176
1423 3300042185 Ga0450909_011634 Ga0450909_011634_706_1236 176
1424 3300042439 Ga0439464_0013453 Ga0439464_0013453_1038_1568 176
1425 3300042439 Ga0439464_0107026 Ga0439464_0107026_115_645 176
1426 3300042461 Ga0439460_0009609 Ga0439460_0009609_1623_2153 176
1427 3300042531 Ga0450918_022186 Ga0450918_022186_508_1038 176
1428 3300042533 Ga0450901_007013 Ga0450901_007013_455_985 176
1429 3300046452 Ga0495617_077854 Ga0495617_077854_486_1016 176
1430 3300046453 Ga0495627_000073 Ga0495627_000073_29741_30271 176
1431 3300046453 Ga0495627_001834 Ga0495627_001834_6375_6905 176
1432 3300046453 Ga0495627_006045 Ga0495627_006045_4009_4539 176
1433 3300046453 Ga0495627_017519 Ga0495627_017519_1394_1924 176
1434 3300046458 Ga0495591_001276 Ga0495591_001276_3678_4208 176
1435 3300046458 Ga0495591_007032 Ga0495591_007032_2170_2700 176
1436 3300046458 Ga0495591_029212 Ga0495591_029212_769_1299 176
1437 3300046458 Ga0495591_050877 Ga0495591_050877_83_613 176
1438 3300046460 Ga0495638_0110718 Ga0495638_0110718_351_881 176
1439 3300046460 Ga0495638_0283298 Ga0495638_0283298_89_619 176
1440 3300046463 Ga0495653_0071418 Ga0495653_0071418_262_792 176
1441 3300046463 Ga0495653_0089718 Ga0495653_0089718_172_702 176
1442 3300046471 Ga0495650_0005961 Ga0495650_0005961_1187_1717 176
1443 3300046471 Ga0495650_0027642 Ga0495650_0027642_1806_2336 176
1444 3300046474 Ga0495605_0000019 Ga0495605_0000019_129577_130107 176
1445 3300046474 Ga0495605_0000342 Ga0495605_0000342_18367_18897 176
1446 3300046474 Ga0495605_0016413 Ga0495605_0016413_2399_2929 176
1447 3300046474 Ga0495605_0116059 Ga0495605_0116059_31_561 176
1448 3300046474 Ga0495605_0175880 Ga0495605_0175880_130_660 176
1449 3300046491 Ga0495584_0001972 Ga0495584_0001972_10832_11362 176
1450 3300046491 Ga0495584_0246831 Ga0495584_0246831_59_589 176
1451 3300046492 Ga0495585_0112494 Ga0495585_0112494_748_1278 176
1452 3300046492 Ga0495585_0241404 Ga0495585_0241404_329_859 176
1453 3300046499 Ga0495594_0001675 Ga0495594_0001675_5866_6396 176
1454 3300046500 Ga0495596_0153768 Ga0495596_0153768_104_634 176
1455 3300046501 Ga0495607_0000773 Ga0495607_0000773_1252_1782 176
1456 3300046501 Ga0495607_0001163 Ga0495607_0001163_22413_22976 176
1457 3300046501 Ga0495607_0002362 Ga0495607_0002362_13945_14475 176
1458 3300046501 Ga0495607_0005030 Ga0495607_0005030_8858_9388 176
1459 3300046501 Ga0495607_0030889 Ga0495607_0030889_432_962 176
1460 3300046501 Ga0495607_0032490 Ga0495607_0032490_1623_2153 176
1461 3300046501 Ga0495607_0043713 Ga0495607_0043713_909_1439 176
1462 3300046501 Ga0495607_0052720 Ga0495607_0052720_1609_2139 176
1463 3300046501 Ga0495607_0077872 Ga0495607_0077872_114_644 176
1464 3300046501 Ga0495607_0104069 Ga0495607_0104069_206_736 176
1465 3300046501 Ga0495607_0164793 Ga0495607_0164793_202_732 176
1466 3300046501 Ga0495607_0244881 Ga0495607_0244881_131_661 176
1467 3300046506 Ga0495583_0000097 Ga0495583_0000097_19763_20293 176
1468 3300046506 Ga0495583_0002802 Ga0495583_0002802_13029_13559 176
1469 3300046506 Ga0495583_0030641 Ga0495583_0030641_395_925 176
1470 3300046507 Ga0495606_0000862 Ga0495606_0000862_27507_28037 176
1471 3300046507 Ga0495606_0017374 Ga0495606_0017374_854_1384 176
1472 3300046507 Ga0495606_0025160 Ga0495606_0025160_3253_3783 176
1473 3300046507 Ga0495606_0025587 Ga0495606_0025587_2504_3034 176
1474 3300046507 Ga0495606_0200446 Ga0495606_0200446_322_852 176
1475 3300046507 Ga0495606_0388850 Ga0495606_0388850_132_662 176
1476 3300046512 Ga0495610_0005941 Ga0495610_0005941_4393_4923 176
1477 3300046512 Ga0495610_0008139 Ga0495610_0008139_250_780 176
1478 3300046512 Ga0495610_0034706 Ga0495610_0034706_1601_2131 176
1479 3300046512 Ga0495610_0135980 Ga0495610_0135980_30_560 176
1480 3300046513 Ga0495616_0016126 Ga0495616_0016126_306_836 176
1481 3300046513 Ga0495616_0058525 Ga0495616_0058525_1097_1627 176
1482 3300046513 Ga0495616_0211290 Ga0495616_0211290_257_787 176
1483 3300046515 Ga0495620_0000199 Ga0495620_0000199_19867_20397 176
1484 3300046515 Ga0495620_0012809 Ga0495620_0012809_1304_1834 176
1485 3300046515 Ga0495620_0060575 Ga0495620_0060575_379_909 176
1486 3300046515 Ga0495620_0105447 Ga0495620_0105447_279_809 176
1487 3300046518 Ga0495631_0002478 Ga0495631_0002478_542_1072 176
1488 3300046519 Ga0495632_0011402 Ga0495632_0011402_195_725 176
1489 3300046519 Ga0495632_0059407 Ga0495632_0059407_700_1230 176
1490 3300046519 Ga0495632_0122816 Ga0495632_0122816_492_1022 176
1491 3300046520 Ga0495637_0000695 Ga0495637_0000695_20211_20741 176
1492 3300046520 Ga0495637_0018892 Ga0495637_0018892_244_774 176
1493 3300046520 Ga0495637_0033292 Ga0495637_0033292_1023_1553 176
1494 3300046520 Ga0495637_0089247 Ga0495637_0089247_420_950 176
1495 3300046520 Ga0495637_0140378 Ga0495637_0140378_210_740 176
1496 3300046522 Ga0495643_0000778 Ga0495643_0000778_14486_15016 176
1497 3300046522 Ga0495643_0011876 Ga0495643_0011876_320_850 176
1498 3300046522 Ga0495643_0086585 Ga0495643_0086585_1062_1592 176
1499 3300046523 Ga0495644_0001886 Ga0495644_0001886_7254_7784 176
1500 3300046523 Ga0495644_0043389 Ga0495644_0043389_252_782 176
1501 3300046524 Ga0495648_0023932 Ga0495648_0023932_3035_3565 176
1502 3300046524 Ga0495648_0143350 Ga0495648_0143350_470_1000 176
1503 3300046524 Ga0495648_0169697 Ga0495648_0169697_71_601 176
1504 3300046524 Ga0495648_0229511 Ga0495648_0229511_246_776 176
1505 3300046526 Ga0495666_0096618 Ga0495666_0096618_839_1369 176
1506 3300046526 Ga0495666_0157182 Ga0495666_0157182_344_874 176
1507 3300046530 Ga0495654_0002890 Ga0495654_0002890_947_1477 176
1508 3300046530 Ga0495654_0020248 Ga0495654_0020248_2790_3320 176
1509 3300046530 Ga0495654_0032212 Ga0495654_0032212_1167_1697 176
1510 3300046530 Ga0495654_0037996 Ga0495654_0037996_1626_2156 176
1511 3300046530 Ga0495654_0044327 Ga0495654_0044327_1342_1872 176
1512 3300046530 Ga0495654_0045050 Ga0495654_0045050_1069_1599 176
1513 3300046530 Ga0495654_0069121 Ga0495654_0069121_238_768 176
1514 3300046530 Ga0495654_0070608 Ga0495654_0070608_872_1402 176
1515 3300046530 Ga0495654_0229886 Ga0495654_0229886_48_578 176
1516 3300046536 Ga0495587_0014233 Ga0495587_0014233_4122_4652 176
1517 3300046538 Ga0495609_0000057 Ga0495609_0000057_19763_20293 176
1518 3300046538 Ga0495609_0000076 Ga0495609_0000076_20200_20730 176
1519 3300046538 Ga0495609_0000223 Ga0495609_0000223_21055_21585 176
1520 3300046538 Ga0495609_0121495 Ga0495609_0121495_191_721 176
1521 3300046542 Ga0495597_0000202 Ga0495597_0000202_53115_53678 176
1522 3300046542 Ga0495597_0061070 Ga0495597_0061070_246_776 176
1523 3300046542 Ga0495597_0094157 Ga0495597_0094157_670_1200 176
1524 3300046542 Ga0495597_0200856 Ga0495597_0200856_31_561 176
1525 3300046558 Ga0495633_0000038 Ga0495633_0000038_19839_20369 176
1526 3300046616 Ga0495668_0023511 Ga0495668_0023511_1827_2357 176
1527 3300046648 Ga0495611_0004652 Ga0495611_0004652_971_1501 176
1528 3300046648 Ga0495611_0034588 Ga0495611_0034588_658_1188 176
1529 3300046660 Ga0495625_0000027 Ga0495625_0000027_128987_129517 176
1530 3300046665 Ga0495661_0000027 Ga0495661_0000027_62904_63434 176
1531 3300046665 Ga0495661_0000174 Ga0495661_0000174_11357_11887 176
1532 3300046665 Ga0495661_0000605 Ga0495661_0000605_6332_6862 176
1533 3300046665 Ga0495661_0011245 Ga0495661_0011245_169_699 176
1534 3300046665 Ga0495661_0057156 Ga0495661_0057156_1714_2244 176
1535 3300046680 Ga0495646_0114856 Ga0495646_0114856_564_1094 176
1536 3300046690 Ga0495624_0017350 Ga0495624_0017350_247_777 176
1537 3300046691 Ga0495670_0007385 Ga0495670_0007385_2515_3045 176
1538 3300046691 Ga0495670_0028245 Ga0495670_0028245_1810_2340 176
1539 3300046691 Ga0495670_0045036 Ga0495670_0045036_1432_1962 176
1540 3300046692 Ga0495671_0009807 Ga0495671_0009807_3426_3956 176
1541 3300046692 Ga0495671_0014512 Ga0495671_0014512_1029_1559 176
1542 3300046692 Ga0495671_0105447 Ga0495671_0105447_233_763 176
1543 3300046692 Ga0495671_0118954 Ga0495671_0118954_385_915 176
1544 3300046694 Ga0495649_0028311 Ga0495649_0028311_57_587 176
1545 3300046694 Ga0495649_0033152 Ga0495649_0033152_1723_2253 176
1546 3300046694 Ga0495649_0037820 Ga0495649_0037820_328_858 176
1547 3300046694 Ga0495649_0217058 Ga0495649_0217058_312_842 176
1548 3300046694 Ga0495649_0220327 Ga0495649_0220327_89_619 176
1549 3300046794 Ga0495589_0121620 Ga0495589_0121620_382_912 176
1550 3300046810 Ga0495660_0076166 Ga0495660_0076166_887_1417 176
1551 3300046810 Ga0495660_0115848 Ga0495660_0115848_456_986 176
1552 3300046810 Ga0495660_0116171 Ga0495660_0116171_807_1337 176
1553 3300047317 Ga0495604_0110489 Ga0495604_0110489_1280_1810 176
1554 3300047320 Ga0495672_0004381 Ga0495672_0004381_11006_11536 176
1555 3300047320 Ga0495672_0062662 Ga0495672_0062662_193_723 176
1556 3300047320 Ga0495672_0074855 Ga0495672_0074855_1063_1593 176
1557 3300047320 Ga0495672_0175249 Ga0495672_0175249_64_594 176
1558 3300047320 Ga0495672_0248515 Ga0495672_0248515_86_616 176
1559 3300047321 Ga0495676_0000012 Ga0495676_0000012_125799_126329 176
1560 3300047321 Ga0495676_0016588 Ga0495676_0016588_235_765 176
1561 3300047321 Ga0495676_0083100 Ga0495676_0083100_264_794 176
1562 3300047322 Ga0495680_0062652 Ga0495680_0062652_348_878 176
1563 3300047322 Ga0495680_0297571 Ga0495680_0297571_241_771 176
1564 3300047323 Ga0495683_0000032 Ga0495683_0000032_129268_129798 176
1565 3300047323 Ga0495683_0000299 Ga0495683_0000299_968_1573 176
1566 3300047446 Ga0495679_000716 Ga0495679_000716_6233_6763 176
1567 3300047446 Ga0495679_005818 Ga0495679_005818_3707_4237 176
1568 3300047469 Ga0495673_0007429 Ga0495673_0007429_1374_1904 176
1569 3300047469 Ga0495673_0029989 Ga0495673_0029989_351_881 176
1570 3300047469 Ga0495673_0042121 Ga0495673_0042121_1292_1822 176
1571 3300047469 Ga0495673_0068027 Ga0495673_0068027_198_728 176
1572 3300047470 Ga0495681_0011056 Ga0495681_0011056_4833_5363 176
1573 3300047470 Ga0495681_0015894 Ga0495681_0015894_3141_3671 176
1574 3300047470 Ga0495681_0019129 Ga0495681_0019129_3151_3681 176
1575 3300047470 Ga0495681_0044276 Ga0495681_0044276_1332_1862 176
1576 3300047673 Ga0495593_0046642 Ga0495593_0046642_81_611 176
1577 3300048088 Ga0495602_0099043 Ga0495602_0099043_1598_2128 176
1578 3300048091 Ga0495626_0000545 Ga0495626_0000545_34253_34783 176
1579 3300048091 Ga0495626_0012629 Ga0495626_0012629_255_785 176
1580 3300048905 Ga0496102_0012587 Ga0496102_0012587_3677_4207 176
1581 3300048913 Ga0496110_0210860 Ga0496110_0210860_376_906 176
1582 3300048913 Ga0496110_0629122 Ga0496110_0629122_331_861 176
1583 3300048919 Ga0496116_0000698 Ga0496116_0000698_18230_18760 176
1584 3300048919 Ga0496116_0017048 Ga0496116_0017048_4061_4591 176
1585 3300048920 Ga0496117_0003200 Ga0496117_0003200_279_809 176
1586 3300048920 Ga0496117_0133523 Ga0496117_0133523_193_723 176
1587 3300048920 Ga0496117_0191463 Ga0496117_0191463_32_562 176
1588 3300048921 Ga0496118_0074998 Ga0496118_0074998_816_1346 176
1589 3300048921 Ga0496118_0261770 Ga0496118_0261770_272_802 176
1590 3300048921 Ga0496118_0318146 Ga0496118_0318146_263_793 176
1591 3300048922 Ga0496119_0000071 Ga0496119_0000071_144506_145036 176
1592 3300048924 Ga0496121_0003930 Ga0496121_0003930_19062_19592 176
1593 3300048924 Ga0496121_0005413 Ga0496121_0005413_284_814 176
1594 3300048924 Ga0496121_0032774 Ga0496121_0032774_2732_3262 176
1595 3300048924 Ga0496121_0045649 Ga0496121_0045649_3185_3715 176
1596 3300048924 Ga0496121_0159913 Ga0496121_0159913_54_584 176
1597 3300048925 Ga0496122_0000370 Ga0496122_0000370_64481_65011 176
1598 3300048925 Ga0496122_0004026 Ga0496122_0004026_6044_6574 176
1599 3300048925 Ga0496122_0031791 Ga0496122_0031791_1717_2247 176
1600 3300048926 Ga0496123_0000135 Ga0496123_0000135_117718_118248 176
1601 3300048926 Ga0496123_0012095 Ga0496123_0012095_5140_5670 176
1602 3300048926 Ga0496123_0013389 Ga0496123_0013389_1451_1981 176
1603 3300048926 Ga0496123_0141790 Ga0496123_0141790_585_1115 176
1604 3300048926 Ga0496123_0227234 Ga0496123_0227234_211_741 176
1605 3300048926 Ga0496123_0257552 Ga0496123_0257552_289_819 176
1606 3300048927 Ga0496124_0000144 Ga0496124_0000144_22750_23280 176
1607 3300048927 Ga0496124_0003720 Ga0496124_0003720_17775_18305 176
1608 3300048927 Ga0496124_0066416 Ga0496124_0066416_2157_2687 176
1609 3300048927 Ga0496124_0465688 Ga0496124_0465688_33_563 176
1610 3300048927 Ga0496124_0492305 Ga0496124_0492305_265_795 176
1611 3300048928 Ga0496125_0097534 Ga0496125_0097534_321_851 176
1612 3300048928 Ga0496125_0287061 Ga0496125_0287061_316_846 176
1613 3300048928 Ga0496125_0325484 Ga0496125_0325484_175_705 176
1614 3300048929 Ga0496126_0154013 Ga0496126_0154013_1264_1794 176
1615 3300048929 Ga0496126_0240172 Ga0496126_0240172_284_814 176
1616 3300048929 Ga0496126_0617030 Ga0496126_0617030_282_812 176
1617 3300048929 Ga0496126_0975102 Ga0496126_0975102_58_588 176
1618 3300049459 Ga0495678_000046 Ga0495678_000046_151336_151866 176
1619 3300049459 Ga0495678_005322 Ga0495678_005322_298_828 176
1620 3300049459 Ga0495678_009603 Ga0495678_009603_282_812 176
1621 3300049459 Ga0495678_027079 Ga0495678_027079_1696_2226 176
1622 3300049460 Ga0495682_0004456 Ga0495682_0004456_1904_2434 176
1623 3300049460 Ga0495682_0038206 Ga0495682_0038206_296_826 176
1624 3300049571 Ga0501034_0151855 Ga0501034_0151855_742_1272 176
1625 3300049571 Ga0501034_0453220 Ga0501034_0453220_348_878 176
1626 3300049574 Ga0501038_0405531 Ga0501038_0405531_170_700 176
1627 3300049758 Ga0501241_011072 Ga0501241_011072_768_1298 176
1628 3300053161 Ga0500634_0167092 Ga0500634_0167092_335_865 176
1629 iso_pu_bacteria 8057160832 8057162233 176

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF19367

DUF5943

Domain of unknown function (DUF5943)

29

124

0.98

Structural Annotation

Top 5 Hits

ID Description Score Start End
6iy8-assembly1.cif.gz_B dmpr-phenol complex of pseudomonas putida 0.8385 10 175
7vqf-assembly1.cif.gz_A phenol binding protein, mopr 0.8204 10 174
5kbe-assembly1.cif.gz_A crystal structure of the aromatic sensor domain of mopr in complex with phenol 0.8193 10 175
5kbh-assembly1.cif.gz_A crystal structure of the aromatic sensor domain of mopr in complex with 3-chloro-phenol 0.8193 10 175
5kbi-assembly1.cif.gz_A crystal structure of the aromatic sensor domain of mopr in complex with catachol 0.818 10 174
ID Description Score Start End Superfamily
af_Q57614_9_172_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.8377 27 175 3.30.1380.20
af_Q58265_65_225_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7977 26 175 3.30.1380.20
af_Q57660_5_148_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7504 28 171 3.30.1380.20
af_Q58149_3_150_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7315 22 175 3.30.1380.20
af_Q59036_1_138_3.30.1380.20 Alpha Beta;2-Layer Sandwich;Muramoyl-pentapeptide Carboxypeptidase; domain 2;Trafficking protein particle complex subunit 3 0.7151 26 175 3.30.1380.20
ID Description Score Start End GO Terms
AF-A0A4Q3HWT0-F1-model_v4 deleted 1.006 55 175
AF-A0A2W5V0F5-F1-model_v4 deleted 1.004 35 175
AF-A0A3M5UY60-F1-model_v4 4-vinyl reductase 4VR domain-containing protein 0.9974 81 175
AF-A0A370RAR4-F1-model_v4 deleted 0.983 6 175
AF-A0A2W5V0F5-F1-model_v4 deleted 0.9827 35 175

Feature Viewer

pLDDT pTM Quality
94.49 0.88 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map