metagRoot

F495036

General Info

Members	Datasets	Scaffolds	Average Seq Length
1608	632	1435	128

Family's Representative Sequence

Representative Sequence	3300048927\|Ga0496124_0476963\|Ga0496124_0476963_231_620
Length	129
Sequence	MEDGIKRYGVEGGSGTGGQHLPFARAVQADGWLYVSGQVPMVDGEVIDGGIIPQTHQAIRNVLKILEEAGYGPEHVVRCVWLDDARDFMSFNRIFKEYFGANPPARACVVSQMVVDCKVEVDCIAWKKP

Samples

	Sample ID	Description	Type	Environment
1	2508501125	Burkholderia sp. WSM2232	Isolate	Nodule
2	2511231003	Herbaspirillum sp. CF444	Isolate	Rhizosphere
3	2511231026	Herbaspirillum sp. YR522	Isolate	Rhizosphere
4	2511231156	Pseudomonas ogarae F113	Isolate	Rhizosphere
5	2513237094	Bradyrhizobium sp. WSM3983	Isolate	Nodule
6	2513237150	Cupriavidus taiwanensis STM6018	Isolate	Nodule
7	2513237151	Burkholderia sp. WSM2230	Isolate	Nodule
8	2513237165	Cupriavidus neocaledonicus STM6070	Isolate	Nodule
9	2513237166	Paraburkholderia azotifigens UYPR1.413	Isolate	Nodule
10	2521172590	Herbaspirillum sp. GW103	Isolate	Rhizosphere
11	2524023205	Bradyrhizobium sp. Cp5.3	Isolate	Nodule
12	2526164713	Paraburkholderia phenoliruptrix JPY366	Isolate	Nodule
13	2551306416	Herbaspirillum seropedicae Os34	Isolate	Unclassified
14	2562617112	Burkholderia sp. BT03	Isolate	Rhizosphere
15	2585427594	Rhizobium sp. YR528	Isolate	Rhizosphere
16	2596583598	Ralstonia sp. UNCCL144	Isolate	Unclassified
17	2599185169	Klebsiella quasipneumoniae NFPP35	Isolate	Rhizoplane
18	2599185178	Ralstonia sp. NFACC01	Isolate	Rhizoplane
19	2599185188	Pseudomonas sp. NFACC45	Isolate	Rhizoplane
20	2599185239	Burkholderia sp. NFACC38-1	Isolate	Rhizoplane
21	2599185240	Burkholderia sp. NFPP32	Isolate	Rhizoplane
22	2599185300	Pseudomonas sp. NFACC39-1	Isolate	Rhizoplane
23	2599185319	Pseudomonas sp. NFACC24-1	Isolate	Rhizoplane
24	2599185323	Pseudomonas sp. NFACC37-1	Isolate	Rhizoplane
25	2599185354	Sphingomonas sp. NFR15	Isolate	Rhizoplane
26	2599185355	Burkholderia sp. NFACC33-1	Isolate	Rhizoplane
27	2600255067	Paraburkholderia kururiensis thiooxydans NBRC 107107	Isolate	Unclassified
28	2600255254	Klebsiella quasipneumoniae NFIX15	Isolate	Rhizoplane
29	2600255255	Klebsiella quasipneumoniae NFIX23	Isolate	Rhizoplane
30	2600255280	Klebsiella quasipneumoniae NFIX42	Isolate	Rhizoplane
31	2600255281	Klebsiella quasipneumoniae NFIX43	Isolate	Rhizoplane
32	2600255287	Klebsiella quasipneumoniae NFIX11	Isolate	Rhizoplane
33	2600255288	Klebsiella quasipneumoniae NFIX14	Isolate	Rhizoplane
34	2600255289	Klebsiella quasipneumoniae NFIX16	Isolate	Rhizoplane
35	2600255290	Klebsiella quasipneumoniae NFIX17	Isolate	Rhizoplane
36	2600255291	Klebsiella quasipneumoniae NFIX19	Isolate	Rhizoplane
37	2600255298	Klebsiella quasipneumoniae NFIX21	Isolate	Rhizoplane
38	2600255299	Klebsiella quasipneumoniae NFIX22	Isolate	Rhizoplane
39	2600255300	Klebsiella quasipneumoniae NFIX30	Isolate	Rhizoplane
40	2600255301	Klebsiella quasipneumoniae NFIX33	Isolate	Rhizoplane
41	2600255302	Klebsiella quasipneumoniae NFIX35	Isolate	Rhizoplane
42	2600255303	Klebsiella quasipneumoniae NFIX36	Isolate	Rhizoplane
43	2600255304	Klebsiella quasipneumoniae NFIX37	Isolate	Rhizoplane
44	2600255305	Klebsiella quasipneumoniae NFIX41	Isolate	Rhizoplane
45	2600255306	Klebsiella quasipneumoniae NFIX44	Isolate	Rhizoplane
46	2600255307	Klebsiella quasipneumoniae NFIX56	Isolate	Rhizoplane
47	2600255309	Klebsiella sp. NFIX53	Isolate	Rhizoplane
48	2600255392	Klebsiella quasipneumoniae NFIX54	Isolate	Rhizoplane
49	2602042052	Klebsiella quasipneumoniae NFIX18	Isolate	Rhizoplane
50	2602042053	Klebsiella quasipneumoniae NFIX12	Isolate	Rhizoplane
51	2602042103	Klebsiella quasipneumoniae NFIX29	Isolate	Rhizoplane
52	2602042104	Klebsiella quasipneumoniae NFIX26	Isolate	Rhizoplane
53	2602042105	Klebsiella quasipneumoniae NFIX25	Isolate	Rhizoplane
54	2602042106	Klebsiella quasipneumoniae NFIX13	Isolate	Rhizoplane
55	2602042110	Klebsiella quasipneumoniae NFIX40	Isolate	Rhizoplane
56	2602042111	Klebsiella quasipneumoniae NFIX20	Isolate	Rhizoplane
57	2603880178	Klebsiella quasipneumoniae NFIX34	Isolate	Rhizoplane
58	2603880184	Klebsiella quasipneumoniae NFIX27	Isolate	Rhizoplane
59	2603880202	Klebsiella quasipneumoniae NFIX38	Isolate	Rhizoplane
60	2603880211	Klebsiella quasipneumoniae NFIX24	Isolate	Rhizoplane
61	2643221569	Achromobacter sp. Root565	Isolate	Unclassified
62	2643221594	Achromobacter sp. Root170	Isolate	Unclassified
63	2643221650	Pseudomonas sp. Root401	Isolate	Unclassified
64	2648501241	Vibrio splendidus UCD-SED7	Isolate	Rhizosphere
65	2651869818	Vibrio splendidus UCD-SED10	Isolate	Rhizosphere
66	2675903046	Klebsiella quasipneumoniae NFIX52	Isolate	Rhizoplane
67	2675903129	Burkholderia pyrrocinia NFIX32	Isolate	Rhizoplane
68	2675903515	Pseudomonas thivervalensis DSM 13194	Isolate	Unclassified
69	2711768613	Burkholderia sp. BT03	Isolate	Rhizosphere
70	2738541276	Cellvibrio sp. YR554	Isolate	Unclassified
71	2738541296	Paraburkholderia sp. GV073	Isolate	Unclassified
72	2738541298	Paraburkholderia sp. GV068	Isolate	Unclassified
73	2738541306	Paraburkholderia sp. GV052	Isolate	Unclassified
74	2738543002	Paraburkholderia sp. GV072	Isolate	Unclassified
75	2738543008	Paraburkholderia sp. GV060	Isolate	Unclassified
76	2738543031	Pleomorphomonas sp. CF100	Isolate	Unclassified
77	2744054620	Pseudomonas thivervalensis LMG 21626	Isolate	Unclassified
78	2744054633	Bradyrhizobium neotropicale BR 10247	Isolate	Unclassified
79	2744054900	Paraburkholderia ginsengiterrae DCY85-1	Isolate	Unclassified
80	2744054901	Paraburkholderia ginsengiterrae DCY85	Isolate	Unclassified
81	2751185846	Paraburkholderia ribeironis STM 7296	Isolate	Unclassified
82	2765235838	Herbaspirillum robiniae AA6	Isolate	Unclassified
83	2791355137	Paraburkholderia piptadeniae STM7183	Isolate	Unclassified
84	2791355520	Pseudomonas sp. s211(2017)	Isolate	Unclassified
85	2808606384	Burkholderia sp. SJZ089	Isolate	Rhizosphere
86	2808606386	Herbaspirillum sp. SJZ099	Isolate	Rhizosphere
87	2808606390	Burkholderia sp. SJZ115	Isolate	Rhizosphere
88	2808606391	Burkholderia sp. SJZ091	Isolate	Rhizosphere
89	2808606395	Achromobacter sp. SLBN-14	Isolate	Unclassified
90	2808606415	Herbaspirillum sp. SJZ130	Isolate	Rhizosphere
91	2808606419	Herbaspirillum sp. SJZ106	Isolate	Rhizosphere
92	2818991436	Collimonas arenae 515	Isolate	Unclassified
93	2818991445	Herbaspirillum hiltneri 3195	Isolate	Unclassified
94	2818991449	Herbaspirillum huttiense 1147	Isolate	Unclassified
95	2818991450	Burkholderia sp. 604	Isolate	Unclassified
96	2818991452	Burkholderia cepacia 561	Isolate	Unclassified
97	2825651385	Pseudomonas brassicacearum L13-6-12	Isolate	Rhizosphere
98	2834641062	Cupriavidus gilardii JZ4	Isolate	Unclassified
99	2839094727	Herbaspirillum robiniae HZ10	Isolate	Nodule
100	2842324504	Paraburkholderia fungorum SEMIA 4007	Isolate	Nodule
101	2842348783	Paraburkholderia fungorum SEMIA 4013	Isolate	Nodule
102	2842454564	Paraburkholderia fungorum SEMIA 4056	Isolate	Nodule
103	2842854478	Pseudomonas sp. R-71998	Isolate	Unclassified
104	2844315083	Bradyrhizobium guangzhouense CCBAU 51670	Isolate	Unclassified
105	2852618963	Herbaspirillum sp. SJZ102	Isolate	Rhizosphere
106	2855730933	Achromobacter sp. HZ28	Isolate	Nodule
107	2855767633	Achromobacter sp. HZ34	Isolate	Nodule
108	2856287931	Paraburkholderia bannensis BE22	Isolate	Rhizosphere
109	2857357740	Paraburkholderia tropica BE15	Isolate	Rhizosphere
110	2857537821	Achromobacter sp. R-71975	Isolate	Unclassified
111	2858688981	Cupriavidus sp. UYMMa02A	Isolate	Unclassified
112	2863421361	Burkholderia cenocepacia CACua-24	Isolate	Rhizosphere
113	2870068957	Burkholderia sp. JP2-270	Isolate	Unclassified
114	2884811622	Herbaspirillum sp. 3C11	Isolate	Unclassified
115	2884836552	Herbaspirillum sp. 3R-11	Isolate	Unclassified
116	2884852848	Herbaspirillum sp. 3R11	Isolate	Unclassified
117	2885266251	Ralstonia sp. SET104	Isolate	Nodule
118	2896154374	Herbaspirillum sp. 3R-3a1	Isolate	Nodule
119	2900577576	Ralstonia sp. TCR112	Isolate	Rhizosphere
120	2900634093	Paraburkholderia dipogonis ICMP 19430	Isolate	Unclassified
121	2901300506	Cupriavidus sp. UYMSc13B	Isolate	Unclassified
122	2903727486	Bradyrhizobium guangzhouense CCBAU 53424	Isolate	Unclassified
123	2904434214	Robbsia andropogonis 1567	Isolate	Rhizosphere
124	2904439833	Herbaspirillum sp. 1589	Isolate	Rhizosphere
125	2904483920	Paraburkholderia caledonica 575	Isolate	Unclassified
126	2904530477	Herbaspirillum huttiense 611	Isolate	Unclassified
127	2904584206	Herbaspirillum sp. 1050	Isolate	Unclassified
128	2904589729	Herbaspirillum sp. 1130	Isolate	Unclassified
129	2904601388	Herbaspirillum sp. 1273	Isolate	Rhizosphere
130	2904615490	Paraburkholderia franconis CNPSo 3157	Isolate	Unclassified
131	2906602504	Bradyrhizobium guangzhouense CCBAU 53426	Isolate	Unclassified
132	2913036834	Pseudomonas viciae 11K1	Isolate	Rhizosphere
133	2919046199	Herbaspirillum frisingense 596	Isolate	Unclassified
134	2919079590	Herbaspirillum sp. 1173	Isolate	Unclassified
135	2919108558	Klebsiella sp. 1400	Isolate	Rhizosphere
136	2919527303	Paraburkholderia strydomiana 3827	Isolate	Unclassified
137	2921643360	Paraburkholderia steynii HC1.1ba	Isolate	Nodule
138	2923510766	Herbaspirillum rubrisubalbicans SLBN-127	Isolate	Rhizosphere
139	2923586266	Pseudomonas fluorescens 1550	Isolate	Rhizosphere
140	2928058823	Ralstonia sp. 1138	Isolate	Unclassified
141	2928108538	Paraburkholderia terricola 1595	Isolate	Rhizosphere
142	2928130867	Herbaspirillum seropedicae 1977	Isolate	Unclassified
143	2928135762	Paraburkholderia terricola 1988	Isolate	Unclassified
144	2928157003	Burkholderia ambifaria 566	Isolate	Unclassified
145	2928163908	Burkholderia sp. 567	Isolate	Unclassified
146	2928170801	Burkholderia sp. 572	Isolate	Unclassified
147	2928503688	Paraburkholderia terricola 1263	Isolate	Rhizosphere
148	2929144301	Pseudomonas sp. R-71838 Hybrid assembly	Isolate	Unclassified
149	2932794094	Bradyrhizobium sp. S3.2.6	Isolate	Nodule
150	2932801729	Bradyrhizobium sp. S3.3.6	Isolate	Nodule
151	2935883170	Bradyrhizobium sp. S3.12.5	Isolate	Nodule
152	2945934425	Paraburkholderia graminis W1I13	Isolate	Rhizosphere
153	2981990288	Burkholderia sp. PvR073	Isolate	Rhizosphere
154	2987605356	Stenotrophomonas sp. ATCM1_4	Isolate	Unclassified
155	2990703756	Paraburkholderia graminis SLBN-33	Isolate	Rhizosphere
156	3005594810	Bradyrhizobium sp. CCBAU 53340	Isolate	Nodule
157	3005718088	Bradyrhizobium sp. CCBAU 53338	Isolate	Nodule
158	3300000546	Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled	Metagenome	Rhizosphere
159	3300001915	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7	Metagenome	Rhizosphere
160	3300001979	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6	Metagenome	Rhizosphere
161	3300001989	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5	Metagenome	Rhizosphere
162	3300001990	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3	Metagenome	Rhizosphere
163	3300002067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1	Metagenome	Rhizosphere
164	3300002075	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4	Metagenome	Rhizosphere
165	3300002704	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB	Metagenome	Unclassified
166	3300002705	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS	Metagenome	Unclassified
167	3300002737	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA	Metagenome	Endosphere
168	3300002738	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA	Metagenome	Unclassified
169	3300002741	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL	Metagenome	Unclassified
170	3300002771	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB	Metagenome	Endosphere
171	3300002772	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS	Metagenome	Endosphere
172	3300003187	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB	Metagenome	Endosphere
173	3300003214	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL	Metagenome	Endosphere
174	3300003215	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF	Metagenome	Endosphere
175	3300003320	Sugarcane root Sample H2	Metagenome	Unclassified
176	3300003322	Sugarcane root Sample L2	Metagenome	Unclassified
177	3300003323	Sugarcane root Sample H1	Metagenome	Unclassified
178	3300003354	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS	Metagenome	Endosphere
179	3300003479	Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - metaT NBMF1_06_lowP_mix1_d1 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Rhizosphere
180	3300003578	Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only)	Metatranscriptome	Unclassified
181	3300003751	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2	Metagenome	Endosphere
182	3300003752	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2	Metagenome	Endosphere
183	3300003756	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2	Metagenome	Endosphere
184	3300003758	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2	Metagenome	Endosphere
185	3300003759	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2	Metagenome	Endosphere
186	3300003760	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2	Metagenome	Endosphere
187	3300003761	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2	Metagenome	Endosphere
188	3300003762	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2	Metagenome	Endosphere
189	3300003763	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2	Metagenome	Endosphere
190	3300003771	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2	Metagenome	Endosphere
191	3300003773	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2	Metagenome	Endosphere
192	3300003781	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2	Metagenome	Endosphere
193	3300003784	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2	Metagenome	Endosphere
194	3300003841	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2	Metagenome	Endosphere
195	3300003856	Agave microbial communities from Guanajuato, Mexico - At.Am.rz	Metagenome	Rhizosphere
196	3300005262	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3)	Metagenome	Endosphere
197	3300005327	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG	Metagenome	Rhizosphere
198	3300005328	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG	Metagenome	Rhizosphere
199	3300005329	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG	Metagenome	Rhizosphere
200	3300005331	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG	Metagenome	Rhizosphere
201	3300005333	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG	Metagenome	Rhizosphere
202	3300005335	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG	Metagenome	Rhizosphere
203	3300005337	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG	Metagenome	Rhizosphere
204	3300005338	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2	Metagenome	Rhizosphere
205	3300005339	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG	Metagenome	Rhizosphere
206	3300005344	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG	Metagenome	Rhizosphere
207	3300005347	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG	Metagenome	Rhizosphere
208	3300005353	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG	Metagenome	Rhizosphere
209	3300005354	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG	Metagenome	Rhizosphere
210	3300005355	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG	Metagenome	Rhizosphere
211	3300005356	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG	Metagenome	Rhizosphere
212	3300005366	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG	Metagenome	Rhizosphere
213	3300005367	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG	Metagenome	Rhizosphere
214	3300005434	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG	Metagenome	Rhizosphere
215	3300005435	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG	Metagenome	Rhizosphere
216	3300005436	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG	Metagenome	Rhizosphere
217	3300005437	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG	Metagenome	Rhizosphere
218	3300005439	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG	Metagenome	Rhizosphere
219	3300005445	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG	Metagenome	Rhizosphere
220	3300005455	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG	Metagenome	Rhizosphere
221	3300005456	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG	Metagenome	Rhizosphere
222	3300005457	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG	Metagenome	Rhizosphere
223	3300005459	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2	Metagenome	Rhizosphere
224	3300005468	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG	Metagenome	Rhizosphere
225	3300005530	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG	Metagenome	Rhizosphere
226	3300005535	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG	Metagenome	Rhizosphere
227	3300005539	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2	Metagenome	Rhizosphere
228	3300005543	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG	Metagenome	Rhizosphere
229	3300005547	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG	Metagenome	Rhizosphere
230	3300005548	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG	Metagenome	Rhizosphere
231	3300005563	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2	Metagenome	Rhizosphere
232	3300005564	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG	Metagenome	Rhizosphere
233	3300005577	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2	Metagenome	Rhizosphere
234	3300005578	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2	Metagenome	Rhizosphere
235	3300005614	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2	Metagenome	Rhizosphere
236	3300005616	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2	Metagenome	Rhizosphere
237	3300005617	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2	Metagenome	Rhizosphere
238	3300005618	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2	Metagenome	Rhizosphere
239	3300005718	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2	Metagenome	Rhizosphere
240	3300005834	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2	Metagenome	Rhizosphere
241	3300005841	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2	Metagenome	Rhizosphere
242	3300005842	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2	Metagenome	Rhizosphere
243	3300005843	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2	Metagenome	Rhizosphere
244	3300006028	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG	Metagenome	Rhizosphere
245	3300006163	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG	Metagenome	Rhizosphere
246	3300006173	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG	Metagenome	Rhizosphere
247	3300006175	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG	Metagenome	Rhizosphere
248	3300006353	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5	Metagenome	Endosphere
249	3300006358	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2	Metagenome	Rhizosphere
250	3300006846	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4	Metagenome	Rhizosphere
251	3300006914	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5	Metagenome	Rhizosphere
252	3300006931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2)	Metagenome	Rhizosphere
253	3300006946	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG	Metagenome	Nodule
254	3300006948	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15	Metagenome	Nodule
255	3300007076	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4	Metagenome	Rhizosphere
256	3300009011	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG	Metagenome	Rhizosphere
257	3300009092	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG	Metagenome	Rhizosphere
258	3300009093	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG	Metagenome	Rhizosphere
259	3300009098	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG	Metagenome	Rhizosphere
260	3300009101	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG	Metagenome	Rhizosphere
261	3300009174	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG	Metagenome	Rhizosphere
262	3300009176	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG	Metagenome	Rhizosphere
263	3300009177	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG	Metagenome	Rhizosphere
264	3300009545	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG	Metagenome	Rhizosphere
265	3300009551	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG	Metagenome	Rhizosphere
266	3300009978	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_199 metaG	Metagenome	Rhizosphere
267	3300009993	Switchgrass associated microbial communities from Austin, Texas, USA, to study host-microbe interactions - RS_106 metaG	Metagenome	Rhizosphere
268	3300010375	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG	Metagenome	Rhizosphere
269	3300011119	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG	Metagenome	Rhizosphere
270	3300012500	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610	Metagenome	Rhizosphere
271	3300012502	Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.2.yng.040610	Metagenome	Rhizosphere
272	3300012508	Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510	Metagenome	Rhizosphere
273	3300013100	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG	Metagenome	Rhizosphere
274	3300013102	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG	Metagenome	Rhizosphere
275	3300013104	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG	Metagenome	Rhizosphere
276	3300013105	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG	Metagenome	Rhizosphere
277	3300013296	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG	Metagenome	Rhizosphere
278	3300013297	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG	Metagenome	Rhizosphere
279	3300013306	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG	Metagenome	Rhizosphere
280	3300013307	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG	Metagenome	Rhizosphere
281	3300013308	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG	Metagenome	Rhizosphere
282	3300014325	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG	Metagenome	Rhizosphere
283	3300014497	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG	Metagenome	Rhizosphere
284	3300014968	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG	Metagenome	Rhizosphere
285	3300014969	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG	Metagenome	Rhizosphere
286	3300015261	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG	Metagenome	Rhizosphere
287	3300015262	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG	Metagenome	Rhizosphere
288	3300015265	Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG	Metagenome	Rhizosphere
289	3300016635	Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A10	Metagenome	Rhizosphere
290	3300017792	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG	Metagenome	Rhizosphere
291	3300020069	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
292	3300020070	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
293	3300020077	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
294	3300020610	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
295	3300021361	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2	Metagenome	Rhizosphere
296	3300021384	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9	Metagenome	Unclassified
297	3300021441	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1	Metagenome	Rhizosphere
298	3300022467	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2)	Metatranscriptome	Rhizosphere
299	3300025206	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2)	Metagenome	Unclassified
300	3300025224	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
301	3300025225	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
302	3300025226	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
303	3300025228	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
304	3300025229	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
305	3300025230	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
306	3300025231	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
307	3300025233	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2)	Metagenome	Endosphere
308	3300025242	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
309	3300025246	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2)	Metagenome	Unclassified
310	3300025250	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2)	Metagenome	Unclassified
311	3300025253	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
312	3300025254	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2)	Metagenome	Endosphere
313	3300025256	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2)	Metagenome	Unclassified
314	3300025258	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3)	Metagenome	Endosphere
315	3300025261	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2)	Metagenome	Endosphere
316	3300025263	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3)	Metagenome	Endosphere
317	3300025272	Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2)	Metagenome	Endosphere
318	3300025273	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3)	Metagenome	Endosphere
319	3300025284	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2)	Metagenome	Endosphere
320	3300025291	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3)	Metagenome	Endosphere
321	3300025292	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2)	Metagenome	Endosphere
322	3300025294	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2)	Metagenome	Endosphere
323	3300025295	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3)	Metagenome	Endosphere
324	3300025297	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2)	Metagenome	Endosphere
325	3300025298	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2)	Metagenome	Endosphere
326	3300025299	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3)	Metagenome	Endosphere
327	3300025302	Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2)	Metagenome	Endosphere
328	3300025303	Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2)	Metagenome	Endosphere
329	3300025321	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
330	3300025711	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
331	3300025735	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
332	3300025893	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
333	3300025899	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
334	3300025900	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
335	3300025903	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
336	3300025904	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2)	Metagenome	Rhizosphere
337	3300025905	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
338	3300025906	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
339	3300025907	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
340	3300025909	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
341	3300025911	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
342	3300025913	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
343	3300025914	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
344	3300025915	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
345	3300025916	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
346	3300025919	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
347	3300025920	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
348	3300025921	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
349	3300025922	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
350	3300025923	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
351	3300025924	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
352	3300025925	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
353	3300025927	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
354	3300025928	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
355	3300025929	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
356	3300025931	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
357	3300025932	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
358	3300025933	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
359	3300025934	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
360	3300025939	Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
361	3300025940	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
362	3300025941	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
363	3300025944	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
364	3300025945	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
365	3300025949	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
366	3300025972	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
367	3300025981	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
368	3300025986	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
369	3300026023	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
370	3300026035	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
371	3300026041	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
372	3300026067	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
373	3300026078	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
374	3300026088	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
375	3300026089	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
376	3300026095	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
377	3300026116	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
378	3300026118	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
379	3300026121	Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
380	3300026142	Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
381	3300027111	Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2)	Metagenome	Nodule
382	3300027312	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2)	Metagenome	Rhizosphere
383	3300027666	Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2)	Metagenome	Nodule
384	3300028379	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2)	Metagenome	Rhizosphere
385	3300028381	Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2)	Metagenome	Rhizosphere
386	3300028800	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG	Metagenome	Rhizosphere
387	3300030500	Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3)	Metagenome	Rhizosphere
388	3300030521	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM	Metagenome	Unclassified
389	3300031235	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG	Metagenome	Rhizosphere
390	3300031240	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG	Metagenome	Rhizosphere
391	3300031241	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG	Metagenome	Rhizosphere
392	3300031242	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG	Metagenome	Rhizosphere
393	3300031250	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG	Metagenome	Rhizosphere
394	3300031344	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG	Metagenome	Rhizosphere
395	3300031507	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM	Metagenome	Unclassified
396	3300031548	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3	Metagenome	Rhizosphere
397	3300031616	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM	Metagenome	Unclassified
398	3300031711	Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG	Metagenome	Rhizosphere
399	3300031730	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM	Metagenome	Unclassified
400	3300031731	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1	Metagenome	Rhizosphere
401	3300031824	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2	Metagenome	Rhizosphere
402	3300031852	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3	Metagenome	Rhizosphere
403	3300031901	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2	Metagenome	Rhizosphere
404	3300031903	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1	Metagenome	Rhizosphere
405	3300031911	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1	Metagenome	Rhizosphere
406	3300031995	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2	Metagenome	Rhizosphere
407	3300032002	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3	Metagenome	Rhizosphere
408	3300032004	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3	Metagenome	Rhizosphere
409	3300032005	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1	Metagenome	Rhizosphere
410	3300032126	Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2	Metagenome	Rhizosphere
411	3300033179	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM	Metagenome	Unclassified
412	3300033180	Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM	Metagenome	Unclassified
413	3300035083	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17	Metagenome	Rhizosphere
414	3300035089	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2	Metagenome	Rhizosphere
415	3300035170	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1	Metagenome	Rhizosphere
416	3300035172	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3	Metagenome	Rhizosphere
417	3300035692	Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11	Metagenome	Rhizosphere
418	3300035695	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19	Metagenome	Rhizosphere
419	3300035725	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8	Metagenome	Rhizosphere
420	3300037068	Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16	Metagenome	Rhizosphere
421	3300037312	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2	Metagenome	Rhizosphere
422	3300037418	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3	Metagenome	Rhizosphere
423	3300037466	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1	Metagenome	Rhizosphere
424	3300037471	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11	Metagenome	Rhizosphere
425	3300038443	Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4	Metagenome	Rhizosphere
426	3300039145	Coralloid root microbial communities from Jiquipilas, Chiapas, Mexico - JP6-T1	Metagenome	Unclassified
427	3300039437	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2	Metagenome	Unclassified
428	3300039438	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2	Metagenome	Rhizosphere
429	3300039447	Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2	Metagenome	Rhizosphere
430	3300039450	Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2	Metagenome	Unclassified
431	3300041404	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272	Metagenome	Rhizosphere
432	3300041411	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708	Metagenome	Rhizosphere
433	3300041451	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG	Metagenome	Rhizoplane
434	3300041452	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG	Metagenome	Rhizoplane
435	3300041456	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG	Metagenome	Rhizoplane
436	3300041459	Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG	Metagenome	Rhizoplane
437	3300041512	White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG	Metagenome	Unclassified
438	3300042005	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216	Metagenome	Rhizosphere
439	3300042006	Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437	Metagenome	Rhizosphere
440	3300042145	Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581	Metagenome	Rhizosphere
441	3300044650	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4E	Metagenome	Unclassified
442	3300044656	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R	Metagenome	Rhizosphere
443	3300044658	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R	Metagenome	Rhizosphere
444	3300044659	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2E	Metagenome	Unclassified
445	3300044660	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3E1	Metagenome	Unclassified
446	3300044666	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1E	Metagenome	Unclassified
447	3300044671	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA1E	Metagenome	Unclassified
448	3300044672	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E	Metagenome	Unclassified
449	3300044683	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R	Metagenome	Rhizosphere
450	3300044684	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R	Metagenome	Rhizosphere
451	3300044693	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R	Metagenome	Rhizosphere
452	3300044694	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R	Metagenome	Rhizosphere
453	3300044706	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R	Metagenome	Rhizosphere
454	3300044719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R	Metagenome	Rhizosphere
455	3300044735	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R	Metagenome	Rhizosphere
456	3300044765	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R	Metagenome	Rhizosphere
457	3300044842	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R	Metagenome	Rhizosphere
458	3300044901	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R	Metagenome	Rhizosphere
459	3300045049	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R	Metagenome	Rhizosphere
460	3300045836	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R	Metagenome	Rhizosphere
461	3300045976	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R	Metagenome	Rhizosphere
462	3300046454	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere	Metagenome	Rhizosphere
463	3300046455	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere	Metagenome	Rhizosphere
464	3300046457	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere	Metagenome	Rhizosphere
465	3300046459	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere	Metagenome	Rhizosphere
466	3300046461	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere	Metagenome	Rhizosphere
467	3300046462	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere	Metagenome	Rhizosphere
468	3300046463	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere	Metagenome	Rhizosphere
469	3300046471	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere	Metagenome	Rhizosphere
470	3300046472	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere	Metagenome	Rhizosphere
471	3300046473	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere	Metagenome	Rhizosphere
472	3300046474	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere	Metagenome	Rhizosphere
473	3300046476	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere	Metagenome	Rhizosphere
474	3300046477	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere	Metagenome	Rhizosphere
475	3300046499	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere	Metagenome	Rhizosphere
476	3300046500	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere	Metagenome	Rhizosphere
477	3300046501	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere	Metagenome	Rhizosphere
478	3300046506	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere	Metagenome	Rhizosphere
479	3300046507	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere	Metagenome	Rhizosphere
480	3300046511	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere	Metagenome	Rhizosphere
481	3300046512	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere	Metagenome	Rhizosphere
482	3300046513	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere	Metagenome	Rhizosphere
483	3300046514	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere	Metagenome	Rhizosphere
484	3300046515	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere	Metagenome	Rhizosphere
485	3300046516	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere	Metagenome	Rhizosphere
486	3300046517	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere	Metagenome	Rhizosphere
487	3300046522	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere	Metagenome	Rhizosphere
488	3300046524	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere	Metagenome	Rhizosphere
489	3300046525	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere	Metagenome	Rhizosphere
490	3300046526	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere	Metagenome	Rhizosphere
491	3300046528	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere	Metagenome	Rhizosphere
492	3300046529	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere	Metagenome	Rhizosphere
493	3300046530	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere	Metagenome	Rhizosphere
494	3300046531	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere	Metagenome	Rhizosphere
495	3300046533	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere	Metagenome	Rhizosphere
496	3300046535	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere	Metagenome	Rhizosphere
497	3300046536	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere	Metagenome	Rhizosphere
498	3300046542	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere	Metagenome	Rhizosphere
499	3300046543	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere	Metagenome	Rhizosphere
500	3300046557	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere	Metagenome	Rhizosphere
501	3300046558	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere	Metagenome	Rhizosphere
502	3300046559	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere	Metagenome	Rhizosphere
503	3300046616	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere	Metagenome	Rhizosphere
504	3300046642	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere	Metagenome	Rhizosphere
505	3300046648	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere	Metagenome	Rhizosphere
506	3300046660	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere	Metagenome	Rhizosphere
507	3300046663	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere	Metagenome	Rhizosphere
508	3300046665	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere	Metagenome	Rhizosphere
509	3300046674	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere	Metagenome	Rhizosphere
510	3300046675	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere	Metagenome	Rhizosphere
511	3300046678	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere	Metagenome	Rhizosphere
512	3300046679	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere	Metagenome	Rhizosphere
513	3300046680	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere	Metagenome	Rhizosphere
514	3300046681	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere	Metagenome	Rhizosphere
515	3300046683	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere	Metagenome	Rhizosphere
516	3300046684	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere	Metagenome	Rhizosphere
517	3300046689	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere	Metagenome	Rhizosphere
518	3300046690	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere	Metagenome	Rhizosphere
519	3300046692	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere	Metagenome	Rhizosphere
520	3300046694	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere	Metagenome	Rhizosphere
521	3300046794	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere	Metagenome	Rhizosphere
522	3300046809	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere	Metagenome	Rhizosphere
523	3300046810	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere	Metagenome	Rhizosphere
524	3300047315	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere	Metagenome	Rhizosphere
525	3300047317	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere	Metagenome	Rhizosphere
526	3300047319	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere	Metagenome	Rhizosphere
527	3300047320	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere	Metagenome	Rhizosphere
528	3300047321	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere	Metagenome	Rhizosphere
529	3300047322	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere	Metagenome	Rhizosphere
530	3300047323	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere	Metagenome	Rhizosphere
531	3300047443	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere	Metagenome	Rhizosphere
532	3300047444	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere	Metagenome	Rhizosphere
533	3300047445	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere	Metagenome	Rhizosphere
534	3300047446	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere	Metagenome	Rhizosphere
535	3300047447	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere	Metagenome	Rhizosphere
536	3300047469	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere	Metagenome	Rhizosphere
537	3300047470	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere	Metagenome	Rhizosphere
538	3300047471	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere	Metagenome	Rhizosphere
539	3300047472	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere	Metagenome	Rhizosphere
540	3300047673	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere	Metagenome	Rhizosphere
541	3300048088	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere	Metagenome	Rhizosphere
542	3300048089	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere	Metagenome	Rhizosphere
543	3300048091	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere	Metagenome	Rhizosphere
544	3300048903	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled	Metagenome	Rhizoplane
545	3300048904	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled	Metagenome	Rhizoplane
546	3300048905	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15	Metagenome	Rhizoplane
547	3300048906	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15	Metagenome	Rhizoplane
548	3300048907	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15	Metagenome	Rhizoplane
549	3300048908	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15	Metagenome	Rhizoplane
550	3300048909	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15	Metagenome	Rhizoplane
551	3300048910	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15	Metagenome	Rhizoplane
552	3300048911	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled	Metagenome	Rhizoplane
553	3300048912	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled	Metagenome	Rhizoplane
554	3300048913	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15	Metagenome	Rhizoplane
555	3300048914	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15	Metagenome	Rhizoplane
556	3300048915	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15	Metagenome	Rhizoplane
557	3300048916	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15	Metagenome	Rhizoplane
558	3300048917	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15	Metagenome	Rhizoplane
559	3300048918	Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15	Metagenome	Rhizoplane
560	3300048919	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled	Metagenome	Unclassified
561	3300048920	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15	Metagenome	Unclassified
562	3300048921	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15	Metagenome	Unclassified
563	3300048922	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15	Metagenome	Unclassified
564	3300048923	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15	Metagenome	Unclassified
565	3300048924	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15	Metagenome	Unclassified
566	3300048925	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled	Metagenome	Unclassified
567	3300048926	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled	Metagenome	Unclassified
568	3300048927	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15	Metagenome	Unclassified
569	3300048928	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15	Metagenome	Unclassified
570	3300048929	Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15	Metagenome	Unclassified
571	3300048986	Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1E	Metagenome	Unclassified
572	3300049459	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere	Metagenome	Rhizosphere
573	3300049460	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere	Metagenome	Rhizosphere
574	3300049571	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01	Metagenome	Rhizosphere
575	3300049575	Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03	Metagenome	Rhizosphere
576	3300049586	Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01	Metagenome	Rhizosphere
577	3300049660	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control	Metagenome	Rhizosphere
578	3300049853	Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought	Metagenome	Rhizosphere
579	3300050491	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation	Metagenome	Endosphere
580	3300050494	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation	Metagenome	Endosphere
581	3300050496	Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation	Metagenome	Endosphere
582	3300050509	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation	Metagenome	Rhizosphere
583	3300050513	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation	Metagenome	Rhizosphere
584	3300050514	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation	Metagenome	Rhizosphere
585	3300050515	Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation	Metagenome	Rhizosphere
586	3300053077	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere	Metagenome	Rhizosphere
587	3300053078	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere	Metagenome	Rhizosphere
588	3300053080	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere	Metagenome	Endosphere
589	3300053083	Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere	Metagenome	Rhizosphere
590	3300053084	Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere	Metagenome	Rhizosphere
591	3300053086	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere	Metagenome	Endosphere
592	3300053091	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere	Metagenome	Endosphere
593	3300053094	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere	Metagenome	Endosphere
594	3300053097	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere	Metagenome	Endosphere
595	3300053103	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere	Metagenome	Endosphere
596	3300053111	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere	Metagenome	Endosphere
597	3300053119	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere	Metagenome	Endosphere
598	3300053125	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere	Metagenome	Endosphere
599	3300053136	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere	Metagenome	Endosphere
600	3300053140	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere	Metagenome	Endosphere
601	3300053141	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere	Metagenome	Endosphere
602	3300053150	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere	Metagenome	Endosphere
603	3300053153	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere	Metagenome	Endosphere
604	3300053162	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere	Metagenome	Endosphere
605	3300053163	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere	Metagenome	Endosphere
606	3300053178	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere	Metagenome	Endosphere
607	3300053725	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere	Metagenome	Endosphere
608	3300053728	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 endosphere	Metagenome	Endosphere
609	3300053730	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere	Metagenome	Endosphere
610	3300053733	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 endosphere	Metagenome	Endosphere
611	3300053735	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere	Metagenome	Endosphere
612	3300053736	Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere	Metagenome	Endosphere
613	3300055283	Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere	Metagenome	Endosphere
614	3300059640	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
615	3300059643	Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome)	Metatranscriptome	Rhizosphere
616	3300061719	Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1	Metagenome	Rhizosphere
617	641736151	Paraburkholderia graminis C4D1M	Isolate	Rhizoplane
618	641736154	Burkholderia ambifaria IOP40-10	Isolate	Rhizosphere
619	642555112	Paraburkholderia phymatum STM815	Isolate	Nodule
620	642555113	Paraburkholderia phytofirmans PsJN	Isolate	Unclassified
621	644736347	Cupriavidus taiwanensis LMG 19424	Isolate	Nodule
622	8003400568	Cupriavidus gilardii USM5	Isolate	Rhizosphere
623	8018845410	Burkholderia reimsis BE51	Isolate	Rhizosphere
624	8019648815	Bradyrhizobium sp. GM24.11	Isolate	Nodule
625	8020938398	Burkholderia sp. BE12	Isolate	Rhizosphere
626	8020945358	Burkholderia sp. BE17	Isolate	Rhizosphere
627	8020953355	Burkholderia sp. BE24	Isolate	Rhizosphere
628	8021120328	Burkholderia sp. LS-044	Isolate	Rhizosphere
629	8055266321	Paraburkholderia rhynchosiae LMG 27174	Isolate	Nodule
630	8055301274	Paraburkholderia kirstenboschensis LMG 28727	Isolate	Nodule
631	8056143049	Pseudomonas alvandae SWRI17	Isolate	Rhizosphere
632	8056967851	Bradyrhizobium zhengyangense WYCCWR 12678	Isolate	Nodule

Type Distribution

Type	Percentage (%)
Metagenomes	88.56
Metatranscriptomes	0.68
Isolates	10.76

Biome Distribution

Category	Percentage (%)
Aerial Root	0
Bulb	0
Endosphere	13.74
Nodule	2.24
Rhizoplane	8.27
Rhizosphere	62.13
Stem	0
Stem Tuber	0
Unclassified	13.62

Taxonomy

Scaffolds

	Scaffold	Dataset	Taxonomy	Length
1	LJNas_1000233	3300000546	Bacteria	9598
2	JGI24741J21665_1001203	3300001915	Bacteria	7631
3	JGI24741J21665_1021899	3300001915	Bacteria	995
4	JGI24740J21852_10001103	3300001979	Bacteria	12201
5	JGI24740J21852_10001307	3300001979	Bacteria	11331
6	JGI24740J21852_10004647	3300001979	Bacteria	5890
7	JGI24740J21852_10006794	3300001979	Bacteria	4701
8	JGI24740J21852_10053219	3300001979	Bacteria	1149
9	JGI24739J22299_10001248	3300001989	Bacteria	9542
10	JGI24739J22299_10004875	3300001989	Bacteria	5116
11	JGI24739J22299_10005521	3300001989	Bacteria	4798
12	JGI24737J22298_10001638	3300001990	Bacteria	7981
13	JGI24737J22298_10023723	3300001990	Bacteria	1945
14	JGI24737J22298_10027864	3300001990	Bacteria	1779
15	JGI24737J22298_10042771	3300001990	Bacteria	1388
16	JGI24735J21928_10001657	3300002067	Bacteria	7892
17	JGI24735J21928_10006062	3300002067	Bacteria	3993
18	JGI24735J21928_10014387	3300002067	Bacteria	2479
19	JGI24738J21930_10015452	3300002075	Bacteria	1623
20	JGI25155J39150_1000312	3300002704	Bacteria	16548
21	JGI25155J39150_1000846	3300002704	Bacteria	4611
22	JGI25156J39149_1000353	3300002705	Bacteria	29806
23	JGI25156J39149_1000458	3300002705	Bacteria	24888
24	JGI25156J39149_1000758	3300002705	Bacteria	16827
25	JGI25156J39149_1000998	3300002705	Bacteria	13353
26	JGI25156J39149_1003045	3300002705	Bacteria	5685
27	JGI25156J39149_1004229	3300002705	Bacteria	4425
28	JGI25156J39149_1011017	3300002705	Bacteria	2076
29	JGI25162J39368_1000001	3300002737	Bacteria	740113
30	JGI25162J39368_1002006	3300002737	Bacteria	9048
31	JGI25162J39368_1010906	3300002737	Bacteria	1122
32	JGI25154J39366_1000450	3300002738	Bacteria	21681
33	JGI25154J39366_1000639	3300002738	Bacteria	16535
34	JGI25154J39366_1002391	3300002738	Bacteria	4921
35	JGI25154J39366_1010452	3300002738	Bacteria	1099
36	JGI25157J39369_1000757	3300002741	Bacteria	16827
37	JGI25157J39369_1005893	3300002741	Bacteria	1930
38	JGI25163J39215_1004393	3300002771	Bacteria	998
39	JGI25164J39214_1000114	3300002772	Bacteria	77747
40	JGI25164J39214_1005191	3300002772	Bacteria	1425
41	JGI25164J39214_1011165	3300002772	Bacteria	862
42	JGI25151J46595_10000174	3300003187	Bacteria	83009
43	JGI25151J46595_10001574	3300003187	Bacteria	15227
44	JGI25151J46595_10003482	3300003187	Bacteria	8688
45	JGI25151J46595_10016775	3300003187	Bacteria	3194
46	JGI25151J46595_10035832	3300003187	Bacteria	1879
47	JGI25165J46597_1000001	3300003214	Bacteria	1111887
48	JGI25165J46597_1000250	3300003214	Bacteria	72685
49	JGI25165J46597_1005414	3300003214	Bacteria	2462
50	JGI25165J46597_1007832	3300003214	Bacteria	1736
51	JGI25153J46596_10019301	3300003215	Bacteria	2617
52	rootH2_10064714	3300003320	Bacteria	3470
53	rootH2_10113234	3300003320	Bacteria	4006
54	rootL2_10290299	3300003322	Bacteria	2190
55	rootH1_10020162	3300003323	Bacteria	25396
56	JGI25160J50197_1035264	3300003354	Bacteria	1229
57	Ga0006556J51387_1037296	3300003479	Bacteria	700
58	Ga0006562J51391_1047084	3300003578	Bacteria	6870
59	Ga0006562J51391_1047087	3300003578	Bacteria	2130
60	Ga0006562J51391_1123888	3300003578	Bacteria	1273
61	Ga0055538_1000001	3300003751	Bacteria	1111887
62	Ga0055538_1000155	3300003751	Bacteria	46426
63	Ga0055538_1005391	3300003751	Bacteria	1330
64	Ga0055538_1005998	3300003751	Bacteria	1211
65	Ga0055539_1000001	3300003752	Bacteria	1111887
66	Ga0055539_1000079	3300003752	Bacteria	126504
67	Ga0055539_1000205	3300003752	Bacteria	46426
68	Ga0055539_1002006	3300003752	Bacteria	3346
69	Ga0055539_1036425	3300003752	Bacteria	541
70	Ga0055533_1000003	3300003756	Bacteria	1111887
71	Ga0055533_1000207	3300003756	Bacteria	46426
72	Ga0055533_1000252	3300003756	Bacteria	32900
73	Ga0055533_1000828	3300003756	Bacteria	9532
74	Ga0055533_1001431	3300003756	Bacteria	6310
75	Ga0055533_1004486	3300003756	Bacteria	2489
76	Ga0055532_1000031	3300003758	Bacteria	231440
77	Ga0055532_1000056	3300003758	Bacteria	158878
78	Ga0055532_1000521	3300003758	Bacteria	16829
79	Ga0055532_1004725	3300003758	Bacteria	2011
80	Ga0055525_1000003	3300003759	Bacteria	962094
81	Ga0055525_1000220	3300003759	Bacteria	62407
82	Ga0055525_1000284	3300003759	Bacteria	46426
83	Ga0055525_1023342	3300003759	Bacteria	526
84	Ga0055527_1000020	3300003760	Bacteria	231441
85	Ga0055527_1002319	3300003760	Bacteria	3284
86	Ga0055527_1003164	3300003760	Bacteria	2530
87	Ga0055527_1004199	3300003760	Bacteria	2011
88	Ga0055527_1012971	3300003760	Bacteria	936
89	Ga0055535_1000013	3300003761	Bacteria	299614
90	Ga0055535_1000023	3300003761	Bacteria	231441
91	Ga0055535_1000253	3300003761	Bacteria	56580
92	Ga0055535_1000665	3300003761	Bacteria	27136
93	Ga0055535_1006042	3300003761	Bacteria	2530
94	Ga0055535_1006633	3300003761	Bacteria	2317
95	Ga0055535_1007753	3300003761	Bacteria	2011
96	Ga0055542_1000035	3300003762	Bacteria	231441
97	Ga0055542_1000104	3300003762	Bacteria	113323
98	Ga0055542_1000377	3300003762	Bacteria	45778
99	Ga0055542_1000696	3300003762	Bacteria	26537
100	Ga0055542_1006190	3300003762	Bacteria	2590
101	Ga0055542_1008601	3300003762	Bacteria	1987
102	Ga0055529_1000039	3300003763	Bacteria	231439
103	Ga0055529_1000074	3300003763	Bacteria	158872
104	Ga0055529_1000404	3300003763	Bacteria	45770
105	Ga0055529_1000799	3300003763	Bacteria	19288
106	Ga0055526_1008394	3300003771	Bacteria	5165
107	Ga0055526_1009634	3300003771	Bacteria	4614
108	Ga0055526_1012513	3300003771	Bacteria	3692
109	Ga0055537_1001158	3300003773	Bacteria	11284
110	Ga0055536_1000112	3300003781	Bacteria	70656
111	Ga0055534_1000387	3300003784	Bacteria	27564
112	Ga0055534_1003703	3300003784	Bacteria	4719
113	Ga0055541_1000001	3300003841	Bacteria	1111887
114	Ga0055541_1000133	3300003841	Bacteria	46426
115	Ga0055541_1001455	3300003841	Bacteria	5144
116	Ga0055541_1008649	3300003841	Bacteria	1612
117	Ga0055541_1027793	3300003841	Bacteria	587
118	Ga0058692_1001715	3300003856	Bacteria	7823
119	Ga0065165_1000115	3300005262	Bacteria	135145
120	Ga0065165_1008711	3300005262	Bacteria	4688
121	Ga0070658_10004659	3300005327	Bacteria	11159
122	Ga0070658_10005856	3300005327	Bacteria	9968
123	Ga0070658_10013643	3300005327	Bacteria	6519
124	Ga0070658_10052123	3300005327	Bacteria	3317
125	Ga0070658_10191523	3300005327	Bacteria	1723
126	Ga0070658_10196261	3300005327	Bacteria	1702
127	Ga0070658_10235775	3300005327	Bacteria	1550
128	Ga0070676_10220853	3300005328	Bacteria	1251
129	Ga0070676_10286582	3300005328	Bacteria	1112
130	Ga0070676_10398552	3300005328	Bacteria	957
131	Ga0070683_100102942	3300005329	Bacteria	2690
132	Ga0070683_100111977	3300005329	Bacteria	2575
133	Ga0070670_100077155	3300005331	Bacteria	2863
134	Ga0070670_100273517	3300005331	Bacteria	1474
135	Ga0070670_100626589	3300005331	Bacteria	964
136	Ga0070677_10014269	3300005333	Bacteria	2795
137	Ga0070666_10322526	3300005335	Bacteria	1102
138	Ga0070682_100111048	3300005337	Bacteria	1827
139	Ga0070682_101266924	3300005337	Bacteria	625
140	Ga0068868_100248058	3300005338	Bacteria	1498
141	Ga0068868_100710119	3300005338	Bacteria	900
142	Ga0070660_100000021	3300005339	Bacteria	97654
143	Ga0070660_100017355	3300005339	Bacteria	5245
144	Ga0070660_100136486	3300005339	Bacteria	1965
145	Ga0070660_100300497	3300005339	Bacteria	1316
146	Ga0070660_100765385	3300005339	Bacteria	811
147	Ga0070660_101186474	3300005339	Bacteria	647
148	Ga0070661_100000007	3300005344	Bacteria	202433
149	Ga0070661_100142950	3300005344	Bacteria	1804
150	Ga0070661_100435378	3300005344	Bacteria	1041
151	Ga0070668_100127113	3300005347	Bacteria	2042
152	Ga0070668_100759239	3300005347	Bacteria	859
153	Ga0070668_101531885	3300005347	Bacteria	610
154	Ga0070669_100152156	3300005353	Bacteria	1792
155	Ga0070675_100178569	3300005354	Bacteria	1834
156	Ga0070675_100324937	3300005354	Bacteria	1359
157	Ga0070671_100062304	3300005355	Bacteria	3106
158	Ga0070671_100404422	3300005355	Bacteria	1168
159	Ga0070671_100651917	3300005355	Bacteria	912
160	Ga0070671_101144077	3300005355	Bacteria	684
161	Ga0070674_100079979	3300005356	Bacteria	2333
162	Ga0070674_101444835	3300005356	Bacteria	617
163	Ga0070659_100000061	3300005366	Bacteria	85192
164	Ga0070659_100002351	3300005366	Bacteria	13444
165	Ga0070659_100005984	3300005366	Bacteria	8768
166	Ga0070659_100036327	3300005366	Bacteria	3841
167	Ga0070659_100562819	3300005366	Bacteria	977
168	Ga0070659_100758902	3300005366	Bacteria	842
169	Ga0070659_101075033	3300005366	Unclassified	708
170	Ga0070667_100987783	3300005367	Bacteria	785
171	Ga0070667_101095214	3300005367	Bacteria	744
172	Ga0070667_101809156	3300005367	Bacteria	575
173	Ga0070709_10069262	3300005434	Bacteria	2272
174	Ga0070709_11213648	3300005434	Bacteria	606
175	Ga0070714_100006441	3300005435	Bacteria	9067
176	Ga0070714_100282295	3300005435	Bacteria	1543
177	Ga0070713_100164587	3300005436	Bacteria	1982
178	Ga0070713_100550770	3300005436	Bacteria	1092
179	Ga0070713_101268018	3300005436	Bacteria	714
180	Ga0070713_101577982	3300005436	Bacteria	637
181	Ga0070710_10085810	3300005437	Bacteria	1847
182	Ga0070710_10526579	3300005437	Bacteria	813
183	Ga0070711_100159019	3300005439	Bacteria	1711
184	Ga0070708_101333131	3300005445	Bacteria	670
185	Ga0070663_100000002	3300005455	Bacteria	298075
186	Ga0070663_100000250	3300005455	Bacteria	27134
187	Ga0070663_100004092	3300005455	Bacteria	8523
188	Ga0070663_100026899	3300005455	Bacteria	3901
189	Ga0070663_100062927	3300005455	Bacteria	2677
190	Ga0070663_100242217	3300005455	Bacteria	1424
191	Ga0070663_100340441	3300005455	Bacteria	1212
192	Ga0070663_100467927	3300005455	Bacteria	1042
193	Ga0070663_100512645	3300005455	Bacteria	997
194	Ga0070663_101208190	3300005455	Bacteria	664
195	Ga0070678_100035014	3300005456	Bacteria	3502
196	Ga0070678_100764086	3300005456	Bacteria	875
197	Ga0070662_101080245	3300005457	Bacteria	688
198	Ga0068867_100087601	3300005459	Bacteria	2358
199	Ga0070707_100198203	3300005468	Bacteria	1957
200	Ga0070679_100766776	3300005530	Bacteria	908
201	Ga0070679_101207077	3300005530	Bacteria	702
202	Ga0070684_100260132	3300005535	Bacteria	1587
203	Ga0070684_100622214	3300005535	Bacteria	1004
204	Ga0068853_100125917	3300005539	Bacteria	2289
205	Ga0068853_100537702	3300005539	Bacteria	1106
206	Ga0068853_100795668	3300005539	Bacteria	905
207	Ga0068853_101482129	3300005539	Bacteria	657
208	Ga0068853_101667111	3300005539	Bacteria	618
209	Ga0070672_100291100	3300005543	Bacteria	1383
210	Ga0070672_100380337	3300005543	Bacteria	1207
211	Ga0070672_100517006	3300005543	Bacteria	1034
212	Ga0070672_101507153	3300005543	Bacteria	602
213	Ga0070693_100477183	3300005547	Bacteria	880
214	Ga0070693_101241578	3300005547	Bacteria	574
215	Ga0070665_100024536	3300005548	Bacteria	6075
216	Ga0070665_100094015	3300005548	Bacteria	3003
217	Ga0070665_100722484	3300005548	Bacteria	1009
218	Ga0068855_100003611	3300005563	Bacteria	18902
219	Ga0068855_100010806	3300005563	Bacteria	11021
220	Ga0068855_100013439	3300005563	Bacteria	9871
221	Ga0068855_100057933	3300005563	Bacteria	4540
222	Ga0068855_100078070	3300005563	Bacteria	3842
223	Ga0068855_100080988	3300005563	Bacteria	3764
224	Ga0068855_100091847	3300005563	Bacteria	3501
225	Ga0068855_100111100	3300005563	Bacteria	3146
226	Ga0068855_100187756	3300005563	Bacteria	2333
227	Ga0068855_100293412	3300005563	Bacteria	1802
228	Ga0068855_100357766	3300005563	Bacteria	1607
229	Ga0068855_101579145	3300005563	Bacteria	672
230	Ga0068855_101744159	3300005563	Bacteria	634
231	Ga0070664_100000004	3300005564	Bacteria	298075
232	Ga0070664_100009050	3300005564	Bacteria	8078
233	Ga0070664_100026511	3300005564	Bacteria	4808
234	Ga0070664_100123601	3300005564	Bacteria	2268
235	Ga0070664_100256130	3300005564	Bacteria	1574
236	Ga0068857_100002031	3300005577	Bacteria	16392
237	Ga0068857_100047085	3300005577	Bacteria	3827
238	Ga0068857_100067592	3300005577	Bacteria	3181
239	Ga0068857_100224684	3300005577	Bacteria	1716
240	Ga0068857_100228334	3300005577	Bacteria	1702
241	Ga0068854_100000252	3300005578	Bacteria	36503
242	Ga0068854_100003444	3300005578	Bacteria	9871
243	Ga0068854_100009144	3300005578	Bacteria	6389
244	Ga0068854_100015182	3300005578	Bacteria	5097
245	Ga0068854_100093284	3300005578	Bacteria	2243
246	Ga0068854_100192920	3300005578	Bacteria	1597
247	Ga0068854_100214846	3300005578	Bacteria	1519
248	Ga0068856_100000051	3300005614	Bacteria	107551
249	Ga0068856_100192517	3300005614	Unclassified	2053
250	Ga0068856_101626460	3300005614	Bacteria	659
251	Ga0068852_100028189	3300005616	Bacteria	4591
252	Ga0068852_100061089	3300005616	Bacteria	3274
253	Ga0068852_100063035	3300005616	Bacteria	3226
254	Ga0068852_100152919	3300005616	Bacteria	2147
255	Ga0068852_101567225	3300005616	Bacteria	681
256	Ga0068859_100323585	3300005617	Bacteria	1636
257	Ga0068864_100106831	3300005618	Bacteria	2490
258	Ga0068864_101396657	3300005618	Bacteria	702
259	Ga0068866_10047322	3300005718	Bacteria	2168
260	Ga0068851_10006865	3300005834	Bacteria	5215
261	Ga0068851_10013274	3300005834	Bacteria	3898
262	Ga0068851_10178883	3300005834	Bacteria	1174
263	Ga0068851_10361086	3300005834	Bacteria	847
264	Ga0068863_100067372	3300005841	Bacteria	3386
265	Ga0068858_100069607	3300005842	Bacteria	3262
266	Ga0068858_100334528	3300005842	Bacteria	1449
267	Ga0068858_100350874	3300005842	Bacteria	1413
268	Ga0068858_100631267	3300005842	Bacteria	1040
269	Ga0068860_100001721	3300005843	Bacteria	23342
270	Ga0068860_100792432	3300005843	Bacteria	961
271	Ga0068860_101549042	3300005843	Bacteria	685
272	Ga0070717_10004517	3300006028	Bacteria	10053
273	Ga0070717_11051951	3300006028	Bacteria	741
274	Ga0070717_11572553	3300006028	Bacteria	596
275	Ga0070715_10039351	3300006163	Bacteria	1969
276	Ga0070715_10653214	3300006163	Bacteria	623
277	Ga0070716_100005231	3300006173	Bacteria	6271
278	Ga0070712_100185235	3300006175	Bacteria	1625
279	Ga0075370_10537308	3300006353	Bacteria	707
280	Ga0068871_100332227	3300006358	Bacteria	1341
281	Ga0068871_100440503	3300006358	Bacteria	1166
282	Ga0068871_100856458	3300006358	Unclassified	840
283	Ga0075430_100714107	3300006846	Bacteria	826
284	Ga0075436_100010993	3300006914	Bacteria	6215
285	Ga0097620_100323589	3300006931	Bacteria	1636
286	Ga0079104_1000030	3300006946	Bacteria	207526
287	Ga0079104_1003721	3300006946	Bacteria	6911
288	Ga0079104_1009675	3300006946	Bacteria	3247
289	Ga0099826_10000026	3300006948	Bacteria	146276
290	Ga0075435_100004515	3300007076	Bacteria	9569
291	Ga0105251_10000913	3300009011	Bacteria	26484
292	Ga0105251_10001662	3300009011	Bacteria	18763
293	Ga0105251_10001746	3300009011	Bacteria	18154
294	Ga0105251_10180261	3300009011	Bacteria	952
295	Ga0105250_10004349	3300009092	Bacteria	6530
296	Ga0105240_10001398	3300009093	Bacteria	41467
297	Ga0105240_10004831	3300009093	Bacteria	20312
298	Ga0105240_10011738	3300009093	Bacteria	12170
299	Ga0105240_10016392	3300009093	Bacteria	10033
300	Ga0105240_10026813	3300009093	Bacteria	7557
301	Ga0105240_10037237	3300009093	Bacteria	6253
302	Ga0105240_10047810	3300009093	Bacteria	5411
303	Ga0105240_10053448	3300009093	Bacteria	5069
304	Ga0105240_10084256	3300009093	Bacteria	3898
305	Ga0105240_10084284	3300009093	Bacteria	3897
306	Ga0105240_10117182	3300009093	Bacteria	3212
307	Ga0105240_10140282	3300009093	Bacteria	2890
308	Ga0105240_10196421	3300009093	Bacteria	2368
309	Ga0105240_10246079	3300009093	Bacteria	2071
310	Ga0105240_10272224	3300009093	Bacteria	1949
311	Ga0105240_10652658	3300009093	Bacteria	1153
312	Ga0105245_10251946	3300009098	Bacteria	1716
313	Ga0105247_10014970	3300009101	Bacteria	4650
314	Ga0105247_10015877	3300009101	Bacteria	4509
315	Ga0105247_10591091	3300009101	Bacteria	822
316	Ga0105241_10000088	3300009174	Bacteria	68941
317	Ga0105241_10093696	3300009174	Bacteria	2374
318	Ga0105241_10167522	3300009174	Bacteria	1812
319	Ga0105241_10178807	3300009174	Bacteria	1758
320	Ga0105241_10512260	3300009174	Bacteria	1072
321	Ga0105241_11065538	3300009174	Bacteria	759
322	Ga0105241_11118713	3300009174	Bacteria	742
323	Ga0105242_10077605	3300009176	Bacteria	2771
324	Ga0105242_10471560	3300009176	Bacteria	1188
325	Ga0105248_10000011	3300009177	Bacteria	339183
326	Ga0105248_10264111	3300009177	Bacteria	1938
327	Ga0105248_10739127	3300009177	Bacteria	1110
328	Ga0105248_13049857	3300009177	Bacteria	533
329	Ga0105237_10000022	3300009545	Bacteria	228427
330	Ga0105237_10001780	3300009545	Bacteria	27851
331	Ga0105237_10037768	3300009545	Bacteria	4880
332	Ga0105237_10039666	3300009545	Bacteria	4753
333	Ga0105237_10100642	3300009545	Bacteria	2882
334	Ga0105237_10135431	3300009545	Bacteria	2458
335	Ga0105237_10275936	3300009545	Bacteria	1684
336	Ga0105237_10328634	3300009545	Bacteria	1533
337	Ga0105237_10454986	3300009545	Bacteria	1286
338	Ga0105238_10001273	3300009551	Bacteria	25347
339	Ga0105238_10005127	3300009551	Bacteria	12948
340	Ga0105238_10023039	3300009551	Bacteria	6350
341	Ga0105238_10046234	3300009551	Bacteria	4394
342	Ga0105238_10117505	3300009551	Bacteria	2640
343	Ga0105238_10382774	3300009551	Bacteria	1398
344	Ga0105238_10458444	3300009551	Bacteria	1272
345	Ga0105238_10776286	3300009551	Bacteria	973
346	Ga0105148_104047	3300009978	Bacteria	1045
347	Ga0105028_107357	3300009993	Bacteria	1150
348	Ga0105239_10000615	3300010375	Bacteria	50705
349	Ga0105239_10044395	3300010375	Bacteria	4873
350	Ga0105239_10082342	3300010375	Bacteria	3543
351	Ga0105239_10117315	3300010375	Bacteria	2954
352	Ga0105239_10150325	3300010375	Bacteria	2599
353	Ga0105239_10685779	3300010375	Bacteria	1171
354	Ga0105239_10921478	3300010375	Bacteria	1003
355	Ga0105239_11015926	3300010375	Bacteria	954
356	Ga0105239_11282324	3300010375	Bacteria	845
357	Ga0105239_11901571	3300010375	Bacteria	690
358	Ga0105239_12642313	3300010375	Bacteria	586
359	Ga0105246_10121779	3300011119	Bacteria	1934
360	Ga0105246_12145457	3300011119	Bacteria	542
361	Ga0157314_1000035	3300012500	Bacteria	13366
362	Ga0157347_1000778	3300012502	Bacteria	2243
363	Ga0157315_1002889	3300012508	Bacteria	1115
364	Ga0157373_10008380	3300013100	Bacteria	7680
365	Ga0157373_10321076	3300013100	Bacteria	1101
366	Ga0157373_10366781	3300013100	Bacteria	1029
367	Ga0157373_11457813	3300013100	Bacteria	522
368	Ga0157371_10000090	3300013102	Bacteria	145235
369	Ga0157371_10031301	3300013102	Bacteria	3832
370	Ga0157371_10118693	3300013102	Bacteria	1880
371	Ga0157371_10812528	3300013102	Bacteria	705
372	Ga0157371_11324840	3300013102	Bacteria	558
373	Ga0157370_10000014	3300013104	Bacteria	194894
374	Ga0157370_10012032	3300013104	Bacteria	9010
375	Ga0157370_10051677	3300013104	Bacteria	3926
376	Ga0157370_10060612	3300013104	Bacteria	3592
377	Ga0157370_11038140	3300013104	Bacteria	741
378	Ga0157369_10000846	3300013105	Bacteria	39124
379	Ga0157369_10034999	3300013105	Bacteria	5507
380	Ga0157369_10061259	3300013105	Bacteria	4057
381	Ga0157369_10075510	3300013105	Bacteria	3614
382	Ga0157369_10272951	3300013105	Bacteria	1762
383	Ga0157369_10809566	3300013105	Bacteria	962
384	Ga0157369_10840559	3300013105	Bacteria	943
385	Ga0157374_10037267	3300013296	Bacteria	4461
386	Ga0157374_10086687	3300013296	Bacteria	2979
387	Ga0157374_10181338	3300013296	Bacteria	2057
388	Ga0157374_10292692	3300013296	Bacteria	1610
389	Ga0157374_11074921	3300013296	Bacteria	825
390	Ga0157378_10044747	3300013297	Bacteria	3932
391	Ga0163162_10132921	3300013306	Bacteria	2598
392	Ga0163162_10137210	3300013306	Bacteria	2557
393	Ga0163162_10303189	3300013306	Bacteria	1730
394	Ga0163162_10470521	3300013306	Bacteria	1388
395	Ga0157372_10000032	3300013307	Bacteria	178666
396	Ga0157372_10001670	3300013307	Bacteria	24027
397	Ga0157372_10005974	3300013307	Bacteria	12938
398	Ga0157372_10175679	3300013307	Bacteria	2479
399	Ga0157372_10550906	3300013307	Bacteria	1344
400	Ga0157372_11545239	3300013307	Bacteria	764
401	Ga0157372_11752394	3300013307	Bacteria	714
402	Ga0157372_12587554	3300013307	Bacteria	582
403	Ga0157375_10061748	3300013308	Bacteria	3722
404	Ga0157375_10748869	3300013308	Bacteria	1128
405	Ga0157375_11138147	3300013308	Bacteria	914
406	Ga0163163_10060355	3300014325	Bacteria	3755
407	Ga0163163_10080314	3300014325	Unclassified	3261
408	Ga0163163_10210688	3300014325	Bacteria	1993
409	Ga0163163_11566669	3300014325	Bacteria	720
410	Ga0182008_10001163	3300014497	Bacteria	18137
411	Ga0182008_10026297	3300014497	Bacteria	2952
412	Ga0182008_10031010	3300014497	Bacteria	2693
413	Ga0182008_10055069	3300014497	Bacteria	1967
414	Ga0182008_10146649	3300014497	Bacteria	1182
415	Ga0182008_10548114	3300014497	Bacteria	642
416	Ga0157379_11452490	3300014968	Bacteria	666
417	Ga0157376_10016735	3300014969	Bacteria	5576
418	Ga0157376_10064877	3300014969	Plasmid	3081
419	Ga0157376_10161189	3300014969	Bacteria	2033
420	Ga0182006_1001264	3300015261	Bacteria	15627
421	Ga0182006_1006453	3300015261	Bacteria	5449
422	Ga0182006_1007974	3300015261	Bacteria	4816
423	Ga0182006_1010959	3300015261	Bacteria	4008
424	Ga0182006_1041585	3300015261	Bacteria	1804
425	Ga0182006_1055485	3300015261	Bacteria	1512
426	Ga0182007_10000384	3300015262	Bacteria	27661
427	Ga0182007_10010622	3300015262	Bacteria	3627
428	Ga0182007_10014753	3300015262	Bacteria	2934
429	Ga0182007_10020813	3300015262	Bacteria	2338
430	Ga0182007_10070555	3300015262	Bacteria	1144
431	Ga0182005_1000475	3300015265	Bacteria	20796
432	Ga0182005_1164192	3300015265	Bacteria	652
433	Ga0183361_10001	3300016635	Bacteria	908583
434	Ga0163161_10158338	3300017792	Bacteria	1725
435	Ga0163161_11292464	3300017792	Bacteria	634
436	Ga0197907_10596243	3300020069	Bacteria	944
437	Ga0206356_10041077	3300020070	Bacteria	1078
438	Ga0206351_10272672	3300020077	Bacteria	3190
439	Ga0154015_1616394	3300020610	Bacteria	29656
440	Ga0213872_10012425	3300021361	Bacteria	4005
441	Ga0213872_10117962	3300021361	Bacteria	1174
442	Ga0213872_10134754	3300021361	Bacteria	1086
443	Ga0213876_10212986	3300021384	Bacteria	1027
444	Ga0213876_10298246	3300021384	Bacteria	857
445	Ga0213871_10030398	3300021441	Bacteria	1405
446	Ga0224712_10006244	3300022467	Bacteria	3382
447	Ga0209435_100188	3300025206	Bacteria	18304
448	Ga0209784_100002	3300025224	Bacteria	1753105
449	Ga0209784_100004	3300025224	Bacteria	1378156
450	Ga0209784_100008	3300025224	Bacteria	740293
451	Ga0209784_100388	3300025224	Bacteria	20135
452	Ga0209784_100437	3300025224	Bacteria	18014
453	Ga0209566_100003	3300025225	Bacteria	1753105
454	Ga0209566_100004	3300025225	Bacteria	1531866
455	Ga0209566_100006	3300025225	Bacteria	789272
456	Ga0209566_100398	3300025225	Bacteria	34826
457	Ga0209566_101273	3300025225	Bacteria	8460
458	Ga0209566_108812	3300025225	Bacteria	1074
459	Ga0209674_100004	3300025226	Bacteria	1753105
460	Ga0209674_100006	3300025226	Bacteria	1531866
461	Ga0209674_100083	3300025226	Bacteria	197744
462	Ga0209674_100109	3300025226	Bacteria	150435
463	Ga0209674_100223	3300025226	Bacteria	52483
464	Ga0209674_100236	3300025226	Bacteria	48381
465	Ga0209674_104698	3300025226	Bacteria	2168
466	Ga0209672_100001	3300025228	Bacteria	2828210
467	Ga0209672_100046	3300025228	Bacteria	264244
468	Ga0209672_100047	3300025228	Bacteria	250925
469	Ga0209672_100113	3300025228	Bacteria	92025
470	Ga0209672_101517	3300025228	Bacteria	8076
471	Ga0209672_101638	3300025228	Bacteria	7356
472	Ga0209672_103411	3300025228	Bacteria	3305
473	Ga0209147_100001	3300025229	Bacteria	2384371
474	Ga0209147_100005	3300025229	Bacteria	1036530
475	Ga0209147_100023	3300025229	Bacteria	437803
476	Ga0209147_100043	3300025229	Bacteria	300460
477	Ga0209147_100059	3300025229	Bacteria	250891
478	Ga0209147_100232	3300025229	Bacteria	55193
479	Ga0209563_100006	3300025230	Bacteria	1753105
480	Ga0209563_100009	3300025230	Bacteria	1378156
481	Ga0209563_100016	3300025230	Bacteria	802091
482	Ga0209563_100302	3300025230	Bacteria	19960
483	Ga0209563_112603	3300025230	Bacteria	1150
484	Ga0207427_100075	3300025231	Bacteria	150143
485	Ga0207427_100257	3300025231	Bacteria	41673
486	Ga0207427_102136	3300025231	Bacteria	5711
487	Ga0209437_100004	3300025233	Bacteria	1378156
488	Ga0209437_100265	3300025233	Bacteria	80495
489	Ga0209437_100366	3300025233	Bacteria	48770
490	Ga0209258_100001	3300025242	Bacteria	2384269
491	Ga0209258_100007	3300025242	Bacteria	1036530
492	Ga0209258_100023	3300025242	Bacteria	547286
493	Ga0209258_100045	3300025242	Bacteria	369941
494	Ga0209258_100172	3300025242	Bacteria	144895
495	Ga0209258_100314	3300025242	Bacteria	75531
496	Ga0209258_100836	3300025242	Bacteria	16872
497	Ga0209646_1000016	3300025246	Bacteria	501688
498	Ga0209646_1000321	3300025246	Bacteria	36870
499	Ga0209646_1000476	3300025246	Bacteria	20097
500	Ga0209646_1009753	3300025246	Bacteria	1517
501	Ga0209026_1000031	3300025250	Bacteria	325747
502	Ga0209026_1000323	3300025250	Bacteria	50493
503	Ga0209026_1003773	3300025250	Bacteria	4804
504	Ga0209026_1009009	3300025250	Bacteria	2013
505	Ga0209026_1044308	3300025250	Bacteria	641
506	Ga0209677_100003	3300025253	Bacteria	1753105
507	Ga0209677_100005	3300025253	Bacteria	1378156
508	Ga0209677_100008	3300025253	Bacteria	802091
509	Ga0209677_100256	3300025253	Bacteria	36093
510	Ga0209677_102251	3300025253	Bacteria	7469
511	Ga0209677_115316	3300025253	Bacteria	1014
512	Ga0209148_1000003	3300025254	Bacteria	2384288
513	Ga0209148_1000024	3300025254	Bacteria	669890
514	Ga0209148_1000029	3300025254	Bacteria	579199
515	Ga0209148_1000051	3300025254	Bacteria	401000
516	Ga0209148_1000052	3300025254	Bacteria	399449
517	Ga0209148_1001548	3300025254	Bacteria	11145
518	Ga0209148_1003965	3300025254	Bacteria	3804
519	Ga0209148_1009157	3300025254	Bacteria	1947
520	Ga0209759_1000227	3300025256	Bacteria	84278
521	Ga0209759_1000466	3300025256	Bacteria	45749
522	Ga0209759_1000511	3300025256	Bacteria	42029
523	Ga0209759_1000599	3300025256	Bacteria	34894
524	Ga0209759_1000627	3300025256	Bacteria	33643
525	Ga0209759_1000995	3300025256	Bacteria	19417
526	Ga0209759_1001884	3300025256	Bacteria	10389
527	Ga0209759_1006041	3300025256	Bacteria	4127
528	Ga0209759_1009920	3300025256	Bacteria	2840
529	Ga0209759_1017698	3300025256	Bacteria	1746
530	Ga0209129_1001095	3300025258	Bacteria	15818
531	Ga0209233_1000005	3300025261	Bacteria	1531866
532	Ga0209233_1000123	3300025261	Bacteria	228400
533	Ga0209233_1000210	3300025261	Bacteria	112384
534	Ga0209233_1001667	3300025261	Bacteria	8647
535	Ga0209233_1017367	3300025261	Bacteria	1962
536	Ga0209565_1000232	3300025263	Bacteria	61159
537	Ga0209455_1000001	3300025272	Bacteria	2384278
538	Ga0209455_1000011	3300025272	Bacteria	947242
539	Ga0209455_1000025	3300025272	Bacteria	670673
540	Ga0209455_1000064	3300025272	Bacteria	332404
541	Ga0209455_1002194	3300025272	Bacteria	7728
542	Ga0209455_1002930	3300025272	Bacteria	6292
543	Ga0209455_1003751	3300025272	Bacteria	5240
544	Ga0209455_1019248	3300025272	Bacteria	1384
545	Ga0209673_1046817	3300025273	Bacteria	1177
546	Ga0209130_1019192	3300025284	Bacteria	1591
547	Ga0209675_1000043	3300025291	Bacteria	235320
548	Ga0209675_1000047	3300025291	Bacteria	221683
549	Ga0209675_1002614	3300025291	Bacteria	9124
550	Ga0209676_1000083	3300025292	Bacteria	279816
551	Ga0209025_1000027	3300025294	Bacteria	505882
552	Ga0209025_1000106	3300025294	Bacteria	222421
553	Ga0209025_1000836	3300025294	Bacteria	48885
554	Ga0209025_1000991	3300025294	Bacteria	42077
555	Ga0209025_1002975	3300025294	Bacteria	16801
556	Ga0209025_1027180	3300025294	Bacteria	2846
557	Ga0209025_1092004	3300025294	Bacteria	988
558	Ga0209564_1000737	3300025295	Bacteria	46496
559	Ga0209564_1001489	3300025295	Bacteria	23606
560	Ga0209564_1001501	3300025295	Bacteria	23419
561	Ga0209564_1007938	3300025295	Bacteria	5348
562	Ga0209758_1000491	3300025297	Bacteria	64678
563	Ga0209758_1010992	3300025297	Bacteria	5312
564	Ga0209758_1016906	3300025297	Bacteria	3673
565	Ga0209758_1022918	3300025297	Bacteria	2842
566	Ga0209050_1002947	3300025298	Bacteria	13308
567	Ga0209256_1000647	3300025299	Bacteria	47365
568	Ga0209256_1004400	3300025299	Bacteria	8878
569	Ga0207426_1000007	3300025302	Bacteria	971011
570	Ga0207426_1004192	3300025302	Bacteria	7188
571	Ga0209051_1014838	3300025303	Bacteria	3617
572	Ga0209051_1019382	3300025303	Bacteria	2969
573	Ga0209051_1022070	3300025303	Bacteria	2691
574	Ga0207656_10047768	3300025321	Bacteria	1841
575	Ga0207656_10226131	3300025321	Bacteria	911
576	Ga0207656_10428938	3300025321	Bacteria	667
577	Ga0207696_1006421	3300025711	Bacteria	4742
578	Ga0207713_1000055	3300025735	Bacteria	221387
579	Ga0207713_1000920	3300025735	Bacteria	26377
580	Ga0207713_1001973	3300025735	Bacteria	15448
581	Ga0207713_1192107	3300025735	Bacteria	631
582	Ga0207682_10018365	3300025893	Bacteria	2734
583	Ga0207642_10107646	3300025899	Bacteria	1413
584	Ga0207710_10014529	3300025900	Bacteria	3322
585	Ga0207680_10059907	3300025903	Bacteria	2315
586	Ga0207680_11033734	3300025903	Bacteria	588
587	Ga0207647_10000635	3300025904	Bacteria	27390
588	Ga0207647_10001156	3300025904	Bacteria	20341
589	Ga0207647_10001464	3300025904	Bacteria	18150
590	Ga0207647_10004154	3300025904	Bacteria	10739
591	Ga0207647_10023061	3300025904	Bacteria	4123
592	Ga0207647_10193358	3300025904	Bacteria	1178
593	Ga0207685_10077076	3300025905	Bacteria	1368
594	Ga0207699_10010709	3300025906	Bacteria	4611
595	Ga0207699_10554204	3300025906	Bacteria	834
596	Ga0207645_10037603	3300025907	Bacteria	3105
597	Ga0207645_10180473	3300025907	Bacteria	1385
598	Ga0207645_10276329	3300025907	Bacteria	1115
599	Ga0207705_10000492	3300025909	Bacteria	33671
600	Ga0207705_10040240	3300025909	Bacteria	3352
601	Ga0207705_10123599	3300025909	Bacteria	1922
602	Ga0207705_10208915	3300025909	Bacteria	1480
603	Ga0207705_10282947	3300025909	Bacteria	1270
604	Ga0207705_10765256	3300025909	Bacteria	750
605	Ga0207654_10000014	3300025911	Bacteria	230865
606	Ga0207654_10148847	3300025911	Bacteria	1501
607	Ga0207654_10642551	3300025911	Bacteria	759
608	Ga0207695_10000157	3300025913	Bacteria	204140
609	Ga0207695_10001066	3300025913	Bacteria	47992
610	Ga0207695_10001444	3300025913	Bacteria	39750
611	Ga0207695_10002435	3300025913	Bacteria	27506
612	Ga0207695_10004189	3300025913	Bacteria	19817
613	Ga0207695_10006362	3300025913	Bacteria	15366
614	Ga0207695_10011925	3300025913	Bacteria	10469
615	Ga0207695_10012833	3300025913	Bacteria	10032
616	Ga0207695_10025973	3300025913	Bacteria	6545
617	Ga0207695_10098925	3300025913	Bacteria	2916
618	Ga0207695_10173654	3300025913	Bacteria	2079
619	Ga0207695_10203070	3300025913	Bacteria	1895
620	Ga0207695_10430073	3300025913	Bacteria	1204
621	Ga0207695_10513032	3300025913	Bacteria	1081
622	Ga0207695_10621830	3300025913	Bacteria	961
623	Ga0207695_10712871	3300025913	Bacteria	884
624	Ga0207695_10861645	3300025913	Bacteria	786
625	Ga0207671_10000009	3300025914	Bacteria	724862
626	Ga0207671_10003233	3300025914	Bacteria	16389
627	Ga0207671_10007405	3300025914	Bacteria	9524
628	Ga0207671_10008088	3300025914	Bacteria	8981
629	Ga0207671_10023425	3300025914	Bacteria	4656
630	Ga0207671_10026938	3300025914	Bacteria	4301
631	Ga0207671_10057654	3300025914	Bacteria	2879
632	Ga0207671_10156005	3300025914	Bacteria	1766
633	Ga0207671_10239979	3300025914	Bacteria	1423
634	Ga0207693_10057366	3300025915	Bacteria	3052
635	Ga0207693_10231860	3300025915	Bacteria	1450
636	Ga0207693_10607571	3300025915	Bacteria	851
637	Ga0207663_10627222	3300025916	Bacteria	847
638	Ga0207657_10000008	3300025919	Bacteria	189885
639	Ga0207657_10074389	3300025919	Bacteria	2869
640	Ga0207657_10115148	3300025919	Bacteria	2216
641	Ga0207657_10142632	3300025919	Bacteria	1956
642	Ga0207657_10280851	3300025919	Bacteria	1322
643	Ga0207657_10340085	3300025919	Bacteria	1184
644	Ga0207657_10614081	3300025919	Bacteria	848
645	Ga0207649_10000115	3300025920	Bacteria	68028
646	Ga0207649_10187535	3300025920	Bacteria	1452
647	Ga0207649_10276832	3300025920	Bacteria	1218
648	Ga0207652_10673112	3300025921	Bacteria	925
649	Ga0207652_10892074	3300025921	Bacteria	786
650	Ga0207646_10197101	3300025922	Bacteria	1819
651	Ga0207681_10590200	3300025923	Bacteria	917
652	Ga0207694_10001091	3300025924	Bacteria	23538
653	Ga0207694_10011833	3300025924	Bacteria	6581
654	Ga0207694_10047223	3300025924	Bacteria	3330
655	Ga0207694_10117904	3300025924	Bacteria	2117
656	Ga0207694_10159434	3300025924	Bacteria	1822
657	Ga0207694_10543656	3300025924	Bacteria	974
658	Ga0207650_10102796	3300025925	Bacteria	2202
659	Ga0207650_10233680	3300025925	Bacteria	1484
660	Ga0207650_10695432	3300025925	Bacteria	859
661	Ga0207687_10628357	3300025927	Bacteria	907
662	Ga0207700_10098290	3300025928	Bacteria	2328
663	Ga0207700_11424897	3300025928	Bacteria	616
664	Ga0207664_10004968	3300025929	Bacteria	9047
665	Ga0207664_10282035	3300025929	Bacteria	1458
666	Ga0207644_10185935	3300025931	Bacteria	1631
667	Ga0207644_10347969	3300025931	Bacteria	1203
668	Ga0207644_10395533	3300025931	Bacteria	1129
669	Ga0207644_10552318	3300025931	Unclassified	953
670	Ga0207644_10912848	3300025931	Bacteria	736
671	Ga0207690_10000013	3300025932	Bacteria	266156
672	Ga0207690_10002668	3300025932	Bacteria	10753
673	Ga0207690_10010596	3300025932	Bacteria	5487
674	Ga0207690_10418630	3300025932	Bacteria	1071
675	Ga0207690_10635175	3300025932	Bacteria	874
676	Ga0207706_10045119	3300025933	Bacteria	3906
677	Ga0207706_10144092	3300025933	Bacteria	2096
678	Ga0207706_10638587	3300025933	Bacteria	912
679	Ga0207686_11348356	3300025934	Bacteria	586
680	Ga0207665_10000928	3300025939	Bacteria	19813
681	Ga0207691_10109516	3300025940	Bacteria	2457
682	Ga0207691_10167287	3300025940	Bacteria	1926
683	Ga0207691_10527413	3300025940	Bacteria	1002
684	Ga0207711_10000028	3300025941	Bacteria	214107
685	Ga0207711_10164800	3300025941	Bacteria	2008
686	Ga0207711_10626637	3300025941	Bacteria	1003
687	Ga0207661_10021702	3300025944	Bacteria	4816
688	Ga0207661_10058433	3300025944	Bacteria	3104
689	Ga0207679_10000002	3300025945	Bacteria	634491
690	Ga0207679_10156612	3300025945	Bacteria	1861
691	Ga0207679_10171740	3300025945	Bacteria	1785
692	Ga0207679_10358641	3300025945	Bacteria	1273
693	Ga0207679_10451373	3300025945	Bacteria	1140
694	Ga0207679_10834214	3300025945	Bacteria	841
695	Ga0207667_10000193	3300025949	Bacteria	88949
696	Ga0207667_10000216	3300025949	Bacteria	80609
697	Ga0207667_10000244	3300025949	Bacteria	76441
698	Ga0207667_10000438	3300025949	Bacteria	55784
699	Ga0207667_10016979	3300025949	Bacteria	8212
700	Ga0207667_10036392	3300025949	Bacteria	5276
701	Ga0207667_10079025	3300025949	Bacteria	3409
702	Ga0207667_10119612	3300025949	Bacteria	2714
703	Ga0207667_10130749	3300025949	Bacteria	2586
704	Ga0207667_10272249	3300025949	Bacteria	1731
705	Ga0207667_11153914	3300025949	Bacteria	756
706	Ga0207667_11379101	3300025949	Bacteria	679
707	Ga0207668_10177599	3300025972	Bacteria	1676
708	Ga0207640_10000169	3300025981	Bacteria	47286
709	Ga0207640_10000249	3300025981	Bacteria	36566
710	Ga0207640_10003540	3300025981	Bacteria	8423
711	Ga0207640_10032724	3300025981	Bacteria	3226
712	Ga0207640_10454103	3300025981	Bacteria	1057
713	Ga0207640_11002768	3300025981	Bacteria	735
714	Ga0207658_10457270	3300025986	Bacteria	1131
715	Ga0207658_10863396	3300025986	Bacteria	823
716	Ga0207677_10039425	3300026023	Bacteria	3106
717	Ga0207703_10008997	3300026035	Bacteria	7865
718	Ga0207703_10282265	3300026035	Bacteria	1508
719	Ga0207703_10438692	3300026035	Bacteria	1218
720	Ga0207703_10524692	3300026035	Bacteria	1114
721	Ga0207703_10583366	3300026035	Bacteria	1056
722	Ga0207639_10351541	3300026041	Bacteria	1316
723	Ga0207639_10701887	3300026041	Bacteria	939
724	Ga0207639_11833604	3300026041	Bacteria	567
725	Ga0207678_10000003	3300026067	Bacteria	282716
726	Ga0207678_10001041	3300026067	Bacteria	25323
727	Ga0207678_10008364	3300026067	Bacteria	9125
728	Ga0207678_10052114	3300026067	Bacteria	3532
729	Ga0207678_10062286	3300026067	Bacteria	3207
730	Ga0207678_10084571	3300026067	Bacteria	2713
731	Ga0207678_10088699	3300026067	Bacteria	2643
732	Ga0207678_10123892	3300026067	Bacteria	2206
733	Ga0207678_10125095	3300026067	Bacteria	2194
734	Ga0207678_10202644	3300026067	Bacteria	1697
735	Ga0207678_10632409	3300026067	Bacteria	939
736	Ga0207702_10000010	3300026078	Bacteria	292789
737	Ga0207702_10286552	3300026078	Unclassified	1559
738	Ga0207702_10368282	3300026078	Bacteria	1379
739	Ga0207702_11001462	3300026078	Bacteria	829
740	Ga0207702_11839636	3300026078	Bacteria	597
741	Ga0207641_10060801	3300026088	Bacteria	3221
742	Ga0207641_10282053	3300026088	Bacteria	1563
743	Ga0207648_10049727	3300026089	Bacteria	3667
744	Ga0207676_10304516	3300026095	Bacteria	1456
745	Ga0207674_10000401	3300026116	Bacteria	56126
746	Ga0207674_10003092	3300026116	Bacteria	20567
747	Ga0207674_10005233	3300026116	Bacteria	15446
748	Ga0207674_10201344	3300026116	Bacteria	1941
749	Ga0207674_10339917	3300026116	Bacteria	1451
750	Ga0207674_11759320	3300026116	Bacteria	587
751	Ga0207675_100878051	3300026118	Bacteria	912
752	Ga0207683_10013134	3300026121	Bacteria	7065
753	Ga0207683_10028367	3300026121	Bacteria	4840
754	Ga0207698_10039454	3300026142	Bacteria	3499
755	Ga0207698_10158636	3300026142	Bacteria	1975
756	Ga0207698_10341515	3300026142	Bacteria	1411
757	Ga0207698_10441370	3300026142	Bacteria	1254
758	Ga0207698_11491462	3300026142	Bacteria	691
759	Ga0209281_1000012	3300027111	Bacteria	684886
760	Ga0209281_1000113	3300027111	Bacteria	211588
761	Ga0209281_1008973	3300027111	Bacteria	2378
762	Ga0209371_1000065	3300027312	Bacteria	214464
763	Ga0209371_1008529	3300027312	Bacteria	3390
764	Ga0209371_1011829	3300027312	Bacteria	2565
765	Ga0209371_1068482	3300027312	Bacteria	635
766	Ga0209282_1000044	3300027666	Bacteria	119005
767	Ga0268266_10031474	3300028379	Bacteria	4505
768	Ga0268266_11200682	3300028379	Bacteria	733
769	Ga0268264_10000107	3300028381	Bacteria	209105
770	Ga0268264_10531370	3300028381	Bacteria	1151
771	Ga0268264_10787769	3300028381	Bacteria	949
772	Ga0265338_10122744	3300028800	Bacteria	2067
773	Ga0268256_1000118	3300030500	Bacteria	115175
774	Ga0268256_1008906	3300030500	Bacteria	3390
775	Ga0268256_1018767	3300030500	Bacteria	1911
776	Ga0268256_1076356	3300030500	Bacteria	635
777	Ga0307511_10077026	3300030521	Bacteria	2378
778	Ga0265330_10505065	3300031235	Bacteria	515
779	Ga0265320_10241173	3300031240	Bacteria	803
780	Ga0265325_10085618	3300031241	Bacteria	1561
781	Ga0265325_10129903	3300031241	Bacteria	1207
782	Ga0265329_10349407	3300031242	Bacteria	506
783	Ga0265331_10106657	3300031250	Bacteria	1286
784	Ga0265316_10013170	3300031344	Bacteria	7367
785	Ga0265316_10729841	3300031344	Unclassified	697
786	Ga0307509_10046936	3300031507	Bacteria	4647
787	Ga0307509_10411398	3300031507	Bacteria	1056
788	Ga0307509_10505964	3300031507	Bacteria	891
789	Ga0307509_10866944	3300031507	Bacteria	567
790	Ga0307408_100000051	3300031548	Bacteria	154427
791	Ga0307408_100001227	3300031548	Bacteria	19297
792	Ga0307408_100002131	3300031548	Bacteria	14202
793	Ga0307508_10093542	3300031616	Bacteria	2595
794	Ga0265314_10020928	3300031711	Bacteria	5043
795	Ga0265314_10033482	3300031711	Bacteria	3768
796	Ga0307516_10118177	3300031730	Bacteria	2445
797	Ga0307516_10141101	3300031730	Bacteria	2179
798	Ga0307405_11834279	3300031731	Bacteria	540
799	Ga0307413_10214594	3300031824	Bacteria	1400
800	Ga0307410_11345778	3300031852	Bacteria	626
801	Ga0307406_10000386	3300031901	Bacteria	25474
802	Ga0307406_10005474	3300031901	Bacteria	6948
803	Ga0307406_10278596	3300031901	Bacteria	1274
804	Ga0307407_10350279	3300031903	Bacteria	1045
805	Ga0307407_11080254	3300031903	Bacteria	623
806	Ga0307412_10000014	3300031911	Bacteria	353795
807	Ga0307412_10039977	3300031911	Bacteria	3032
808	Ga0307412_10094850	3300031911	Bacteria	2096
809	Ga0307412_10389733	3300031911	Bacteria	1131
810	Ga0307412_10758031	3300031911	Bacteria	839
811	Ga0307409_101795570	3300031995	Bacteria	642
812	Ga0307416_100107757	3300032002	Bacteria	2446
813	Ga0307416_100778015	3300032002	Bacteria	1051
814	Ga0307416_100928759	3300032002	Bacteria	971
815	Ga0307414_10053745	3300032004	Bacteria	2811
816	Ga0307414_11063740	3300032004	Bacteria	746
817	Ga0307411_10078757	3300032005	Bacteria	2260
818	Ga0307415_100185015	3300032126	Bacteria	1638
819	Ga0307507_10196286	3300033179	Bacteria	1407
820	Ga0307510_10201870	3300033180	Bacteria	1522
821	Ga0373926_0051463	3300035083	Bacteria	1486
822	Ga0373944_0378365	3300035089	Unclassified	543
823	Ga0373943_0169927	3300035170	Bacteria	1192
824	Ga0373943_0211683	3300035170	Bacteria	1077
825	Ga0373955_0666209	3300035172	Bacteria	638
826	Ga0373935_0243497	3300035692	Bacteria	1256
827	Ga0373935_0282707	3300035692	Bacteria	1168
828	Ga0373927_0007941	3300035695	Bacteria	7164
829	Ga0373927_0470004	3300035695	Unclassified	831
830	Ga0373947_0003866	3300035725	Bacteria	8817
831	Ga0373947_0007466	3300035725	Bacteria	6328
832	Ga0373947_0279665	3300035725	Bacteria	1109
833	Ga0373925_0002934	3300037068	Bacteria	13456
834	Ga0373925_0042606	3300037068	Bacteria	3367
835	Ga0373925_0158221	3300037068	Bacteria	1783
836	Ga0373925_0327452	3300037068	Bacteria	1241
837	Ga0395899_0075016	3300037312	Bacteria	2470
838	Ga0395900_0007165	3300037418	Bacteria	11556
839	Ga0395900_0343157	3300037418	Bacteria	1468
840	Ga0395900_0383610	3300037418	Bacteria	1373
841	Ga0395898_0160424	3300037466	Bacteria	2150
842	Ga0395898_0738592	3300037466	Bacteria	926
843	Ga0395905_0000014	3300037471	Bacteria	394209
844	Ga0395905_0007035	3300037471	Bacteria	11244
845	Ga0395905_0266339	3300037471	Bacteria	1599
846	Ga0395905_0446749	3300037471	Bacteria	1191
847	Ga0395905_0557468	3300037471	Bacteria	1047
848	Ga0395905_0674899	3300037471	Bacteria	936
849	Ga0395901_0002709	3300038443	Bacteria	17846
850	Ga0237816_00997	3300039145	Bacteria	2318
851	Ga0436365_0545029	3300039437	Bacteria	515
852	Ga0436365_1055985	3300039437	Bacteria	1196
853	Ga0436365_1696154	3300039437	Bacteria	2367
854	Ga0436360_0889577	3300039438	Bacteria	503
855	Ga0436360_0906320	3300039438	Bacteria	1891
856	Ga0436360_1007276	3300039438	Bacteria	3772
857	Ga0436361_0101173	3300039447	Bacteria	1550
858	Ga0436361_0105757	3300039447	Bacteria	930
859	Ga0436361_0319367	3300039447	Bacteria	9105
860	Ga0436361_0700468	3300039447	Bacteria	4262
861	Ga0436361_0934247	3300039447	Bacteria	1517
862	Ga0436361_1155901	3300039447	Bacteria	1930
863	Ga0436363_0012408	3300039450	Bacteria	652
864	Ga0436363_1497794	3300039450	Bacteria	1693
865	Ga0439436_0042654	3300041404	Bacteria	1296
866	Ga0439466_0010943	3300041411	Bacteria	3362
867	Ga0451791_1690615	3300041451	Bacteria	829
868	Ga0451793_1843072	3300041452	Bacteria	645
869	Ga0451795_0947916	3300041456	Bacteria	859
870	Ga0451800_0358299	3300041459	Bacteria	500
871	Ga0451800_1421740	3300041459	Bacteria	653
872	Ga0451853_2778251	3300041512	Bacteria	952
873	Ga0439448_0014250	3300042005	Bacteria	2397
874	Ga0439432_012835	3300042006	Bacteria	2856
875	Ga0450906_091134	3300042145	Bacteria	553
876	Ga0466986_0220805	3300044650	Bacteria	1231
877	Ga0466969_0000298	3300044656	Bacteria	27190
878	Ga0466969_0081393	3300044656	Bacteria	1545
879	Ga0466969_0271271	3300044656	Bacteria	768
880	Ga0466972_0113803	3300044658	Bacteria	1278
881	Ga0466972_0339487	3300044658	Bacteria	702
882	Ga0466973_0007584	3300044659	Bacteria	9716
883	Ga0466974_0262635	3300044660	Bacteria	1048
884	Ga0466977_0000242	3300044666	Bacteria	15165
885	Ga0466977_0323200	3300044666	Bacteria	924
886	Ga0466978_0152104	3300044671	Bacteria	1411
887	Ga0466978_0362829	3300044671	Bacteria	793
888	Ga0466982_0234877	3300044672	Bacteria	1081
889	Ga0466965_0000535	3300044683	Bacteria	13684
890	Ga0466965_0089249	3300044683	Bacteria	1566
891	Ga0466965_0142124	3300044683	Bacteria	1250
892	Ga0466965_0887730	3300044683	Bacteria	519
893	Ga0466966_0000950	3300044684	Bacteria	18538
894	Ga0466961_0000484	3300044693	Bacteria	25285
895	Ga0466961_0069232	3300044693	Bacteria	2240
896	Ga0466961_0162533	3300044693	Bacteria	1391
897	Ga0466963_0000457	3300044694	Bacteria	18964
898	Ga0466963_0046072	3300044694	Bacteria	2874
899	Ga0466964_0082084	3300044706	Bacteria	1385
900	Ga0466964_0090948	3300044706	Bacteria	1328
901	Ga0466964_0255667	3300044706	Bacteria	866
902	Ga0466964_0410606	3300044706	Bacteria	710
903	Ga0466971_0002220	3300044719	Bacteria	8211
904	Ga0466971_0148577	3300044719	Bacteria	1093
905	Ga0466968_0028123	3300044735	Bacteria	2317
906	Ga0466968_0278280	3300044735	Bacteria	800
907	Ga0466970_0029344	3300044765	Bacteria	2895
908	Ga0466970_0050562	3300044765	Bacteria	2217
909	Ga0466970_0071174	3300044765	Bacteria	1870
910	Ga0466970_0277879	3300044765	Bacteria	941
911	Ga0466970_0751032	3300044765	Bacteria	570
912	Ga0466970_0921462	3300044765	Bacteria	514
913	Ga0466957_0005789	3300044842	Bacteria	6950
914	Ga0466957_0379643	3300044842	Bacteria	963
915	Ga0466957_0425070	3300044842	Bacteria	912
916	Ga0466960_0233205	3300044901	Bacteria	1016
917	Ga0466960_0310291	3300044901	Bacteria	891
918	Ga0466960_0557521	3300044901	Bacteria	676
919	Ga0466959_0000471	3300045049	Bacteria	23514
920	Ga0466959_0005542	3300045049	Bacteria	8660
921	Ga0466959_0170693	3300045049	Bacteria	1525
922	Ga0466958_0001730	3300045836	Bacteria	10556
923	Ga0466958_0475348	3300045836	Bacteria	810
924	Ga0466967_0166377	3300045976	Bacteria	2072
925	Ga0466967_0611339	3300045976	Bacteria	1076
926	Ga0466967_0915206	3300045976	Bacteria	872
927	Ga0495592_0039688	3300046454	Bacteria	3535
928	Ga0495592_0195261	3300046454	Bacteria	1369
929	Ga0495592_0427913	3300046454	Bacteria	834
930	Ga0495592_0913208	3300046454	Bacteria	515
931	Ga0495603_0006686	3300046455	Bacteria	6918
932	Ga0495603_0089659	3300046455	Bacteria	1799
933	Ga0495603_0893759	3300046455	Bacteria	505
934	Ga0495590_0001378	3300046457	Bacteria	10546
935	Ga0495590_0219165	3300046457	Bacteria	702
936	Ga0495629_0006461	3300046459	Bacteria	8681
937	Ga0495629_0007741	3300046459	Bacteria	7905
938	Ga0495629_0013511	3300046459	Bacteria	5890
939	Ga0495629_0030525	3300046459	Bacteria	3820
940	Ga0495641_0035088	3300046461	Bacteria	2367
941	Ga0495641_0086658	3300046461	Bacteria	1401
942	Ga0495651_0001538	3300046462	Bacteria	17838
943	Ga0495651_0015149	3300046462	Bacteria	5958
944	Ga0495651_0066745	3300046462	Bacteria	2745
945	Ga0495651_0092025	3300046462	Bacteria	2272
946	Ga0495651_0097335	3300046462	Bacteria	2197
947	Ga0495653_0001513	3300046463	Bacteria	18167
948	Ga0495653_0008953	3300046463	Bacteria	8185
949	Ga0495653_0265991	3300046463	Bacteria	1131
950	Ga0495650_0001473	3300046471	Bacteria	22580
951	Ga0495650_0005440	3300046471	Bacteria	8272
952	Ga0495650_0045175	3300046471	Bacteria	1856
953	Ga0495650_0055575	3300046471	Bacteria	1610
954	Ga0495650_0190224	3300046471	Bacteria	717
955	Ga0495580_0000620	3300046472	Bacteria	30033
956	Ga0495580_0001306	3300046472	Bacteria	22016
957	Ga0495580_0004206	3300046472	Bacteria	12103
958	Ga0495580_0012868	3300046472	Bacteria	6412
959	Ga0495582_0001265	3300046473	Bacteria	14214
960	Ga0495582_0006415	3300046473	Bacteria	6534
961	Ga0495582_0008271	3300046473	Bacteria	5743
962	Ga0495582_0027718	3300046473	Bacteria	3106
963	Ga0495582_0632079	3300046473	Bacteria	619
964	Ga0495605_0011680	3300046474	Bacteria	4887
965	Ga0495605_0057464	3300046474	Bacteria	1872
966	Ga0495605_0265361	3300046474	Bacteria	732
967	Ga0495662_0015928	3300046476	Bacteria	3648
968	Ga0495662_0027421	3300046476	Bacteria	2752
969	Ga0495664_0024866	3300046477	Bacteria	3482
970	Ga0495664_0146201	3300046477	Bacteria	1433
971	Ga0495664_0263228	3300046477	Bacteria	1042
972	Ga0495594_0105827	3300046499	Bacteria	1584
973	Ga0495594_0489733	3300046499	Bacteria	699
974	Ga0495596_0000808	3300046500	Bacteria	18964
975	Ga0495596_0109787	3300046500	Bacteria	1071
976	Ga0495607_0339655	3300046501	Bacteria	696
977	Ga0495583_0103621	3300046506	Bacteria	1212
978	Ga0495583_0117453	3300046506	Bacteria	1122
979	Ga0495606_0014550	3300046507	Bacteria	6126
980	Ga0495606_0026258	3300046507	Bacteria	4153
981	Ga0495606_0029158	3300046507	Bacteria	3879
982	Ga0495606_0115891	3300046507	Bacteria	1610
983	Ga0495606_0132469	3300046507	Bacteria	1480
984	Ga0495608_0008335	3300046511	Bacteria	7270
985	Ga0495608_0055269	3300046511	Bacteria	2623
986	Ga0495608_0148901	3300046511	Bacteria	1492
987	Ga0495608_0568520	3300046511	Bacteria	682
988	Ga0495610_0000112	3300046512	Bacteria	94977
989	Ga0495610_0058046	3300046512	Bacteria	1853
990	Ga0495616_0010982	3300046513	Bacteria	5212
991	Ga0495616_0128172	3300046513	Bacteria	1165
992	Ga0495616_0276732	3300046513	Bacteria	714
993	Ga0495618_0002492	3300046514	Bacteria	11814
994	Ga0495618_0005972	3300046514	Bacteria	7395
995	Ga0495618_0059387	3300046514	Bacteria	2423
996	Ga0495618_0134976	3300046514	Bacteria	1579
997	Ga0495620_0050801	3300046515	Bacteria	1767
998	Ga0495620_0073483	3300046515	Bacteria	1394
999	Ga0495628_0000315	3300046516	Bacteria	43763
1000	Ga0495628_0000726	3300046516	Bacteria	30567
1001	Ga0495628_0005618	3300046516	Bacteria	10982
1002	Ga0495628_0049883	3300046516	Bacteria	3312
1003	Ga0495628_0100608	3300046516	Bacteria	2231
1004	Ga0495628_0326984	3300046516	Bacteria	1130
1005	Ga0495628_0426125	3300046516	Bacteria	966
1006	Ga0495628_0469618	3300046516	Bacteria	912
1007	Ga0495630_0002778	3300046517	Bacteria	12146
1008	Ga0495630_0333633	3300046517	Bacteria	1160
1009	Ga0495643_0270804	3300046522	Bacteria	785
1010	Ga0495648_0007814	3300046524	Bacteria	8508
1011	Ga0495648_0016407	3300046524	Bacteria	5343
1012	Ga0495648_0038001	3300046524	Bacteria	3086
1013	Ga0495663_0066174	3300046525	Bacteria	1143
1014	Ga0495666_0000596	3300046526	Bacteria	16164
1015	Ga0495666_0039486	3300046526	Bacteria	2291
1016	Ga0495666_0130648	3300046526	Bacteria	1174
1017	Ga0495666_0196411	3300046526	Bacteria	928
1018	Ga0495642_0066842	3300046528	Bacteria	1498
1019	Ga0495642_0190282	3300046528	Bacteria	894
1020	Ga0495642_0296354	3300046528	Bacteria	708
1021	Ga0495652_0009207	3300046529	Bacteria	8979
1022	Ga0495652_0048675	3300046529	Bacteria	3630
1023	Ga0495652_0062151	3300046529	Bacteria	3149
1024	Ga0495652_0112474	3300046529	Bacteria	2187
1025	Ga0495652_0123724	3300046529	Bacteria	2058
1026	Ga0495652_0300413	3300046529	Bacteria	1167
1027	Ga0495652_0345045	3300046529	Bacteria	1068
1028	Ga0495652_0994635	3300046529	Bacteria	549
1029	Ga0495654_0000426	3300046530	Bacteria	35665
1030	Ga0495654_0080579	3300046530	Bacteria	1527
1031	Ga0495654_0108199	3300046530	Bacteria	1271
1032	Ga0495665_0003260	3300046531	Bacteria	8783
1033	Ga0495665_0007760	3300046531	Bacteria	5806
1034	Ga0495665_0062765	3300046531	Bacteria	1961
1035	Ga0495665_0074118	3300046531	Bacteria	1792
1036	Ga0495665_0083053	3300046531	Bacteria	1684
1037	Ga0495665_0084382	3300046531	Bacteria	1669
1038	Ga0495665_0627210	3300046531	Bacteria	536
1039	Ga0495640_0043144	3300046533	Bacteria	3142
1040	Ga0495640_0044316	3300046533	Bacteria	3094
1041	Ga0495640_0051955	3300046533	Bacteria	2815
1042	Ga0495640_0810223	3300046533	Bacteria	558
1043	Ga0495586_0006068	3300046535	Bacteria	6460
1044	Ga0495586_0244763	3300046535	Bacteria	1022
1045	Ga0495587_0000830	3300046536	Bacteria	20449
1046	Ga0495597_0004607	3300046542	Bacteria	7520
1047	Ga0495645_0000674	3300046543	Bacteria	23485
1048	Ga0495645_0001423	3300046543	Bacteria	16109
1049	Ga0495645_0027193	3300046543	Bacteria	4154
1050	Ga0495645_0070713	3300046543	Bacteria	2518
1051	Ga0495645_0128277	3300046543	Bacteria	1780
1052	Ga0495645_0132963	3300046543	Bacteria	1742
1053	Ga0495645_0211289	3300046543	Bacteria	1310
1054	Ga0495645_0476949	3300046543	Bacteria	783
1055	Ga0495622_0110863	3300046557	Bacteria	1256
1056	Ga0495622_0238909	3300046557	Bacteria	801
1057	Ga0495633_0358627	3300046558	Bacteria	660
1058	Ga0495667_0198219	3300046559	Bacteria	1285
1059	Ga0495668_0202175	3300046616	Bacteria	1088
1060	Ga0495634_0014465	3300046642	Bacteria	5688
1061	Ga0495634_0475817	3300046642	Bacteria	734
1062	Ga0495611_0096957	3300046648	Bacteria	1366
1063	Ga0495625_0001042	3300046660	Bacteria	36418
1064	Ga0495625_0375760	3300046660	Bacteria	893
1065	Ga0495635_0015258	3300046663	Bacteria	5375
1066	Ga0495635_0059264	3300046663	Bacteria	2632
1067	Ga0495635_0101475	3300046663	Bacteria	1967
1068	Ga0495635_0448138	3300046663	Bacteria	853
1069	Ga0495661_0004119	3300046665	Bacteria	10586
1070	Ga0495588_0029294	3300046674	Bacteria	2761
1071	Ga0495588_0204469	3300046674	Bacteria	1043
1072	Ga0495588_0357121	3300046674	Bacteria	768
1073	Ga0495657_0034909	3300046675	Bacteria	3490
1074	Ga0495657_0397310	3300046675	Bacteria	812
1075	Ga0495657_0783443	3300046675	Bacteria	545
1076	Ga0495599_0000661	3300046678	Bacteria	19492
1077	Ga0495599_0004883	3300046678	Bacteria	7975
1078	Ga0495599_0309655	3300046678	Bacteria	952
1079	Ga0495623_0052551	3300046679	Bacteria	2574
1080	Ga0495623_0055327	3300046679	Bacteria	2501
1081	Ga0495623_0078745	3300046679	Bacteria	2042
1082	Ga0495623_0142605	3300046679	Bacteria	1423
1083	Ga0495623_0388103	3300046679	Bacteria	753
1084	Ga0495646_0002711	3300046680	Bacteria	10951
1085	Ga0495646_0002843	3300046680	Bacteria	10712
1086	Ga0495646_0004439	3300046680	Bacteria	8836
1087	Ga0495646_0013120	3300046680	Bacteria	5265
1088	Ga0495646_0114655	3300046680	Bacteria	1531
1089	Ga0495646_0241472	3300046680	Bacteria	970
1090	Ga0495647_0631244	3300046681	Bacteria	504
1091	Ga0495658_0151974	3300046683	Bacteria	1422
1092	Ga0495658_0552266	3300046683	Bacteria	737
1093	Ga0495669_0007176	3300046684	Bacteria	4669
1094	Ga0495669_0071473	3300046684	Bacteria	1582
1095	Ga0495669_0098161	3300046684	Bacteria	1359
1096	Ga0495669_0195354	3300046684	Bacteria	966
1097	Ga0495669_0369945	3300046684	Bacteria	693
1098	Ga0495613_0006472	3300046689	Bacteria	8755
1099	Ga0495613_0056284	3300046689	Bacteria	2888
1100	Ga0495613_0369996	3300046689	Bacteria	981
1101	Ga0495624_0050489	3300046690	Bacteria	2634
1102	Ga0495624_0109243	3300046690	Bacteria	1701
1103	Ga0495624_0128775	3300046690	Bacteria	1552
1104	Ga0495624_0195752	3300046690	Bacteria	1228
1105	Ga0495671_0000937	3300046692	Bacteria	20602
1106	Ga0495671_0030563	3300046692	Bacteria	2758
1107	Ga0495649_0001086	3300046694	Bacteria	21208
1108	Ga0495649_0006675	3300046694	Bacteria	7162
1109	Ga0495649_0038152	3300046694	Bacteria	2637
1110	Ga0495649_0077892	3300046694	Bacteria	1774
1111	Ga0495649_0084167	3300046694	Bacteria	1699
1112	Ga0495649_0127945	3300046694	Bacteria	1341
1113	Ga0495589_0066429	3300046794	Bacteria	1766
1114	Ga0495589_0146884	3300046794	Bacteria	1127
1115	Ga0495600_0010791	3300046809	Bacteria	5679
1116	Ga0495600_0027203	3300046809	Bacteria	3696
1117	Ga0495600_0029209	3300046809	Bacteria	3569
1118	Ga0495600_0198451	3300046809	Bacteria	1289
1119	Ga0495600_0792913	3300046809	Bacteria	565
1120	Ga0495660_0049609	3300046810	Bacteria	2290
1121	Ga0495581_0007409	3300047315	Bacteria	6345
1122	Ga0495581_0010990	3300047315	Bacteria	5232
1123	Ga0495581_0024133	3300047315	Bacteria	3523
1124	Ga0495604_0001047	3300047317	Bacteria	22987
1125	Ga0495604_0119193	3300047317	Bacteria	1912
1126	Ga0495604_0121478	3300047317	Bacteria	1890
1127	Ga0495604_0230491	3300047317	Bacteria	1270
1128	Ga0495604_0320211	3300047317	Bacteria	1036
1129	Ga0495604_0377974	3300047317	Bacteria	936
1130	Ga0495674_0014154	3300047319	Bacteria	7473
1131	Ga0495674_0017879	3300047319	Bacteria	6602
1132	Ga0495674_0029344	3300047319	Bacteria	5010
1133	Ga0495674_0041962	3300047319	Bacteria	4083
1134	Ga0495674_0055620	3300047319	Bacteria	3469
1135	Ga0495674_0107675	3300047319	Bacteria	2366
1136	Ga0495674_0236327	3300047319	Bacteria	1507
1137	Ga0495674_0376260	3300047319	Bacteria	1150
1138	Ga0495674_0739498	3300047319	Bacteria	769
1139	Ga0495674_0765089	3300047319	Bacteria	753
1140	Ga0495672_0052037	3300047320	Bacteria	2407
1141	Ga0495672_0118116	3300047320	Bacteria	1414
1142	Ga0495672_0125699	3300047320	Bacteria	1356
1143	Ga0495676_0001352	3300047321	Bacteria	21067
1144	Ga0495676_0307523	3300047321	Bacteria	1067
1145	Ga0495680_0064775	3300047322	Bacteria	2801
1146	Ga0495680_0304413	3300047322	Bacteria	1118
1147	Ga0495680_1086680	3300047322	Bacteria	506
1148	Ga0495683_0001210	3300047323	Bacteria	17583
1149	Ga0495683_0003518	3300047323	Bacteria	9114
1150	Ga0495683_0018701	3300047323	Bacteria	3580
1151	Ga0495683_0040005	3300047323	Bacteria	2369
1152	Ga0495683_0079270	3300047323	Bacteria	1604
1153	Ga0495683_0085603	3300047323	Bacteria	1532
1154	Ga0495683_0109288	3300047323	Bacteria	1321
1155	Ga0495687_000011	3300047443	Bacteria	397225
1156	Ga0495687_024040	3300047443	Bacteria	2903
1157	Ga0495687_048036	3300047443	Bacteria	1833
1158	Ga0495687_103617	3300047443	Bacteria	1061
1159	Ga0495675_0201702	3300047444	Bacteria	1210
1160	Ga0495675_0340310	3300047444	Bacteria	884
1161	Ga0495677_0287993	3300047445	Bacteria	645
1162	Ga0495679_001769	3300047446	Bacteria	11831
1163	Ga0495679_014797	3300047446	Bacteria	2875
1164	Ga0495685_087367	3300047447	Bacteria	1035
1165	Ga0495673_0018159	3300047469	Bacteria	3554
1166	Ga0495673_0051650	3300047469	Bacteria	1799
1167	Ga0495673_0093232	3300047469	Bacteria	1228
1168	Ga0495673_0328312	3300047469	Bacteria	543
1169	Ga0495681_0045238	3300047470	Bacteria	2108
1170	Ga0495684_0120922	3300047471	Bacteria	1972
1171	Ga0495686_0000014	3300047472	Bacteria	474014
1172	Ga0495686_0000655	3300047472	Bacteria	47295
1173	Ga0495686_0100468	3300047472	Bacteria	1745
1174	Ga0495686_0143570	3300047472	Bacteria	1407
1175	Ga0495593_0002328	3300047673	Bacteria	11411
1176	Ga0495593_0025125	3300047673	Bacteria	3296
1177	Ga0495593_0033074	3300047673	Bacteria	2817
1178	Ga0495593_0040517	3300047673	Bacteria	2508
1179	Ga0495593_0053557	3300047673	Bacteria	2129
1180	Ga0495593_0072173	3300047673	Bacteria	1793
1181	Ga0495593_0121631	3300047673	Bacteria	1328
1182	Ga0495593_0233318	3300047673	Bacteria	922
1183	Ga0495602_0041708	3300048088	Bacteria	4189
1184	Ga0495602_0054279	3300048088	Bacteria	3539
1185	Ga0495602_0054451	3300048088	Bacteria	3531
1186	Ga0495602_0068637	3300048088	Bacteria	3043
1187	Ga0495602_0071542	3300048088	Bacteria	2961
1188	Ga0495602_0128394	3300048088	Bacteria	2026
1189	Ga0495602_0206332	3300048088	Bacteria	1495
1190	Ga0495602_0266376	3300048088	Bacteria	1268
1191	Ga0495614_0010475	3300048089	Bacteria	4088
1192	Ga0495614_0020723	3300048089	Bacteria	2841
1193	Ga0495614_0245095	3300048089	Bacteria	819
1194	Ga0495626_0020931	3300048091	Bacteria	3253
1195	Ga0495626_0032398	3300048091	Bacteria	2510
1196	Ga0495626_0039416	3300048091	Bacteria	2236
1197	Ga0495626_0097626	3300048091	Bacteria	1284
1198	Ga0496100_0018322	3300048903	Bacteria	4151
1199	Ga0496100_0164901	3300048903	Bacteria	1591
1200	Ga0496100_0189182	3300048903	Bacteria	1493
1201	Ga0496100_0245917	3300048903	Bacteria	1321
1202	Ga0496100_0274982	3300048903	Bacteria	1254
1203	Ga0496100_0429982	3300048903	Bacteria	1009
1204	Ga0496100_0437045	3300048903	Bacteria	1001
1205	Ga0496100_0594215	3300048903	Bacteria	859
1206	Ga0496101_0039076	3300048904	Bacteria	3372
1207	Ga0496101_0043008	3300048904	Bacteria	3226
1208	Ga0496101_0199042	3300048904	Bacteria	1548
1209	Ga0496101_0213476	3300048904	Bacteria	1496
1210	Ga0496101_0315040	3300048904	Bacteria	1227
1211	Ga0496101_0371552	3300048904	Bacteria	1124
1212	Ga0496101_0454993	3300048904	Bacteria	1010
1213	Ga0496102_0015822	3300048905	Bacteria	6576
1214	Ga0496102_0057814	3300048905	Bacteria	3542
1215	Ga0496102_0459657	3300048905	Bacteria	1194
1216	Ga0496102_0512078	3300048905	Bacteria	1122
1217	Ga0496102_0975476	3300048905	Bacteria	768
1218	Ga0496103_0005820	3300048906	Bacteria	7362
1219	Ga0496103_0044723	3300048906	Bacteria	2729
1220	Ga0496103_0199261	3300048906	Bacteria	1287
1221	Ga0496103_0845585	3300048906	Bacteria	576
1222	Ga0496104_0006716	3300048907	Bacteria	10129
1223	Ga0496104_0018153	3300048907	Bacteria	6415
1224	Ga0496104_0058374	3300048907	Bacteria	3652
1225	Ga0496104_0081528	3300048907	Bacteria	3085
1226	Ga0496104_0148980	3300048907	Bacteria	2247
1227	Ga0496104_0530195	3300048907	Bacteria	1088
1228	Ga0496104_0678089	3300048907	Bacteria	939
1229	Ga0496104_0680896	3300048907	Bacteria	936
1230	Ga0496104_1347079	3300048907	Bacteria	617
1231	Ga0496105_0011443	3300048908	Bacteria	7011
1232	Ga0496105_0036550	3300048908	Bacteria	4046
1233	Ga0496105_0073971	3300048908	Bacteria	2815
1234	Ga0496105_0123792	3300048908	Bacteria	2131
1235	Ga0496105_0132372	3300048908	Bacteria	2055
1236	Ga0496105_0144390	3300048908	Bacteria	1957
1237	Ga0496105_0191777	3300048908	Bacteria	1670
1238	Ga0496106_0041850	3300048909	Bacteria	3434
1239	Ga0496106_0297283	3300048909	Bacteria	1294
1240	Ga0496106_0304766	3300048909	Bacteria	1278
1241	Ga0496107_0130584	3300048910	Bacteria	1854
1242	Ga0496107_0407258	3300048910	Bacteria	1011
1243	Ga0496107_0573326	3300048910	Bacteria	835
1244	Ga0496108_0011087	3300048911	Bacteria	7321
1245	Ga0496108_0172658	3300048911	Bacteria	1871
1246	Ga0496108_1068217	3300048911	Bacteria	687
1247	Ga0496109_0046494	3300048912	Bacteria	3942
1248	Ga0496109_0110707	3300048912	Bacteria	2553
1249	Ga0496109_0257641	3300048912	Bacteria	1643
1250	Ga0496109_0819405	3300048912	Bacteria	869
1251	Ga0496110_0038284	3300048913	Bacteria	4172
1252	Ga0496110_0532426	3300048913	Bacteria	1068
1253	Ga0496111_0088242	3300048914	Bacteria	2271
1254	Ga0496111_0249898	3300048914	Bacteria	1316
1255	Ga0496111_0458050	3300048914	Bacteria	941
1256	Ga0496111_0665894	3300048914	Bacteria	759
1257	Ga0496112_0009812	3300048915	Bacteria	8650
1258	Ga0496112_0032496	3300048915	Bacteria	5067
1259	Ga0496112_0093817	3300048915	Bacteria	2972
1260	Ga0496112_0276938	3300048915	Bacteria	1625
1261	Ga0496112_0387741	3300048915	Bacteria	1337
1262	Ga0496113_0002481	3300048916	Bacteria	10750
1263	Ga0496113_0060953	3300048916	Unclassified	2845
1264	Ga0496113_0214323	3300048916	Bacteria	1533
1265	Ga0496113_0262205	3300048916	Bacteria	1380
1266	Ga0496113_0474116	3300048916	Bacteria	1006
1267	Ga0496113_0476755	3300048916	Bacteria	1002
1268	Ga0496113_0489596	3300048916	Bacteria	988
1269	Ga0496114_0008840	3300048917	Bacteria	7984
1270	Ga0496114_0077805	3300048917	Bacteria	2797
1271	Ga0496114_0338374	3300048917	Bacteria	1331
1272	Ga0496114_0594902	3300048917	Bacteria	976
1273	Ga0496114_0914807	3300048917	Bacteria	759
1274	Ga0496115_0017930	3300048918	Bacteria	5424
1275	Ga0496115_0022784	3300048918	Bacteria	4856
1276	Ga0496115_0035274	3300048918	Bacteria	3957
1277	Ga0496115_0118814	3300048918	Bacteria	2174
1278	Ga0496115_0341580	3300048918	Bacteria	1222
1279	Ga0496115_0627832	3300048918	Unclassified	852
1280	Ga0496116_0005564	3300048919	Bacteria	11622
1281	Ga0496116_0059618	3300048919	Bacteria	2481
1282	Ga0496116_0159236	3300048919	Bacteria	1241
1283	Ga0496116_0207002	3300048919	Bacteria	1020
1284	Ga0496116_0319856	3300048919	Bacteria	727
1285	Ga0496116_0447738	3300048919	Bacteria	554
1286	Ga0496116_0467329	3300048919	Bacteria	535
1287	Ga0496117_0002552	3300048920	Bacteria	22681
1288	Ga0496117_0015617	3300048920	Bacteria	6457
1289	Ga0496117_0036969	3300048920	Bacteria	3644
1290	Ga0496117_0045344	3300048920	Bacteria	3176
1291	Ga0496117_0068445	3300048920	Bacteria	2396
1292	Ga0496117_0074824	3300048920	Bacteria	2253
1293	Ga0496117_0097632	3300048920	Bacteria	1870
1294	Ga0496117_0107717	3300048920	Bacteria	1745
1295	Ga0496117_0138396	3300048920	Bacteria	1462
1296	Ga0496118_0001681	3300048921	Bacteria	32365
1297	Ga0496118_0006477	3300048921	Bacteria	12854
1298	Ga0496118_0016354	3300048921	Bacteria	6809
1299	Ga0496118_0071617	3300048921	Bacteria	2494
1300	Ga0496118_0090826	3300048921	Bacteria	2103
1301	Ga0496118_0112037	3300048921	Bacteria	1807
1302	Ga0496118_0112900	3300048921	Bacteria	1797
1303	Ga0496118_0189271	3300048921	Bacteria	1233
1304	Ga0496118_0256692	3300048921	Bacteria	989
1305	Ga0496118_0257788	3300048921	Bacteria	986
1306	Ga0496118_0458898	3300048921	Bacteria	644
1307	Ga0496118_0494825	3300048921	Bacteria	609
1308	Ga0496119_0076118	3300048922	Bacteria	1947
1309	Ga0496119_0190806	3300048922	Bacteria	1068
1310	Ga0496120_0018613	3300048923	Bacteria	4469
1311	Ga0496120_0153441	3300048923	Bacteria	1155
1312	Ga0496120_0192054	3300048923	Bacteria	995
1313	Ga0496120_0308619	3300048923	Bacteria	722
1314	Ga0496120_0393717	3300048923	Bacteria	613
1315	Ga0496120_0465575	3300048923	Bacteria	548
1316	Ga0496121_0003178	3300048924	Bacteria	23674
1317	Ga0496121_0025099	3300048924	Bacteria	5672
1318	Ga0496121_0025932	3300048924	Bacteria	5544
1319	Ga0496121_0033483	3300048924	Bacteria	4648
1320	Ga0496121_0036501	3300048924	Bacteria	4379
1321	Ga0496121_0041509	3300048924	Bacteria	4019
1322	Ga0496121_0064272	3300048924	Bacteria	2993
1323	Ga0496121_0085569	3300048924	Bacteria	2481
1324	Ga0496121_0092934	3300048924	Bacteria	2350
1325	Ga0496121_0127089	3300048924	Bacteria	1914
1326	Ga0496121_0177903	3300048924	Bacteria	1538
1327	Ga0496121_0179663	3300048924	Bacteria	1528
1328	Ga0496121_0211527	3300048924	Bacteria	1373
1329	Ga0496121_0318518	3300048924	Bacteria	1048
1330	Ga0496122_0000416	3300048925	Bacteria	90497
1331	Ga0496122_0003934	3300048925	Bacteria	18988
1332	Ga0496122_0007094	3300048925	Bacteria	12587
1333	Ga0496122_0178399	3300048925	Bacteria	1270
1334	Ga0496122_0195013	3300048925	Bacteria	1191
1335	Ga0496122_0422598	3300048925	Bacteria	670
1336	Ga0496123_0000104	3300048926	Bacteria	168230
1337	Ga0496123_0003125	3300048926	Bacteria	18991
1338	Ga0496123_0003140	3300048926	Bacteria	18944
1339	Ga0496123_0117534	3300048926	Bacteria	1503
1340	Ga0496124_0000071	3300048927	Bacteria	220642
1341	Ga0496124_0000800	3300048927	Bacteria	51160
1342	Ga0496124_0002348	3300048927	Bacteria	24978
1343	Ga0496124_0019039	3300048927	Bacteria	6407
1344	Ga0496124_0056849	3300048927	Bacteria	3298
1345	Ga0496124_0084335	3300048927	Bacteria	2606
1346	Ga0496124_0124476	3300048927	Bacteria	2056
1347	Ga0496124_0206893	3300048927	Bacteria	1488
1348	Ga0496124_0355347	3300048927	Bacteria	1035
1349	Ga0496124_0476963	3300048927	Bacteria	843
1350	Ga0496125_0000647	3300048928	Bacteria	58140
1351	Ga0496125_0003004	3300048928	Bacteria	21106
1352	Ga0496125_0018927	3300048928	Bacteria	6517
1353	Ga0496125_0038656	3300048928	Bacteria	4126
1354	Ga0496125_0076929	3300048928	Bacteria	2575
1355	Ga0496125_0190373	3300048928	Bacteria	1355
1356	Ga0496125_0214847	3300048928	Bacteria	1245
1357	Ga0496125_0233672	3300048928	Bacteria	1173
1358	Ga0496125_0321110	3300048928	Bacteria	939
1359	Ga0496125_0405771	3300048928	Bacteria	795
1360	Ga0496125_0510230	3300048928	Bacteria	675
1361	Ga0496126_0000088	3300048929	Bacteria	212256
1362	Ga0496126_0000333	3300048929	Bacteria	100416
1363	Ga0496126_0000810	3300048929	Bacteria	55834
1364	Ga0496126_0009707	3300048929	Bacteria	10195
1365	Ga0496126_0023731	3300048929	Bacteria	5939
1366	Ga0496126_0026626	3300048929	Bacteria	5541
1367	Ga0496126_0147862	3300048929	Bacteria	2016
1368	Ga0496126_0624171	3300048929	Bacteria	846
1369	Ga0496126_0715664	3300048929	Bacteria	776
1370	Ga0496126_1120312	3300048929	Bacteria	583
1371	Ga0466983_0362901	3300048986	Bacteria	1065
1372	Ga0495678_051886	3300049459	Bacteria	1582
1373	Ga0495682_0039710	3300049460	Bacteria	1727
1374	Ga0495682_0047053	3300049460	Bacteria	1574
1375	Ga0495682_0290083	3300049460	Bacteria	577
1376	Ga0501034_0000128	3300049571	Bacteria	140568
1377	Ga0501034_0049517	3300049571	Bacteria	4239
1378	Ga0501034_0067525	3300049571	Bacteria	3588
1379	Ga0501034_0127491	3300049571	Bacteria	2530
1380	Ga0501039_0191342	3300049575	Bacteria	1609
1381	Ga0501070_0057772	3300049586	Bacteria	3217
1382	Ga0501216_147655	3300049660	Bacteria	557
1383	Ga0501226_005418	3300049853	Bacteria	1456
1384	nmdc:mga00v17_131240_c1	3300050491	Bacteria	1601
1385	nmdc:mga06z11_180679_c1	3300050494	Bacteria	1216
1386	nmdc:mga07m45_530597_c1	3300050496	Bacteria	681
1387	nmdc:mga0qj67_606784_c1	3300050509	Bacteria	875
1388	nmdc:mga0rr50_38764_c1	3300050513	Bacteria	3451
1389	nmdc:mga08x19_9296_c1	3300050514	Bacteria	5876
1390	nmdc:mga0a205_1323955_c1	3300050515	Bacteria	568
1391	Ga0495601_0009012	3300053077	Bacteria	5890
1392	Ga0495601_0140566	3300053077	Bacteria	1575
1393	Ga0495601_0486429	3300053077	Bacteria	797
1394	Ga0495612_0254955	3300053078	Bacteria	781
1395	Ga0500635_0094454	3300053080	Bacteria	1092
1396	Ga0495655_0033724	3300053083	Bacteria	1262
1397	Ga0495655_0082517	3300053083	Bacteria	922
1398	Ga0495595_0277536	3300053084	Bacteria	841
1399	Ga0500578_0079627	3300053086	Bacteria	2085
1400	Ga0500647_0239512	3300053091	Bacteria	803
1401	Ga0500566_0050852	3300053094	Bacteria	2372
1402	Ga0500648_403898	3300053097	Bacteria	516
1403	Ga0500555_000508	3300053103	Bacteria	15727
1404	Ga0500572_001251	3300053111	Bacteria	7161
1405	Ga0500572_136763	3300053111	Bacteria	797
1406	Ga0500595_001308	3300053119	Bacteria	13528
1407	Ga0500595_009852	3300053119	Bacteria	3834
1408	Ga0500595_031401	3300053119	Bacteria	1783
1409	Ga0500595_121033	3300053119	Bacteria	740
1410	Ga0500618_000861	3300053125	Bacteria	16307
1411	Ga0500618_002077	3300053125	Bacteria	7998
1412	Ga0500559_0000434	3300053136	Bacteria	29606
1413	Ga0500559_0004239	3300053136	Bacteria	6862
1414	Ga0500559_0232036	3300053136	Bacteria	870
1415	Ga0500573_0016243	3300053140	Bacteria	4223
1416	Ga0500574_001680	3300053141	Bacteria	3392
1417	Ga0500603_029533	3300053150	Bacteria	1406
1418	Ga0500616_0000489	3300053153	Bacteria	51122
1419	Ga0500638_158264	3300053162	Bacteria	1000
1420	Ga0500638_312425	3300053162	Bacteria	601
1421	Ga0500639_071030	3300053163	Bacteria	1774
1422	Ga0500639_173357	3300053163	Bacteria	964
1423	Ga0500637_0148534	3300053178	Bacteria	1354
1424	Ga0500576_208024	3300053725	Bacteria	657
1425	Ga0500657_083819	3300053728	Bacteria	1362
1426	Ga0500645_000060	3300053730	Bacteria	89018
1427	Ga0500552_003386	3300053733	Bacteria	1617
1428	Ga0500596_000542	3300053735	Bacteria	7165
1429	Ga0500599_003122	3300053736	Bacteria	2013
1430	Ga0500661_070300	3300055283	Bacteria	640
1431	Ga0587067_000876	3300059640	Bacteria	2979
1432	Ga0587072_000060	3300059643	Bacteria	7791
1433	Ga0466962_0000885	3300061719	Bacteria	13608
1434	Ga0466962_0022265	3300061719	Bacteria	3044
1435	Ga0466962_0389493	3300061719	Bacteria	697

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

	Sample	Scaffold	Protein	Protein Length
1	3300025321	Ga0207656_10428938	Ga0207656_104289381	112
2	3300042145	Ga0450906_091134	Ga0450906_091134_118_507	121
3	3300049586	Ga0501070_0057772	Ga0501070_0057772_157_522	121
4	3300005347	Ga0070668_101531885	Ga0070668_1015318852	122
5	3300005543	Ga0070672_100517006	Ga0070672_1005170062	122
6	3300005564	Ga0070664_100256130	Ga0070664_1002561302	122
7	3300025940	Ga0207691_10527413	Ga0207691_105274132	122
8	3300025945	Ga0207679_10834214	Ga0207679_108342142	122
9	3300039438	Ga0436360_0889577	Ga0436360_0889577_113_484	123
10	iso_pu_bacteria	2511231003	2511250860	123
11	iso_pu_bacteria	2513237094	2513637201	123
12	iso_pu_bacteria	2521172590	2521557703	123
13	iso_pu_bacteria	2524023205	2524442748	123
14	iso_pu_bacteria	2551306416	2553002820	123
15	iso_pu_bacteria	2599185319	2600042996	123
16	iso_pu_bacteria	2599185323	2600066282	123
17	iso_pu_bacteria	2744054633	2745080117	123
18	iso_pu_bacteria	2765235838	2765570123	123
19	iso_pu_bacteria	2808606386	2808981590	123
20	iso_pu_bacteria	2808606415	2809129173	123
21	iso_pu_bacteria	2808606419	2809148793	123
22	iso_pu_bacteria	2818991436	2819542799	123
23	iso_pu_bacteria	2818991445	2819591557	123
24	iso_pu_bacteria	2818991449	2819615162	123
25	iso_pu_bacteria	2839094727	2839096937	123
26	iso_pu_bacteria	2842854478	2842855124	123
27	iso_pu_bacteria	2844315083	2844320496	123
28	iso_pu_bacteria	2852618963	2852621331	123
29	iso_pu_bacteria	2884811622	2884816901	123
30	iso_pu_bacteria	2884836552	2884837367	123
31	iso_pu_bacteria	2884852848	2884853658	123
32	iso_pu_bacteria	2896154374	2896155225	123
33	iso_pu_bacteria	2903727486	2903732789	123
34	iso_pu_bacteria	2904439833	2904441556	123
35	iso_pu_bacteria	2904530477	2904531515	123
36	iso_pu_bacteria	2904584206	2904586848	123
37	iso_pu_bacteria	2904589729	2904593119	123
38	iso_pu_bacteria	2904601388	2904603035	123
39	iso_pu_bacteria	2906602504	2906606966	123
40	iso_pu_bacteria	2919046199	2919050860	123
41	iso_pu_bacteria	2919079590	2919083944	123
42	iso_pu_bacteria	2923510766	2923510908	123
43	iso_pu_bacteria	2928130867	2928130882	123
44	iso_pu_bacteria	2932794094	2932797817	123
45	iso_pu_bacteria	2932801729	2932806353	123
46	iso_pu_bacteria	2935883170	2935888360	123
47	iso_pu_bacteria	3005594810	3005600886	123
48	iso_pu_bacteria	3005718088	3005723675	123
49	iso_pu_bacteria	8019648815	8019655536	123
50	iso_pu_bacteria	8056143049	8056146861	123
51	iso_pu_bacteria	8056967851	8056970406	123
52	3300032004	Ga0307414_11063740	Ga0307414_110637401	124
53	iso_pu_bacteria	2508501125	2509132602	124
54	iso_pu_bacteria	2511231156	2511825245	124
55	iso_pu_bacteria	2513237151	2513959149	124
56	iso_pu_bacteria	2513237166	2514047953	124
57	iso_pu_bacteria	2526164713	2527080773	124
58	iso_pu_bacteria	2562617112	2563059958	124
59	iso_pu_bacteria	2585427594	2585846485	124
60	iso_pu_bacteria	2596583598	2597030933	124
61	iso_pu_bacteria	2599185178	2599446024	124
62	iso_pu_bacteria	2599185188	2599504742	124
63	iso_pu_bacteria	2599185239	2599739874	124
64	iso_pu_bacteria	2599185240	2599749037	124
65	iso_pu_bacteria	2599185300	2599931171	124
66	iso_pu_bacteria	2599185355	2600211097	124
67	iso_pu_bacteria	2600255067	2600810375	124
68	iso_pu_bacteria	2643221650	2644280840	124
69	iso_pu_bacteria	2675903129	2676747316	124
70	iso_pu_bacteria	2675903515	2678263194	124
71	iso_pu_bacteria	2711768613	2713479325	124
72	iso_pu_bacteria	2738541296	2738823732	124
73	iso_pu_bacteria	2738541298	2738836123	124
74	iso_pu_bacteria	2738541306	2738877653	124
75	iso_pu_bacteria	2738543002	2739189359	124
76	iso_pu_bacteria	2738543008	2739224246	124
77	iso_pu_bacteria	2738543031	2739347618	124
78	iso_pu_bacteria	2744054620	2745009526	124
79	iso_pu_bacteria	2744054900	2746085301	124
80	iso_pu_bacteria	2744054901	2746098227	124
81	iso_pu_bacteria	2751185846	2753565874	124
82	iso_pu_bacteria	2791355137	2792834620	124
83	iso_pu_bacteria	2791355520	2794597647	124
84	iso_pu_bacteria	2808606384	2808968257	124
85	iso_pu_bacteria	2808606390	2809003088	124
86	iso_pu_bacteria	2808606391	2809010365	124
87	iso_pu_bacteria	2818991450	2819620779	124
88	iso_pu_bacteria	2818991452	2819633777	124
89	iso_pu_bacteria	2825651385	2825652576	124
90	iso_pu_bacteria	2856287931	2856293319	124
91	iso_pu_bacteria	2857357740	2857366562	124
92	iso_pu_bacteria	2863421361	2863426943	124
93	iso_pu_bacteria	2870068957	2870070187	124
94	iso_pu_bacteria	2885266251	2885268192	124
95	iso_pu_bacteria	2900577576	2900579746	124
96	iso_pu_bacteria	2904483920	2904488594	124
97	iso_pu_bacteria	2904615490	2904620447	124
98	iso_pu_bacteria	2913036834	2913038969	124
99	iso_pu_bacteria	2919527303	2919532206	124
100	iso_pu_bacteria	2921643360	2921644236	124
101	iso_pu_bacteria	2923586266	2923586822	124
102	iso_pu_bacteria	2928058823	2928059173	124
103	iso_pu_bacteria	2928108538	2928109579	124
104	iso_pu_bacteria	2928135762	2928136967	124
105	iso_pu_bacteria	2928157003	2928162132	124
106	iso_pu_bacteria	2928163908	2928169362	124
107	iso_pu_bacteria	2928170801	2928175534	124
108	iso_pu_bacteria	2928503688	2928506495	124
109	iso_pu_bacteria	2929144301	2929147909	124
110	iso_pu_bacteria	2945934425	2945935325	124
111	iso_pu_bacteria	2981990288	2981992723	124
112	iso_pu_bacteria	2990703756	2990704126	124
113	iso_pu_bacteria	641736151	642422281	124
114	iso_pu_bacteria	641736154	642416660	124
115	iso_pu_bacteria	642555112	642592131	124
116	iso_pu_bacteria	642555113	642620207	124
117	iso_pu_bacteria	8018845410	8018851180	124
118	iso_pu_bacteria	8020938398	8020945154	124
119	iso_pu_bacteria	8020945358	8020948880	124
120	iso_pu_bacteria	8020953355	8020955761	124
121	iso_pu_bacteria	8021120328	8021125634	124
122	iso_pu_bacteria	8055301274	8055304019	124
123	3300010375	Ga0105239_10082342	Ga0105239_100823423	125
124	3300041456	Ga0451795_0947916	Ga0451795_0947916_417_800	125
125	iso_pu_bacteria	2842324504	2842331438	125
126	iso_pu_bacteria	2842348783	2842355777	125
127	iso_pu_bacteria	2842454564	2842459406	125
128	iso_pu_bacteria	2858688981	2858694580	125
129	iso_pu_bacteria	2900634093	2900636337	125
130	iso_pu_bacteria	2904434214	2904438420	125
131	iso_pu_bacteria	8055266321	8055273177	125
132	3300001990	JGI24737J22298_10023723	JGI24737J22298_100237232	126
133	3300002067	JGI24735J21928_10001657	JGI24735J21928_100016572	126
134	3300002704	JGI25155J39150_1000312	JGI25155J39150_10003122	126
135	3300002704	JGI25155J39150_1000846	JGI25155J39150_10008464	126
136	3300002705	JGI25156J39149_1000758	JGI25156J39149_10007582	126
137	3300002705	JGI25156J39149_1003045	JGI25156J39149_10030455	126
138	3300002737	JGI25162J39368_1000001	JGI25162J39368_1000001317	126
139	3300002737	JGI25162J39368_1010906	JGI25162J39368_10109062	126
140	3300002738	JGI25154J39366_1000450	JGI25154J39366_10004505	126
141	3300002738	JGI25154J39366_1000639	JGI25154J39366_100063914	126
142	3300002741	JGI25157J39369_1000757	JGI25157J39369_10007572	126
143	3300002771	JGI25163J39215_1004393	JGI25163J39215_10043932	126
144	3300002772	JGI25164J39214_1005191	JGI25164J39214_10051912	126
145	3300003214	JGI25165J46597_1000001	JGI25165J46597_1000001311	126
146	3300003214	JGI25165J46597_1007832	JGI25165J46597_10078322	126
147	3300003354	JGI25160J50197_1035264	JGI25160J50197_10352641	126
148	3300003751	Ga0055538_1000001	Ga0055538_1000001722	126
149	3300003751	Ga0055538_1000155	Ga0055538_100015515	126
150	3300003752	Ga0055539_1000001	Ga0055539_1000001722	126
151	3300003752	Ga0055539_1000205	Ga0055539_100020515	126
152	3300003752	Ga0055539_1002006	Ga0055539_10020062	126
153	3300003756	Ga0055533_1000003	Ga0055533_1000003311	126
154	3300003756	Ga0055533_1000207	Ga0055533_100020715	126
155	3300003758	Ga0055532_1000521	Ga0055532_100052115	126
156	3300003759	Ga0055525_1000003	Ga0055525_1000003311	126
157	3300003759	Ga0055525_1000284	Ga0055525_100028415	126
158	3300003761	Ga0055535_1006633	Ga0055535_10066332	126
159	3300003841	Ga0055541_1000001	Ga0055541_1000001311	126
160	3300003841	Ga0055541_1000133	Ga0055541_100013334	126
161	3300005327	Ga0070658_10004659	Ga0070658_100046599	126
162	3300005327	Ga0070658_10196261	Ga0070658_101962612	126
163	3300005329	Ga0070683_100111977	Ga0070683_1001119772	126
164	3300005331	Ga0070670_100077155	Ga0070670_1000771552	126
165	3300005331	Ga0070670_100273517	Ga0070670_1002735171	126
166	3300005335	Ga0070666_10322526	Ga0070666_103225262	126
167	3300005337	Ga0070682_101266924	Ga0070682_1012669241	126
168	3300005338	Ga0068868_100710119	Ga0068868_1007101192	126
169	3300005339	Ga0070660_100017355	Ga0070660_1000173553	126
170	3300005339	Ga0070660_101186474	Ga0070660_1011864741	126
171	3300005355	Ga0070671_100404422	Ga0070671_1004044221	126
172	3300005366	Ga0070659_100036327	Ga0070659_1000363274	126
173	3300005367	Ga0070667_101095214	Ga0070667_1010952141	126
174	3300005436	Ga0070713_101268018	Ga0070713_1012680182	126
175	3300005436	Ga0070713_101577982	Ga0070713_1015779821	126
176	3300005530	Ga0070679_101207077	Ga0070679_1012070772	126
177	3300005535	Ga0070684_100260132	Ga0070684_1002601322	126
178	3300005539	Ga0068853_100537702	Ga0068853_1005377022	126
179	3300005539	Ga0068853_101482129	Ga0068853_1014821292	126
180	3300005563	Ga0068855_100003611	Ga0068855_10000361116	126
181	3300005563	Ga0068855_100057933	Ga0068855_1000579334	126
182	3300005563	Ga0068855_100078070	Ga0068855_1000780703	126
183	3300005563	Ga0068855_100111100	Ga0068855_1001111003	126
184	3300005563	Ga0068855_100357766	Ga0068855_1003577662	126
185	3300005564	Ga0070664_100009050	Ga0070664_1000090501	126
186	3300005577	Ga0068857_100067592	Ga0068857_1000675922	126
187	3300005577	Ga0068857_100224684	Ga0068857_1002246842	126
188	3300005577	Ga0068857_100228334	Ga0068857_1002283342	126
189	3300005578	Ga0068854_100015182	Ga0068854_1000151826	126
190	3300005578	Ga0068854_100093284	Ga0068854_1000932842	126
191	3300005578	Ga0068854_100192920	Ga0068854_1001929202	126
192	3300005616	Ga0068852_100061089	Ga0068852_1000610893	126
193	3300005616	Ga0068852_100152919	Ga0068852_1001529192	126
194	3300005617	Ga0068859_100323585	Ga0068859_1003235851	126
195	3300005618	Ga0068864_100106831	Ga0068864_1001068313	126
196	3300005834	Ga0068851_10006865	Ga0068851_100068655	126
197	3300005834	Ga0068851_10361086	Ga0068851_103610861	126
198	3300005841	Ga0068863_100067372	Ga0068863_1000673723	126
199	3300005842	Ga0068858_100334528	Ga0068858_1003345282	126
200	3300005843	Ga0068860_100001721	Ga0068860_10000172114	126
201	3300005843	Ga0068860_100792432	Ga0068860_1007924322	126
202	3300005843	Ga0068860_101549042	Ga0068860_1015490421	126
203	3300006028	Ga0070717_11572553	Ga0070717_115725532	126
204	3300006163	Ga0070715_10653214	Ga0070715_106532142	126
205	3300006353	Ga0075370_10537308	Ga0075370_105373082	126
206	3300006358	Ga0068871_100332227	Ga0068871_1003322272	126
207	3300006931	Ga0097620_100323589	Ga0097620_1003235891	126
208	3300006946	Ga0079104_1009675	Ga0079104_10096752	126
209	3300009011	Ga0105251_10001662	Ga0105251_100016629	126
210	3300009093	Ga0105240_10004831	Ga0105240_100048312	126
211	3300009093	Ga0105240_10053448	Ga0105240_100534484	126
212	3300009093	Ga0105240_10084256	Ga0105240_100842562	126
213	3300009093	Ga0105240_10084284	Ga0105240_100842842	126
214	3300009093	Ga0105240_10272224	Ga0105240_102722242	126
215	3300009098	Ga0105245_10251946	Ga0105245_102519462	126
216	3300009101	Ga0105247_10015877	Ga0105247_100158772	126
217	3300009174	Ga0105241_10093696	Ga0105241_100936962	126
218	3300009174	Ga0105241_10512260	Ga0105241_105122602	126
219	3300009545	Ga0105237_10037768	Ga0105237_100377682	126
220	3300009545	Ga0105237_10100642	Ga0105237_101006424	126
221	3300009545	Ga0105237_10135431	Ga0105237_101354313	126
222	3300009545	Ga0105237_10275936	Ga0105237_102759362	126
223	3300009545	Ga0105237_10454986	Ga0105237_104549861	126
224	3300009551	Ga0105238_10001273	Ga0105238_100012735	126
225	3300009551	Ga0105238_10046234	Ga0105238_100462342	126
226	3300009551	Ga0105238_10117505	Ga0105238_101175051	126
227	3300010375	Ga0105239_10117315	Ga0105239_101173152	126
228	3300010375	Ga0105239_10150325	Ga0105239_101503252	126
229	3300010375	Ga0105239_10685779	Ga0105239_106857792	126
230	3300010375	Ga0105239_10921478	Ga0105239_109214782	126
231	3300010375	Ga0105239_11282324	Ga0105239_112823242	126
232	3300010375	Ga0105239_11901571	Ga0105239_119015712	126
233	3300010375	Ga0105239_12642313	Ga0105239_126423131	126
234	3300011119	Ga0105246_12145457	Ga0105246_121454571	126
235	3300013100	Ga0157373_10366781	Ga0157373_103667811	126
236	3300013102	Ga0157371_10118693	Ga0157371_101186934	126
237	3300013102	Ga0157371_10812528	Ga0157371_108125281	126
238	3300013105	Ga0157369_10840559	Ga0157369_108405592	126
239	3300013296	Ga0157374_10181338	Ga0157374_101813383	126
240	3300013306	Ga0163162_10137210	Ga0163162_101372103	126
241	3300013307	Ga0157372_10005974	Ga0157372_100059745	126
242	3300013308	Ga0157375_10748869	Ga0157375_107488691	126
243	3300013308	Ga0157375_11138147	Ga0157375_111381472	126
244	3300014325	Ga0163163_10210688	Ga0163163_102106882	126
245	3300014497	Ga0182008_10026297	Ga0182008_100262972	126
246	3300014968	Ga0157379_11452490	Ga0157379_114524902	126
247	3300015261	Ga0182006_1001264	Ga0182006_100126413	126
248	3300015261	Ga0182006_1007974	Ga0182006_10079742	126
249	3300015261	Ga0182006_1041585	Ga0182006_10415852	126
250	3300015262	Ga0182007_10010622	Ga0182007_100106222	126
251	3300015262	Ga0182007_10020813	Ga0182007_100208132	126
252	3300015262	Ga0182007_10070555	Ga0182007_100705552	126
253	3300015265	Ga0182005_1000475	Ga0182005_100047513	126
254	3300016635	Ga0183361_10001	Ga0183361_10001142	126
255	3300021361	Ga0213872_10012425	Ga0213872_100124252	126
256	3300021384	Ga0213876_10298246	Ga0213876_102982462	126
257	3300025206	Ga0209435_100188	Ga0209435_10018817	126
258	3300025224	Ga0209784_100002	Ga0209784_1000021187	126
259	3300025224	Ga0209784_100004	Ga0209784_100004310	126
260	3300025225	Ga0209566_100003	Ga0209566_1000031187	126
261	3300025225	Ga0209566_100004	Ga0209566_100004467	126
262	3300025226	Ga0209674_100004	Ga0209674_1000041187	126
263	3300025226	Ga0209674_100006	Ga0209674_100006467	126
264	3300025228	Ga0209672_103411	Ga0209672_1034111	126
265	3300025229	Ga0209147_100023	Ga0209147_1000233	126
266	3300025230	Ga0209563_100006	Ga0209563_1000061187	126
267	3300025230	Ga0209563_100009	Ga0209563_100009310	126
268	3300025231	Ga0207427_100257	Ga0207427_1002573	126
269	3300025233	Ga0209437_100004	Ga0209437_100004310	126
270	3300025233	Ga0209437_100265	Ga0209437_10026515	126
271	3300025242	Ga0209258_100836	Ga0209258_10083615	126
272	3300025246	Ga0209646_1000321	Ga0209646_100032124	126
273	3300025246	Ga0209646_1000476	Ga0209646_10004763	126
274	3300025250	Ga0209026_1000031	Ga0209026_10000313	126
275	3300025250	Ga0209026_1003773	Ga0209026_10037735	126
276	3300025253	Ga0209677_100003	Ga0209677_1000031187	126
277	3300025253	Ga0209677_100005	Ga0209677_100005310	126
278	3300025253	Ga0209677_100256	Ga0209677_10025626	126
279	3300025254	Ga0209148_1009157	Ga0209148_10091572	126
280	3300025256	Ga0209759_1000227	Ga0209759_100022783	126
281	3300025256	Ga0209759_1000599	Ga0209759_100059916	126
282	3300025261	Ga0209233_1000005	Ga0209233_1000005467	126
283	3300025261	Ga0209233_1001667	Ga0209233_10016673	126
284	3300025261	Ga0209233_1017367	Ga0209233_10173672	126
285	3300025272	Ga0209455_1002930	Ga0209455_10029305	126
286	3300025272	Ga0209455_1019248	Ga0209455_10192482	126
287	3300025297	Ga0209758_1010992	Ga0209758_10109924	126
288	3300025302	Ga0207426_1004192	Ga0207426_10041924	126
289	3300025321	Ga0207656_10047768	Ga0207656_100477681	126
290	3300025735	Ga0207713_1001973	Ga0207713_10019739	126
291	3300025900	Ga0207710_10014529	Ga0207710_100145293	126
292	3300025903	Ga0207680_10059907	Ga0207680_100599072	126
293	3300025904	Ga0207647_10023061	Ga0207647_100230614	126
294	3300025907	Ga0207645_10276329	Ga0207645_102763292	126
295	3300025909	Ga0207705_10282947	Ga0207705_102829472	126
296	3300025909	Ga0207705_10765256	Ga0207705_107652562	126
297	3300025911	Ga0207654_10148847	Ga0207654_101488472	126
298	3300025913	Ga0207695_10000157	Ga0207695_10000157141	126
299	3300025913	Ga0207695_10002435	Ga0207695_1000243521	126
300	3300025913	Ga0207695_10011925	Ga0207695_100119256	126
301	3300025913	Ga0207695_10203070	Ga0207695_102030702	126
302	3300025914	Ga0207671_10008088	Ga0207671_100080882	126
303	3300025914	Ga0207671_10026938	Ga0207671_100269383	126
304	3300025914	Ga0207671_10057654	Ga0207671_100576542	126
305	3300025914	Ga0207671_10239979	Ga0207671_102399792	126
306	3300025915	Ga0207693_10607571	Ga0207693_106075712	126
307	3300025919	Ga0207657_10614081	Ga0207657_106140812	126
308	3300025921	Ga0207652_10892074	Ga0207652_108920741	126
309	3300025924	Ga0207694_10001091	Ga0207694_1000109121	126
310	3300025924	Ga0207694_10543656	Ga0207694_105436562	126
311	3300025925	Ga0207650_10233680	Ga0207650_102336802	126
312	3300025925	Ga0207650_10695432	Ga0207650_106954322	126
313	3300025927	Ga0207687_10628357	Ga0207687_106283571	126
314	3300025931	Ga0207644_10347969	Ga0207644_103479691	126
315	3300025932	Ga0207690_10418630	Ga0207690_104186302	126
316	3300025933	Ga0207706_10638587	Ga0207706_106385872	126
317	3300025934	Ga0207686_11348356	Ga0207686_113483561	126
318	3300025941	Ga0207711_10626637	Ga0207711_106266372	126
319	3300025944	Ga0207661_10021702	Ga0207661_100217022	126
320	3300025945	Ga0207679_10156612	Ga0207679_101566121	126
321	3300025949	Ga0207667_10000438	Ga0207667_1000043817	126
322	3300025949	Ga0207667_10036392	Ga0207667_100363924	126
323	3300025949	Ga0207667_10130749	Ga0207667_101307493	126
324	3300025949	Ga0207667_10272249	Ga0207667_102722492	126
325	3300025981	Ga0207640_10032724	Ga0207640_100327243	126
326	3300025981	Ga0207640_10454103	Ga0207640_104541031	126
327	3300025986	Ga0207658_10457270	Ga0207658_104572702	126
328	3300026023	Ga0207677_10039425	Ga0207677_100394253	126
329	3300026035	Ga0207703_10524692	Ga0207703_105246922	126
330	3300026041	Ga0207639_11833604	Ga0207639_118336041	126
331	3300026078	Ga0207702_11839636	Ga0207702_118396361	126
332	3300026088	Ga0207641_10060801	Ga0207641_100608012	126
333	3300026089	Ga0207648_10049727	Ga0207648_100497272	126
334	3300026095	Ga0207676_10304516	Ga0207676_103045161	126
335	3300026116	Ga0207674_10003092	Ga0207674_1000309221	126
336	3300026116	Ga0207674_10201344	Ga0207674_102013443	126
337	3300026116	Ga0207674_11759320	Ga0207674_117593201	126
338	3300026142	Ga0207698_10039454	Ga0207698_100394542	126
339	3300026142	Ga0207698_10158636	Ga0207698_101586362	126
340	3300026142	Ga0207698_11491462	Ga0207698_114914621	126
341	3300027111	Ga0209281_1008973	Ga0209281_10089733	126
342	3300028381	Ga0268264_10000107	Ga0268264_10000107146	126
343	3300028381	Ga0268264_10531370	Ga0268264_105313702	126
344	3300028381	Ga0268264_10787769	Ga0268264_107877691	126
345	3300030521	Ga0307511_10077026	Ga0307511_100770262	126
346	3300031507	Ga0307509_10046936	Ga0307509_100469363	126
347	3300031507	Ga0307509_10411398	Ga0307509_104113982	126
348	3300031507	Ga0307509_10505964	Ga0307509_105059642	126
349	3300031507	Ga0307509_10866944	Ga0307509_108669441	126
350	3300031616	Ga0307508_10093542	Ga0307508_100935422	126
351	3300031730	Ga0307516_10118177	Ga0307516_101181771	126
352	3300031730	Ga0307516_10141101	Ga0307516_101411012	126
353	3300033179	Ga0307507_10196286	Ga0307507_101962862	126
354	3300033180	Ga0307510_10201870	Ga0307510_102018702	126
355	3300035170	Ga0373943_0211683	Ga0373943_0211683_309_692	126
356	3300035692	Ga0373935_0243497	Ga0373935_0243497_59_442	126
357	3300035695	Ga0373927_0007941	Ga0373927_0007941_6393_6776	126
358	3300035725	Ga0373947_0279665	Ga0373947_0279665_337_720	126
359	3300037068	Ga0373925_0042606	Ga0373925_0042606_1029_1412	126
360	3300037068	Ga0373925_0327452	Ga0373925_0327452_714_1097	126
361	3300037418	Ga0395900_0383610	Ga0395900_0383610_782_1162	126
362	3300037471	Ga0395905_0007035	Ga0395905_0007035_1798_2178	126
363	3300039437	Ga0436365_1696154	Ga0436365_1696154_1635_2018	126
364	3300039447	Ga0436361_0319367	Ga0436361_0319367_6965_7348	126
365	3300039447	Ga0436361_0700468	Ga0436361_0700468_1314_1700	126
366	3300041452	Ga0451793_1843072	Ga0451793_1843072_75_458	126
367	3300041459	Ga0451800_0358299	Ga0451800_0358299_52_435	126
368	3300041459	Ga0451800_1421740	Ga0451800_1421740_21_404	126
369	3300041512	Ga0451853_2778251	Ga0451853_2778251_458_841	126
370	3300044656	Ga0466969_0000298	Ga0466969_0000298_19810_20190	126
371	3300044658	Ga0466972_0339487	Ga0466972_0339487_122_502	126
372	3300044659	Ga0466973_0007584	Ga0466973_0007584_7829_8209	126
373	3300044683	Ga0466965_0000535	Ga0466965_0000535_10134_10514	126
374	3300044684	Ga0466966_0000950	Ga0466966_0000950_510_893	126
375	3300044693	Ga0466961_0000484	Ga0466961_0000484_9647_10030	126
376	3300044694	Ga0466963_0000457	Ga0466963_0000457_11603_11983	126
377	3300044706	Ga0466964_0090948	Ga0466964_0090948_657_1037	126
378	3300044706	Ga0466964_0255667	Ga0466964_0255667_235_618	126
379	3300044706	Ga0466964_0410606	Ga0466964_0410606_259_642	126
380	3300044719	Ga0466971_0002220	Ga0466971_0002220_791_1171	126
381	3300044735	Ga0466968_0278280	Ga0466968_0278280_118_498	126
382	3300044765	Ga0466970_0029344	Ga0466970_0029344_1803_2183	126
383	3300044765	Ga0466970_0921462	Ga0466970_0921462_54_437	126
384	3300044842	Ga0466957_0005789	Ga0466957_0005789_792_1172	126
385	3300044901	Ga0466960_0310291	Ga0466960_0310291_138_521	126
386	3300045049	Ga0466959_0000471	Ga0466959_0000471_18064_18447	126
387	3300045049	Ga0466959_0005542	Ga0466959_0005542_5589_5969	126
388	3300045836	Ga0466958_0001730	Ga0466958_0001730_325_705	126
389	3300045976	Ga0466967_0915206	Ga0466967_0915206_453_833	126
390	3300046454	Ga0495592_0195261	Ga0495592_0195261_683_1066	126
391	3300046454	Ga0495592_0427913	Ga0495592_0427913_26_406	126
392	3300046454	Ga0495592_0913208	Ga0495592_0913208_19_402	126
393	3300046455	Ga0495603_0893759	Ga0495603_0893759_40_423	126
394	3300046457	Ga0495590_0001378	Ga0495590_0001378_3742_4122	126
395	3300046459	Ga0495629_0030525	Ga0495629_0030525_866_1249	126
396	3300046462	Ga0495651_0015149	Ga0495651_0015149_4314_4697	126
397	3300046462	Ga0495651_0066745	Ga0495651_0066745_338_721	126
398	3300046462	Ga0495651_0092025	Ga0495651_0092025_1822_2205	126
399	3300046462	Ga0495651_0097335	Ga0495651_0097335_407_790	126
400	3300046463	Ga0495653_0001513	Ga0495653_0001513_13289_13672	126
401	3300046463	Ga0495653_0265991	Ga0495653_0265991_490_870	126
402	3300046477	Ga0495664_0146201	Ga0495664_0146201_627_1007	126
403	3300046499	Ga0495594_0489733	Ga0495594_0489733_303_686	126
404	3300046507	Ga0495606_0014550	Ga0495606_0014550_499_879	126
405	3300046507	Ga0495606_0115891	Ga0495606_0115891_625_1008	126
406	3300046511	Ga0495608_0008335	Ga0495608_0008335_6445_6828	126
407	3300046511	Ga0495608_0055269	Ga0495608_0055269_1782_2165	126
408	3300046511	Ga0495608_0148901	Ga0495608_0148901_264_647	126
409	3300046511	Ga0495608_0568520	Ga0495608_0568520_274_660	126
410	3300046513	Ga0495616_0276732	Ga0495616_0276732_39_422	126
411	3300046514	Ga0495618_0005972	Ga0495618_0005972_2330_2713	126
412	3300046514	Ga0495618_0134976	Ga0495618_0134976_1054_1437	126
413	3300046515	Ga0495620_0050801	Ga0495620_0050801_408_788	126
414	3300046515	Ga0495620_0073483	Ga0495620_0073483_33_416	126
415	3300046516	Ga0495628_0000315	Ga0495628_0000315_35488_35871	126
416	3300046516	Ga0495628_0005618	Ga0495628_0005618_5978_6361	126
417	3300046516	Ga0495628_0100608	Ga0495628_0100608_1395_1775	126
418	3300046516	Ga0495628_0426125	Ga0495628_0426125_220_603	126
419	3300046516	Ga0495628_0469618	Ga0495628_0469618_493_876	126
420	3300046524	Ga0495648_0016407	Ga0495648_0016407_4889_5272	126
421	3300046526	Ga0495666_0130648	Ga0495666_0130648_416_796	126
422	3300046529	Ga0495652_0009207	Ga0495652_0009207_4271_4654	126
423	3300046529	Ga0495652_0112474	Ga0495652_0112474_1536_1919	126
424	3300046529	Ga0495652_0123724	Ga0495652_0123724_252_635	126
425	3300046529	Ga0495652_0300413	Ga0495652_0300413_137_517	126
426	3300046529	Ga0495652_0345045	Ga0495652_0345045_266_649	126
427	3300046531	Ga0495665_0074118	Ga0495665_0074118_67_450	126
428	3300046531	Ga0495665_0083053	Ga0495665_0083053_499_879	126
429	3300046531	Ga0495665_0084382	Ga0495665_0084382_1256_1636	126
430	3300046531	Ga0495665_0627210	Ga0495665_0627210_35_418	126
431	3300046533	Ga0495640_0044316	Ga0495640_0044316_286_669	126
432	3300046542	Ga0495597_0004607	Ga0495597_0004607_6736_7116	126
433	3300046543	Ga0495645_0027193	Ga0495645_0027193_2140_2523	126
434	3300046543	Ga0495645_0070713	Ga0495645_0070713_1563_1946	126
435	3300046543	Ga0495645_0128277	Ga0495645_0128277_315_695	126
436	3300046557	Ga0495622_0110863	Ga0495622_0110863_456_839	126
437	3300046557	Ga0495622_0238909	Ga0495622_0238909_175_558	126
438	3300046642	Ga0495634_0475817	Ga0495634_0475817_82_465	126
439	3300046660	Ga0495625_0001042	Ga0495625_0001042_3927_4310	126
440	3300046663	Ga0495635_0059264	Ga0495635_0059264_106_489	126
441	3300046663	Ga0495635_0448138	Ga0495635_0448138_199_579	126
442	3300046675	Ga0495657_0034909	Ga0495657_0034909_1657_2040	126
443	3300046675	Ga0495657_0783443	Ga0495657_0783443_53_436	126
444	3300046678	Ga0495599_0000661	Ga0495599_0000661_14209_14592	126
445	3300046678	Ga0495599_0309655	Ga0495599_0309655_555_938	126
446	3300046679	Ga0495623_0052551	Ga0495623_0052551_1854_2237	126
447	3300046679	Ga0495623_0142605	Ga0495623_0142605_228_611	126
448	3300046679	Ga0495623_0388103	Ga0495623_0388103_185_565	126
449	3300046680	Ga0495646_0002711	Ga0495646_0002711_7648_8031	126
450	3300046680	Ga0495646_0004439	Ga0495646_0004439_5100_5483	126
451	3300046680	Ga0495646_0241472	Ga0495646_0241472_434_814	126
452	3300046681	Ga0495647_0631244	Ga0495647_0631244_59_442	126
453	3300046683	Ga0495658_0552266	Ga0495658_0552266_173_556	126
454	3300046684	Ga0495669_0071473	Ga0495669_0071473_342_722	126
455	3300046689	Ga0495613_0056284	Ga0495613_0056284_1209_1592	126
456	3300046690	Ga0495624_0109243	Ga0495624_0109243_1264_1647	126
457	3300046690	Ga0495624_0128775	Ga0495624_0128775_688_1071	126
458	3300046690	Ga0495624_0195752	Ga0495624_0195752_58_438	126
459	3300046694	Ga0495649_0077892	Ga0495649_0077892_892_1275	126
460	3300046809	Ga0495600_0010791	Ga0495600_0010791_998_1381	126
461	3300046809	Ga0495600_0027203	Ga0495600_0027203_2211_2594	126
462	3300047317	Ga0495604_0119193	Ga0495604_0119193_345_728	126
463	3300047317	Ga0495604_0230491	Ga0495604_0230491_249_632	126
464	3300047317	Ga0495604_0320211	Ga0495604_0320211_394_774	126
465	3300047319	Ga0495674_0029344	Ga0495674_0029344_1171_1551	126
466	3300047319	Ga0495674_0376260	Ga0495674_0376260_582_965	126
467	3300047319	Ga0495674_0739498	Ga0495674_0739498_220_600	126
468	3300047320	Ga0495672_0052037	Ga0495672_0052037_65_445	126
469	3300047322	Ga0495680_0304413	Ga0495680_0304413_628_1008	126
470	3300047322	Ga0495680_1086680	Ga0495680_1086680_79_465	126
471	3300047323	Ga0495683_0003518	Ga0495683_0003518_869_1249	126
472	3300047323	Ga0495683_0079270	Ga0495683_0079270_370_753	126
473	3300047444	Ga0495675_0340310	Ga0495675_0340310_402_782	126
474	3300047445	Ga0495677_0287993	Ga0495677_0287993_18_401	126
475	3300047469	Ga0495673_0093232	Ga0495673_0093232_22_405	126
476	3300047469	Ga0495673_0328312	Ga0495673_0328312_151_531	126
477	3300047472	Ga0495686_0100468	Ga0495686_0100468_534_917	126
478	3300047673	Ga0495593_0033074	Ga0495593_0033074_1631_2011	126
479	3300047673	Ga0495593_0053557	Ga0495593_0053557_362_742	126
480	3300047673	Ga0495593_0072173	Ga0495593_0072173_1135_1518	126
481	3300047673	Ga0495593_0233318	Ga0495593_0233318_360_743	126
482	3300048088	Ga0495602_0054279	Ga0495602_0054279_160_540	126
483	3300048088	Ga0495602_0068637	Ga0495602_0068637_1720_2103	126
484	3300048088	Ga0495602_0071542	Ga0495602_0071542_2402_2785	126
485	3300048088	Ga0495602_0206332	Ga0495602_0206332_267_650	126
486	3300048089	Ga0495614_0245095	Ga0495614_0245095_336_716	126
487	3300048903	Ga0496100_0018322	Ga0496100_0018322_1378_1758	126
488	3300048903	Ga0496100_0189182	Ga0496100_0189182_452_832	126
489	3300048903	Ga0496100_0274982	Ga0496100_0274982_511_897	126
490	3300048903	Ga0496100_0594215	Ga0496100_0594215_213_596	126
491	3300048904	Ga0496101_0039076	Ga0496101_0039076_2930_3310	126
492	3300048904	Ga0496101_0213476	Ga0496101_0213476_165_545	126
493	3300048904	Ga0496101_0315040	Ga0496101_0315040_64_447	126
494	3300048905	Ga0496102_0057814	Ga0496102_0057814_2697_3077	126
495	3300048905	Ga0496102_0975476	Ga0496102_0975476_48_431	126
496	3300048906	Ga0496103_0005820	Ga0496103_0005820_2574_2954	126
497	3300048907	Ga0496104_0018153	Ga0496104_0018153_1303_1686	126
498	3300048907	Ga0496104_0530195	Ga0496104_0530195_136_516	126
499	3300048907	Ga0496104_0678089	Ga0496104_0678089_292_678	126
500	3300048907	Ga0496104_0680896	Ga0496104_0680896_530_910	126
501	3300048908	Ga0496105_0036550	Ga0496105_0036550_3526_3906	126
502	3300048908	Ga0496105_0073971	Ga0496105_0073971_1002_1382	126
503	3300048908	Ga0496105_0132372	Ga0496105_0132372_1009_1392	126
504	3300048909	Ga0496106_0041850	Ga0496106_0041850_1295_1678	126
505	3300048910	Ga0496107_0130584	Ga0496107_0130584_791_1171	126
506	3300048910	Ga0496107_0573326	Ga0496107_0573326_404_790	126
507	3300048911	Ga0496108_0172658	Ga0496108_0172658_1196_1576	126
508	3300048911	Ga0496108_1068217	Ga0496108_1068217_244_630	126
509	3300048912	Ga0496109_0110707	Ga0496109_0110707_1505_1885	126
510	3300048912	Ga0496109_0257641	Ga0496109_0257641_512_898	126
511	3300048913	Ga0496110_0532426	Ga0496110_0532426_348_734	126
512	3300048914	Ga0496111_0088242	Ga0496111_0088242_1722_2108	126
513	3300048914	Ga0496111_0249898	Ga0496111_0249898_823_1203	126
514	3300048914	Ga0496111_0458050	Ga0496111_0458050_390_773	126
515	3300048915	Ga0496112_0009812	Ga0496112_0009812_7197_7583	126
516	3300048915	Ga0496112_0093817	Ga0496112_0093817_1701_2081	126
517	3300048916	Ga0496113_0002481	Ga0496113_0002481_688_1068	126
518	3300048916	Ga0496113_0476755	Ga0496113_0476755_175_558	126
519	3300048916	Ga0496113_0489596	Ga0496113_0489596_334_720	126
520	3300048917	Ga0496114_0338374	Ga0496114_0338374_622_1005	126
521	3300048917	Ga0496114_0594902	Ga0496114_0594902_517_903	126
522	3300048918	Ga0496115_0035274	Ga0496115_0035274_3341_3724	126
523	3300048918	Ga0496115_0341580	Ga0496115_0341580_677_1057	126
524	3300048919	Ga0496116_0005564	Ga0496116_0005564_5143_5523	126
525	3300048919	Ga0496116_0059618	Ga0496116_0059618_405_788	126
526	3300048919	Ga0496116_0159236	Ga0496116_0159236_74_457	126
527	3300048920	Ga0496117_0015617	Ga0496117_0015617_3971_4354	126
528	3300048920	Ga0496117_0036969	Ga0496117_0036969_1430_1810	126
529	3300048920	Ga0496117_0074824	Ga0496117_0074824_1703_2086	126
530	3300048921	Ga0496118_0016354	Ga0496118_0016354_4682_5065	126
531	3300048921	Ga0496118_0090826	Ga0496118_0090826_1248_1631	126
532	3300048921	Ga0496118_0112900	Ga0496118_0112900_908_1291	126
533	3300048921	Ga0496118_0494825	Ga0496118_0494825_119_502	126
534	3300048922	Ga0496119_0076118	Ga0496119_0076118_1045_1428	126
535	3300048923	Ga0496120_0018613	Ga0496120_0018613_36_419	126
536	3300048923	Ga0496120_0192054	Ga0496120_0192054_409_789	126
537	3300048923	Ga0496120_0465575	Ga0496120_0465575_128_511	126
538	3300048924	Ga0496121_0003178	Ga0496121_0003178_19878_20261	126
539	3300048924	Ga0496121_0025099	Ga0496121_0025099_1227_1607	126
540	3300048924	Ga0496121_0025932	Ga0496121_0025932_1017_1400	126
541	3300048924	Ga0496121_0064272	Ga0496121_0064272_813_1196	126
542	3300048924	Ga0496121_0085569	Ga0496121_0085569_130_513	126
543	3300048924	Ga0496121_0092934	Ga0496121_0092934_1923_2306	126
544	3300048924	Ga0496121_0127089	Ga0496121_0127089_220_603	126
545	3300048924	Ga0496121_0211527	Ga0496121_0211527_474_857	126
546	3300048925	Ga0496122_0003934	Ga0496122_0003934_4111_4494	126
547	3300048925	Ga0496122_0007094	Ga0496122_0007094_651_1031	126
548	3300048926	Ga0496123_0003125	Ga0496123_0003125_14470_14853	126
549	3300048927	Ga0496124_0002348	Ga0496124_0002348_4722_5105	126
550	3300048927	Ga0496124_0019039	Ga0496124_0019039_33_413	126
551	3300048927	Ga0496124_0084335	Ga0496124_0084335_1745_2128	126
552	3300048928	Ga0496125_0003004	Ga0496125_0003004_3468_3851	126
553	3300048928	Ga0496125_0018927	Ga0496125_0018927_2854_3234	126
554	3300048928	Ga0496125_0038656	Ga0496125_0038656_2030_2413	126
555	3300048928	Ga0496125_0076929	Ga0496125_0076929_1531_1914	126
556	3300048928	Ga0496125_0214847	Ga0496125_0214847_385_768	126
557	3300048929	Ga0496126_0023731	Ga0496126_0023731_4466_4849	126
558	3300048929	Ga0496126_0026626	Ga0496126_0026626_3361_3744	126
559	3300048929	Ga0496126_1120312	Ga0496126_1120312_19_399	126
560	3300048986	Ga0466983_0362901	Ga0466983_0362901_343_723	126
561	3300049460	Ga0495682_0290083	Ga0495682_0290083_172_555	126
562	3300050496	nmdc:mga07m45_530597_c1	nmdc:mga07m45_530597_c1_267_650	126
563	3300053077	Ga0495601_0009012	Ga0495601_0009012_1091_1474	126
564	3300053077	Ga0495601_0140566	Ga0495601_0140566_1045_1428	126
565	3300053077	Ga0495601_0486429	Ga0495601_0486429_369_752	126
566	3300053080	Ga0500635_0094454	Ga0500635_0094454_389_772	126
567	3300053083	Ga0495655_0082517	Ga0495655_0082517_31_414	126
568	3300053084	Ga0495595_0277536	Ga0495595_0277536_108_494	126
569	3300053086	Ga0500578_0079627	Ga0500578_0079627_607_990	126
570	3300053091	Ga0500647_0239512	Ga0500647_0239512_389_772	126
571	3300053094	Ga0500566_0050852	Ga0500566_0050852_1250_1633	126
572	3300053111	Ga0500572_136763	Ga0500572_136763_13_396	126
573	3300053119	Ga0500595_001308	Ga0500595_001308_12675_13058	126
574	3300053119	Ga0500595_009852	Ga0500595_009852_1128_1511	126
575	3300053119	Ga0500595_031401	Ga0500595_031401_702_1085	126
576	3300053125	Ga0500618_000861	Ga0500618_000861_434_817	126
577	3300053125	Ga0500618_002077	Ga0500618_002077_3481_3864	126
578	3300053136	Ga0500559_0232036	Ga0500559_0232036_49_432	126
579	3300053141	Ga0500574_001680	Ga0500574_001680_269_652	126
580	3300053150	Ga0500603_029533	Ga0500603_029533_698_1081	126
581	3300053162	Ga0500638_158264	Ga0500638_158264_340_723	126
582	3300053162	Ga0500638_312425	Ga0500638_312425_132_515	126
583	3300053163	Ga0500639_173357	Ga0500639_173357_95_478	126
584	3300053178	Ga0500637_0148534	Ga0500637_0148534_847_1230	126
585	3300053728	Ga0500657_083819	Ga0500657_083819_683_1066	126
586	3300053733	Ga0500552_003386	Ga0500552_003386_330_713	126
587	3300055283	Ga0500661_070300	Ga0500661_070300_151_534	126
588	3300061719	Ga0466962_0022265	Ga0466962_0022265_1874_2254	126
589	iso_pu_bacteria	2511231026	2511387533	126
590	iso_pu_bacteria	2513237150	2513952280	126
591	iso_pu_bacteria	2513237165	2514044863	126
592	iso_pu_bacteria	2599185169	2599412939	126
593	iso_pu_bacteria	2599185354	2600202007	126
594	iso_pu_bacteria	2600255254	2601525591	126
595	iso_pu_bacteria	2600255255	2601530799	126
596	iso_pu_bacteria	2600255280	2601617712	126
597	iso_pu_bacteria	2600255281	2601622746	126
598	iso_pu_bacteria	2600255287	2601644708	126
599	iso_pu_bacteria	2600255288	2601651019	126
600	iso_pu_bacteria	2600255289	2601656069	126
601	iso_pu_bacteria	2600255290	2601660992	126
602	iso_pu_bacteria	2600255291	2601664873	126
603	iso_pu_bacteria	2600255298	2601697258	126
604	iso_pu_bacteria	2600255299	2601702646	126
605	iso_pu_bacteria	2600255300	2601708835	126
606	iso_pu_bacteria	2600255301	2601713872	126
607	iso_pu_bacteria	2600255302	2601718918	126
608	iso_pu_bacteria	2600255303	2601722694	126
609	iso_pu_bacteria	2600255304	2601728961	126
610	iso_pu_bacteria	2600255305	2601733864	126
611	iso_pu_bacteria	2600255306	2601738839	126
612	iso_pu_bacteria	2600255307	2601743354	126
613	iso_pu_bacteria	2600255309	2601754480	126
614	iso_pu_bacteria	2600255392	2602021421	126
615	iso_pu_bacteria	2602042052	2603662809	126
616	iso_pu_bacteria	2602042053	2603667706	126
617	iso_pu_bacteria	2602042103	2603841389	126
618	iso_pu_bacteria	2602042104	2603846482	126
619	iso_pu_bacteria	2602042105	2603851557	126
620	iso_pu_bacteria	2602042106	2603856602	126
621	iso_pu_bacteria	2602042110	2603874204	126
622	iso_pu_bacteria	2602042111	2603878515	126
623	iso_pu_bacteria	2603880178	2606051361	126
624	iso_pu_bacteria	2603880184	2606072362	126
625	iso_pu_bacteria	2603880202	2606149046	126
626	iso_pu_bacteria	2603880211	2606179275	126
627	iso_pu_bacteria	2648501241	2649119225	126
628	iso_pu_bacteria	2651869818	2652976229	126
629	iso_pu_bacteria	2675903046	2676409798	126
630	iso_pu_bacteria	2834641062	2834644674	126
631	iso_pu_bacteria	2901300506	2901303927	126
632	iso_pu_bacteria	2919108558	2919112752	126
633	iso_pu_bacteria	644736347	644751155	126
634	iso_pu_bacteria	8003400568	8003402401	126
635	3300001915	JGI24741J21665_1001203	JGI24741J21665_10012033	127
636	3300001979	JGI24740J21852_10001103	JGI24740J21852_1000110310	127
637	3300001979	JGI24740J21852_10001307	JGI24740J21852_100013072	127
638	3300002705	JGI25156J39149_1004229	JGI25156J39149_10042292	127
639	3300002705	JGI25156J39149_1011017	JGI25156J39149_10110172	127
640	3300002738	JGI25154J39366_1002391	JGI25154J39366_10023912	127
641	3300003187	JGI25151J46595_10035832	JGI25151J46595_100358322	127
642	3300003578	Ga0006562J51391_1123888	Ga0006562J51391_11238882	127
643	3300003751	Ga0055538_1005391	Ga0055538_10053912	127
644	3300003751	Ga0055538_1005998	Ga0055538_10059982	127
645	3300003752	Ga0055539_1000079	Ga0055539_100007981	127
646	3300003752	Ga0055539_1036425	Ga0055539_10364251	127
647	3300003756	Ga0055533_1001431	Ga0055533_10014313	127
648	3300003756	Ga0055533_1004486	Ga0055533_10044863	127
649	3300003758	Ga0055532_1000056	Ga0055532_10000565	127
650	3300003759	Ga0055525_1000220	Ga0055525_100022013	127
651	3300003760	Ga0055527_1002319	Ga0055527_10023194	127
652	3300003761	Ga0055535_1000013	Ga0055535_1000013121	127
653	3300003762	Ga0055542_1000696	Ga0055542_10006967	127
654	3300003763	Ga0055529_1000074	Ga0055529_1000074151	127
655	3300003841	Ga0055541_1001455	Ga0055541_10014554	127
656	3300003841	Ga0055541_1027793	Ga0055541_10277931	127
657	3300005328	Ga0070676_10220853	Ga0070676_102208531	127
658	3300005328	Ga0070676_10398552	Ga0070676_103985522	127
659	3300005329	Ga0070683_100102942	Ga0070683_1001029423	127
660	3300005337	Ga0070682_100111048	Ga0070682_1001110482	127
661	3300005338	Ga0068868_100248058	Ga0068868_1002480581	127
662	3300005339	Ga0070660_100136486	Ga0070660_1001364862	127
663	3300005344	Ga0070661_100000007	Ga0070661_100000007121	127
664	3300005347	Ga0070668_100127113	Ga0070668_1001271131	127
665	3300005347	Ga0070668_100759239	Ga0070668_1007592392	127
666	3300005353	Ga0070669_100152156	Ga0070669_1001521562	127
667	3300005356	Ga0070674_100079979	Ga0070674_1000799792	127
668	3300005366	Ga0070659_100002351	Ga0070659_10000235112	127
669	3300005367	Ga0070667_100987783	Ga0070667_1009877831	127
670	3300005367	Ga0070667_101809156	Ga0070667_1018091561	127
671	3300005455	Ga0070663_100000002	Ga0070663_100000002121	127
672	3300005455	Ga0070663_100467927	Ga0070663_1004679272	127
673	3300005539	Ga0068853_100125917	Ga0068853_1001259172	127
674	3300005543	Ga0070672_100380337	Ga0070672_1003803372	127
675	3300005547	Ga0070693_101241578	Ga0070693_1012415781	127
676	3300005548	Ga0070665_100722484	Ga0070665_1007224842	127
677	3300005564	Ga0070664_100000004	Ga0070664_100000004122	127
678	3300005577	Ga0068857_100047085	Ga0068857_1000470852	127
679	3300005578	Ga0068854_100000252	Ga0068854_10000025214	127
680	3300005578	Ga0068854_100214846	Ga0068854_1002148462	127
681	3300005614	Ga0068856_100000051	Ga0068856_10000005112	127
682	3300005614	Ga0068856_101626460	Ga0068856_1016264601	127
683	3300005618	Ga0068864_101396657	Ga0068864_1013966571	127
684	3300005718	Ga0068866_10047322	Ga0068866_100473221	127
685	3300005834	Ga0068851_10178883	Ga0068851_101788832	127
686	3300009093	Ga0105240_10001398	Ga0105240_1000139813	127
687	3300009093	Ga0105240_10196421	Ga0105240_101964212	127
688	3300009093	Ga0105240_10652658	Ga0105240_106526582	127
689	3300009101	Ga0105247_10591091	Ga0105247_105910911	127
690	3300009174	Ga0105241_11065538	Ga0105241_110655382	127
691	3300009176	Ga0105242_10077605	Ga0105242_100776051	127
692	3300009177	Ga0105248_13049857	Ga0105248_130498572	127
693	3300009545	Ga0105237_10001780	Ga0105237_1000178017	127
694	3300009551	Ga0105238_10023039	Ga0105238_100230393	127
695	3300009978	Ga0105148_104047	Ga0105148_1040471	127
696	3300010375	Ga0105239_10000615	Ga0105239_1000061523	127
697	3300013102	Ga0157371_10000090	Ga0157371_1000009056	127
698	3300013104	Ga0157370_10000014	Ga0157370_10000014122	127
699	3300013105	Ga0157369_10075510	Ga0157369_100755103	127
700	3300013296	Ga0157374_10292692	Ga0157374_102926922	127
701	3300013306	Ga0163162_10303189	Ga0163162_103031892	127
702	3300013307	Ga0157372_10000032	Ga0157372_10000032103	127
703	3300013308	Ga0157375_10061748	Ga0157375_100617483	127
704	3300014325	Ga0163163_11566669	Ga0163163_115666692	127
705	3300014497	Ga0182008_10146649	Ga0182008_101466492	127
706	3300015261	Ga0182006_1006453	Ga0182006_10064534	127
707	3300015261	Ga0182006_1010959	Ga0182006_10109592	127
708	3300015262	Ga0182007_10014753	Ga0182007_100147533	127
709	3300015265	Ga0182005_1164192	Ga0182005_11641922	127
710	3300017792	Ga0163161_10158338	Ga0163161_101583381	127
711	3300020069	Ga0197907_10596243	Ga0197907_105962432	127
712	3300020070	Ga0206356_10041077	Ga0206356_100410772	127
713	3300020077	Ga0206351_10272672	Ga0206351_102726723	127
714	3300020610	Ga0154015_1616394	Ga0154015_16163945	127
715	3300025224	Ga0209784_100008	Ga0209784_100008567	127
716	3300025224	Ga0209784_100388	Ga0209784_10038812	127
717	3300025224	Ga0209784_100437	Ga0209784_10043711	127
718	3300025225	Ga0209566_100006	Ga0209566_100006567	127
719	3300025225	Ga0209566_101273	Ga0209566_1012733	127
720	3300025225	Ga0209566_108812	Ga0209566_1088122	127
721	3300025226	Ga0209674_100083	Ga0209674_10008336	127
722	3300025226	Ga0209674_100109	Ga0209674_10010942	127
723	3300025226	Ga0209674_104698	Ga0209674_1046982	127
724	3300025228	Ga0209672_101517	Ga0209672_1015175	127
725	3300025229	Ga0209147_100005	Ga0209147_100005574	127
726	3300025230	Ga0209563_100016	Ga0209563_100016567	127
727	3300025230	Ga0209563_112603	Ga0209563_1126032	127
728	3300025242	Ga0209258_100007	Ga0209258_100007574	127
729	3300025246	Ga0209646_1000016	Ga0209646_1000016189	127
730	3300025250	Ga0209026_1009009	Ga0209026_10090092	127
731	3300025253	Ga0209677_100008	Ga0209677_100008126	127
732	3300025253	Ga0209677_102251	Ga0209677_1022512	127
733	3300025254	Ga0209148_1000051	Ga0209148_1000051182	127
734	3300025254	Ga0209148_1003965	Ga0209148_10039652	127
735	3300025256	Ga0209759_1000995	Ga0209759_10009952	127
736	3300025256	Ga0209759_1009920	Ga0209759_10099201	127
737	3300025256	Ga0209759_1017698	Ga0209759_10176981	127
738	3300025272	Ga0209455_1000011	Ga0209455_1000011499	127
739	3300025291	Ga0209675_1002614	Ga0209675_10026144	127
740	3300025294	Ga0209025_1002975	Ga0209025_10029754	127
741	3300025299	Ga0209256_1004400	Ga0209256_10044002	127
742	3300025303	Ga0209051_1014838	Ga0209051_10148382	127
743	3300025321	Ga0207656_10226131	Ga0207656_102261311	127
744	3300025899	Ga0207642_10107646	Ga0207642_101076462	127
745	3300025907	Ga0207645_10037603	Ga0207645_100376033	127
746	3300025911	Ga0207654_10642551	Ga0207654_106425512	127
747	3300025913	Ga0207695_10001066	Ga0207695_1000106616	127
748	3300025913	Ga0207695_10006362	Ga0207695_100063623	127
749	3300025913	Ga0207695_10430073	Ga0207695_104300733	127
750	3300025913	Ga0207695_10513032	Ga0207695_105130322	127
751	3300025914	Ga0207671_10003233	Ga0207671_100032332	127
752	3300025919	Ga0207657_10074389	Ga0207657_100743893	127
753	3300025919	Ga0207657_10142632	Ga0207657_101426322	127
754	3300025920	Ga0207649_10000115	Ga0207649_1000011530	127
755	3300025920	Ga0207649_10276832	Ga0207649_102768322	127
756	3300025923	Ga0207681_10590200	Ga0207681_105902002	127
757	3300025924	Ga0207694_10047223	Ga0207694_100472233	127
758	3300025931	Ga0207644_10912848	Ga0207644_109128481	127
759	3300025932	Ga0207690_10002668	Ga0207690_100026688	127
760	3300025933	Ga0207706_10144092	Ga0207706_101440921	127
761	3300025940	Ga0207691_10167287	Ga0207691_101672872	127
762	3300025941	Ga0207711_10164800	Ga0207711_101648002	127
763	3300025944	Ga0207661_10058433	Ga0207661_100584333	127
764	3300025945	Ga0207679_10000002	Ga0207679_10000002153	127
765	3300025945	Ga0207679_10451373	Ga0207679_104513731	127
766	3300025972	Ga0207668_10177599	Ga0207668_101775992	127
767	3300025981	Ga0207640_10000249	Ga0207640_1000024913	127
768	3300025986	Ga0207658_10863396	Ga0207658_108633962	127
769	3300026035	Ga0207703_10282265	Ga0207703_102822651	127
770	3300026041	Ga0207639_10351541	Ga0207639_103515412	127
771	3300026067	Ga0207678_10000003	Ga0207678_10000003122	127
772	3300026067	Ga0207678_10052114	Ga0207678_100521142	127
773	3300026067	Ga0207678_10084571	Ga0207678_100845712	127
774	3300026078	Ga0207702_10000010	Ga0207702_1000001071	127
775	3300026116	Ga0207674_10005233	Ga0207674_1000523310	127
776	3300026118	Ga0207675_100878051	Ga0207675_1008780512	127
777	3300026142	Ga0207698_10341515	Ga0207698_103415152	127
778	3300028379	Ga0268266_11200682	Ga0268266_112006822	127
779	3300028800	Ga0265338_10122744	Ga0265338_101227443	127
780	3300031241	Ga0265325_10085618	Ga0265325_100856182	127
781	3300031344	Ga0265316_10729841	Ga0265316_107298412	127
782	3300031548	Ga0307408_100002131	Ga0307408_1000021318	127
783	3300031731	Ga0307405_11834279	Ga0307405_118342791	127
784	3300031824	Ga0307413_10214594	Ga0307413_102145942	127
785	3300031852	Ga0307410_11345778	Ga0307410_113457782	127
786	3300031901	Ga0307406_10005474	Ga0307406_100054741	127
787	3300031901	Ga0307406_10278596	Ga0307406_102785962	127
788	3300031903	Ga0307407_10350279	Ga0307407_103502792	127
789	3300031911	Ga0307412_10389733	Ga0307412_103897332	127
790	3300031995	Ga0307409_101795570	Ga0307409_1017955702	127
791	3300032002	Ga0307416_100778015	Ga0307416_1007780152	127
792	3300032002	Ga0307416_100928759	Ga0307416_1009287592	127
793	3300032004	Ga0307414_10053745	Ga0307414_100537452	127
794	3300032005	Ga0307411_10078757	Ga0307411_100787572	127
795	3300032126	Ga0307415_100185015	Ga0307415_1001850152	127
796	3300037418	Ga0395900_0007165	Ga0395900_0007165_10999_11385	127
797	3300037471	Ga0395905_0446749	Ga0395905_0446749_258_647	127
798	3300037471	Ga0395905_0557468	Ga0395905_0557468_625_1011	127
799	3300044650	Ga0466986_0220805	Ga0466986_0220805_470_856	127
800	3300044666	Ga0466977_0323200	Ga0466977_0323200_398_784	127
801	3300044671	Ga0466978_0152104	Ga0466978_0152104_375_761	127
802	3300044683	Ga0466965_0142124	Ga0466965_0142124_434_820	127
803	3300044693	Ga0466961_0069232	Ga0466961_0069232_1310_1696	127
804	3300044706	Ga0466964_0082084	Ga0466964_0082084_473_859	127
805	3300044719	Ga0466971_0148577	Ga0466971_0148577_154_540	127
806	3300044735	Ga0466968_0028123	Ga0466968_0028123_1360_1746	127
807	3300044765	Ga0466970_0071174	Ga0466970_0071174_1147_1533	127
808	3300044901	Ga0466960_0233205	Ga0466960_0233205_307_693	127
809	3300045049	Ga0466959_0170693	Ga0466959_0170693_677_1063	127
810	3300045976	Ga0466967_0166377	Ga0466967_0166377_393_779	127
811	3300045976	Ga0466967_0611339	Ga0466967_0611339_65_451	127
812	3300046528	Ga0495642_0190282	Ga0495642_0190282_81_470	127
813	3300047472	Ga0495686_0143570	Ga0495686_0143570_131_514	127
814	3300048909	Ga0496106_0304766	Ga0496106_0304766_98_487	127
815	3300048927	Ga0496124_0476963	Ga0496124_0476963_231_620	127
816	3300048928	Ga0496125_0190373	Ga0496125_0190373_435_821	127
817	3300048928	Ga0496125_0321110	Ga0496125_0321110_421_816	127
818	3300049660	Ga0501216_147655	Ga0501216_147655_28_417	127
819	3300059640	Ga0587067_000876	Ga0587067_000876_385_771	127
820	3300059643	Ga0587072_000060	Ga0587072_000060_4879_5265	127
821	3300061719	Ga0466962_0000885	Ga0466962_0000885_12659_13045	127
822	iso_pu_bacteria	2643221569	2643862522	127
823	iso_pu_bacteria	2643221594	2643980467	127
824	iso_pu_bacteria	2808606395	2809032216	127
825	iso_pu_bacteria	2855730933	2855735824	127
826	iso_pu_bacteria	2855767633	2855772762	127
827	iso_pu_bacteria	2987605356	2987608720	127
828	3300001915	JGI24741J21665_1021899	JGI24741J21665_10218992	128
829	3300001979	JGI24740J21852_10004647	JGI24740J21852_100046472	128
830	3300001979	JGI24740J21852_10006794	JGI24740J21852_100067945	128
831	3300001979	JGI24740J21852_10053219	JGI24740J21852_100532192	128
832	3300001989	JGI24739J22299_10001248	JGI24739J22299_100012484	128
833	3300001989	JGI24739J22299_10004875	JGI24739J22299_100048752	128
834	3300001989	JGI24739J22299_10005521	JGI24739J22299_100055212	128
835	3300001990	JGI24737J22298_10001638	JGI24737J22298_100016384	128
836	3300001990	JGI24737J22298_10027864	JGI24737J22298_100278642	128
837	3300001990	JGI24737J22298_10042771	JGI24737J22298_100427711	128
838	3300002067	JGI24735J21928_10006062	JGI24735J21928_100060622	128
839	3300002067	JGI24735J21928_10014387	JGI24735J21928_100143872	128
840	3300002075	JGI24738J21930_10015452	JGI24738J21930_100154522	128
841	3300002705	JGI25156J39149_1000353	JGI25156J39149_100035325	128
842	3300002705	JGI25156J39149_1000458	JGI25156J39149_100045822	128
843	3300002705	JGI25156J39149_1000998	JGI25156J39149_10009984	128
844	3300002737	JGI25162J39368_1002006	JGI25162J39368_10020065	128
845	3300002738	JGI25154J39366_1010452	JGI25154J39366_10104521	128
846	3300002741	JGI25157J39369_1005893	JGI25157J39369_10058931	128
847	3300002772	JGI25164J39214_1000114	JGI25164J39214_100011426	128
848	3300002772	JGI25164J39214_1011165	JGI25164J39214_10111652	128
849	3300003187	JGI25151J46595_10000174	JGI25151J46595_1000017428	128
850	3300003214	JGI25165J46597_1000250	JGI25165J46597_100025031	128
851	3300003214	JGI25165J46597_1005414	JGI25165J46597_10054141	128
852	3300003215	JGI25153J46596_10019301	JGI25153J46596_100193012	128
853	3300003320	rootH2_10064714	rootH2_100647141	128
854	3300003322	rootL2_10290299	rootL2_102902993	128
855	3300003323	rootH1_10020162	rootH1_1002016211	128
856	3300003479	Ga0006556J51387_1037296	Ga0006556J51387_10372961	128
857	3300003578	Ga0006562J51391_1047084	Ga0006562J51391_10470843	128
858	3300003578	Ga0006562J51391_1047087	Ga0006562J51391_10470872	128
859	3300003756	Ga0055533_1000252	Ga0055533_100025228	128
860	3300003756	Ga0055533_1000828	Ga0055533_10008284	128
861	3300003758	Ga0055532_1000031	Ga0055532_10000314	128
862	3300003758	Ga0055532_1004725	Ga0055532_10047253	128
863	3300003759	Ga0055525_1023342	Ga0055525_10233421	128
864	3300003760	Ga0055527_1000020	Ga0055527_10000204	128
865	3300003760	Ga0055527_1003164	Ga0055527_10031644	128
866	3300003760	Ga0055527_1004199	Ga0055527_10041993	128
867	3300003760	Ga0055527_1012971	Ga0055527_10129711	128
868	3300003761	Ga0055535_1000023	Ga0055535_1000023214	128
869	3300003761	Ga0055535_1000665	Ga0055535_10006654	128
870	3300003761	Ga0055535_1006042	Ga0055535_10060424	128
871	3300003761	Ga0055535_1007753	Ga0055535_10077533	128
872	3300003762	Ga0055542_1000035	Ga0055542_10000354	128
873	3300003762	Ga0055542_1000377	Ga0055542_100037712	128
874	3300003762	Ga0055542_1006190	Ga0055542_10061904	128
875	3300003762	Ga0055542_1008601	Ga0055542_10086012	128
876	3300003763	Ga0055529_1000039	Ga0055529_1000039214	128
877	3300003763	Ga0055529_1000404	Ga0055529_100040412	128
878	3300003763	Ga0055529_1000799	Ga0055529_100079914	128
879	3300003841	Ga0055541_1008649	Ga0055541_10086492	128
880	3300003856	Ga0058692_1001715	Ga0058692_10017157	128
881	3300005262	Ga0065165_1000115	Ga0065165_10001151	128
882	3300005327	Ga0070658_10005856	Ga0070658_100058567	128
883	3300005327	Ga0070658_10013643	Ga0070658_100136436	128
884	3300005327	Ga0070658_10191523	Ga0070658_101915232	128
885	3300005339	Ga0070660_100000021	Ga0070660_10000002156	128
886	3300005344	Ga0070661_100435378	Ga0070661_1004353781	128
887	3300005355	Ga0070671_101144077	Ga0070671_1011440771	128
888	3300005366	Ga0070659_100000061	Ga0070659_10000006138	128
889	3300005366	Ga0070659_100005984	Ga0070659_1000059846	128
890	3300005366	Ga0070659_100758902	Ga0070659_1007589022	128
891	3300005445	Ga0070708_101333131	Ga0070708_1013331312	128
892	3300005455	Ga0070663_100000250	Ga0070663_10000025011	128
893	3300005455	Ga0070663_100062927	Ga0070663_1000629272	128
894	3300005455	Ga0070663_100340441	Ga0070663_1003404412	128
895	3300005455	Ga0070663_100512645	Ga0070663_1005126451	128
896	3300005455	Ga0070663_101208190	Ga0070663_1012081901	128
897	3300005457	Ga0070662_101080245	Ga0070662_1010802451	128
898	3300005539	Ga0068853_100795668	Ga0068853_1007956681	128
899	3300005539	Ga0068853_101667111	Ga0068853_1016671111	128
900	3300005547	Ga0070693_100477183	Ga0070693_1004771831	128
901	3300005563	Ga0068855_100013439	Ga0068855_1000134394	128
902	3300005563	Ga0068855_100091847	Ga0068855_1000918473	128
903	3300005563	Ga0068855_100187756	Ga0068855_1001877563	128
904	3300005563	Ga0068855_101579145	Ga0068855_1015791452	128
905	3300005563	Ga0068855_101744159	Ga0068855_1017441591	128
906	3300005564	Ga0070664_100026511	Ga0070664_1000265111	128
907	3300005564	Ga0070664_100123601	Ga0070664_1001236011	128
908	3300005577	Ga0068857_100002031	Ga0068857_1000020312	128
909	3300005578	Ga0068854_100003444	Ga0068854_1000034444	128
910	3300005578	Ga0068854_100009144	Ga0068854_1000091446	128
911	3300005616	Ga0068852_100028189	Ga0068852_1000281892	128
912	3300005616	Ga0068852_100063035	Ga0068852_1000630352	128
913	3300005616	Ga0068852_101567225	Ga0068852_1015672252	128
914	3300005834	Ga0068851_10013274	Ga0068851_100132742	128
915	3300005842	Ga0068858_100069607	Ga0068858_1000696076	128
916	3300005842	Ga0068858_100350874	Ga0068858_1003508742	128
917	3300006846	Ga0075430_100714107	Ga0075430_1007141072	128
918	3300009011	Ga0105251_10000913	Ga0105251_100009132	128
919	3300009011	Ga0105251_10180261	Ga0105251_101802612	128
920	3300009092	Ga0105250_10004349	Ga0105250_100043494	128
921	3300009093	Ga0105240_10011738	Ga0105240_100117388	128
922	3300009093	Ga0105240_10026813	Ga0105240_100268132	128
923	3300009093	Ga0105240_10037237	Ga0105240_100372376	128
924	3300009093	Ga0105240_10047810	Ga0105240_100478106	128
925	3300009093	Ga0105240_10117182	Ga0105240_101171823	128
926	3300009174	Ga0105241_10167522	Ga0105241_101675222	128
927	3300009174	Ga0105241_10178807	Ga0105241_101788073	128
928	3300009176	Ga0105242_10471560	Ga0105242_104715602	128
929	3300009545	Ga0105237_10000022	Ga0105237_1000002215	128
930	3300009551	Ga0105238_10005127	Ga0105238_1000512713	128
931	3300009551	Ga0105238_10382774	Ga0105238_103827742	128
932	3300010375	Ga0105239_10044395	Ga0105239_100443958	128
933	3300011119	Ga0105246_10121779	Ga0105246_101217792	128
934	3300012500	Ga0157314_1000035	Ga0157314_10000356	128
935	3300012502	Ga0157347_1000778	Ga0157347_10007782	128
936	3300012508	Ga0157315_1002889	Ga0157315_10028892	128
937	3300013100	Ga0157373_10321076	Ga0157373_103210762	128
938	3300013100	Ga0157373_11457813	Ga0157373_114578131	128
939	3300013102	Ga0157371_10031301	Ga0157371_100313014	128
940	3300013102	Ga0157371_11324840	Ga0157371_113248401	128
941	3300013104	Ga0157370_10051677	Ga0157370_100516772	128
942	3300013105	Ga0157369_10000846	Ga0157369_1000084626	128
943	3300013105	Ga0157369_10272951	Ga0157369_102729512	128
944	3300013105	Ga0157369_10809566	Ga0157369_108095661	128
945	3300013296	Ga0157374_10086687	Ga0157374_100866875	128
946	3300013306	Ga0163162_10470521	Ga0163162_104705212	128
947	3300013307	Ga0157372_10550906	Ga0157372_105509062	128
948	3300013307	Ga0157372_12587554	Ga0157372_125875541	128
949	3300014497	Ga0182008_10031010	Ga0182008_100310102	128
950	3300014497	Ga0182008_10055069	Ga0182008_100550692	128
951	3300014497	Ga0182008_10548114	Ga0182008_105481142	128
952	3300015261	Ga0182006_1055485	Ga0182006_10554852	128
953	3300015262	Ga0182007_10000384	Ga0182007_1000038423	128
954	3300021384	Ga0213876_10212986	Ga0213876_102129862	128
955	3300022467	Ga0224712_10006244	Ga0224712_100062443	128
956	3300025225	Ga0209566_100398	Ga0209566_10039826	128
957	3300025226	Ga0209674_100223	Ga0209674_10022344	128
958	3300025226	Ga0209674_100236	Ga0209674_10023639	128
959	3300025228	Ga0209672_100001	Ga0209672_1000011884	128
960	3300025228	Ga0209672_100046	Ga0209672_100046147	128
961	3300025228	Ga0209672_100047	Ga0209672_100047201	128
962	3300025228	Ga0209672_100113	Ga0209672_10011364	128
963	3300025229	Ga0209147_100001	Ga0209147_1000011884	128
964	3300025229	Ga0209147_100043	Ga0209147_100043117	128
965	3300025229	Ga0209147_100059	Ga0209147_100059201	128
966	3300025229	Ga0209147_100232	Ga0209147_10023217	128
967	3300025230	Ga0209563_100302	Ga0209563_1003024	128
968	3300025231	Ga0207427_100075	Ga0207427_10007568	128
969	3300025231	Ga0207427_102136	Ga0207427_1021364	128
970	3300025233	Ga0209437_100366	Ga0209437_10036612	128
971	3300025242	Ga0209258_100001	Ga0209258_1000011884	128
972	3300025242	Ga0209258_100023	Ga0209258_100023317	128
973	3300025242	Ga0209258_100172	Ga0209258_10017299	128
974	3300025242	Ga0209258_100314	Ga0209258_10031425	128
975	3300025246	Ga0209646_1009753	Ga0209646_10097532	128
976	3300025250	Ga0209026_1000323	Ga0209026_100032324	128
977	3300025253	Ga0209677_115316	Ga0209677_1153162	128
978	3300025254	Ga0209148_1000003	Ga0209148_10000031884	128
979	3300025254	Ga0209148_1000024	Ga0209148_1000024256	128
980	3300025254	Ga0209148_1000029	Ga0209148_1000029383	128
981	3300025254	Ga0209148_1001548	Ga0209148_10015484	128
982	3300025256	Ga0209759_1000466	Ga0209759_100046637	128
983	3300025256	Ga0209759_1000511	Ga0209759_100051134	128
984	3300025256	Ga0209759_1000627	Ga0209759_10006274	128
985	3300025256	Ga0209759_1001884	Ga0209759_10018846	128
986	3300025256	Ga0209759_1006041	Ga0209759_10060413	128
987	3300025258	Ga0209129_1001095	Ga0209129_10010958	128
988	3300025261	Ga0209233_1000123	Ga0209233_1000123208	128
989	3300025261	Ga0209233_1000210	Ga0209233_100021069	128
990	3300025272	Ga0209455_1000001	Ga0209455_10000011884	128
991	3300025272	Ga0209455_1000025	Ga0209455_1000025256	128
992	3300025272	Ga0209455_1000064	Ga0209455_1000064112	128
993	3300025272	Ga0209455_1002194	Ga0209455_10021942	128
994	3300025294	Ga0209025_1000027	Ga0209025_1000027197	128
995	3300025294	Ga0209025_1092004	Ga0209025_10920041	128
996	3300025295	Ga0209564_1007938	Ga0209564_10079384	128
997	3300025297	Ga0209758_1000491	Ga0209758_100049111	128
998	3300025302	Ga0207426_1000007	Ga0207426_1000007215	128
999	3300025711	Ga0207696_1006421	Ga0207696_10064213	128
1000	3300025735	Ga0207713_1000920	Ga0207713_100092024	128
1001	3300025735	Ga0207713_1192107	Ga0207713_11921071	128
1002	3300025904	Ga0207647_10000635	Ga0207647_1000063523	128
1003	3300025904	Ga0207647_10001156	Ga0207647_1000115610	128
1004	3300025904	Ga0207647_10004154	Ga0207647_100041549	128
1005	3300025904	Ga0207647_10193358	Ga0207647_101933581	128
1006	3300025909	Ga0207705_10000492	Ga0207705_1000049210	128
1007	3300025909	Ga0207705_10208915	Ga0207705_102089152	128
1008	3300025913	Ga0207695_10001444	Ga0207695_1000144435	128
1009	3300025913	Ga0207695_10004189	Ga0207695_1000418911	128
1010	3300025913	Ga0207695_10025973	Ga0207695_100259732	128
1011	3300025913	Ga0207695_10098925	Ga0207695_100989253	128
1012	3300025913	Ga0207695_10173654	Ga0207695_101736543	128
1013	3300025913	Ga0207695_10621830	Ga0207695_106218301	128
1014	3300025913	Ga0207695_10861645	Ga0207695_108616451	128
1015	3300025914	Ga0207671_10000009	Ga0207671_10000009615	128
1016	3300025914	Ga0207671_10007405	Ga0207671_100074054	128
1017	3300025914	Ga0207671_10023425	Ga0207671_100234252	128
1018	3300025914	Ga0207671_10156005	Ga0207671_101560052	128
1019	3300025919	Ga0207657_10000008	Ga0207657_10000008137	128
1020	3300025919	Ga0207657_10280851	Ga0207657_102808512	128
1021	3300025919	Ga0207657_10340085	Ga0207657_103400852	128
1022	3300025924	Ga0207694_10011833	Ga0207694_100118337	128
1023	3300025924	Ga0207694_10117904	Ga0207694_101179042	128
1024	3300025932	Ga0207690_10000013	Ga0207690_1000001336	128
1025	3300025932	Ga0207690_10010596	Ga0207690_100105965	128
1026	3300025932	Ga0207690_10635175	Ga0207690_106351752	128
1027	3300025933	Ga0207706_10045119	Ga0207706_100451192	128
1028	3300025945	Ga0207679_10171740	Ga0207679_101717401	128
1029	3300025945	Ga0207679_10358641	Ga0207679_103586411	128
1030	3300025949	Ga0207667_10000193	Ga0207667_1000019362	128
1031	3300025949	Ga0207667_10000216	Ga0207667_1000021643	128
1032	3300025949	Ga0207667_10000244	Ga0207667_1000024468	128
1033	3300025949	Ga0207667_10016979	Ga0207667_100169798	128
1034	3300025949	Ga0207667_11379101	Ga0207667_113791012	128
1035	3300025981	Ga0207640_10000169	Ga0207640_100001696	128
1036	3300025981	Ga0207640_10003540	Ga0207640_100035404	128
1037	3300025981	Ga0207640_11002768	Ga0207640_110027682	128
1038	3300026035	Ga0207703_10008997	Ga0207703_100089974	128
1039	3300026035	Ga0207703_10438692	Ga0207703_104386922	128
1040	3300026041	Ga0207639_10701887	Ga0207639_107018871	128
1041	3300026067	Ga0207678_10001041	Ga0207678_1000104111	128
1042	3300026067	Ga0207678_10088699	Ga0207678_100886992	128
1043	3300026067	Ga0207678_10125095	Ga0207678_101250951	128
1044	3300026067	Ga0207678_10632409	Ga0207678_106324092	128
1045	3300026116	Ga0207674_10000401	Ga0207674_1000040148	128
1046	3300026116	Ga0207674_10339917	Ga0207674_103399173	128
1047	3300026142	Ga0207698_10441370	Ga0207698_104413702	128
1048	3300027312	Ga0209371_1000065	Ga0209371_100006518	128
1049	3300027312	Ga0209371_1008529	Ga0209371_10085294	128
1050	3300030500	Ga0268256_1000118	Ga0268256_100011818	128
1051	3300030500	Ga0268256_1008906	Ga0268256_10089062	128
1052	3300031548	Ga0307408_100001227	Ga0307408_10000122716	128
1053	3300031903	Ga0307407_11080254	Ga0307407_110802541	128
1054	3300031911	Ga0307412_10000014	Ga0307412_1000001487	128
1055	3300031911	Ga0307412_10039977	Ga0307412_100399772	128
1056	3300031911	Ga0307412_10094850	Ga0307412_100948501	128
1057	3300031911	Ga0307412_10758031	Ga0307412_107580312	128
1058	3300032002	Ga0307416_100107757	Ga0307416_1001077571	128
1059	3300035172	Ga0373955_0666209	Ga0373955_0666209_25_414	128
1060	3300037312	Ga0395899_0075016	Ga0395899_0075016_159_545	128
1061	3300037418	Ga0395900_0343157	Ga0395900_0343157_229_615	128
1062	3300037466	Ga0395898_0160424	Ga0395898_0160424_638_1024	128
1063	3300037466	Ga0395898_0738592	Ga0395898_0738592_405_791	128
1064	3300037471	Ga0395905_0000014	Ga0395905_0000014_127259_127645	128
1065	3300037471	Ga0395905_0266339	Ga0395905_0266339_68_454	128
1066	3300038443	Ga0395901_0002709	Ga0395901_0002709_16823_17209	128
1067	3300039437	Ga0436365_1055985	Ga0436365_1055985_585_971	128
1068	3300039447	Ga0436361_0934247	Ga0436361_0934247_716_1105	128
1069	3300039450	Ga0436363_0012408	Ga0436363_0012408_150_536	128
1070	3300042005	Ga0439448_0014250	Ga0439448_0014250_1578_1970	128
1071	3300044656	Ga0466969_0271271	Ga0466969_0271271_331_717	128
1072	3300044658	Ga0466972_0113803	Ga0466972_0113803_110_496	128
1073	3300044660	Ga0466974_0262635	Ga0466974_0262635_365_763	128
1074	3300044672	Ga0466982_0234877	Ga0466982_0234877_482_868	128
1075	3300044683	Ga0466965_0089249	Ga0466965_0089249_630_1016	128
1076	3300044683	Ga0466965_0887730	Ga0466965_0887730_105_491	128
1077	3300044765	Ga0466970_0050562	Ga0466970_0050562_292_678	128
1078	3300044765	Ga0466970_0277879	Ga0466970_0277879_216_602	128
1079	3300044842	Ga0466957_0379643	Ga0466957_0379643_247_633	128
1080	3300044842	Ga0466957_0425070	Ga0466957_0425070_510_896	128
1081	3300044901	Ga0466960_0557521	Ga0466960_0557521_241_627	128
1082	3300045836	Ga0466958_0475348	Ga0466958_0475348_395_781	128
1083	3300046459	Ga0495629_0006461	Ga0495629_0006461_3491_3877	128
1084	3300046462	Ga0495651_0001538	Ga0495651_0001538_1849_2235	128
1085	3300046471	Ga0495650_0001473	Ga0495650_0001473_16607_16993	128
1086	3300046471	Ga0495650_0045175	Ga0495650_0045175_1051_1437	128
1087	3300046471	Ga0495650_0055575	Ga0495650_0055575_65_451	128
1088	3300046472	Ga0495580_0004206	Ga0495580_0004206_6390_6776	128
1089	3300046473	Ga0495582_0027718	Ga0495582_0027718_18_404	128
1090	3300046474	Ga0495605_0057464	Ga0495605_0057464_808_1194	128
1091	3300046474	Ga0495605_0265361	Ga0495605_0265361_188_574	128
1092	3300046476	Ga0495662_0027421	Ga0495662_0027421_603_989	128
1093	3300046477	Ga0495664_0263228	Ga0495664_0263228_94_480	128
1094	3300046500	Ga0495596_0109787	Ga0495596_0109787_47_433	128
1095	3300046501	Ga0495607_0339655	Ga0495607_0339655_289_675	128
1096	3300046506	Ga0495583_0103621	Ga0495583_0103621_55_441	128
1097	3300046506	Ga0495583_0117453	Ga0495583_0117453_666_1052	128
1098	3300046507	Ga0495606_0026258	Ga0495606_0026258_258_644	128
1099	3300046507	Ga0495606_0029158	Ga0495606_0029158_2718_3104	128
1100	3300046507	Ga0495606_0132469	Ga0495606_0132469_837_1223	128
1101	3300046512	Ga0495610_0058046	Ga0495610_0058046_90_476	128
1102	3300046513	Ga0495616_0128172	Ga0495616_0128172_420_806	128
1103	3300046516	Ga0495628_0049883	Ga0495628_0049883_1696_2082	128
1104	3300046517	Ga0495630_0333633	Ga0495630_0333633_294_680	128
1105	3300046522	Ga0495643_0270804	Ga0495643_0270804_160_546	128
1106	3300046524	Ga0495648_0007814	Ga0495648_0007814_7729_8115	128
1107	3300046526	Ga0495666_0039486	Ga0495666_0039486_218_604	128
1108	3300046526	Ga0495666_0196411	Ga0495666_0196411_54_440	128
1109	3300046528	Ga0495642_0066842	Ga0495642_0066842_640_1026	128
1110	3300046528	Ga0495642_0296354	Ga0495642_0296354_126_512	128
1111	3300046530	Ga0495654_0080579	Ga0495654_0080579_133_519	128
1112	3300046530	Ga0495654_0108199	Ga0495654_0108199_618_1004	128
1113	3300046531	Ga0495665_0062765	Ga0495665_0062765_1381_1767	128
1114	3300046535	Ga0495586_0244763	Ga0495586_0244763_616_1002	128
1115	3300046543	Ga0495645_0000674	Ga0495645_0000674_13888_14274	128
1116	3300046543	Ga0495645_0211289	Ga0495645_0211289_803_1189	128
1117	3300046559	Ga0495667_0198219	Ga0495667_0198219_173_559	128
1118	3300046660	Ga0495625_0375760	Ga0495625_0375760_339_725	128
1119	3300046663	Ga0495635_0101475	Ga0495635_0101475_1092_1478	128
1120	3300046674	Ga0495588_0029294	Ga0495588_0029294_1047_1433	128
1121	3300046680	Ga0495646_0114655	Ga0495646_0114655_609_995	128
1122	3300046684	Ga0495669_0007176	Ga0495669_0007176_3613_3999	128
1123	3300046684	Ga0495669_0098161	Ga0495669_0098161_80_466	128
1124	3300046684	Ga0495669_0369945	Ga0495669_0369945_178_564	128
1125	3300046689	Ga0495613_0369996	Ga0495613_0369996_533_919	128
1126	3300046694	Ga0495649_0006675	Ga0495649_0006675_5946_6332	128
1127	3300046694	Ga0495649_0038152	Ga0495649_0038152_2167_2553	128
1128	3300046694	Ga0495649_0127945	Ga0495649_0127945_807_1193	128
1129	3300046794	Ga0495589_0066429	Ga0495589_0066429_1194_1580	128
1130	3300046809	Ga0495600_0198451	Ga0495600_0198451_435_824	128
1131	3300046810	Ga0495660_0049609	Ga0495660_0049609_21_407	128
1132	3300047315	Ga0495581_0010990	Ga0495581_0010990_3822_4208	128
1133	3300047319	Ga0495674_0014154	Ga0495674_0014154_7024_7410	128
1134	3300047319	Ga0495674_0017879	Ga0495674_0017879_398_784	128
1135	3300047320	Ga0495672_0125699	Ga0495672_0125699_801_1187	128
1136	3300047323	Ga0495683_0018701	Ga0495683_0018701_1962_2348	128
1137	3300047323	Ga0495683_0040005	Ga0495683_0040005_41_427	128
1138	3300047323	Ga0495683_0109288	Ga0495683_0109288_212_598	128
1139	3300047443	Ga0495687_000011	Ga0495687_000011_173131_173517	128
1140	3300047443	Ga0495687_048036	Ga0495687_048036_985_1371	128
1141	3300047443	Ga0495687_103617	Ga0495687_103617_159_545	128
1142	3300047447	Ga0495685_087367	Ga0495685_087367_43_429	128
1143	3300047469	Ga0495673_0051650	Ga0495673_0051650_1232_1618	128
1144	3300047472	Ga0495686_0000014	Ga0495686_0000014_204368_204754	128
1145	3300047673	Ga0495593_0040517	Ga0495593_0040517_139_525	128
1146	3300048091	Ga0495626_0032398	Ga0495626_0032398_1776_2162	128
1147	3300048091	Ga0495626_0039416	Ga0495626_0039416_935_1321	128
1148	3300048091	Ga0495626_0097626	Ga0495626_0097626_643_1029	128
1149	3300048903	Ga0496100_0164901	Ga0496100_0164901_479_865	128
1150	3300048903	Ga0496100_0245917	Ga0496100_0245917_79_465	128
1151	3300048903	Ga0496100_0429982	Ga0496100_0429982_44_430	128
1152	3300048903	Ga0496100_0437045	Ga0496100_0437045_268_654	128
1153	3300048904	Ga0496101_0043008	Ga0496101_0043008_263_649	128
1154	3300048904	Ga0496101_0371552	Ga0496101_0371552_492_878	128
1155	3300048905	Ga0496102_0512078	Ga0496102_0512078_667_1053	128
1156	3300048906	Ga0496103_0044723	Ga0496103_0044723_331_717	128
1157	3300048906	Ga0496103_0199261	Ga0496103_0199261_762_1148	128
1158	3300048907	Ga0496104_0058374	Ga0496104_0058374_1881_2267	128
1159	3300048907	Ga0496104_0081528	Ga0496104_0081528_1981_2367	128
1160	3300048908	Ga0496105_0123792	Ga0496105_0123792_882_1268	128
1161	3300048908	Ga0496105_0144390	Ga0496105_0144390_152_538	128
1162	3300048908	Ga0496105_0191777	Ga0496105_0191777_568_954	128
1163	3300048909	Ga0496106_0297283	Ga0496106_0297283_177_563	128
1164	3300048910	Ga0496107_0407258	Ga0496107_0407258_167_553	128
1165	3300048912	Ga0496109_0819405	Ga0496109_0819405_436_822	128
1166	3300048914	Ga0496111_0665894	Ga0496111_0665894_311_697	128
1167	3300048915	Ga0496112_0276938	Ga0496112_0276938_876_1262	128
1168	3300048915	Ga0496112_0387741	Ga0496112_0387741_277_663	128
1169	3300048916	Ga0496113_0214323	Ga0496113_0214323_1004_1390	128
1170	3300048916	Ga0496113_0262205	Ga0496113_0262205_423_809	128
1171	3300048917	Ga0496114_0077805	Ga0496114_0077805_1097_1483	128
1172	3300048917	Ga0496114_0914807	Ga0496114_0914807_51_437	128
1173	3300048918	Ga0496115_0022784	Ga0496115_0022784_1980_2366	128
1174	3300048918	Ga0496115_0118814	Ga0496115_0118814_80_466	128
1175	3300048919	Ga0496116_0207002	Ga0496116_0207002_413_799	128
1176	3300048919	Ga0496116_0319856	Ga0496116_0319856_179_565	128
1177	3300048919	Ga0496116_0447738	Ga0496116_0447738_57_449	128
1178	3300048919	Ga0496116_0467329	Ga0496116_0467329_82_468	128
1179	3300048920	Ga0496117_0045344	Ga0496117_0045344_2251_2637	128
1180	3300048920	Ga0496117_0068445	Ga0496117_0068445_1996_2382	128
1181	3300048920	Ga0496117_0097632	Ga0496117_0097632_148_534	128
1182	3300048920	Ga0496117_0107717	Ga0496117_0107717_679_1065	128
1183	3300048920	Ga0496117_0138396	Ga0496117_0138396_389_775	128
1184	3300048921	Ga0496118_0001681	Ga0496118_0001681_2028_2414	128
1185	3300048921	Ga0496118_0071617	Ga0496118_0071617_60_446	128
1186	3300048921	Ga0496118_0112037	Ga0496118_0112037_1262_1648	128
1187	3300048921	Ga0496118_0256692	Ga0496118_0256692_314_700	128
1188	3300048921	Ga0496118_0257788	Ga0496118_0257788_242_628	128
1189	3300048921	Ga0496118_0458898	Ga0496118_0458898_60_446	128
1190	3300048922	Ga0496119_0190806	Ga0496119_0190806_393_779	128
1191	3300048923	Ga0496120_0153441	Ga0496120_0153441_702_1088	128
1192	3300048923	Ga0496120_0308619	Ga0496120_0308619_50_442	128
1193	3300048923	Ga0496120_0393717	Ga0496120_0393717_23_409	128
1194	3300048924	Ga0496121_0033483	Ga0496121_0033483_3827_4213	128
1195	3300048924	Ga0496121_0036501	Ga0496121_0036501_839_1231	128
1196	3300048924	Ga0496121_0177903	Ga0496121_0177903_71_457	128
1197	3300048924	Ga0496121_0179663	Ga0496121_0179663_804_1190	128
1198	3300048925	Ga0496122_0178399	Ga0496122_0178399_599_985	128
1199	3300048925	Ga0496122_0195013	Ga0496122_0195013_229_621	128
1200	3300048925	Ga0496122_0422598	Ga0496122_0422598_102_488	128
1201	3300048926	Ga0496123_0117534	Ga0496123_0117534_730_1116	128
1202	3300048927	Ga0496124_0000071	Ga0496124_0000071_219710_220102	128
1203	3300048927	Ga0496124_0000800	Ga0496124_0000800_541_933	128
1204	3300048927	Ga0496124_0056849	Ga0496124_0056849_935_1327	128
1205	3300048927	Ga0496124_0206893	Ga0496124_0206893_1008_1394	128
1206	3300048927	Ga0496124_0355347	Ga0496124_0355347_49_435	128
1207	3300048928	Ga0496125_0000647	Ga0496125_0000647_16818_17210	128
1208	3300048928	Ga0496125_0233672	Ga0496125_0233672_189_575	128
1209	3300048928	Ga0496125_0405771	Ga0496125_0405771_258_644	128
1210	3300048929	Ga0496126_0147862	Ga0496126_0147862_997_1389	128
1211	3300048929	Ga0496126_0715664	Ga0496126_0715664_73_459	128
1212	3300049459	Ga0495678_051886	Ga0495678_051886_1037_1423	128
1213	3300049460	Ga0495682_0039710	Ga0495682_0039710_714_1100	128
1214	3300049571	Ga0501034_0067525	Ga0501034_0067525_1679_2083	128
1215	3300049575	Ga0501039_0191342	Ga0501039_0191342_753_1157	128
1216	3300049853	Ga0501226_005418	Ga0501226_005418_522_959	128
1217	3300050509	nmdc:mga0qj67_606784_c1	nmdc:mga0qj67_606784_c1_203_589	128
1218	3300053097	Ga0500648_403898	Ga0500648_403898_96_485	128
1219	3300053103	Ga0500555_000508	Ga0500555_000508_13416_13802	128
1220	3300053111	Ga0500572_001251	Ga0500572_001251_5843_6232	128
1221	3300053136	Ga0500559_0000434	Ga0500559_0000434_7096_7485	128
1222	3300053136	Ga0500559_0004239	Ga0500559_0004239_4669_5058	128
1223	3300053140	Ga0500573_0016243	Ga0500573_0016243_484_873	128
1224	3300053153	Ga0500616_0000489	Ga0500616_0000489_29920_30306	128
1225	3300053163	Ga0500639_071030	Ga0500639_071030_191_580	128
1226	3300053725	Ga0500576_208024	Ga0500576_208024_105_494	128
1227	3300053730	Ga0500645_000060	Ga0500645_000060_32017_32403	128
1228	3300053735	Ga0500596_000542	Ga0500596_000542_4936_5325	128
1229	3300053736	Ga0500599_003122	Ga0500599_003122_272_658	128
1230	3300061719	Ga0466962_0389493	Ga0466962_0389493_56_442	128
1231	3300003187	JGI25151J46595_10001574	JGI25151J46595_100015745	129
1232	3300003187	JGI25151J46595_10003482	JGI25151J46595_100034822	129
1233	3300003187	JGI25151J46595_10016775	JGI25151J46595_100167752	129
1234	3300003761	Ga0055535_1000253	Ga0055535_100025336	129
1235	3300003762	Ga0055542_1000104	Ga0055542_100010469	129
1236	3300003771	Ga0055526_1008394	Ga0055526_10083945	129
1237	3300003771	Ga0055526_1009634	Ga0055526_10096342	129
1238	3300003771	Ga0055526_1012513	Ga0055526_10125132	129
1239	3300003773	Ga0055537_1001158	Ga0055537_10011582	129
1240	3300003781	Ga0055536_1000112	Ga0055536_10001122	129
1241	3300003784	Ga0055534_1000387	Ga0055534_100038714	129
1242	3300003784	Ga0055534_1003703	Ga0055534_10037034	129
1243	3300005328	Ga0070676_10286582	Ga0070676_102865821	129
1244	3300005333	Ga0070677_10014269	Ga0070677_100142692	129
1245	3300005354	Ga0070675_100178569	Ga0070675_1001785693	129
1246	3300005354	Ga0070675_100324937	Ga0070675_1003249372	129
1247	3300005355	Ga0070671_100651917	Ga0070671_1006519172	129
1248	3300005356	Ga0070674_101444835	Ga0070674_1014448351	129
1249	3300005366	Ga0070659_100562819	Ga0070659_1005628192	129
1250	3300005437	Ga0070710_10526579	Ga0070710_105265791	129
1251	3300005459	Ga0068867_100087601	Ga0068867_1000876012	129
1252	3300005543	Ga0070672_100291100	Ga0070672_1002911001	129
1253	3300005543	Ga0070672_101507153	Ga0070672_1015071531	129
1254	3300006948	Ga0099826_10000026	Ga0099826_1000002639	129
1255	3300009093	Ga0105240_10140282	Ga0105240_101402822	129
1256	3300010375	Ga0105239_11015926	Ga0105239_110159262	129
1257	3300013105	Ga0157369_10061259	Ga0157369_100612593	129
1258	3300014325	Ga0163163_10080314	Ga0163163_100803142	129
1259	3300017792	Ga0163161_11292464	Ga0163161_112924642	129
1260	3300025228	Ga0209672_101638	Ga0209672_1016384	129
1261	3300025242	Ga0209258_100045	Ga0209258_100045153	129
1262	3300025254	Ga0209148_1000052	Ga0209148_1000052153	129
1263	3300025263	Ga0209565_1000232	Ga0209565_100023233	129
1264	3300025272	Ga0209455_1003751	Ga0209455_10037514	129
1265	3300025273	Ga0209673_1046817	Ga0209673_10468172	129
1266	3300025284	Ga0209130_1019192	Ga0209130_10191921	129
1267	3300025291	Ga0209675_1000043	Ga0209675_1000043206	129
1268	3300025291	Ga0209675_1000047	Ga0209675_1000047183	129
1269	3300025292	Ga0209676_1000083	Ga0209676_1000083253	129
1270	3300025294	Ga0209025_1000106	Ga0209025_1000106197	129
1271	3300025294	Ga0209025_1000836	Ga0209025_10008365	129
1272	3300025294	Ga0209025_1000991	Ga0209025_100099114	129
1273	3300025294	Ga0209025_1027180	Ga0209025_10271802	129
1274	3300025295	Ga0209564_1000737	Ga0209564_100073714	129
1275	3300025295	Ga0209564_1001489	Ga0209564_100148923	129
1276	3300025295	Ga0209564_1001501	Ga0209564_100150121	129
1277	3300025297	Ga0209758_1022918	Ga0209758_10229182	129
1278	3300025299	Ga0209256_1000647	Ga0209256_10006472	129
1279	3300025303	Ga0209051_1022070	Ga0209051_10220702	129
1280	3300025893	Ga0207682_10018365	Ga0207682_100183653	129
1281	3300025903	Ga0207680_11033734	Ga0207680_110337341	129
1282	3300025907	Ga0207645_10180473	Ga0207645_101804731	129
1283	3300025920	Ga0207649_10187535	Ga0207649_101875352	129
1284	3300025931	Ga0207644_10185935	Ga0207644_101859352	129
1285	3300025940	Ga0207691_10109516	Ga0207691_101095163	129
1286	3300027666	Ga0209282_1000044	Ga0209282_100004431	129
1287	3300031235	Ga0265330_10505065	Ga0265330_105050651	129
1288	3300031548	Ga0307408_100000051	Ga0307408_100000051126	129
1289	3300031901	Ga0307406_10000386	Ga0307406_1000038611	129
1290	3300037471	Ga0395905_0674899	Ga0395905_0674899_53_445	129
1291	3300039438	Ga0436360_0906320	Ga0436360_0906320_204_593	129
1292	3300039450	Ga0436363_1497794	Ga0436363_1497794_386_775	129
1293	3300041404	Ga0439436_0042654	Ga0439436_0042654_570_962	129
1294	3300046454	Ga0495592_0039688	Ga0495592_0039688_413_802	129
1295	3300046455	Ga0495603_0006686	Ga0495603_0006686_3511_3900	129
1296	3300046455	Ga0495603_0089659	Ga0495603_0089659_701_1093	129
1297	3300046457	Ga0495590_0219165	Ga0495590_0219165_66_458	129
1298	3300046459	Ga0495629_0007741	Ga0495629_0007741_1459_1848	129
1299	3300046459	Ga0495629_0013511	Ga0495629_0013511_5287_5676	129
1300	3300046461	Ga0495641_0035088	Ga0495641_0035088_975_1364	129
1301	3300046461	Ga0495641_0086658	Ga0495641_0086658_353_745	129
1302	3300046463	Ga0495653_0008953	Ga0495653_0008953_6817_7206	129
1303	3300046471	Ga0495650_0005440	Ga0495650_0005440_4866_5255	129
1304	3300046471	Ga0495650_0190224	Ga0495650_0190224_59_448	129
1305	3300046472	Ga0495580_0000620	Ga0495580_0000620_27717_28106	129
1306	3300046472	Ga0495580_0012868	Ga0495580_0012868_734_1126	129
1307	3300046473	Ga0495582_0006415	Ga0495582_0006415_5149_5541	129
1308	3300046473	Ga0495582_0008271	Ga0495582_0008271_1924_2313	129
1309	3300046473	Ga0495582_0632079	Ga0495582_0632079_200_589	129
1310	3300046474	Ga0495605_0011680	Ga0495605_0011680_1786_2178	129
1311	3300046476	Ga0495662_0015928	Ga0495662_0015928_131_520	129
1312	3300046477	Ga0495664_0024866	Ga0495664_0024866_1895_2284	129
1313	3300046499	Ga0495594_0105827	Ga0495594_0105827_973_1362	129
1314	3300046500	Ga0495596_0000808	Ga0495596_0000808_18031_18423	129
1315	3300046512	Ga0495610_0000112	Ga0495610_0000112_94181_94573	129
1316	3300046513	Ga0495616_0010982	Ga0495616_0010982_883_1275	129
1317	3300046514	Ga0495618_0002492	Ga0495618_0002492_11309_11698	129
1318	3300046514	Ga0495618_0059387	Ga0495618_0059387_994_1386	129
1319	3300046516	Ga0495628_0000726	Ga0495628_0000726_28251_28640	129
1320	3300046516	Ga0495628_0326984	Ga0495628_0326984_598_990	129
1321	3300046517	Ga0495630_0002778	Ga0495630_0002778_1926_2315	129
1322	3300046524	Ga0495648_0038001	Ga0495648_0038001_931_1320	129
1323	3300046526	Ga0495666_0000596	Ga0495666_0000596_468_857	129
1324	3300046529	Ga0495652_0048675	Ga0495652_0048675_1475_1864	129
1325	3300046529	Ga0495652_0062151	Ga0495652_0062151_994_1386	129
1326	3300046529	Ga0495652_0994635	Ga0495652_0994635_81_470	129
1327	3300046531	Ga0495665_0003260	Ga0495665_0003260_6817_7206	129
1328	3300046533	Ga0495640_0043144	Ga0495640_0043144_889_1281	129
1329	3300046533	Ga0495640_0051955	Ga0495640_0051955_1457_1846	129
1330	3300046535	Ga0495586_0006068	Ga0495586_0006068_4330_4719	129
1331	3300046536	Ga0495587_0000830	Ga0495587_0000830_18133_18522	129
1332	3300046543	Ga0495645_0001423	Ga0495645_0001423_13821_14210	129
1333	3300046543	Ga0495645_0132963	Ga0495645_0132963_260_652	129
1334	3300046558	Ga0495633_0358627	Ga0495633_0358627_56_454	129
1335	3300046642	Ga0495634_0014465	Ga0495634_0014465_3008_3397	129
1336	3300046648	Ga0495611_0096957	Ga0495611_0096957_224_613	129
1337	3300046663	Ga0495635_0015258	Ga0495635_0015258_4566_4955	129
1338	3300046665	Ga0495661_0004119	Ga0495661_0004119_8822_9211	129
1339	3300046674	Ga0495588_0204469	Ga0495588_0204469_298_687	129
1340	3300046674	Ga0495588_0357121	Ga0495588_0357121_20_412	129
1341	3300046675	Ga0495657_0397310	Ga0495657_0397310_92_481	129
1342	3300046678	Ga0495599_0004883	Ga0495599_0004883_5981_6370	129
1343	3300046679	Ga0495623_0055327	Ga0495623_0055327_28_420	129
1344	3300046679	Ga0495623_0078745	Ga0495623_0078745_667_1056	129
1345	3300046680	Ga0495646_0002843	Ga0495646_0002843_413_802	129
1346	3300046680	Ga0495646_0013120	Ga0495646_0013120_1758_2150	129
1347	3300046684	Ga0495669_0195354	Ga0495669_0195354_59_451	129
1348	3300046689	Ga0495613_0006472	Ga0495613_0006472_2428_2817	129
1349	3300046690	Ga0495624_0050489	Ga0495624_0050489_1578_1967	129
1350	3300046692	Ga0495671_0000937	Ga0495671_0000937_18065_18457	129
1351	3300046692	Ga0495671_0030563	Ga0495671_0030563_596_985	129
1352	3300046694	Ga0495649_0001086	Ga0495649_0001086_19680_20072	129
1353	3300046694	Ga0495649_0084167	Ga0495649_0084167_521_913	129
1354	3300046794	Ga0495589_0146884	Ga0495589_0146884_157_549	129
1355	3300046809	Ga0495600_0029209	Ga0495600_0029209_781_1173	129
1356	3300046809	Ga0495600_0792913	Ga0495600_0792913_24_413	129
1357	3300047315	Ga0495581_0007409	Ga0495581_0007409_4482_4871	129
1358	3300047315	Ga0495581_0024133	Ga0495581_0024133_1309_1701	129
1359	3300047317	Ga0495604_0001047	Ga0495604_0001047_535_924	129
1360	3300047317	Ga0495604_0121478	Ga0495604_0121478_935_1327	129
1361	3300047317	Ga0495604_0377974	Ga0495604_0377974_489_878	129
1362	3300047319	Ga0495674_0041962	Ga0495674_0041962_1928_2317	129
1363	3300047319	Ga0495674_0055620	Ga0495674_0055620_559_948	129
1364	3300047319	Ga0495674_0236327	Ga0495674_0236327_908_1297	129
1365	3300047319	Ga0495674_0765089	Ga0495674_0765089_182_574	129
1366	3300047320	Ga0495672_0118116	Ga0495672_0118116_792_1184	129
1367	3300047321	Ga0495676_0001352	Ga0495676_0001352_987_1376	129
1368	3300047321	Ga0495676_0307523	Ga0495676_0307523_180_572	129
1369	3300047322	Ga0495680_0064775	Ga0495680_0064775_596_985	129
1370	3300047323	Ga0495683_0001210	Ga0495683_0001210_3019_3411	129
1371	3300047323	Ga0495683_0085603	Ga0495683_0085603_559_951	129
1372	3300047443	Ga0495687_024040	Ga0495687_024040_1731_2123	129
1373	3300047444	Ga0495675_0201702	Ga0495675_0201702_266_655	129
1374	3300047446	Ga0495679_001769	Ga0495679_001769_1578_1967	129
1375	3300047446	Ga0495679_014797	Ga0495679_014797_1735_2124	129
1376	3300047469	Ga0495673_0018159	Ga0495673_0018159_1215_1604	129
1377	3300047470	Ga0495681_0045238	Ga0495681_0045238_175_564	129
1378	3300047471	Ga0495684_0120922	Ga0495684_0120922_1392_1781	129
1379	3300047673	Ga0495593_0002328	Ga0495593_0002328_1911_2300	129
1380	3300047673	Ga0495593_0025125	Ga0495593_0025125_653_1045	129
1381	3300048088	Ga0495602_0041708	Ga0495602_0041708_1895_2284	129
1382	3300048088	Ga0495602_0054451	Ga0495602_0054451_1113_1502	129
1383	3300048088	Ga0495602_0128394	Ga0495602_0128394_1612_2001	129
1384	3300048088	Ga0495602_0266376	Ga0495602_0266376_697_1089	129
1385	3300048089	Ga0495614_0010475	Ga0495614_0010475_1805_2194	129
1386	3300048089	Ga0495614_0020723	Ga0495614_0020723_1905_2297	129
1387	3300048091	Ga0495626_0020931	Ga0495626_0020931_2392_2784	129
1388	3300048904	Ga0496101_0454993	Ga0496101_0454993_528_929	129
1389	3300048905	Ga0496102_0459657	Ga0496102_0459657_200_592	129
1390	3300048916	Ga0496113_0474116	Ga0496113_0474116_358_750	129
1391	3300048918	Ga0496115_0627832	Ga0496115_0627832_452_841	129
1392	3300048924	Ga0496121_0041509	Ga0496121_0041509_671_1063	129
1393	3300048926	Ga0496123_0003140	Ga0496123_0003140_481_873	129
1394	3300048929	Ga0496126_0000810	Ga0496126_0000810_52113_52502	129
1395	3300049460	Ga0495682_0047053	Ga0495682_0047053_682_1077	129
1396	3300049571	Ga0501034_0000128	Ga0501034_0000128_111035_111427	129
1397	3300049571	Ga0501034_0127491	Ga0501034_0127491_1363_1758	129
1398	3300050515	nmdc:mga0a205_1323955_c1	nmdc:mga0a205_1323955_c1_144_533	129
1399	3300053083	Ga0495655_0033724	Ga0495655_0033724_354_743	129
1400	iso_pu_bacteria	2857537821	2857538679	129
1401	3300003320	rootH2_10113234	rootH2_101132342	130
1402	3300005262	Ga0065165_1008711	Ga0065165_10087111	130
1403	3300005327	Ga0070658_10052123	Ga0070658_100521232	130
1404	3300005327	Ga0070658_10235775	Ga0070658_102357752	130
1405	3300005331	Ga0070670_100626589	Ga0070670_1006265892	130
1406	3300005339	Ga0070660_100300497	Ga0070660_1003004972	130
1407	3300005339	Ga0070660_100765385	Ga0070660_1007653853	130
1408	3300005344	Ga0070661_100142950	Ga0070661_1001429502	130
1409	3300005355	Ga0070671_100062304	Ga0070671_1000623043	130
1410	3300005366	Ga0070659_101075033	Ga0070659_1010750331	130
1411	3300005434	Ga0070709_10069262	Ga0070709_100692622	130
1412	3300005434	Ga0070709_11213648	Ga0070709_112136481	130
1413	3300005435	Ga0070714_100006441	Ga0070714_1000064418	130
1414	3300005435	Ga0070714_100282295	Ga0070714_1002822952	130
1415	3300005436	Ga0070713_100164587	Ga0070713_1001645872	130
1416	3300005437	Ga0070710_10085810	Ga0070710_100858102	130
1417	3300005439	Ga0070711_100159019	Ga0070711_1001590192	130
1418	3300005455	Ga0070663_100004092	Ga0070663_1000040926	130
1419	3300005455	Ga0070663_100242217	Ga0070663_1002422172	130
1420	3300005456	Ga0070678_100035014	Ga0070678_1000350142	130
1421	3300005456	Ga0070678_100764086	Ga0070678_1007640862	130
1422	3300005468	Ga0070707_100198203	Ga0070707_1001982032	130
1423	3300005530	Ga0070679_100766776	Ga0070679_1007667762	130
1424	3300005535	Ga0070684_100622214	Ga0070684_1006222142	130
1425	3300005548	Ga0070665_100024536	Ga0070665_1000245365	130
1426	3300005548	Ga0070665_100094015	Ga0070665_1000940152	130
1427	3300005563	Ga0068855_100010806	Ga0068855_1000108065	130
1428	3300005563	Ga0068855_100080988	Ga0068855_1000809882	130
1429	3300005563	Ga0068855_100293412	Ga0068855_1002934122	130
1430	3300005614	Ga0068856_100192517	Ga0068856_1001925172	130
1431	3300005842	Ga0068858_100631267	Ga0068858_1006312672	130
1432	3300006028	Ga0070717_10004517	Ga0070717_100045177	130
1433	3300006028	Ga0070717_11051951	Ga0070717_110519511	130
1434	3300006163	Ga0070715_10039351	Ga0070715_100393512	130
1435	3300006173	Ga0070716_100005231	Ga0070716_1000052315	130
1436	3300006175	Ga0070712_100185235	Ga0070712_1001852352	130
1437	3300006358	Ga0068871_100440503	Ga0068871_1004405032	130
1438	3300006358	Ga0068871_100856458	Ga0068871_1008564581	130
1439	3300006914	Ga0075436_100010993	Ga0075436_1000109934	130
1440	3300006946	Ga0079104_1000030	Ga0079104_1000030100	130
1441	3300006946	Ga0079104_1003721	Ga0079104_10037212	130
1442	3300007076	Ga0075435_100004515	Ga0075435_1000045153	130
1443	3300009011	Ga0105251_10001746	Ga0105251_1000174610	130
1444	3300009093	Ga0105240_10016392	Ga0105240_100163926	130
1445	3300009093	Ga0105240_10246079	Ga0105240_102460792	130
1446	3300009174	Ga0105241_10000088	Ga0105241_1000008839	130
1447	3300009174	Ga0105241_11118713	Ga0105241_111187131	130
1448	3300009177	Ga0105248_10000011	Ga0105248_10000011133	130
1449	3300009177	Ga0105248_10739127	Ga0105248_107391272	130
1450	3300009545	Ga0105237_10039666	Ga0105237_100396662	130
1451	3300009551	Ga0105238_10458444	Ga0105238_104584443	130
1452	3300009993	Ga0105028_107357	Ga0105028_1073572	130
1453	3300013100	Ga0157373_10008380	Ga0157373_100083806	130
1454	3300013104	Ga0157370_10012032	Ga0157370_100120329	130
1455	3300013104	Ga0157370_10060612	Ga0157370_100606122	130
1456	3300013104	Ga0157370_11038140	Ga0157370_110381401	130
1457	3300013296	Ga0157374_11074921	Ga0157374_110749212	130
1458	3300013297	Ga0157378_10044747	Ga0157378_100447473	130
1459	3300013307	Ga0157372_10175679	Ga0157372_101756793	130
1460	3300013307	Ga0157372_11545239	Ga0157372_115452391	130
1461	3300014497	Ga0182008_10001163	Ga0182008_100011632	130
1462	3300014969	Ga0157376_10064877	Ga0157376_100648772	130
1463	3300014969	Ga0157376_10161189	Ga0157376_101611892	130
1464	3300021361	Ga0213872_10117962	Ga0213872_101179622	130
1465	3300021361	Ga0213872_10134754	Ga0213872_101347542	130
1466	3300021441	Ga0213871_10030398	Ga0213871_100303982	130
1467	3300025250	Ga0209026_1044308	Ga0209026_10443081	130
1468	3300025297	Ga0209758_1016906	Ga0209758_10169063	130
1469	3300025298	Ga0209050_1002947	Ga0209050_10029478	130
1470	3300025303	Ga0209051_1019382	Ga0209051_10193823	130
1471	3300025735	Ga0207713_1000055	Ga0207713_1000055155	130
1472	3300025904	Ga0207647_10001464	Ga0207647_100014646	130
1473	3300025905	Ga0207685_10077076	Ga0207685_100770762	130
1474	3300025906	Ga0207699_10010709	Ga0207699_100107093	130
1475	3300025906	Ga0207699_10554204	Ga0207699_105542042	130
1476	3300025909	Ga0207705_10040240	Ga0207705_100402402	130
1477	3300025909	Ga0207705_10123599	Ga0207705_101235992	130
1478	3300025911	Ga0207654_10000014	Ga0207654_10000014190	130
1479	3300025913	Ga0207695_10012833	Ga0207695_100128334	130
1480	3300025913	Ga0207695_10712871	Ga0207695_107128712	130
1481	3300025915	Ga0207693_10057366	Ga0207693_100573662	130
1482	3300025915	Ga0207693_10231860	Ga0207693_102318602	130
1483	3300025916	Ga0207663_10627222	Ga0207663_106272222	130
1484	3300025919	Ga0207657_10115148	Ga0207657_101151481	130
1485	3300025921	Ga0207652_10673112	Ga0207652_106731121	130
1486	3300025922	Ga0207646_10197101	Ga0207646_101971012	130
1487	3300025924	Ga0207694_10159434	Ga0207694_101594344	130
1488	3300025925	Ga0207650_10102796	Ga0207650_101027962	130
1489	3300025928	Ga0207700_10098290	Ga0207700_100982902	130
1490	3300025928	Ga0207700_11424897	Ga0207700_114248971	130
1491	3300025929	Ga0207664_10004968	Ga0207664_100049686	130
1492	3300025929	Ga0207664_10282035	Ga0207664_102820352	130
1493	3300025931	Ga0207644_10395533	Ga0207644_103955332	130
1494	3300025931	Ga0207644_10552318	Ga0207644_105523181	130
1495	3300025939	Ga0207665_10000928	Ga0207665_100009285	130
1496	3300025941	Ga0207711_10000028	Ga0207711_1000002838	130
1497	3300025949	Ga0207667_10079025	Ga0207667_100790255	130
1498	3300025949	Ga0207667_10119612	Ga0207667_101196123	130
1499	3300025949	Ga0207667_11153914	Ga0207667_111539142	130
1500	3300026035	Ga0207703_10583366	Ga0207703_105833662	130
1501	3300026067	Ga0207678_10008364	Ga0207678_100083648	130
1502	3300026067	Ga0207678_10062286	Ga0207678_100622862	130
1503	3300026067	Ga0207678_10123892	Ga0207678_101238922	130
1504	3300026067	Ga0207678_10202644	Ga0207678_102026442	130
1505	3300026078	Ga0207702_10286552	Ga0207702_102865522	130
1506	3300026078	Ga0207702_10368282	Ga0207702_103682822	130
1507	3300026078	Ga0207702_11001462	Ga0207702_110014622	130
1508	3300026088	Ga0207641_10282053	Ga0207641_102820532	130
1509	3300026121	Ga0207683_10013134	Ga0207683_100131343	130
1510	3300026121	Ga0207683_10028367	Ga0207683_100283672	130
1511	3300027111	Ga0209281_1000012	Ga0209281_1000012280	130
1512	3300027111	Ga0209281_1000113	Ga0209281_100011331	130
1513	3300027312	Ga0209371_1011829	Ga0209371_10118292	130
1514	3300027312	Ga0209371_1068482	Ga0209371_10684822	130
1515	3300028379	Ga0268266_10031474	Ga0268266_100314742	130
1516	3300030500	Ga0268256_1018767	Ga0268256_10187672	130
1517	3300030500	Ga0268256_1076356	Ga0268256_10763562	130
1518	3300031240	Ga0265320_10241173	Ga0265320_102411732	130
1519	3300031241	Ga0265325_10129903	Ga0265325_101299032	130
1520	3300031242	Ga0265329_10349407	Ga0265329_103494071	130
1521	3300031250	Ga0265331_10106657	Ga0265331_101066572	130
1522	3300031344	Ga0265316_10013170	Ga0265316_100131705	130
1523	3300031711	Ga0265314_10020928	Ga0265314_100209283	130
1524	3300031711	Ga0265314_10033482	Ga0265314_100334823	130
1525	3300035083	Ga0373926_0051463	Ga0373926_0051463_32_424	130
1526	3300035089	Ga0373944_0378365	Ga0373944_0378365_138_530	130
1527	3300035170	Ga0373943_0169927	Ga0373943_0169927_703_1095	130
1528	3300035692	Ga0373935_0282707	Ga0373935_0282707_182_574	130
1529	3300035695	Ga0373927_0470004	Ga0373927_0470004_428_820	130
1530	3300035725	Ga0373947_0003866	Ga0373947_0003866_3443_3835	130
1531	3300035725	Ga0373947_0007466	Ga0373947_0007466_2855_3247	130
1532	3300037068	Ga0373925_0002934	Ga0373925_0002934_9126_9518	130
1533	3300037068	Ga0373925_0158221	Ga0373925_0158221_683_1075	130
1534	3300039437	Ga0436365_0545029	Ga0436365_0545029_21_413	130
1535	3300039438	Ga0436360_1007276	Ga0436360_1007276_1617_2009	130
1536	3300039447	Ga0436361_0101173	Ga0436361_0101173_1146_1538	130
1537	3300039447	Ga0436361_0105757	Ga0436361_0105757_220_612	130
1538	3300039447	Ga0436361_1155901	Ga0436361_1155901_614_1006	130
1539	3300041411	Ga0439466_0010943	Ga0439466_0010943_1950_2348	130
1540	3300041451	Ga0451791_1690615	Ga0451791_1690615_174_569	130
1541	3300042006	Ga0439432_012835	Ga0439432_012835_2276_2674	130
1542	3300044656	Ga0466969_0081393	Ga0466969_0081393_228_620	130
1543	3300044666	Ga0466977_0000242	Ga0466977_0000242_9051_9443	130
1544	3300044671	Ga0466978_0362829	Ga0466978_0362829_114_506	130
1545	3300044765	Ga0466970_0751032	Ga0466970_0751032_65_457	130
1546	3300046472	Ga0495580_0001306	Ga0495580_0001306_12591_12983	130
1547	3300046473	Ga0495582_0001265	Ga0495582_0001265_9684_10076	130
1548	3300046525	Ga0495663_0066174	Ga0495663_0066174_55_453	130
1549	3300046530	Ga0495654_0000426	Ga0495654_0000426_12014_12412	130
1550	3300046531	Ga0495665_0007760	Ga0495665_0007760_1714_2106	130
1551	3300046533	Ga0495640_0810223	Ga0495640_0810223_33_425	130
1552	3300046543	Ga0495645_0476949	Ga0495645_0476949_220_612	130
1553	3300046683	Ga0495658_0151974	Ga0495658_0151974_852_1244	130
1554	3300047319	Ga0495674_0107675	Ga0495674_0107675_52_444	130
1555	3300047673	Ga0495593_0121631	Ga0495593_0121631_406_798	130
1556	3300048907	Ga0496104_0148980	Ga0496104_0148980_1683_2075	130
1557	3300048907	Ga0496104_1347079	Ga0496104_1347079_123_515	130
1558	3300048917	Ga0496114_0008840	Ga0496114_0008840_4761_5156	130
1559	3300048921	Ga0496118_0189271	Ga0496118_0189271_194_586	130
1560	3300048925	Ga0496122_0000416	Ga0496122_0000416_43747_44142	130
1561	3300048926	Ga0496123_0000104	Ga0496123_0000104_17655_18050	130
1562	3300048927	Ga0496124_0124476	Ga0496124_0124476_495_887	130
1563	3300048929	Ga0496126_0000333	Ga0496126_0000333_38324_38716	130
1564	3300048929	Ga0496126_0009707	Ga0496126_0009707_4836_5228	130
1565	3300048929	Ga0496126_0624171	Ga0496126_0624171_331_726	130
1566	3300049571	Ga0501034_0049517	Ga0501034_0049517_1300_1695	130
1567	3300050491	nmdc:mga00v17_131240_c1	nmdc:mga00v17_131240_c1_965_1387	130
1568	3300050513	nmdc:mga0rr50_38764_c1	nmdc:mga0rr50_38764_c1_1360_1752	130
1569	3300050514	nmdc:mga08x19_9296_c1	nmdc:mga08x19_9296_c1_1674_2066	130
1570	3300053078	Ga0495612_0254955	Ga0495612_0254955_344_736	130
1571	3300053119	Ga0500595_121033	Ga0500595_121033_148_540	130
1572	3300044693	Ga0466961_0162533	Ga0466961_0162533_403_798	131
1573	3300048920	Ga0496117_0002552	Ga0496117_0002552_15400_15822	131
1574	3300048921	Ga0496118_0006477	Ga0496118_0006477_11316_11738	131
1575	3300048929	Ga0496126_0000088	Ga0496126_0000088_106920_107342	131
1576	iso_pu_bacteria	2738541276	2738713717	131
1577	3300039145	Ga0237816_00997	Ga0237816_00997_72_476	132
1578	3300047472	Ga0495686_0000655	Ga0495686_0000655_7001_7408	135
1579	3300009101	Ga0105247_10014970	Ga0105247_100149702	137
1580	3300013307	Ga0157372_10001670	Ga0157372_1000167013	137
1581	3300050494	nmdc:mga06z11_180679_c1	nmdc:mga06z11_180679_c1_717_1163	138
1582	3300005436	Ga0070713_100550770	Ga0070713_1005507702	139
1583	3300005455	Ga0070663_100026899	Ga0070663_1000268993	139
1584	3300009177	Ga0105248_10264111	Ga0105248_102641112	139
1585	3300009545	Ga0105237_10328634	Ga0105237_103286342	139
1586	3300009551	Ga0105238_10776286	Ga0105238_107762862	139
1587	3300013105	Ga0157369_10034999	Ga0157369_100349992	139
1588	3300013296	Ga0157374_10037267	Ga0157374_100372674	139
1589	3300013306	Ga0163162_10132921	Ga0163162_101329212	139
1590	3300013307	Ga0157372_11752394	Ga0157372_117523942	139
1591	3300014325	Ga0163163_10060355	Ga0163163_100603553	139
1592	3300014969	Ga0157376_10016735	Ga0157376_100167355	139
1593	3300048904	Ga0496101_0199042	Ga0496101_0199042_889_1308	139
1594	3300048905	Ga0496102_0015822	Ga0496102_0015822_1340_1768	139
1595	3300048906	Ga0496103_0845585	Ga0496103_0845585_26_454	139
1596	3300048907	Ga0496104_0006716	Ga0496104_0006716_2673_3101	139
1597	3300048908	Ga0496105_0011443	Ga0496105_0011443_5415_5843	139
1598	3300048911	Ga0496108_0011087	Ga0496108_0011087_1978_2406	139
1599	3300048912	Ga0496109_0046494	Ga0496109_0046494_1705_2133	139
1600	3300048913	Ga0496110_0038284	Ga0496110_0038284_2793_3221	139
1601	3300048915	Ga0496112_0032496	Ga0496112_0032496_3722_4150	139
1602	3300048916	Ga0496113_0060953	Ga0496113_0060953_1500_1928	139
1603	3300048918	Ga0496115_0017930	Ga0496115_0017930_3017_3445	139
1604	3300048924	Ga0496121_0318518	Ga0496121_0318518_251_670	139
1605	3300046616	Ga0495668_0202175	Ga0495668_0202175_70_519	140
1606	3300048928	Ga0496125_0510230	Ga0496125_0510230_46_495	140
1607	3300000546	LJNas_1000233	LJNas_10002332	149
1608	3300044694	Ga0466963_0046072	Ga0466963_0046072_2321_2788	149

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

18

127

0.95 Structural Annotation

Top 5 Hits

ID	Description	Score	Start	End
2b33-assembly1.cif.gz_A	crystal structure of a putative endoribonuclease (tm0215) from thermotoga maritima msb8 at 2.30 a resolution	0.9775	38	145
2dyy-assembly3.cif.gz_G	crystal structure of putative translation initiation inhibitor ph0854 from pyrococcus horikoshii	0.9757	38	145
5yu2-assembly1.cif.gz_B	structure of ribonuclease yabj	0.9743	39	144
5y6u-assembly1.cif.gz_C	crystal structure of wild-type yabj protein from bacillus subtilis (natto).	0.9704	38	144
3l7q-assembly2.cif.gz_E	crystal structure of aldr from streptococcus mutans	0.9676	38	144

ID	Description	Score	Start	End	Superfamily
2dyyG00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.9757	38	145	3.30.1330.40
5hp8A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.9669	41	145	3.30.1330.40
6izhH00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.9356	36	147	3.30.1330.40
5hp8A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.9322	41	145	3.30.1330.40
1pf5A00	Alpha Beta;2-Layer Sandwich;60s Ribosomal Protein L30; Chain: A;;RutC-like	0.9242	40	146	3.30.1330.40

ID	Description	Score	Start	End	GO Terms
AF-A0A1W6ZF99-F1-model_v4	Reactive intermediate/imine deaminase	0.9923	21	149	GO:0005829 GO:0019239
AF-A0A0P9VVI6-F1-model_v4	Endoribonuclease L-PSP family protein	0.9867	51	148	GO:0005829 GO:0019239
AF-A0A1S8G281-F1-model_v4	deleted	0.9845	38	144
AF-A0A246PJR4-F1-model_v4	RidA family protein	0.9833	38	144	GO:0005829 GO:0019239
AF-A0A1X9M8B7-F1-model_v4	Enamine/imine deaminase (EC 3.5.4.-)	0.9826	38	144	GO:0005829 GO:0019239

Feature Viewer

pLDDT	pTM	Quality
86.2	0.8	High

Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Download PDB Download HMM

F495036

General Info

Family's Representative Sequence

Samples

Type Distribution

Biome Distribution

Taxonomy

Scaffolds

MSA Aligner

Family Sequences

Functional Annotation

PF01042

Ribonuc_L-PSP

Endoribonuclease L-PSP

18

127

0.95

Structural Annotation

Top 5 Hits

Feature Viewer

Predicted Structure (AlphaFold2)

Skylign Viewer

Map