F494962

General Info

Members Datasets Scaffolds Average Seq Length
1595 460 3190 156

Family's Representative Sequence

Representative Sequence 3300020081|Ga0206354_11410044|Ga0206354_114100441
Length 192
Sequence MSAIMNWIAWFFPIGCPNASRCAAYFTDSSTQPCASPTASAEIAIRPVDADPVYSSRLVSQLINRVMLDGKRSTAEKIVYGALDRVGQKTGKPPVDVLEQAVKSVTPVLEVRSRRVGGANYQVPVEVPQRRARTLAVRWLVTFSRQRREKEMHEKLAAEILDASNQQGGAYKKKDDIYRMAQANKAFAHYRW

Samples

Sample ID Description Type Environment
1 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
2 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
7 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
38 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
39 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
42 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
43 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
44 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
45 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
46 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
47 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
48 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
49 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
50 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
51 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
82 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
83 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
84 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
90 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
93 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
94 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
95 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
96 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
97 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
98 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
101 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
102 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
103 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
105 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
106 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
108 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
109 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
110 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
111 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
112 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
113 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
114 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
115 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
116 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
117 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
118 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
121 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
122 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
123 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
124 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
125 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
126 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
127 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
128 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
129 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
130 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
131 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
132 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
140 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
141 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300025227 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
209 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
213 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
214 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
215 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
216 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
217 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
218 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
219 3300029957 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG Metagenome Rhizosphere
220 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
223 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
224 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
225 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
226 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
227 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
228 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
229 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
230 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
231 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
232 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
233 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
234 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
235 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
236 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
237 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
238 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
239 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
240 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
241 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
242 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
243 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
244 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
245 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
246 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
247 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
248 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
249 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
250 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
251 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
252 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
254 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
255 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
256 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
257 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
258 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
259 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
260 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
261 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
262 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
263 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
264 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
265 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
266 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
267 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
268 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
269 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
270 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
271 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
272 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
273 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
274 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
275 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
276 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
277 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
278 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
279 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
280 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
281 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
282 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
283 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
284 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
285 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
286 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
287 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
288 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
289 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
290 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
291 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
292 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
293 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
294 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
295 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
296 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
297 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
298 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
299 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
300 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
303 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
304 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
305 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
306 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
307 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
308 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
309 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
310 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
311 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
312 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
313 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
314 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
315 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
316 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
317 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
318 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
319 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
320 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
321 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
322 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
323 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
324 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
325 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
330 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
331 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
334 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
335 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
336 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
337 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
338 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
339 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
340 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
341 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
342 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
343 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
344 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
345 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
346 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
347 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
348 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
349 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
350 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
351 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
352 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
353 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
354 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
355 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
356 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
357 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
358 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
359 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
360 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
361 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
362 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
363 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
364 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
365 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
366 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
367 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
368 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
369 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
370 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
371 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
372 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
373 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
374 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
375 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
376 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
377 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
378 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
379 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
380 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
381 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
382 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
383 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
384 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
385 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
386 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
387 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
388 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
389 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
390 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
391 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
392 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
393 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
394 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
395 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
396 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
397 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
398 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
399 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
400 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
401 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
406 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
407 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
409 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
410 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
411 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
414 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
415 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
416 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
417 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
418 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
419 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
420 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
421 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
422 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
423 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
424 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
425 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
426 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
427 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
428 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
429 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
430 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
431 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
432 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
433 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
434 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
435 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
436 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
437 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
438 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
439 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
440 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
441 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
442 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
443 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
444 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
445 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
446 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
447 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
448 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
449 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
450 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
451 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
452 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
453 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
454 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
455 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
456 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
457 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
458 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
459 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
460 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99
Metatranscriptomes 1
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.75
Nodule 0
Rhizoplane 11.22
Rhizosphere 87.65
Stem 0
Stem Tuber 0
Unclassified 0.19

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0206354_11410044 3300020081 Bacteria 761
2 JGI24750J21931_1007751 3300002070 Bacteria 1355
3 JGI24745J21846_1022792 3300002073 Unclassified 740
4 JGI24749J21850_1008744 3300002076 Bacteria 1413
5 JGI24744J21845_10055980 3300002077 Unclassified 724
6 JGI24742J22300_10043870 3300002244 Unclassified 800
7 Ga0058863_10051448 3300004799 Bacteria 1470
8 Ga0070658_10012196 3300005327 Bacteria 6898
9 Ga0070658_10040720 3300005327 Bacteria 3748
10 Ga0070658_10087565 3300005327 Bacteria 2563
11 Ga0070658_10288287 3300005327 Bacteria 1399
12 Ga0070676_10026558 3300005328 Bacteria 3279
13 Ga0070683_100009431 3300005329 Bacteria 8347
14 Ga0070683_100562461 3300005329 Bacteria 1090
15 Ga0070690_100020038 3300005330 Bacteria 4071
16 Ga0070670_100124734 3300005331 Bacteria 2223
17 Ga0070670_101389383 3300005331 Bacteria 644
18 Ga0068869_101021318 3300005334 Bacteria 721
19 Ga0070666_10208582 3300005335 Bacteria 1376
20 Ga0070680_100129344 3300005336 Bacteria 2111
21 Ga0070680_100159764 3300005336 Bacteria 1893
22 Ga0070680_100403331 3300005336 Bacteria 1165
23 Ga0070680_100447146 3300005336 Bacteria 1103
24 Ga0070680_100522193 3300005336 Bacteria 1016
25 Ga0070682_100004124 3300005337 Bacteria 8062
26 Ga0070682_100122111 3300005337 Bacteria 1751
27 Ga0070682_100146514 3300005337 Bacteria 1615
28 Ga0070682_100241243 3300005337 Bacteria 1297
29 Ga0070682_100247756 3300005337 Bacteria 1283
30 Ga0068868_100147177 3300005338 Bacteria 1937
31 Ga0068868_100167952 3300005338 Bacteria 1815
32 Ga0068868_100298164 3300005338 Bacteria 1368
33 Ga0068868_100345334 3300005338 Bacteria 1273
34 Ga0068868_100539533 3300005338 Bacteria 1026
35 Ga0070660_100030791 3300005339 Bacteria 4026
36 Ga0070660_100089485 3300005339 Bacteria 2425
37 Ga0070660_100185845 3300005339 Bacteria 1682
38 Ga0070660_100304781 3300005339 Bacteria 1306
39 Ga0070660_100457234 3300005339 Bacteria 1060
40 Ga0070660_101022145 3300005339 Bacteria 699
41 Ga0070689_100019147 3300005340 Bacteria 5057
42 Ga0070689_100024547 3300005340 Bacteria 4523
43 Ga0070689_100469387 3300005340 Bacteria 1073
44 Ga0070691_10319457 3300005341 Bacteria 854
45 Ga0070687_100129359 3300005343 Bacteria 1456
46 Ga0070661_100741583 3300005344 Bacteria 802
47 Ga0070661_101085076 3300005344 Bacteria 667
48 Ga0070692_10026768 3300005345 Bacteria 2853
49 Ga0070692_10091713 3300005345 Bacteria 1653
50 Ga0070692_10697900 3300005345 Bacteria 683
51 Ga0070668_100082401 3300005347 Bacteria 2523
52 Ga0070668_100091956 3300005347 Bacteria 2392
53 Ga0070668_100400625 3300005347 Bacteria 1172
54 Ga0070669_100064711 3300005353 Bacteria 2693
55 Ga0070675_100324428 3300005354 Bacteria 1361
56 Ga0070675_100339337 3300005354 Bacteria 1331
57 Ga0070671_100042707 3300005355 Bacteria 3769
58 Ga0070671_100163329 3300005355 Bacteria 1882
59 Ga0070671_100164883 3300005355 Bacteria 1873
60 Ga0070671_100299707 3300005355 Bacteria 1369
61 Ga0070674_100034154 3300005356 Bacteria 3394
62 Ga0070674_100420232 3300005356 Bacteria 1097
63 Ga0070674_100805184 3300005356 Bacteria 812
64 Ga0070673_101009776 3300005364 Bacteria 775
65 Ga0070673_101061773 3300005364 Bacteria 756
66 Ga0070688_100021514 3300005365 Bacteria 3768
67 Ga0070688_100132110 3300005365 Bacteria 1686
68 Ga0070688_100504006 3300005365 Bacteria 913
69 Ga0070688_100533792 3300005365 Bacteria 890
70 Ga0070688_100763351 3300005365 Bacteria 754
71 Ga0070659_100048560 3300005366 Bacteria 3334
72 Ga0070659_100093044 3300005366 Bacteria 2419
73 Ga0070659_100149681 3300005366 Bacteria 1903
74 Ga0070659_100212804 3300005366 Bacteria 1593
75 Ga0070659_101223843 3300005366 Bacteria 664
76 Ga0070667_100290632 3300005367 Bacteria 1470
77 Ga0070667_101029486 3300005367 Bacteria 769
78 Ga0070709_10268498 3300005434 Bacteria 1235
79 Ga0070709_10301985 3300005434 Bacteria 1169
80 Ga0070709_11217407 3300005434 Bacteria 605
81 Ga0070714_100016722 3300005435 Bacteria 5931
82 Ga0070714_100035324 3300005435 Bacteria 4189
83 Ga0070714_100061187 3300005435 Bacteria 3233
84 Ga0070714_100130737 3300005435 Bacteria 2243
85 Ga0070714_100501441 3300005435 Bacteria 1158
86 Ga0070714_100525679 3300005435 Bacteria 1130
87 Ga0070714_100993743 3300005435 Bacteria 816
88 Ga0070714_101047255 3300005435 Bacteria 794
89 Ga0070714_101243807 3300005435 Bacteria 726
90 Ga0070714_101405067 3300005435 Bacteria 681
91 Ga0070713_100043779 3300005436 Bacteria 3662
92 Ga0070713_100297409 3300005436 Bacteria 1485
93 Ga0070713_100861019 3300005436 Bacteria 870
94 Ga0070713_100907466 3300005436 Bacteria 847
95 Ga0070713_100909427 3300005436 Bacteria 847
96 Ga0070713_100913959 3300005436 Bacteria 844
97 Ga0070710_10005272 3300005437 Bacteria 6129
98 Ga0070710_10015456 3300005437 Bacteria 3865
99 Ga0070710_10383119 3300005437 Bacteria 938
100 Ga0070710_10615351 3300005437 Bacteria 757
101 Ga0070701_10002177 3300005438 Bacteria 7466
102 Ga0070701_10013227 3300005438 Bacteria 3748
103 Ga0070701_10134758 3300005438 Bacteria 1406
104 Ga0070701_10338970 3300005438 Bacteria 936
105 Ga0070701_10394283 3300005438 Bacteria 875
106 Ga0070711_100004345 3300005439 Bacteria 8347
107 Ga0070711_100007994 3300005439 Bacteria 6455
108 Ga0070711_100063227 3300005439 Bacteria 2582
109 Ga0070711_100405473 3300005439 Bacteria 1107
110 Ga0070705_100050664 3300005440 Bacteria 2417
111 Ga0070705_100053354 3300005440 Bacteria 2366
112 Ga0070705_100424647 3300005440 Bacteria 991
113 Ga0070705_100710338 3300005440 Bacteria 791
114 Ga0070705_100743779 3300005440 Bacteria 774
115 Ga0070700_100052619 3300005441 Bacteria 2539
116 Ga0070700_101085790 3300005441 Bacteria 662
117 Ga0070694_101140385 3300005444 Bacteria 651
118 Ga0070708_100120562 3300005445 Bacteria 2419
119 Ga0070708_100130291 3300005445 Bacteria 2327
120 Ga0070708_100512401 3300005445 Bacteria 1132
121 Ga0070663_100097993 3300005455 Bacteria 2183
122 Ga0070663_100559814 3300005455 Bacteria 957
123 Ga0070663_100781193 3300005455 Bacteria 818
124 Ga0070678_100007082 3300005456 Bacteria 6631
125 Ga0070678_100026391 3300005456 Bacteria 3926
126 Ga0070678_100041054 3300005456 Bacteria 3277
127 Ga0070678_100140695 3300005456 Bacteria 1931
128 Ga0070678_100174608 3300005456 Bacteria 1753
129 Ga0070678_101008228 3300005456 Bacteria 765
130 Ga0070662_100400493 3300005457 Bacteria 1133
131 Ga0070681_10015901 3300005458 Bacteria 7502
132 Ga0070681_10180313 3300005458 Bacteria 2033
133 Ga0070681_10242111 3300005458 Bacteria 1717
134 Ga0070681_10279107 3300005458 Bacteria 1581
135 Ga0070681_10393115 3300005458 Bacteria 1297
136 Ga0070681_10961260 3300005458 Bacteria 773
137 Ga0068867_100005177 3300005459 Bacteria 9200
138 Ga0068867_100028426 3300005459 Bacteria 4026
139 Ga0068867_100082863 3300005459 Bacteria 2420
140 Ga0070685_10001884 3300005466 Bacteria 10938
141 Ga0070685_10007752 3300005466 Bacteria 5496
142 Ga0070685_10042725 3300005466 Bacteria 2588
143 Ga0070706_100123350 3300005467 Bacteria 2415
144 Ga0070706_100708057 3300005467 Bacteria 934
145 Ga0070707_100001557 3300005468 Bacteria 22299
146 Ga0070707_100033363 3300005468 Bacteria 4909
147 Ga0070707_100163694 3300005468 Bacteria 2168
148 Ga0070707_100417308 3300005468 Bacteria 1302
149 Ga0070707_101100559 3300005468 Bacteria 760
150 Ga0070707_101320915 3300005468 Bacteria 687
151 Ga0070698_100024862 3300005471 Bacteria 6244
152 Ga0070698_100062258 3300005471 Bacteria 3764
153 Ga0070698_100073464 3300005471 Bacteria 3426
154 Ga0070698_100837530 3300005471 Bacteria 864
155 Ga0070698_100974598 3300005471 Bacteria 795
156 Ga0070679_100020719 3300005530 Bacteria 6415
157 Ga0070679_100250004 3300005530 Bacteria 1729
158 Ga0070684_100023316 3300005535 Bacteria 5174
159 Ga0070684_100024998 3300005535 Bacteria 5015
160 Ga0070684_100076862 3300005535 Bacteria 2948
161 Ga0070684_100158664 3300005535 Bacteria 2051
162 Ga0070684_100161559 3300005535 Bacteria 2032
163 Ga0070684_100482407 3300005535 Bacteria 1148
164 Ga0070684_100599006 3300005535 Bacteria 1024
165 Ga0070684_100735482 3300005535 Bacteria 920
166 Ga0070684_101175437 3300005535 Bacteria 721
167 Ga0070697_100106408 3300005536 Bacteria 2333
168 Ga0070697_100390518 3300005536 Bacteria 1206
169 Ga0070697_101408160 3300005536 Bacteria 622
170 Ga0068853_100010960 3300005539 Bacteria 7347
171 Ga0070672_100005416 3300005543 Bacteria 8455
172 Ga0070672_100160201 3300005543 Bacteria 1866
173 Ga0070672_101356177 3300005543 Bacteria 636
174 Ga0070686_100001859 3300005544 Bacteria 11768
175 Ga0070686_100020981 3300005544 Bacteria 3876
176 Ga0070686_100056299 3300005544 Bacteria 2522
177 Ga0070686_100119066 3300005544 Bacteria 1811
178 Ga0070695_100002689 3300005545 Bacteria 10291
179 Ga0070695_100667050 3300005545 Bacteria 822
180 Ga0070695_100853405 3300005545 Bacteria 733
181 Ga0070696_100167693 3300005546 Bacteria 1621
182 Ga0070696_100686087 3300005546 Bacteria 834
183 Ga0070696_100944378 3300005546 Bacteria 717
184 Ga0070693_100004830 3300005547 Bacteria 6426
185 Ga0070693_100110585 3300005547 Bacteria 1689
186 Ga0070693_100555336 3300005547 Bacteria 822
187 Ga0070665_100572070 3300005548 Bacteria 1143
188 Ga0070665_100752407 3300005548 Bacteria 987
189 Ga0070704_100093364 3300005549 Bacteria 2248
190 Ga0070704_100312493 3300005549 Bacteria 1313
191 Ga0070704_100494141 3300005549 Bacteria 1061
192 Ga0070704_101594938 3300005549 Bacteria 602
193 Ga0068855_100443891 3300005563 Bacteria 1416
194 Ga0070664_100045258 3300005564 Bacteria 3717
195 Ga0070664_100071090 3300005564 Bacteria 2981
196 Ga0070664_100081626 3300005564 Bacteria 2787
197 Ga0070664_100109052 3300005564 Bacteria 2414
198 Ga0068857_100018953 3300005577 Bacteria 6037
199 Ga0068857_100227757 3300005577 Bacteria 1704
200 Ga0068857_101308443 3300005577 Bacteria 703
201 Ga0068854_100076095 3300005578 Bacteria 2466
202 Ga0068856_100014179 3300005614 Bacteria 7704
203 Ga0068856_100090897 3300005614 Bacteria 3037
204 Ga0068856_100232549 3300005614 Bacteria 1858
205 Ga0068856_100254676 3300005614 Bacteria 1770
206 Ga0068856_100321065 3300005614 Bacteria 1566
207 Ga0068856_100333992 3300005614 Bacteria 1533
208 Ga0068856_100967960 3300005614 Bacteria 869
209 Ga0068856_101003950 3300005614 Bacteria 853
210 Ga0068856_101273756 3300005614 Bacteria 751
211 Ga0068856_101591774 3300005614 Bacteria 666
212 Ga0070702_100202353 3300005615 Bacteria 1315
213 Ga0070702_100448044 3300005615 Bacteria 936
214 Ga0070702_100912627 3300005615 Bacteria 689
215 Ga0070702_101081696 3300005615 Bacteria 640
216 Ga0068852_100047094 3300005616 Bacteria 3676
217 Ga0068852_100327493 3300005616 Bacteria 1489
218 Ga0068852_100426066 3300005616 Bacteria 1309
219 Ga0068852_100929149 3300005616 Bacteria 887
220 Ga0068852_101056432 3300005616 Bacteria 832
221 Ga0068859_100124155 3300005617 Bacteria 2650
222 Ga0068859_100661067 3300005617 Bacteria 1137
223 Ga0068859_100784876 3300005617 Bacteria 1041
224 Ga0068864_100014298 3300005618 Bacteria 6593
225 Ga0068864_100272752 3300005618 Bacteria 1577
226 Ga0068864_101624193 3300005618 Bacteria 651
227 Ga0068866_10008633 3300005718 Bacteria 4303
228 Ga0068866_10069108 3300005718 Bacteria 1860
229 Ga0068866_10195935 3300005718 Bacteria 1204
230 Ga0068866_10388792 3300005718 Bacteria 897
231 Ga0068861_100033707 3300005719 Bacteria 3780
232 Ga0068861_100285167 3300005719 Bacteria 1424
233 Ga0068861_100402038 3300005719 Bacteria 1216
234 Ga0068861_100886782 3300005719 Bacteria 844
235 Ga0068851_10110022 3300005834 Bacteria 1470
236 Ga0068870_10009635 3300005840 Bacteria 4401
237 Ga0068870_10061744 3300005840 Bacteria 2015
238 Ga0068870_10558949 3300005840 Bacteria 772
239 Ga0068863_100222283 3300005841 Bacteria 1820
240 Ga0068863_100255986 3300005841 Bacteria 1692
241 Ga0068863_101340880 3300005841 Bacteria 723
242 Ga0068858_100159638 3300005842 Bacteria 2123
243 Ga0068860_100654188 3300005843 Bacteria 1059
244 Ga0068862_100243339 3300005844 Bacteria 1637
245 Ga0068862_100713063 3300005844 Bacteria 973
246 Ga0068862_101302548 3300005844 Bacteria 728
247 Ga0081455_10064511 3300005937 Bacteria 3066
248 Ga0081455_10065549 3300005937 Bacteria 3037
249 Ga0081455_10067811 3300005937 Bacteria 2972
250 Ga0081455_10194627 3300005937 Bacteria 1524
251 Ga0081455_10354823 3300005937 Bacteria 1033
252 Ga0081538_10000037 3300005981 Bacteria 119828
253 Ga0081538_10013229 3300005981 Bacteria 6547
254 Ga0081538_10014684 3300005981 Bacteria 6115
255 Ga0081538_10015351 3300005981 Bacteria 5935
256 Ga0081538_10039195 3300005981 Bacteria 3043
257 Ga0081538_10069095 3300005981 Bacteria 1959
258 Ga0081538_10209135 3300005981 Bacteria 789
259 Ga0081539_10002193 3300005985 Bacteria 28646
260 Ga0081539_10003843 3300005985 Bacteria 17623
261 Ga0070717_10011659 3300006028 Bacteria 6683
262 Ga0070717_10013934 3300006028 Bacteria 6175
263 Ga0070717_10206338 3300006028 Bacteria 1723
264 Ga0070717_10639725 3300006028 Bacteria 965
265 Ga0070717_10693015 3300006028 Bacteria 925
266 Ga0075365_10100239 3300006038 Bacteria 1982
267 Ga0075365_10808136 3300006038 Bacteria 662
268 Ga0075364_10024709 3300006051 Bacteria 3818
269 Ga0075432_10061606 3300006058 Bacteria 1337
270 Ga0075432_10077826 3300006058 Bacteria 1199
271 Ga0070715_10000565 3300006163 Bacteria 9750
272 Ga0070715_10036740 3300006163 Bacteria 2023
273 Ga0070716_100006022 3300006173 Bacteria 5908
274 Ga0070716_100494948 3300006173 Bacteria 900
275 Ga0070716_100594140 3300006173 Bacteria 832
276 Ga0070716_100621141 3300006173 Bacteria 815
277 Ga0070712_100006000 3300006175 Bacteria 7517
278 Ga0070712_100056555 3300006175 Bacteria 2752
279 Ga0070712_100289256 3300006175 Bacteria 1322
280 Ga0070712_100301307 3300006175 Bacteria 1297
281 Ga0070712_100342824 3300006175 Bacteria 1220
282 Ga0070712_100743780 3300006175 Bacteria 839
283 Ga0070712_100808803 3300006175 Bacteria 804
284 Ga0075362_10022581 3300006177 Bacteria 2653
285 Ga0097621_100204246 3300006237 Bacteria 1717
286 Ga0097621_100223481 3300006237 Bacteria 1641
287 Ga0097621_100422624 3300006237 Bacteria 1196
288 Ga0068871_100059583 3300006358 Bacteria 3111
289 Ga0068871_100065087 3300006358 Bacteria 2985
290 Ga0075428_100515800 3300006844 Bacteria 1278
291 Ga0075428_100871680 3300006844 Bacteria 955
292 Ga0075430_100083598 3300006846 Bacteria 2674
293 Ga0075430_100341714 3300006846 Bacteria 1236
294 Ga0075431_100121575 3300006847 Bacteria 2694
295 Ga0075431_100244476 3300006847 Bacteria 1824
296 Ga0075433_10084447 3300006852 Bacteria 2802
297 Ga0075433_10172648 3300006852 Bacteria 1924
298 Ga0075433_10253630 3300006852 Bacteria 1560
299 Ga0075434_100016435 3300006871 Bacteria 7113
300 Ga0075434_100042438 3300006871 Bacteria 4509
301 Ga0075434_100276485 3300006871 Bacteria 1698
302 Ga0075434_100502303 3300006871 Bacteria 1233
303 Ga0075434_100610494 3300006871 Bacteria 1110
304 Ga0075429_100658216 3300006880 Bacteria 918
305 Ga0068865_100004970 3300006881 Bacteria 8041
306 Ga0068865_100020981 3300006881 Bacteria 4244
307 Ga0068865_100168119 3300006881 Bacteria 1678
308 Ga0068865_100301528 3300006881 Bacteria 1283
309 Ga0068865_100441079 3300006881 Bacteria 1075
310 Ga0068865_100721648 3300006881 Bacteria 853
311 Ga0075436_100303440 3300006914 Bacteria 1145
312 Ga0097620_100124152 3300006931 Bacteria 2650
313 Ga0097620_100661113 3300006931 Bacteria 1137
314 Ga0097620_100784919 3300006931 Bacteria 1041
315 Ga0075435_100113748 3300007076 Bacteria 2252
316 Ga0075435_100420695 3300007076 Bacteria 1151
317 Ga0075435_100459282 3300007076 Bacteria 1098
318 Ga0075435_101204724 3300007076 Bacteria 662
319 Ga0111539_10122024 3300009094 Bacteria 3053
320 Ga0111539_10312375 3300009094 Bacteria 1829
321 Ga0111539_10499400 3300009094 Bacteria 1417
322 Ga0111539_11051258 3300009094 Bacteria 946
323 Ga0111539_11509700 3300009094 Bacteria 779
324 Ga0111539_12848976 3300009094 Bacteria 560
325 Ga0105245_10051119 3300009098 Bacteria 3705
326 Ga0105245_10099555 3300009098 Bacteria 2688
327 Ga0105245_10106484 3300009098 Bacteria 2602
328 Ga0105245_10167293 3300009098 Bacteria 2091
329 Ga0105245_10288254 3300009098 Bacteria 1607
330 Ga0105245_10290160 3300009098 Bacteria 1602
331 Ga0105245_10917566 3300009098 Bacteria 918
332 Ga0105247_10580108 3300009101 Bacteria 829
333 Ga0105247_11297130 3300009101 Bacteria 584
334 Ga0114129_11453704 3300009147 Bacteria 844
335 Ga0114129_11576530 3300009147 Bacteria 805
336 Ga0114129_11590593 3300009147 Bacteria 800
337 Ga0114129_11628620 3300009147 Bacteria 789
338 Ga0105243_10002992 3300009148 Bacteria 13963
339 Ga0105243_10055328 3300009148 Bacteria 3153
340 Ga0105243_10244044 3300009148 Bacteria 1600
341 Ga0105243_10271795 3300009148 Bacteria 1522
342 Ga0105243_10448894 3300009148 Bacteria 1209
343 Ga0105241_10072481 3300009174 Bacteria 2677
344 Ga0105241_10238783 3300009174 Bacteria 1535
345 Ga0105241_10541586 3300009174 Bacteria 1044
346 Ga0105241_11304209 3300009174 Bacteria 692
347 Ga0105242_10148257 3300009176 Bacteria 2043
348 Ga0105242_10167775 3300009176 Bacteria 1927
349 Ga0105242_10197397 3300009176 Bacteria 1785
350 Ga0105242_10362638 3300009176 Bacteria 1342
351 Ga0105242_10369170 3300009176 Bacteria 1330
352 Ga0105242_10644618 3300009176 Bacteria 1029
353 Ga0105242_10941555 3300009176 Bacteria 867
354 Ga0105242_11374169 3300009176 Bacteria 733
355 Ga0105242_12141368 3300009176 Bacteria 604
356 Ga0105248_10015623 3300009177 Bacteria 8368
357 Ga0105248_10745745 3300009177 Bacteria 1105
358 Ga0105248_10958854 3300009177 Bacteria 966
359 Ga0105237_10079496 3300009545 Bacteria 3269
360 Ga0105237_11079763 3300009545 Bacteria 809
361 Ga0105238_10043513 3300009551 Bacteria 4543
362 Ga0105238_11180247 3300009551 Bacteria 790
363 Ga0105238_11301210 3300009551 Bacteria 753
364 Ga0105249_10009884 3300009553 Bacteria 8363
365 Ga0105239_10325172 3300010375 Bacteria 1734
366 Ga0105239_10485652 3300010375 Bacteria 1403
367 Ga0105239_10526113 3300010375 Bacteria 1345
368 Ga0105239_10645658 3300010375 Bacteria 1209
369 Ga0105239_11304203 3300010375 Bacteria 837
370 Ga0105239_12072682 3300010375 Bacteria 661
371 Ga0105246_10515629 3300011119 Bacteria 1018
372 Ga0105246_11415010 3300011119 Bacteria 649
373 Ga0157339_1005165 3300012505 Bacteria 1019
374 Ga0157327_1014400 3300012512 Bacteria 808
375 Ga0157373_10517660 3300013100 Bacteria 863
376 Ga0157371_10884669 3300013102 Bacteria 677
377 Ga0157369_10283256 3300013105 Bacteria 1726
378 Ga0157369_10599746 3300013105 Bacteria 1137
379 Ga0157369_11498414 3300013105 Bacteria 686
380 Ga0157374_10284831 3300013296 Bacteria 1632
381 Ga0157374_10401038 3300013296 Bacteria 1368
382 Ga0157374_11242267 3300013296 Bacteria 767
383 Ga0157378_10217575 3300013297 Bacteria 1814
384 Ga0157378_10260173 3300013297 Bacteria 1664
385 Ga0157378_10406906 3300013297 Bacteria 1342
386 Ga0157378_10410230 3300013297 Bacteria 1337
387 Ga0157378_10869261 3300013297 Bacteria 931
388 Ga0157378_10976970 3300013297 Bacteria 880
389 Ga0157378_11061631 3300013297 Bacteria 846
390 Ga0157378_11607311 3300013297 Bacteria 696
391 Ga0157378_11715565 3300013297 Bacteria 675
392 Ga0163162_10199776 3300013306 Bacteria 2128
393 Ga0163162_11593065 3300013306 Bacteria 745
394 Ga0163162_12189375 3300013306 Bacteria 635
395 Ga0157372_10660788 3300013307 Bacteria 1217
396 Ga0157372_10664777 3300013307 Bacteria 1213
397 Ga0157372_11237211 3300013307 Bacteria 862
398 Ga0157372_11496035 3300013307 Bacteria 778
399 Ga0157375_10161829 3300013308 Bacteria 2380
400 Ga0157375_10198195 3300013308 Bacteria 2163
401 Ga0157375_10289762 3300013308 Bacteria 1800
402 Ga0157375_10419790 3300013308 Bacteria 1504
403 Ga0157375_11273545 3300013308 Bacteria 864
404 Ga0157375_11719422 3300013308 Bacteria 743
405 Ga0163163_10020662 3300014325 Bacteria 6205
406 Ga0163163_10382842 3300014325 Bacteria 1464
407 Ga0157380_10282638 3300014326 Bacteria 1519
408 Ga0157380_10446551 3300014326 Bacteria 1241
409 Ga0157380_11064782 3300014326 Bacteria 846
410 Ga0157380_11270386 3300014326 Bacteria 782
411 Ga0182008_10004665 3300014497 Bacteria 7965
412 Ga0182008_10461642 3300014497 Bacteria 692
413 Ga0182008_10753453 3300014497 Bacteria 561
414 Ga0157377_10031731 3300014745 Bacteria 2873
415 Ga0157377_10086401 3300014745 Bacteria 1843
416 Ga0157377_10382383 3300014745 Bacteria 953
417 Ga0157379_10288838 3300014968 Bacteria 1493
418 Ga0157379_10605430 3300014968 Bacteria 1023
419 Ga0157379_10943188 3300014968 Bacteria 820
420 Ga0157379_11617498 3300014968 Bacteria 633
421 Ga0157376_10011788 3300014969 Bacteria 6459
422 Ga0157376_10104146 3300014969 Bacteria 2486
423 Ga0157376_10566311 3300014969 Bacteria 1126
424 Ga0157376_10677354 3300014969 Bacteria 1034
425 Ga0157376_10815181 3300014969 Bacteria 947
426 Ga0157376_12786349 3300014969 Bacteria 529
427 Ga0182007_10015950 3300015262 Bacteria 2786
428 Ga0163161_10389859 3300017792 Bacteria 1115
429 Ga0197907_10978116 3300020069 Bacteria 1469
430 Ga0197907_11392553 3300020069 Bacteria 605
431 Ga0206356_10239065 3300020070 Bacteria 1739
432 Ga0206356_11088656 3300020070 Bacteria 1551
433 Ga0206349_1037198 3300020075 Bacteria 653
434 Ga0206350_11457104 3300020080 Bacteria 984
435 Ga0206353_10918220 3300020082 Bacteria 1075
436 Ga0206353_12001256 3300020082 Bacteria 1612
437 Ga0213873_10012098 3300021358 Bacteria 1865
438 Ga0213871_10035748 3300021441 Bacteria 1315
439 Ga0224712_10132690 3300022467 Bacteria 1089
440 Ga0207638_1003322 3300025227 Bacteria 638
441 Ga0207697_10037177 3300025315 Bacteria 1994
442 Ga0207692_10147999 3300025898 Bacteria 1342
443 Ga0207692_10209597 3300025898 Bacteria 1150
444 Ga0207692_10342981 3300025898 Bacteria 919
445 Ga0207642_10023441 3300025899 Bacteria 2465
446 Ga0207642_10165774 3300025899 Bacteria 1190
447 Ga0207642_10195677 3300025899 Bacteria 1113
448 Ga0207710_10168886 3300025900 Bacteria 1069
449 Ga0207688_10011759 3300025901 Bacteria 4761
450 Ga0207688_10305088 3300025901 Bacteria 974
451 Ga0207688_10507265 3300025901 Bacteria 756
452 Ga0207680_10590681 3300025903 Bacteria 794
453 Ga0207647_10041881 3300025904 Bacteria 2876
454 Ga0207647_10074362 3300025904 Bacteria 2047
455 Ga0207647_10432742 3300025904 Bacteria 739
456 Ga0207647_10505585 3300025904 Bacteria 673
457 Ga0207685_10039400 3300025905 Bacteria 1754
458 Ga0207685_10039846 3300025905 Bacteria 1747
459 Ga0207699_10002820 3300025906 Bacteria 8226
460 Ga0207699_10156246 3300025906 Bacteria 1514
461 Ga0207699_10420100 3300025906 Bacteria 955
462 Ga0207645_10020975 3300025907 Bacteria 4268
463 Ga0207645_10129652 3300025907 Bacteria 1641
464 Ga0207643_10020891 3300025908 Bacteria 3594
465 Ga0207643_10067194 3300025908 Bacteria 2057
466 Ga0207643_10243672 3300025908 Bacteria 1106
467 Ga0207705_10068235 3300025909 Bacteria 2574
468 Ga0207705_10264986 3300025909 Bacteria 1313
469 Ga0207705_10577404 3300025909 Bacteria 874
470 Ga0207684_10168406 3300025910 Bacteria 1888
471 Ga0207684_10341686 3300025910 Bacteria 1289
472 Ga0207654_10096035 3300025911 Bacteria 1817
473 Ga0207654_10322502 3300025911 Bacteria 1056
474 Ga0207654_10753987 3300025911 Bacteria 701
475 Ga0207707_10003180 3300025912 Bacteria 14576
476 Ga0207707_10017461 3300025912 Bacteria 6256
477 Ga0207707_10068018 3300025912 Bacteria 3103
478 Ga0207707_10091440 3300025912 Bacteria 2659
479 Ga0207707_10241526 3300025912 Bacteria 1570
480 Ga0207707_10295079 3300025912 Bacteria 1402
481 Ga0207707_10909981 3300025912 Bacteria 727
482 Ga0207695_10043176 3300025913 Bacteria 4807
483 Ga0207695_10467872 3300025913 Bacteria 1143
484 Ga0207671_10041645 3300025914 Bacteria 3399
485 Ga0207671_10908210 3300025914 Bacteria 696
486 Ga0207693_10008279 3300025915 Bacteria 8516
487 Ga0207693_10019701 3300025915 Bacteria 5365
488 Ga0207693_10288274 3300025915 Bacteria 1286
489 Ga0207693_10345236 3300025915 Bacteria 1165
490 Ga0207693_10414231 3300025915 Bacteria 1053
491 Ga0207693_10416778 3300025915 Bacteria 1050
492 Ga0207693_10624072 3300025915 Bacteria 838
493 Ga0207693_10849194 3300025915 Bacteria 702
494 Ga0207663_10001658 3300025916 Bacteria 10492
495 Ga0207663_10067383 3300025916 Bacteria 2295
496 Ga0207663_10076870 3300025916 Bacteria 2171
497 Ga0207663_10295750 3300025916 Bacteria 1208
498 Ga0207663_10980466 3300025916 Bacteria 677
499 Ga0207660_10003324 3300025917 Bacteria 10497
500 Ga0207660_10085298 3300025917 Bacteria 2329
501 Ga0207660_10243965 3300025917 Bacteria 1416
502 Ga0207660_10414347 3300025917 Bacteria 1086
503 Ga0207660_10960578 3300025917 Bacteria 697
504 Ga0207662_10251851 3300025918 Bacteria 1159
505 Ga0207662_10316530 3300025918 Bacteria 1041
506 Ga0207662_10522240 3300025918 Bacteria 820
507 Ga0207657_10023955 3300025919 Bacteria 5668
508 Ga0207657_10104313 3300025919 Bacteria 2349
509 Ga0207657_10152933 3300025919 Bacteria 1878
510 Ga0207657_10531940 3300025919 Bacteria 920
511 Ga0207649_10066928 3300025920 Bacteria 2279
512 Ga0207649_10126012 3300025920 Bacteria 1733
513 Ga0207652_10026093 3300025921 Bacteria 4863
514 Ga0207652_10032074 3300025921 Bacteria 4413
515 Ga0207652_10141578 3300025921 Bacteria 2151
516 Ga0207652_10612085 3300025921 Bacteria 976
517 Ga0207646_10000851 3300025922 Bacteria 39515
518 Ga0207646_10006167 3300025922 Bacteria 12463
519 Ga0207646_10350239 3300025922 Bacteria 1334
520 Ga0207646_10470048 3300025922 Bacteria 1134
521 Ga0207646_10873204 3300025922 Bacteria 799
522 Ga0207646_11255629 3300025922 Bacteria 648
523 Ga0207681_10141949 3300025923 Bacteria 1790
524 Ga0207650_10102675 3300025925 Bacteria 2203
525 Ga0207650_10211548 3300025925 Bacteria 1557
526 Ga0207659_10054577 3300025926 Bacteria 2854
527 Ga0207659_10439310 3300025926 Bacteria 1097
528 Ga0207659_10525473 3300025926 Bacteria 1004
529 Ga0207659_10809743 3300025926 Bacteria 805
530 Ga0207659_11222875 3300025926 Bacteria 646
531 Ga0207687_10040067 3300025927 Bacteria 3210
532 Ga0207687_10051517 3300025927 Bacteria 2870
533 Ga0207687_10095470 3300025927 Bacteria 2177
534 Ga0207687_10172632 3300025927 Bacteria 1669
535 Ga0207687_10178037 3300025927 Bacteria 1645
536 Ga0207687_10363650 3300025927 Bacteria 1182
537 Ga0207687_10552335 3300025927 Bacteria 966
538 Ga0207687_10773573 3300025927 Bacteria 818
539 Ga0207687_11343192 3300025927 Bacteria 614
540 Ga0207700_10000001 3300025928 Bacteria 1122509
541 Ga0207700_10026626 3300025928 Bacteria 4035
542 Ga0207700_10038712 3300025928 Bacteria 3463
543 Ga0207700_11080513 3300025928 Bacteria 717
544 Ga0207664_10001406 3300025929 Bacteria 15838
545 Ga0207664_10020871 3300025929 Bacteria 4861
546 Ga0207664_10022997 3300025929 Bacteria 4664
547 Ga0207664_10033965 3300025929 Bacteria 3924
548 Ga0207664_10274078 3300025929 Bacteria 1479
549 Ga0207664_10290865 3300025929 Bacteria 1436
550 Ga0207664_10447145 3300025929 Bacteria 1153
551 Ga0207664_10447901 3300025929 Bacteria 1152
552 Ga0207664_10868463 3300025929 Bacteria 811
553 Ga0207644_10220744 3300025931 Bacteria 1502
554 Ga0207644_10248632 3300025931 Bacteria 1418
555 Ga0207644_10393798 3300025931 Bacteria 1131
556 Ga0207644_10605170 3300025931 Bacteria 910
557 Ga0207690_10185138 3300025932 Bacteria 1571
558 Ga0207690_10387590 3300025932 Bacteria 1112
559 Ga0207690_10434491 3300025932 Bacteria 1052
560 Ga0207690_10845447 3300025932 Bacteria 757
561 Ga0207706_10198818 3300025933 Bacteria 1758
562 Ga0207706_10509487 3300025933 Bacteria 1038
563 Ga0207706_10953555 3300025933 Bacteria 723
564 Ga0207686_10007037 3300025934 Bacteria 6053
565 Ga0207686_10692594 3300025934 Bacteria 809
566 Ga0207686_10863041 3300025934 Bacteria 729
567 Ga0207709_10001060 3300025935 Bacteria 20295
568 Ga0207709_10036357 3300025935 Bacteria 2918
569 Ga0207709_10082444 3300025935 Bacteria 2077
570 Ga0207670_10023173 3300025936 Bacteria 3860
571 Ga0207670_10329651 3300025936 Bacteria 1203
572 Ga0207669_10074154 3300025937 Bacteria 2150
573 Ga0207669_10190376 3300025937 Bacteria 1479
574 Ga0207669_11009560 3300025937 Bacteria 699
575 Ga0207704_10000286 3300025938 Bacteria 23986
576 Ga0207704_10046777 3300025938 Bacteria 2581
577 Ga0207704_10149932 3300025938 Bacteria 1644
578 Ga0207704_10168404 3300025938 Bacteria 1568
579 Ga0207704_10231522 3300025938 Bacteria 1374
580 Ga0207704_10443972 3300025938 Bacteria 1034
581 Ga0207665_10006962 3300025939 Bacteria 7483
582 Ga0207665_10113016 3300025939 Bacteria 1910
583 Ga0207665_10117162 3300025939 Bacteria 1878
584 Ga0207665_10226469 3300025939 Bacteria 1372
585 Ga0207665_10630871 3300025939 Bacteria 839
586 Ga0207691_10011073 3300025940 Bacteria 8655
587 Ga0207691_10049708 3300025940 Bacteria 3842
588 Ga0207711_10021100 3300025941 Bacteria 5441
589 Ga0207711_10063781 3300025941 Bacteria 3181
590 Ga0207711_10812375 3300025941 Bacteria 871
591 Ga0207689_10326490 3300025942 Bacteria 1274
592 Ga0207689_10820087 3300025942 Bacteria 785
593 Ga0207661_10003657 3300025944 Bacteria 10711
594 Ga0207661_10022155 3300025944 Bacteria 4778
595 Ga0207661_10062325 3300025944 Bacteria 3016
596 Ga0207661_10141659 3300025944 Bacteria 2070
597 Ga0207661_10242250 3300025944 Bacteria 1600
598 Ga0207661_10615782 3300025944 Bacteria 997
599 Ga0207661_11751763 3300025944 Bacteria 567
600 Ga0207679_10019995 3300025945 Bacteria 4511
601 Ga0207679_10047938 3300025945 Bacteria 3107
602 Ga0207679_10056211 3300025945 Bacteria 2904
603 Ga0207679_10066082 3300025945 Bacteria 2709
604 Ga0207679_10174390 3300025945 Bacteria 1773
605 Ga0207667_10719049 3300025949 Bacteria 1000
606 Ga0207651_10035870 3300025960 Bacteria 3231
607 Ga0207651_10100525 3300025960 Bacteria 2144
608 Ga0207651_10517320 3300025960 Bacteria 1034
609 Ga0207712_10003169 3300025961 Bacteria 10480
610 Ga0207712_10557806 3300025961 Bacteria 986
611 Ga0207712_10780708 3300025961 Bacteria 839
612 Ga0207712_10782487 3300025961 Bacteria 838
613 Ga0207668_10055925 3300025972 Bacteria 2746
614 Ga0207668_10081936 3300025972 Bacteria 2342
615 Ga0207668_10461127 3300025972 Bacteria 1086
616 Ga0207640_10103531 3300025981 Bacteria 2001
617 Ga0207640_10302855 3300025981 Bacteria 1265
618 Ga0207640_10643411 3300025981 Bacteria 903
619 Ga0207658_10205342 3300025986 Bacteria 1648
620 Ga0207658_10263410 3300025986 Bacteria 1470
621 Ga0207677_10118400 3300026023 Bacteria 1987
622 Ga0207677_10174254 3300026023 Bacteria 1686
623 Ga0207677_10197711 3300026023 Bacteria 1595
624 Ga0207677_10650835 3300026023 Bacteria 930
625 Ga0207677_10703393 3300026023 Bacteria 897
626 Ga0207677_10829953 3300026023 Bacteria 829
627 Ga0207639_10037000 3300026041 Bacteria 3622
628 Ga0207678_10074836 3300026067 Bacteria 2901
629 Ga0207678_10264428 3300026067 Bacteria 1475
630 Ga0207678_10410741 3300026067 Bacteria 1173
631 Ga0207708_10018770 3300026075 Bacteria 5210
632 Ga0207708_10074971 3300026075 Bacteria 2594
633 Ga0207708_10380061 3300026075 Bacteria 1164
634 Ga0207708_10769965 3300026075 Bacteria 827
635 Ga0207708_11112989 3300026075 Bacteria 689
636 Ga0207702_10045933 3300026078 Bacteria 3675
637 Ga0207702_10087132 3300026078 Bacteria 2725
638 Ga0207702_10324033 3300026078 Bacteria 1468
639 Ga0207702_10582704 3300026078 Bacteria 1097
640 Ga0207702_11212359 3300026078 Bacteria 749
641 Ga0207641_10168864 3300026088 Bacteria 1995
642 Ga0207641_10940579 3300026088 Bacteria 859
643 Ga0207648_10011203 3300026089 Bacteria 8454
644 Ga0207648_10041456 3300026089 Bacteria 4042
645 Ga0207648_10124916 3300026089 Bacteria 2263
646 Ga0207648_10152132 3300026089 Bacteria 2042
647 Ga0207676_10295678 3300026095 Bacteria 1476
648 Ga0207676_10568968 3300026095 Bacteria 1085
649 Ga0207676_10601768 3300026095 Bacteria 1056
650 Ga0207674_10039665 3300026116 Bacteria 4881
651 Ga0207674_10305202 3300026116 Bacteria 1541
652 Ga0207674_10798825 3300026116 Bacteria 911
653 Ga0207675_100149812 3300026118 Bacteria 2220
654 Ga0207675_100183839 3300026118 Bacteria 2002
655 Ga0207675_100395333 3300026118 Bacteria 1361
656 Ga0207675_100619731 3300026118 Bacteria 1086
657 Ga0207675_101222279 3300026118 Bacteria 772
658 Ga0207683_10009121 3300026121 Bacteria 8454
659 Ga0207683_10104857 3300026121 Bacteria 2527
660 Ga0207683_10197559 3300026121 Bacteria 1828
661 Ga0207683_10209468 3300026121 Bacteria 1774
662 Ga0207683_10697336 3300026121 Bacteria 941
663 Ga0207683_10812935 3300026121 Bacteria 868
664 Ga0207683_11101104 3300026121 Bacteria 737
665 Ga0207698_10046157 3300026142 Bacteria 3287
666 Ga0207698_10383541 3300026142 Bacteria 1338
667 Ga0207698_11661250 3300026142 Bacteria 654
668 Ga0207698_11720906 3300026142 Bacteria 642
669 Ga0209983_1018103 3300027665 Bacteria 1462
670 Ga0209971_1076288 3300027682 Bacteria 815
671 Ga0207428_10013247 3300027907 Bacteria 7213
672 Ga0207428_10030394 3300027907 Bacteria 4465
673 Ga0207428_10502528 3300027907 Bacteria 880
674 Ga0268266_10069113 3300028379 Bacteria 3060
675 Ga0268266_10509710 3300028379 Bacteria 1149
676 Ga0268266_10629067 3300028379 Bacteria 1032
677 Ga0268265_10222160 3300028380 Bacteria 1654
678 Ga0268265_10441519 3300028380 Bacteria 1213
679 Ga0268265_10937753 3300028380 Bacteria 852
680 Ga0268265_11538312 3300028380 Bacteria 669
681 Ga0268265_12009071 3300028380 Bacteria 585
682 Ga0268264_10332760 3300028381 Bacteria 1440
683 Ga0265337_1054029 3300028556 Bacteria 1124
684 Ga0265319_1001715 3300028563 Bacteria 12639
685 Ga0265319_1002457 3300028563 Bacteria 10113
686 Ga0265319_1017512 3300028563 Bacteria 2722
687 Ga0265319_1024157 3300028563 Bacteria 2191
688 Ga0265334_10003069 3300028573 Bacteria 7626
689 Ga0265318_10002235 3300028577 Bacteria 10435
690 Ga0265318_10005575 3300028577 Bacteria 5900
691 Ga0265323_10065227 3300028653 Bacteria 1256
692 Ga0265323_10131647 3300028653 Bacteria 809
693 Ga0265336_10001246 3300028666 Bacteria 12055
694 Ga0265336_10074058 3300028666 Bacteria 1018
695 Ga0265338_10001634 3300028800 Bacteria 35869
696 Ga0265338_10004752 3300028800 Bacteria 18169
697 Ga0265338_10006529 3300028800 Bacteria 14826
698 Ga0265338_10006962 3300028800 Bacteria 14212
699 Ga0265338_10012182 3300028800 Bacteria 9822
700 Ga0265338_10035857 3300028800 Bacteria 4756
701 Ga0265338_10295283 3300028800 Bacteria 1179
702 Ga0265324_10008952 3300029957 Bacteria 3939
703 Ga0265324_10172657 3300029957 Bacteria 734
704 Ga0265330_10002117 3300031235 Bacteria 10966
705 Ga0265330_10007769 3300031235 Bacteria 5207
706 Ga0265332_10003068 3300031238 Bacteria 8165
707 Ga0265332_10287458 3300031238 Bacteria 679
708 Ga0265328_10009953 3300031239 Bacteria 3845
709 Ga0265320_10011013 3300031240 Bacteria 5345
710 Ga0265320_10045980 3300031240 Bacteria 2142
711 Ga0265320_10120669 3300031240 Bacteria 1195
712 Ga0265320_10182513 3300031240 Bacteria 940
713 Ga0265325_10002707 3300031241 Bacteria 11847
714 Ga0265329_10004301 3300031242 Bacteria 5959
715 Ga0265329_10012733 3300031242 Bacteria 3015
716 Ga0265329_10191763 3300031242 Bacteria 671
717 Ga0265340_10002927 3300031247 Bacteria 9724
718 Ga0265340_10082712 3300031247 Bacteria 1509
719 Ga0265340_10227680 3300031247 Bacteria 834
720 Ga0265339_10007125 3300031249 Bacteria 7259
721 Ga0265339_10016606 3300031249 Bacteria 4383
722 Ga0265339_10208688 3300031249 Bacteria 960
723 Ga0265331_10001137 3300031250 Bacteria 20282
724 Ga0265331_10193784 3300031250 Bacteria 916
725 Ga0265327_10013950 3300031251 Bacteria 5295
726 Ga0265327_10072157 3300031251 Bacteria 1725
727 Ga0265327_10136870 3300031251 Bacteria 1147
728 Ga0265316_10005912 3300031344 Bacteria 11790
729 Ga0265316_10010068 3300031344 Bacteria 8645
730 Ga0265316_10018295 3300031344 Bacteria 6024
731 Ga0265316_10163328 3300031344 Bacteria 1664
732 Ga0265316_10331911 3300031344 Bacteria 1103
733 Ga0307408_100138064 3300031548 Bacteria 1910
734 Ga0307408_100235426 3300031548 Bacteria 1502
735 Ga0265313_10011203 3300031595 Bacteria 5590
736 Ga0265313_10032156 3300031595 Bacteria 2683
737 Ga0265314_10008726 3300031711 Bacteria 8664
738 Ga0265314_10012224 3300031711 Bacteria 7026
739 Ga0265314_10017019 3300031711 Bacteria 5717
740 Ga0265314_10180252 3300031711 Bacteria 1266
741 Ga0265342_10009012 3300031712 Bacteria 7087
742 Ga0265342_10018402 3300031712 Bacteria 4526
743 Ga0265342_10051186 3300031712 Bacteria 2465
744 Ga0307405_10189710 3300031731 Bacteria 1483
745 Ga0307405_10319662 3300031731 Bacteria 1185
746 Ga0307413_10083017 3300031824 Bacteria 2060
747 Ga0307410_10109011 3300031852 Bacteria 2000
748 Ga0307406_10118559 3300031901 Bacteria 1835
749 Ga0307407_10027944 3300031903 Bacteria 3009
750 Ga0307407_10264512 3300031903 Bacteria 1184
751 Ga0307412_10045102 3300031911 Bacteria 2880
752 Ga0307412_11158248 3300031911 Bacteria 691
753 Ga0307409_100202921 3300031995 Bacteria 1775
754 Ga0307409_100503331 3300031995 Bacteria 1180
755 Ga0307416_100076773 3300032002 Bacteria 2802
756 Ga0307416_100127477 3300032002 Bacteria 2282
757 Ga0307414_10016323 3300032004 Bacteria 4512
758 Ga0307411_10014197 3300032005 Bacteria 4425
759 Ga0307411_10235027 3300032005 Bacteria 1431
760 Ga0307415_100104630 3300032126 Bacteria 2085
761 Ga0373926_0131172 3300035083 Bacteria 949
762 Ga0373926_0178304 3300035083 Bacteria 814
763 Ga0373928_0141958 3300035084 Bacteria 659
764 Ga0373928_0206433 3300035084 Bacteria 569
765 Ga0373934_0153330 3300035086 Bacteria 944
766 Ga0373944_0038235 3300035089 Bacteria 1473
767 Ga0373923_0004775 3300035111 Bacteria 4533
768 Ga0373923_0203504 3300035111 Bacteria 916
769 Ga0373923_0342261 3300035111 Bacteria 713
770 Ga0373932_0069873 3300035112 Bacteria 1087
771 Ga0373932_0240562 3300035112 Bacteria 657
772 Ga0373936_0135879 3300035113 Bacteria 1059
773 Ga0373941_0127722 3300035115 Bacteria 913
774 Ga0373941_0271081 3300035115 Bacteria 669
775 Ga0373945_0046039 3300035116 Bacteria 1590
776 Ga0373945_0048762 3300035116 Bacteria 1552
777 Ga0373954_0120172 3300035118 Bacteria 1275
778 Ga0373956_0047636 3300035119 Bacteria 1918
779 Ga0373956_0201944 3300035119 Bacteria 942
780 Ga0373957_0053871 3300035120 Bacteria 1544
781 Ga0373960_0061905 3300035121 Bacteria 1138
782 Ga0373960_0212208 3300035121 Bacteria 689
783 Ga0373943_0001856 3300035170 Bacteria 9548
784 Ga0373943_0017801 3300035170 Bacteria 3255
785 Ga0373943_0325241 3300035170 Bacteria 877
786 Ga0373946_0403741 3300035171 Bacteria 690
787 Ga0373955_0288351 3300035172 Bacteria 988
788 Ga0373955_0329151 3300035172 Bacteria 923
789 Ga0373942_0358248 3300035207 Bacteria 517
790 Ga0373962_0100731 3300035242 Bacteria 901
791 Ga0373924_0067174 3300035410 Bacteria 1508
792 Ga0373924_0149373 3300035410 Bacteria 1022
793 Ga0373931_0040708 3300035691 Bacteria 2439
794 Ga0373931_0241595 3300035691 Bacteria 1095
795 Ga0373931_0382374 3300035691 Bacteria 888
796 Ga0373931_0685960 3300035691 Bacteria 675
797 Ga0373931_0798042 3300035691 Bacteria 629
798 Ga0373935_0053852 3300035692 Bacteria 2560
799 Ga0373935_0102216 3300035692 Bacteria 1891
800 Ga0373935_0150025 3300035692 Bacteria 1581
801 Ga0373935_0246897 3300035692 Bacteria 1248
802 Ga0373935_0690550 3300035692 Bacteria 750
803 Ga0373927_0108261 3300035695 Bacteria 1810
804 Ga0373933_0048328 3300035724 Bacteria 2533
805 Ga0373933_0207289 3300035724 Bacteria 1255
806 Ga0373933_0213579 3300035724 Bacteria 1236
807 Ga0373933_0507228 3300035724 Bacteria 790
808 Ga0373947_0000695 3300035725 Bacteria 20048
809 Ga0373947_0006392 3300035725 Bacteria 6847
810 Ga0373947_0246830 3300035725 Bacteria 1179
811 Ga0373947_0363030 3300035725 Bacteria 973
812 Ga0373937_0001944 3300036401 Bacteria 17289
813 Ga0373937_0017853 3300036401 Bacteria 6330
814 Ga0373937_0037507 3300036401 Bacteria 4417
815 Ga0373937_0125976 3300036401 Bacteria 2389
816 Ga0373937_1387833 3300036401 Bacteria 650
817 Ga0316582_0250654 3300036647 Bacteria 1213
818 Ga0373925_0004944 3300037068 Bacteria 10016
819 Ga0373925_0243960 3300037068 Bacteria 1439
820 Ga0373925_0650794 3300037068 Bacteria 868
821 Ga0373925_0858440 3300037068 Bacteria 748
822 Ga0373925_1271220 3300037068 Bacteria 604
823 Ga0395899_0026847 3300037312 Bacteria 4344
824 Ga0395899_0027964 3300037312 Bacteria 4247
825 Ga0395899_0033987 3300037312 Bacteria 3828
826 Ga0395899_0051296 3300037312 Bacteria 3062
827 Ga0395899_0066928 3300037312 Bacteria 2637
828 Ga0395899_0079485 3300037312 Bacteria 2388
829 Ga0395899_0271370 3300037312 Bacteria 1157
830 Ga0395899_0576025 3300037312 Bacteria 720
831 Ga0395900_0003484 3300037418 Bacteria 16983
832 Ga0395900_0005403 3300037418 Bacteria 13384
833 Ga0395900_0008039 3300037418 Bacteria 10858
834 Ga0395900_0013982 3300037418 Bacteria 8192
835 Ga0395900_0020785 3300037418 Bacteria 6710
836 Ga0395900_0032892 3300037418 Bacteria 5335
837 Ga0395900_0055275 3300037418 Bacteria 4088
838 Ga0395900_0092866 3300037418 Bacteria 3100
839 Ga0395900_0260483 3300037418 Bacteria 1732
840 Ga0395900_0476283 3300037418 Bacteria 1201
841 Ga0395900_0632917 3300037418 Bacteria 1008
842 Ga0395898_0005726 3300037466 Bacteria 13385
843 Ga0395898_0006566 3300037466 Bacteria 12409
844 Ga0395898_0008907 3300037466 Bacteria 10572
845 Ga0395898_0015727 3300037466 Bacteria 7753
846 Ga0395898_0030358 3300037466 Bacteria 5409
847 Ga0395898_0100928 3300037466 Bacteria 2771
848 Ga0395898_0165459 3300037466 Bacteria 2115
849 Ga0395898_0346098 3300037466 Bacteria 1417
850 Ga0395898_0465826 3300037466 Bacteria 1203
851 Ga0395898_0532919 3300037466 Bacteria 1116
852 Ga0395898_0938964 3300037466 Bacteria 802
853 Ga0395898_1409829 3300037466 Bacteria 624
854 Ga0395898_1529062 3300037466 Bacteria 593
855 Ga0395905_0002297 3300037471 Bacteria 21445
856 Ga0395905_0002950 3300037471 Bacteria 18479
857 Ga0395905_0020250 3300037471 Bacteria 6302
858 Ga0395905_0024606 3300037471 Bacteria 5681
859 Ga0395905_0065936 3300037471 Bacteria 3390
860 Ga0395905_0067751 3300037471 Bacteria 3343
861 Ga0395905_0117805 3300037471 Bacteria 2496
862 Ga0395905_0118322 3300037471 Bacteria 2490
863 Ga0395905_0143538 3300037471 Bacteria 2246
864 Ga0395905_1085993 3300037471 Bacteria 703
865 Ga0395905_1121377 3300037471 Bacteria 690
866 Ga0436364_0821737 3300037853 Bacteria 1051
867 Ga0395901_0000608 3300038443 Bacteria 41717
868 Ga0395901_0007743 3300038443 Bacteria 10837
869 Ga0395901_0022332 3300038443 Bacteria 6484
870 Ga0395901_0027614 3300038443 Bacteria 5832
871 Ga0395901_0030522 3300038443 Bacteria 5553
872 Ga0395901_0045595 3300038443 Bacteria 4551
873 Ga0395901_0097478 3300038443 Bacteria 3082
874 Ga0395901_0112528 3300038443 Bacteria 2859
875 Ga0395901_0117176 3300038443 Bacteria 2798
876 Ga0395901_0277699 3300038443 Bacteria 1741
877 Ga0395901_0284901 3300038443 Bacteria 1716
878 Ga0395901_0313804 3300038443 Bacteria 1623
879 Ga0395901_0665864 3300038443 Bacteria 1042
880 Ga0395901_0813527 3300038443 Bacteria 922
881 Ga0395901_0860493 3300038443 Bacteria 891
882 Ga0395901_0970755 3300038443 Bacteria 827
883 Ga0395901_1359367 3300038443 Bacteria 670
884 Ga0436365_0656028 3300039437 Bacteria 813
885 Ga0436360_0776362 3300039438 Bacteria 4441
886 Ga0436363_0952217 3300039450 Bacteria 851
887 Ga0436362_0380053 3300039453 Bacteria 1160
888 Ga0436362_1147745 3300039453 Bacteria 3284
889 Ga0439465_0094326 3300041413 Bacteria 1027
890 Ga0451807_1368180 3300041486 Bacteria 1154
891 Ga0451833_0863113 3300041491 Bacteria 1030
892 Ga0451839_0797568 3300041496 Bacteria 788
893 Ga0451853_3840200 3300041512 Bacteria 627
894 Ga0439456_026426 3300042013 Bacteria 1235
895 Ga0450920_022902 3300042122 Bacteria 1211
896 Ga0439458_0102334 3300042157 Bacteria 744
897 Ga0439444_0073923 3300042437 Bacteria 735
898 Ga0439460_0092680 3300042461 Bacteria 962
899 Ga0451577_1389975 3300042876 Bacteria 623
900 Ga0466969_0004507 3300044656 Bacteria 7416
901 Ga0466969_0010275 3300044656 Bacteria 4964
902 Ga0466969_0091539 3300044656 Bacteria 1441
903 Ga0466972_0046231 3300044658 Bacteria 2108
904 Ga0466972_0213288 3300044658 Bacteria 903
905 Ga0466972_0223562 3300044658 Bacteria 881
906 Ga0466965_0024494 3300044683 Bacteria 2920
907 Ga0466965_0051753 3300044683 Bacteria 2038
908 Ga0466966_0009082 3300044684 Bacteria 6587
909 Ga0466966_0010536 3300044684 Bacteria 6143
910 Ga0466966_0026245 3300044684 Bacteria 3804
911 Ga0466966_0068631 3300044684 Bacteria 2225
912 Ga0466966_0171730 3300044684 Bacteria 1317
913 Ga0466966_0667460 3300044684 Bacteria 626
914 Ga0466961_0009633 3300044693 Bacteria 6150
915 Ga0466961_0026261 3300044693 Bacteria 3745
916 Ga0466961_0026772 3300044693 Bacteria 3707
917 Ga0466961_0125361 3300044693 Bacteria 1611
918 Ga0466961_0338604 3300044693 Bacteria 916
919 Ga0466961_0457038 3300044693 Bacteria 772
920 Ga0466963_0003701 3300044694 Bacteria 8794
921 Ga0466963_0004189 3300044694 Bacteria 8354
922 Ga0466963_0004471 3300044694 Bacteria 8134
923 Ga0466963_0014876 3300044694 Bacteria 4806
924 Ga0466963_0021567 3300044694 Bacteria 4066
925 Ga0466963_0045882 3300044694 Bacteria 2879
926 Ga0466963_0063742 3300044694 Bacteria 2467
927 Ga0466963_0101421 3300044694 Bacteria 1970
928 Ga0466963_0159350 3300044694 Bacteria 1570
929 Ga0466963_0207834 3300044694 Bacteria 1369
930 Ga0466963_0237225 3300044694 Bacteria 1278
931 Ga0466963_0247612 3300044694 Bacteria 1250
932 Ga0466963_0406939 3300044694 Bacteria 959
933 Ga0466963_0503319 3300044694 Bacteria 855
934 Ga0466963_0553379 3300044694 Bacteria 812
935 Ga0466963_0654516 3300044694 Bacteria 741
936 Ga0466963_0852651 3300044694 Bacteria 642
937 Ga0466964_0013102 3300044706 Bacteria 3143
938 Ga0466964_0110831 3300044706 Bacteria 1223
939 Ga0466964_0156465 3300044706 Bacteria 1061
940 Ga0466964_0196636 3300044706 Bacteria 965
941 Ga0466964_0208338 3300044706 Bacteria 943
942 Ga0466964_0235949 3300044706 Bacteria 895
943 Ga0466964_0274808 3300044706 Bacteria 840
944 Ga0466971_0000811 3300044719 Bacteria 12589
945 Ga0466971_0029937 3300044719 Bacteria 2435
946 Ga0466971_0176300 3300044719 Bacteria 1004
947 Ga0466968_0001383 3300044735 Bacteria 8679
948 Ga0466968_0008580 3300044735 Bacteria 3915
949 Ga0466968_0412375 3300044735 Bacteria 663
950 Ga0466970_0013070 3300044765 Bacteria 4253
951 Ga0466970_0044329 3300044765 Bacteria 2368
952 Ga0466970_0166158 3300044765 Bacteria 1222
953 Ga0466957_0005732 3300044842 Bacteria 6984
954 Ga0466957_0017579 3300044842 Bacteria 4191
955 Ga0466957_0027729 3300044842 Bacteria 3367
956 Ga0466957_0028136 3300044842 Bacteria 3345
957 Ga0466957_0038491 3300044842 Bacteria 2881
958 Ga0466957_0053073 3300044842 Bacteria 2470
959 Ga0466957_0063308 3300044842 Bacteria 2273
960 Ga0466957_0186843 3300044842 Bacteria 1355
961 Ga0466957_0272997 3300044842 Bacteria 1129
962 Ga0466960_0006002 3300044901 Bacteria 4850
963 Ga0466959_0005002 3300045049 Bacteria 8995
964 Ga0466959_0005947 3300045049 Bacteria 8413
965 Ga0466959_0025018 3300045049 Bacteria 4422
966 Ga0466959_0027957 3300045049 Bacteria 4182
967 Ga0466959_0128359 3300045049 Bacteria 1798
968 Ga0466959_0258199 3300045049 Bacteria 1200
969 Ga0466959_0688490 3300045049 Bacteria 685
970 Ga0466958_0004460 3300045836 Bacteria 7391
971 Ga0466958_0012842 3300045836 Bacteria 4753
972 Ga0466958_0021604 3300045836 Bacteria 3763
973 Ga0466958_0036844 3300045836 Bacteria 2929
974 Ga0466958_0054902 3300045836 Bacteria 2416
975 Ga0466958_0078285 3300045836 Bacteria 2031
976 Ga0466958_0100437 3300045836 Bacteria 1798
977 Ga0466958_0239482 3300045836 Bacteria 1159
978 Ga0466958_0366278 3300045836 Bacteria 928
979 Ga0466967_0006451 3300045976 Bacteria 8302
980 Ga0466967_0011148 3300045976 Bacteria 6791
981 Ga0466967_0013513 3300045976 Bacteria 6313
982 Ga0466967_0015715 3300045976 Bacteria 5944
983 Ga0466967_0021669 3300045976 Bacteria 5226
984 Ga0466967_0035150 3300045976 Bacteria 4261
985 Ga0466967_0038721 3300045976 Bacteria 4091
986 Ga0466967_0041751 3300045976 Bacteria 3958
987 Ga0466967_0045124 3300045976 Bacteria 3828
988 Ga0466967_0048763 3300045976 Bacteria 3700
989 Ga0466967_0068371 3300045976 Bacteria 3171
990 Ga0466967_0086049 3300045976 Bacteria 2847
991 Ga0466967_0104259 3300045976 Bacteria 2596
992 Ga0466967_0129685 3300045976 Bacteria 2339
993 Ga0466967_0193253 3300045976 Bacteria 1924
994 Ga0466967_0319700 3300045976 Bacteria 1496
995 Ga0466967_0846890 3300045976 Bacteria 908
996 Ga0466967_1801184 3300045976 Bacteria 609
997 Ga0466967_2050243 3300045976 Bacteria 568
998 Ga0495592_0000082 3300046454 Bacteria 83312
999 Ga0495592_0109231 3300046454 Bacteria 1959
1000 Ga0495592_0226657 3300046454 Bacteria 1246
1001 Ga0495592_0736525 3300046454 Bacteria 590
1002 Ga0495603_0006416 3300046455 Bacteria 7041
1003 Ga0495603_0016906 3300046455 Bacteria 4414
1004 Ga0495603_0019605 3300046455 Bacteria 4094
1005 Ga0495603_0055549 3300046455 Bacteria 2346
1006 Ga0495603_0079401 3300046455 Bacteria 1923
1007 Ga0495603_0184050 3300046455 Bacteria 1208
1008 Ga0495629_0007529 3300046459 Bacteria 8026
1009 Ga0495629_0010957 3300046459 Bacteria 6592
1010 Ga0495629_0025764 3300046459 Bacteria 4180
1011 Ga0495629_0102512 3300046459 Bacteria 1996
1012 Ga0495629_0339656 3300046459 Bacteria 1025
1013 Ga0495629_0455326 3300046459 Bacteria 866
1014 Ga0495629_0459346 3300046459 Bacteria 862
1015 Ga0495629_0547591 3300046459 Bacteria 777
1016 Ga0495629_0928086 3300046459 Bacteria 569
1017 Ga0495638_0582878 3300046460 Bacteria 552
1018 Ga0495641_0032439 3300046461 Bacteria 2486
1019 Ga0495641_0050947 3300046461 Bacteria 1891
1020 Ga0495641_0145703 3300046461 Bacteria 1058
1021 Ga0495641_0200396 3300046461 Bacteria 894
1022 Ga0495651_0000254 3300046462 Bacteria 41379
1023 Ga0495651_0118119 3300046462 Bacteria 1951
1024 Ga0495651_0330441 3300046462 Bacteria 1013
1025 Ga0495653_0033226 3300046463 Bacteria 4088
1026 Ga0495653_0056045 3300046463 Bacteria 3006
1027 Ga0495653_0062040 3300046463 Bacteria 2826
1028 Ga0495653_0331519 3300046463 Bacteria 983
1029 Ga0495580_0015356 3300046472 Bacteria 5777
1030 Ga0495580_0414083 3300046472 Bacteria 907
1031 Ga0495580_0450201 3300046472 Bacteria 864
1032 Ga0495582_0015545 3300046473 Bacteria 4180
1033 Ga0495582_0015963 3300046473 Bacteria 4117
1034 Ga0495582_0023288 3300046473 Bacteria 3388
1035 Ga0495582_0073875 3300046473 Bacteria 1887
1036 Ga0495582_0125969 3300046473 Bacteria 1445
1037 Ga0495582_0294629 3300046473 Bacteria 932
1038 Ga0495582_0411421 3300046473 Bacteria 780
1039 Ga0495582_0549023 3300046473 Bacteria 668
1040 Ga0495605_0016774 3300046474 Bacteria 3958
1041 Ga0495639_0001278 3300046475 Bacteria 11309
1042 Ga0495639_0008210 3300046475 Bacteria 4484
1043 Ga0495639_0133036 3300046475 Bacteria 1192
1044 Ga0495639_0312500 3300046475 Bacteria 785
1045 Ga0495662_0002354 3300046476 Bacteria 9524
1046 Ga0495662_0107155 3300046476 Bacteria 1368
1047 Ga0495664_0037746 3300046477 Bacteria 2851
1048 Ga0495664_0105295 3300046477 Bacteria 1700
1049 Ga0495664_0109398 3300046477 Bacteria 1667
1050 Ga0495664_0250652 3300046477 Bacteria 1071
1051 Ga0495664_0358547 3300046477 Bacteria 878
1052 Ga0495664_0726659 3300046477 Bacteria 586
1053 Ga0495584_0087083 3300046491 Bacteria 1574
1054 Ga0495584_0495897 3300046491 Bacteria 622
1055 Ga0495584_0664631 3300046491 Bacteria 531
1056 Ga0495585_0095394 3300046492 Bacteria 1598
1057 Ga0495594_0024508 3300046499 Bacteria 3241
1058 Ga0495594_0053590 3300046499 Bacteria 2222
1059 Ga0495594_0084112 3300046499 Bacteria 1779
1060 Ga0495594_0609334 3300046499 Bacteria 619
1061 Ga0495596_0022588 3300046500 Bacteria 2561
1062 Ga0495596_0073391 3300046500 Bacteria 1329
1063 Ga0495596_0102679 3300046500 Bacteria 1110
1064 Ga0495596_0106757 3300046500 Bacteria 1088
1065 Ga0495607_0048502 3300046501 Bacteria 2483
1066 Ga0495607_0188969 3300046501 Bacteria 1027
1067 Ga0495607_0333120 3300046501 Bacteria 705
1068 Ga0495608_0004089 3300046511 Bacteria 10464
1069 Ga0495608_0091613 3300046511 Bacteria 1965
1070 Ga0495608_0268406 3300046511 Bacteria 1061
1071 Ga0495608_0271781 3300046511 Bacteria 1053
1072 Ga0495608_0335761 3300046511 Bacteria 932
1073 Ga0495618_0002754 3300046514 Bacteria 11177
1074 Ga0495618_0072183 3300046514 Bacteria 2196
1075 Ga0495618_0127546 3300046514 Bacteria 1628
1076 Ga0495618_0216426 3300046514 Bacteria 1209
1077 Ga0495620_0074733 3300046515 Bacteria 1380
1078 Ga0495628_0005951 3300046516 Bacteria 10673
1079 Ga0495628_0101878 3300046516 Bacteria 2215
1080 Ga0495628_0115368 3300046516 Bacteria 2063
1081 Ga0495628_0124383 3300046516 Bacteria 1976
1082 Ga0495628_0201504 3300046516 Bacteria 1499
1083 Ga0495630_0025613 3300046517 Bacteria 4363
1084 Ga0495630_0048821 3300046517 Bacteria 3167
1085 Ga0495630_0063085 3300046517 Bacteria 2783
1086 Ga0495630_0224548 3300046517 Bacteria 1434
1087 Ga0495630_0346156 3300046517 Bacteria 1137
1088 Ga0495630_0409240 3300046517 Bacteria 1039
1089 Ga0495630_0673763 3300046517 Bacteria 792
1090 Ga0495630_0946211 3300046517 Bacteria 655
1091 Ga0495637_0066058 3300046520 Bacteria 1471
1092 Ga0495637_0144781 3300046520 Bacteria 900
1093 Ga0495644_0002786 3300046523 Bacteria 6926
1094 Ga0495644_0054640 3300046523 Bacteria 1500
1095 Ga0495644_0135363 3300046523 Bacteria 940
1096 Ga0495644_0164875 3300046523 Bacteria 850
1097 Ga0495663_0262423 3300046525 Bacteria 615
1098 Ga0495666_0011435 3300046526 Bacteria 4423
1099 Ga0495666_0014313 3300046526 Bacteria 3952
1100 Ga0495642_0132537 3300046528 Bacteria 1073
1101 Ga0495642_0172573 3300046528 Bacteria 940
1102 Ga0495652_0000144 3300046529 Bacteria 80486
1103 Ga0495652_0028166 3300046529 Bacteria 4947
1104 Ga0495652_0029633 3300046529 Bacteria 4807
1105 Ga0495652_0066760 3300046529 Bacteria 3017
1106 Ga0495652_0260278 3300046529 Bacteria 1281
1107 Ga0495652_0383841 3300046529 Bacteria 998
1108 Ga0495652_0422562 3300046529 Bacteria 939
1109 Ga0495654_0170806 3300046530 Bacteria 948
1110 Ga0495665_0030850 3300046531 Bacteria 2867
1111 Ga0495665_0041398 3300046531 Bacteria 2452
1112 Ga0495640_0034587 3300046533 Bacteria 3582
1113 Ga0495640_0198122 3300046533 Bacteria 1274
1114 Ga0495586_0041582 3300046535 Bacteria 2475
1115 Ga0495586_0093460 3300046535 Bacteria 1663
1116 Ga0495587_0000060 3300046536 Bacteria 93780
1117 Ga0495587_0049059 3300046536 Bacteria 2500
1118 Ga0495587_0068914 3300046536 Bacteria 2060
1119 Ga0495587_0072977 3300046536 Bacteria 1994
1120 Ga0495587_0080158 3300046536 Bacteria 1892
1121 Ga0495587_0092874 3300046536 Bacteria 1742
1122 Ga0495598_0038241 3300046537 Bacteria 1389
1123 Ga0495609_0123311 3300046538 Bacteria 1113
1124 Ga0495609_0249949 3300046538 Bacteria 730
1125 Ga0495645_0000038 3300046543 Bacteria 96124
1126 Ga0495645_0006731 3300046543 Bacteria 7984
1127 Ga0495645_0228928 3300046543 Bacteria 1246
1128 Ga0495645_0399325 3300046543 Bacteria 876
1129 Ga0495622_0115122 3300046557 Bacteria 1230
1130 Ga0495667_0101587 3300046559 Bacteria 1860
1131 Ga0495667_0106308 3300046559 Bacteria 1814
1132 Ga0495667_0138363 3300046559 Bacteria 1569
1133 Ga0495656_0026801 3300046615 Bacteria 2297
1134 Ga0495656_0068571 3300046615 Bacteria 1568
1135 Ga0495656_0110469 3300046615 Bacteria 1285
1136 Ga0495668_0108621 3300046616 Bacteria 1517
1137 Ga0495634_0029831 3300046642 Bacteria 3773
1138 Ga0495634_0047853 3300046642 Bacteria 2880
1139 Ga0495634_0049693 3300046642 Bacteria 2818
1140 Ga0495634_0257353 3300046642 Bacteria 1066
1141 Ga0495634_0315289 3300046642 Bacteria 943
1142 Ga0495634_0683320 3300046642 Bacteria 591
1143 Ga0495611_0039072 3300046648 Bacteria 2112
1144 Ga0495635_0009523 3300046663 Bacteria 6791
1145 Ga0495635_0013153 3300046663 Bacteria 5793
1146 Ga0495635_0041858 3300046663 Bacteria 3164
1147 Ga0495635_0095636 3300046663 Bacteria 2031
1148 Ga0495635_0142819 3300046663 Bacteria 1630
1149 Ga0495635_0327008 3300046663 Bacteria 1025
1150 Ga0495659_0009389 3300046664 Bacteria 3121
1151 Ga0495659_0161914 3300046664 Bacteria 904
1152 Ga0495659_0173365 3300046664 Bacteria 876
1153 Ga0495659_0190402 3300046664 Bacteria 838
1154 Ga0495661_0166056 3300046665 Bacteria 1181
1155 Ga0495588_0183108 3300046674 Bacteria 1107
1156 Ga0495588_0378415 3300046674 Bacteria 743
1157 Ga0495588_0508561 3300046674 Bacteria 631
1158 Ga0495588_0527774 3300046674 Bacteria 619
1159 Ga0495657_0015397 3300046675 Bacteria 5598
1160 Ga0495657_0103474 3300046675 Bacteria 1811
1161 Ga0495657_0345580 3300046675 Bacteria 881
1162 Ga0495657_0538100 3300046675 Bacteria 679
1163 Ga0495599_0000048 3300046678 Bacteria 85175
1164 Ga0495599_0032178 3300046678 Bacteria 3292
1165 Ga0495599_0218968 3300046678 Bacteria 1165
1166 Ga0495599_0318156 3300046678 Bacteria 937
1167 Ga0495623_0001647 3300046679 Bacteria 15000
1168 Ga0495623_0274569 3300046679 Bacteria 940
1169 Ga0495623_0402171 3300046679 Bacteria 736
1170 Ga0495646_0015156 3300046680 Bacteria 4897
1171 Ga0495646_0091567 3300046680 Bacteria 1754
1172 Ga0495646_0100604 3300046680 Bacteria 1658
1173 Ga0495646_0106134 3300046680 Bacteria 1604
1174 Ga0495647_0001533 3300046681 Bacteria 7139
1175 Ga0495647_0001646 3300046681 Bacteria 6920
1176 Ga0495647_0015581 3300046681 Bacteria 2665
1177 Ga0495647_0028628 3300046681 Bacteria 2055
1178 Ga0495647_0156005 3300046681 Bacteria 981
1179 Ga0495647_0180326 3300046681 Bacteria 918
1180 Ga0495658_0001182 3300046683 Bacteria 13746
1181 Ga0495658_0010111 3300046683 Bacteria 4714
1182 Ga0495658_0058066 3300046683 Bacteria 2212
1183 Ga0495658_0074539 3300046683 Bacteria 1978
1184 Ga0495658_0097970 3300046683 Bacteria 1746
1185 Ga0495658_0314540 3300046683 Bacteria 992
1186 Ga0495658_0317888 3300046683 Bacteria 986
1187 Ga0495658_0510153 3300046683 Bacteria 769
1188 Ga0495658_0806690 3300046683 Bacteria 601
1189 Ga0495613_0033317 3300046689 Bacteria 3828
1190 Ga0495613_0038260 3300046689 Bacteria 3555
1191 Ga0495613_0045117 3300046689 Bacteria 3260
1192 Ga0495613_0057564 3300046689 Bacteria 2854
1193 Ga0495624_0014707 3300046690 Bacteria 5299
1194 Ga0495624_0054293 3300046690 Bacteria 2526
1195 Ga0495624_0154463 3300046690 Bacteria 1403
1196 Ga0495670_0022603 3300046691 Bacteria 3106
1197 Ga0495670_0326546 3300046691 Bacteria 824
1198 Ga0495670_0479709 3300046691 Bacteria 675
1199 Ga0495671_0301212 3300046692 Bacteria 771
1200 Ga0495649_0486087 3300046694 Bacteria 615
1201 Ga0495589_0038706 3300046794 Bacteria 2385
1202 Ga0495589_0102899 3300046794 Bacteria 1381
1203 Ga0495589_0217337 3300046794 Bacteria 899
1204 Ga0495589_0256981 3300046794 Bacteria 815
1205 Ga0495600_0059326 3300046809 Bacteria 2499
1206 Ga0495600_0192117 3300046809 Bacteria 1312
1207 Ga0495600_0423693 3300046809 Bacteria 826
1208 Ga0495600_0451787 3300046809 Bacteria 795
1209 Ga0495660_0204466 3300046810 Bacteria 941
1210 Ga0495660_0255255 3300046810 Bacteria 812
1211 Ga0495581_0007592 3300047315 Bacteria 6269
1212 Ga0495581_0035922 3300047315 Bacteria 2866
1213 Ga0495581_0474985 3300047315 Bacteria 727
1214 Ga0495581_0564153 3300047315 Bacteria 660
1215 Ga0495604_0000043 3300047317 Bacteria 116335
1216 Ga0495604_0159747 3300047317 Bacteria 1593
1217 Ga0495604_0287193 3300047317 Bacteria 1109
1218 Ga0495604_0412910 3300047317 Bacteria 887
1219 Ga0495604_0921317 3300047317 Bacteria 545
1220 Ga0495636_0329448 3300047318 Bacteria 718
1221 Ga0495674_0031987 3300047319 Bacteria 4775
1222 Ga0495674_0063357 3300047319 Bacteria 3216
1223 Ga0495674_0157644 3300047319 Bacteria 1900
1224 Ga0495674_0188984 3300047319 Bacteria 1712
1225 Ga0495674_0251882 3300047319 Bacteria 1453
1226 Ga0495674_0283417 3300047319 Bacteria 1357
1227 Ga0495674_0469375 3300047319 Bacteria 1009
1228 Ga0495674_0556665 3300047319 Bacteria 912
1229 Ga0495674_0717293 3300047319 Bacteria 783
1230 Ga0495676_0003238 3300047321 Bacteria 14724
1231 Ga0495676_0037011 3300047321 Bacteria 4067
1232 Ga0495676_0351535 3300047321 Bacteria 985
1233 Ga0495676_0606602 3300047321 Bacteria 712
1234 Ga0495676_0625607 3300047321 Bacteria 700
1235 Ga0495680_0001621 3300047322 Bacteria 23946
1236 Ga0495680_0006421 3300047322 Bacteria 10927
1237 Ga0495680_0012966 3300047322 Bacteria 7297
1238 Ga0495680_0034460 3300047322 Bacteria 4087
1239 Ga0495680_0111639 3300047322 Bacteria 2025
1240 Ga0495680_0143144 3300047322 Bacteria 1748
1241 Ga0495680_0223492 3300047322 Bacteria 1343
1242 Ga0495683_0079607 3300047323 Bacteria 1600
1243 Ga0495675_0000413 3300047444 Bacteria 29216
1244 Ga0495675_0005668 3300047444 Bacteria 7631
1245 Ga0495677_0232428 3300047445 Bacteria 719
1246 Ga0495684_0099684 3300047471 Bacteria 2196
1247 Ga0495684_0103614 3300047471 Bacteria 2150
1248 Ga0495684_0267993 3300047471 Bacteria 1236
1249 Ga0495684_0358541 3300047471 Bacteria 1033
1250 Ga0495593_0008203 3300047673 Bacteria 6076
1251 Ga0495593_0008597 3300047673 Bacteria 5936
1252 Ga0495593_0074431 3300047673 Bacteria 1761
1253 Ga0495593_0412386 3300047673 Bacteria 676
1254 Ga0495602_0008483 3300048088 Bacteria 10729
1255 Ga0495602_0016733 3300048088 Bacteria 7365
1256 Ga0495602_0273214 3300048088 Bacteria 1248
1257 Ga0495602_0427376 3300048088 Bacteria 939
1258 Ga0495602_0611426 3300048088 Bacteria 748
1259 Ga0495614_0006192 3300048089 Bacteria 5376
1260 Ga0495614_0035419 3300048089 Bacteria 2144
1261 Ga0495614_0285238 3300048089 Bacteria 761
1262 Ga0495614_0307288 3300048089 Bacteria 734
1263 Ga0495615_0156671 3300048090 Bacteria 681
1264 Ga0495626_0264478 3300048091 Bacteria 687
1265 Ga0496100_0025042 3300048903 Bacteria 3645
1266 Ga0496100_0094937 3300048903 Bacteria 2043
1267 Ga0496100_0134046 3300048903 Bacteria 1748
1268 Ga0496100_0349598 3300048903 Bacteria 1116
1269 Ga0496100_0372299 3300048903 Bacteria 1083
1270 Ga0496100_0389514 3300048903 Bacteria 1059
1271 Ga0496100_0594120 3300048903 Bacteria 859
1272 Ga0496101_0000625 3300048904 Bacteria 21507
1273 Ga0496101_0001765 3300048904 Bacteria 12976
1274 Ga0496101_0019351 3300048904 Bacteria 4646
1275 Ga0496101_0026566 3300048904 Bacteria 4026
1276 Ga0496101_0108464 3300048904 Bacteria 2087
1277 Ga0496101_0190110 3300048904 Bacteria 1584
1278 Ga0496101_0205860 3300048904 Bacteria 1522
1279 Ga0496101_0287296 3300048904 Bacteria 1286
1280 Ga0496101_0560345 3300048904 Bacteria 903
1281 Ga0496101_0568248 3300048904 Bacteria 897
1282 Ga0496101_0706513 3300048904 Bacteria 796
1283 Ga0496101_1130989 3300048904 Bacteria 614
1284 Ga0496102_0003464 3300048905 Bacteria 13382
1285 Ga0496102_0004850 3300048905 Bacteria 11380
1286 Ga0496102_0009140 3300048905 Bacteria 8500
1287 Ga0496102_0010068 3300048905 Bacteria 8133
1288 Ga0496102_0010768 3300048905 Bacteria 7877
1289 Ga0496102_0108024 3300048905 Bacteria 2591
1290 Ga0496102_0192503 3300048905 Bacteria 1922
1291 Ga0496102_0199799 3300048905 Bacteria 1884
1292 Ga0496102_0213831 3300048905 Bacteria 1817
1293 Ga0496102_0511500 3300048905 Bacteria 1123
1294 Ga0496102_0785822 3300048905 Bacteria 874
1295 Ga0496102_1059488 3300048905 Bacteria 731
1296 Ga0496103_0000427 3300048906 Bacteria 36647
1297 Ga0496103_0004657 3300048906 Bacteria 8307
1298 Ga0496103_0028417 3300048906 Bacteria 3393
1299 Ga0496103_0063793 3300048906 Bacteria 2295
1300 Ga0496103_0064919 3300048906 Bacteria 2276
1301 Ga0496103_0091724 3300048906 Bacteria 1917
1302 Ga0496103_0561292 3300048906 Bacteria 728
1303 Ga0496104_0016549 3300048907 Bacteria 6701
1304 Ga0496104_0016872 3300048907 Bacteria 6639
1305 Ga0496104_0077315 3300048907 Bacteria 3171
1306 Ga0496104_0088244 3300048907 Bacteria 2962
1307 Ga0496104_0120426 3300048907 Bacteria 2519
1308 Ga0496104_0168519 3300048907 Bacteria 2100
1309 Ga0496104_0186929 3300048907 Bacteria 1982
1310 Ga0496104_0308408 3300048907 Bacteria 1495
1311 Ga0496104_0354789 3300048907 Bacteria 1379
1312 Ga0496104_0686984 3300048907 Bacteria 931
1313 Ga0496104_0979325 3300048907 Bacteria 750
1314 Ga0496104_1029384 3300048907 Bacteria 727
1315 Ga0496105_0003116 3300048908 Bacteria 12201
1316 Ga0496105_0006964 3300048908 Bacteria 8710
1317 Ga0496105_0022559 3300048908 Bacteria 5099
1318 Ga0496105_0030137 3300048908 Bacteria 4445
1319 Ga0496105_0034600 3300048908 Bacteria 4156
1320 Ga0496105_0047956 3300048908 Bacteria 3526
1321 Ga0496105_0097943 3300048908 Bacteria 2422
1322 Ga0496105_0157072 3300048908 Bacteria 1868
1323 Ga0496105_0216393 3300048908 Bacteria 1560
1324 Ga0496106_0000838 3300048909 Bacteria 22301
1325 Ga0496106_0002532 3300048909 Bacteria 13605
1326 Ga0496106_0011768 3300048909 Bacteria 6458
1327 Ga0496106_0108030 3300048909 Bacteria 2164
1328 Ga0496106_0395856 3300048909 Bacteria 1110
1329 Ga0496106_0428982 3300048909 Bacteria 1062
1330 Ga0496106_1373478 3300048909 Bacteria 547
1331 Ga0496107_0000371 3300048910 Bacteria 24322
1332 Ga0496107_0000608 3300048910 Bacteria 19966
1333 Ga0496107_0001409 3300048910 Bacteria 14833
1334 Ga0496107_0031040 3300048910 Bacteria 3810
1335 Ga0496107_0085656 3300048910 Bacteria 2299
1336 Ga0496107_0238090 3300048910 Bacteria 1354
1337 Ga0496107_0288475 3300048910 Bacteria 1221
1338 Ga0496107_0411333 3300048910 Bacteria 1006
1339 Ga0496107_0457669 3300048910 Bacteria 947
1340 Ga0496107_0774976 3300048910 Bacteria 703
1341 Ga0496107_0866342 3300048910 Bacteria 659
1342 Ga0496108_0005123 3300048911 Bacteria 10594
1343 Ga0496108_0007474 3300048911 Bacteria 8858
1344 Ga0496108_0025543 3300048911 Bacteria 4868
1345 Ga0496108_0055197 3300048911 Bacteria 3335
1346 Ga0496108_0056915 3300048911 Bacteria 3285
1347 Ga0496108_0086072 3300048911 Bacteria 2668
1348 Ga0496108_0100883 3300048911 Bacteria 2462
1349 Ga0496108_0190683 3300048911 Bacteria 1776
1350 Ga0496108_0243139 3300048911 Bacteria 1565
1351 Ga0496108_0336111 3300048911 Bacteria 1317
1352 Ga0496108_0486565 3300048911 Bacteria 1078
1353 Ga0496108_0964377 3300048911 Bacteria 729
1354 Ga0496108_1046988 3300048911 Bacteria 695
1355 Ga0496109_0010043 3300048912 Bacteria 8077
1356 Ga0496109_0010864 3300048912 Bacteria 7793
1357 Ga0496109_0011904 3300048912 Bacteria 7489
1358 Ga0496109_0012268 3300048912 Bacteria 7397
1359 Ga0496109_0016215 3300048912 Bacteria 6511
1360 Ga0496109_0016233 3300048912 Bacteria 6509
1361 Ga0496109_0037498 3300048912 Bacteria 4379
1362 Ga0496109_0039111 3300048912 Bacteria 4292
1363 Ga0496109_0050409 3300048912 Bacteria 3791
1364 Ga0496109_0060980 3300048912 Bacteria 3447
1365 Ga0496109_0080705 3300048912 Bacteria 2997
1366 Ga0496109_0232009 3300048912 Bacteria 1736
1367 Ga0496109_0370753 3300048912 Bacteria 1352
1368 Ga0496109_0415147 3300048912 Bacteria 1271
1369 Ga0496109_0687536 3300048912 Bacteria 960
1370 Ga0496109_0704036 3300048912 Bacteria 947
1371 Ga0496109_0787284 3300048912 Bacteria 889
1372 Ga0496109_0889996 3300048912 Bacteria 828
1373 Ga0496109_1412214 3300048912 Bacteria 631
1374 Ga0496109_1490485 3300048912 Bacteria 611
1375 Ga0496110_0004734 3300048913 Bacteria 10593
1376 Ga0496110_0005775 3300048913 Bacteria 9724
1377 Ga0496110_0006738 3300048913 Bacteria 9133
1378 Ga0496110_0038727 3300048913 Bacteria 4149
1379 Ga0496110_0064467 3300048913 Bacteria 3238
1380 Ga0496110_0129343 3300048913 Bacteria 2279
1381 Ga0496110_0167951 3300048913 Bacteria 1990
1382 Ga0496110_0193797 3300048913 Bacteria 1845
1383 Ga0496110_0207284 3300048913 Bacteria 1782
1384 Ga0496110_0289107 3300048913 Bacteria 1493
1385 Ga0496110_0317347 3300048913 Bacteria 1419
1386 Ga0496110_0492411 3300048913 Bacteria 1116
1387 Ga0496110_0638024 3300048913 Bacteria 964
1388 Ga0496111_0002804 3300048914 Bacteria 10616
1389 Ga0496111_0009880 3300048914 Bacteria 6377
1390 Ga0496111_0030027 3300048914 Bacteria 3864
1391 Ga0496111_0031386 3300048914 Bacteria 3784
1392 Ga0496111_0057802 3300048914 Bacteria 2807
1393 Ga0496111_0061008 3300048914 Bacteria 2733
1394 Ga0496111_0063988 3300048914 Bacteria 2668
1395 Ga0496111_0084993 3300048914 Bacteria 2313
1396 Ga0496111_0086746 3300048914 Bacteria 2290
1397 Ga0496111_0362835 3300048914 Bacteria 1072
1398 Ga0496111_0401370 3300048914 Bacteria 1013
1399 Ga0496111_0480939 3300048914 Bacteria 915
1400 Ga0496112_0010312 3300048915 Bacteria 8474
1401 Ga0496112_0027854 3300048915 Bacteria 5450
1402 Ga0496112_0030237 3300048915 Bacteria 5240
1403 Ga0496112_0037958 3300048915 Bacteria 4704
1404 Ga0496112_0044267 3300048915 Bacteria 4361
1405 Ga0496112_0047964 3300048915 Bacteria 4189
1406 Ga0496112_0048601 3300048915 Bacteria 4159
1407 Ga0496112_0111345 3300048915 Bacteria 2707
1408 Ga0496112_0262344 3300048915 Bacteria 1677
1409 Ga0496112_0292611 3300048915 Bacteria 1574
1410 Ga0496112_0349409 3300048915 Bacteria 1421
1411 Ga0496112_0895789 3300048915 Bacteria 809
1412 Ga0496112_1005313 3300048915 Bacteria 754
1413 Ga0496112_1411723 3300048915 Bacteria 611
1414 Ga0496112_1492253 3300048915 Bacteria 590
1415 Ga0496113_0123253 3300048916 Bacteria 2028
1416 Ga0496113_0220680 3300048916 Bacteria 1510
1417 Ga0496113_0241059 3300048916 Bacteria 1443
1418 Ga0496113_0302301 3300048916 Bacteria 1281
1419 Ga0496113_0348586 3300048916 Bacteria 1188
1420 Ga0496113_0572668 3300048916 Bacteria 905
1421 Ga0496113_1028267 3300048916 Bacteria 648
1422 Ga0496114_0014447 3300048917 Bacteria 6341
1423 Ga0496114_0019217 3300048917 Bacteria 5536
1424 Ga0496114_0022546 3300048917 Bacteria 5132
1425 Ga0496114_0046348 3300048917 Bacteria 3612
1426 Ga0496114_0061744 3300048917 Bacteria 3135
1427 Ga0496114_0092491 3300048917 Bacteria 2569
1428 Ga0496114_0104736 3300048917 Bacteria 2419
1429 Ga0496114_0118246 3300048917 Bacteria 2277
1430 Ga0496114_0294417 3300048917 Bacteria 1432
1431 Ga0496114_0405936 3300048917 Bacteria 1206
1432 Ga0496114_0715449 3300048917 Bacteria 877
1433 Ga0496114_0818620 3300048917 Bacteria 810
1434 Ga0496114_1108428 3300048917 Bacteria 676
1435 Ga0496114_1379516 3300048917 Bacteria 592
1436 Ga0496115_0039590 3300048918 Bacteria 3744
1437 Ga0496115_0052111 3300048918 Bacteria 3282
1438 Ga0496115_0080599 3300048918 Bacteria 2650
1439 Ga0496115_0104564 3300048918 Bacteria 2324
1440 Ga0496115_0310946 3300048918 Bacteria 1290
1441 Ga0496115_0474100 3300048918 Bacteria 1008
1442 Ga0496115_0521457 3300048918 Bacteria 953
1443 Ga0501031_0559054 3300049568 Bacteria 737
1444 Ga0501031_0982461 3300049568 Bacteria 540
1445 Ga0501032_0042828 3300049569 Bacteria 3070
1446 Ga0501032_0043872 3300049569 Bacteria 3027
1447 Ga0501033_0071104 3300049570 Bacteria 2556
1448 Ga0501034_0045090 3300049571 Bacteria 4457
1449 Ga0501036_0139906 3300049572 Bacteria 2043
1450 Ga0501037_0490125 3300049573 Bacteria 835
1451 Ga0501038_0002469 3300049574 Bacteria 17199
1452 Ga0501038_0860751 3300049574 Bacteria 671
1453 Ga0501039_0401762 3300049575 Bacteria 1076
1454 Ga0501039_0662899 3300049575 Bacteria 817
1455 Ga0501040_0003658 3300049576 Bacteria 9957
1456 Ga0501040_0156035 3300049576 Bacteria 1612
1457 Ga0501040_0601505 3300049576 Bacteria 794
1458 Ga0501040_0763508 3300049576 Bacteria 699
1459 Ga0501041_0004418 3300049577 Bacteria 8131
1460 Ga0501041_0169685 3300049577 Bacteria 1365
1461 Ga0501042_0000667 3300049578 Bacteria 18449
1462 Ga0501043_0005069 3300049579 Bacteria 10654
1463 Ga0501043_1001967 3300049579 Bacteria 594
1464 Ga0501048_0014271 3300049582 Bacteria 5884
1465 Ga0501048_0260084 3300049582 Bacteria 1233
1466 Ga0501048_0634802 3300049582 Bacteria 767
1467 Ga0501067_0036280 3300049583 Bacteria 2737
1468 Ga0501067_0051224 3300049583 Bacteria 2289
1469 Ga0501067_0127758 3300049583 Bacteria 1414
1470 Ga0501067_0217258 3300049583 Bacteria 1064
1471 Ga0501068_0015065 3300049584 Bacteria 4433
1472 Ga0501068_0029375 3300049584 Bacteria 3254
1473 Ga0501068_0187153 3300049584 Bacteria 1310
1474 Ga0501068_0735983 3300049584 Bacteria 645
1475 Ga0501069_0008120 3300049585 Bacteria 5516
1476 Ga0501069_0052921 3300049585 Bacteria 2261
1477 Ga0501069_0063548 3300049585 Bacteria 2062
1478 Ga0501070_0071043 3300049586 Bacteria 2882
1479 Ga0501070_0273145 3300049586 Bacteria 1380
1480 Ga0501070_0345058 3300049586 Bacteria 1209
1481 Ga0501071_0007796 3300049587 Bacteria 7059
1482 Ga0501071_0193736 3300049587 Bacteria 1525
1483 Ga0501071_0522853 3300049587 Bacteria 910
1484 Ga0501071_0764828 3300049587 Bacteria 744
1485 Ga0501072_0072741 3300049588 Bacteria 2717
1486 Ga0501072_0374017 3300049588 Bacteria 1131
1487 Ga0501072_0589893 3300049588 Bacteria 876
1488 Ga0501072_0705655 3300049588 Bacteria 793
1489 Ga0501073_0068922 3300049589 Bacteria 2465
1490 Ga0501074_0007535 3300049590 Bacteria 7874
1491 Ga0501074_0014796 3300049590 Bacteria 5676
1492 Ga0501074_0546640 3300049590 Bacteria 820
1493 Ga0501075_0002769 3300049591 Bacteria 11747
1494 Ga0501075_0184386 3300049591 Bacteria 1592
1495 Ga0501075_0437690 3300049591 Bacteria 997
1496 Ga0501075_1244986 3300049591 Bacteria 564
1497 Ga0501076_0010351 3300049592 Bacteria 6917
1498 Ga0501076_0455143 3300049592 Bacteria 1054
1499 Ga0501076_0621957 3300049592 Bacteria 891
1500 Ga0501076_0645605 3300049592 Bacteria 873
1501 Ga0501076_0821038 3300049592 Bacteria 767
1502 Ga0501077_0021232 3300049593 Bacteria 4109
1503 Ga0501077_0029478 3300049593 Bacteria 3488
1504 Ga0501261_112525 3300049690 Bacteria 530
1505 Ga0501225_0209194 3300049705 Bacteria 623
1506 Ga0501079_0008491 3300049741 Bacteria 7788
1507 Ga0501079_0022136 3300049741 Bacteria 4870
1508 Ga0501080_0022647 3300049742 Bacteria 5819
1509 Ga0501080_0769264 3300049742 Bacteria 846
1510 Ga0501081_0007966 3300049743 Bacteria 6873
1511 Ga0501081_0028001 3300049743 Bacteria 3800
1512 Ga0501083_0002257 3300049744 Bacteria 13181
1513 Ga0501035_0014204 3300049822 Bacteria 7350
1514 Ga0501044_0293432 3300049823 Bacteria 1557
1515 Ga0501045_0009808 3300049824 Bacteria 6699
1516 nmdc:mga03683_47425_c1 3300050489 Bacteria 1783
1517 nmdc:mga00v17_141770_c1 3300050491 Bacteria 1541
1518 nmdc:mga00v17_91256_c1 3300050491 Bacteria 1914
1519 nmdc:mga0yw44_190072_c1 3300050492 Bacteria 1354
1520 nmdc:mga0yw44_313445_c1 3300050492 Bacteria 1053
1521 nmdc:mga06z11_496463_c1 3300050494 Bacteria 739
1522 nmdc:mga05p37_140955_c1 3300050507 Bacteria 2954
1523 nmdc:mga05p37_300216_c1 3300050507 Bacteria 1908
1524 nmdc:mga05p37_345361_c1 3300050507 Bacteria 1754
1525 nmdc:mga05p37_490630_c1 3300050507 Bacteria 1412
1526 nmdc:mga09592_67999_c1 3300050508 Bacteria 3022
1527 nmdc:mga0qj67_290980_c1 3300050509 Bacteria 1324
1528 nmdc:mga0qj67_364472_c1 3300050509 Bacteria 1168
1529 nmdc:mga06r32_163204_c1 3300050510 Bacteria 2211
1530 nmdc:mga06r32_262122_c1 3300050510 Bacteria 1716
1531 nmdc:mga06r32_702455_c1 3300050510 Bacteria 977
1532 nmdc:mga08y16_107169_c1 3300050511 Bacteria 2909
1533 nmdc:mga08y16_376843_c1 3300050511 Bacteria 1455
1534 nmdc:mga08y16_941299_c1 3300050511 Bacteria 847
1535 nmdc:mga0n895_56037_c1 3300050512 Bacteria 3882
1536 nmdc:mga0n895_90972_c1 3300050512 Bacteria 3053
1537 nmdc:mga0rr50_153180_c1 3300050513 Bacteria 1865
1538 nmdc:mga0rr50_89406_c1 3300050513 Bacteria 2394
1539 nmdc:mga08x19_1111876_c1 3300050514 Bacteria 561
1540 nmdc:mga0a205_279421_c1 3300050515 Bacteria 1545
1541 nmdc:mga0a205_82813_c1 3300050515 Bacteria 3099
1542 Ga0495601_0002689 3300053077 Bacteria 10079
1543 Ga0495601_0070924 3300053077 Bacteria 2224
1544 Ga0495601_0071802 3300053077 Bacteria 2210
1545 Ga0495601_0105098 3300053077 Bacteria 1825
1546 Ga0495601_0128380 3300053077 Bacteria 1650
1547 Ga0495601_0132710 3300053077 Bacteria 1622
1548 Ga0495601_0179307 3300053077 Bacteria 1385
1549 Ga0495601_0210324 3300053077 Bacteria 1271
1550 Ga0495612_0007861 3300053078 Bacteria 4348
1551 Ga0495612_0038529 3300053078 Bacteria 1942
1552 Ga0495655_0011457 3300053083 Bacteria 1783
1553 Ga0495655_0196562 3300053083 Bacteria 657
1554 Ga0495595_0087956 3300053084 Bacteria 1487
1555 Ga0495595_0217012 3300053084 Bacteria 954
1556 Ga0495595_0534599 3300053084 Bacteria 598
1557 Ga0495595_0745344 3300053084 Bacteria 502
1558 Ga0495619_0005446 3300053085 Bacteria 8067
1559 Ga0495619_0006219 3300053085 Bacteria 7570
1560 Ga0495619_0081789 3300053085 Bacteria 2175
1561 Ga0495619_0087481 3300053085 Bacteria 2106
1562 Ga0495619_0088932 3300053085 Bacteria 2089
1563 Ga0495619_0129198 3300053085 Bacteria 1736
1564 Ga0495619_0191522 3300053085 Bacteria 1415
1565 Ga0495619_0571896 3300053085 Bacteria 774
1566 Ga0495619_0605118 3300053085 Bacteria 750
1567 Ga0500566_0036462 3300053094 Bacteria 2852
1568 Ga0500566_0524119 3300053094 Bacteria 506
1569 Ga0501084_0001291 3300054114 Bacteria 19731
1570 Ga0501084_0102325 3300054114 Bacteria 2406
1571 Ga0501084_0628377 3300054114 Bacteria 907
1572 Ga0501084_0635174 3300054114 Bacteria 901
1573 Ga0587083_0067294 3300059505 Bacteria 823
1574 Ga0587106_048776 3300059605 Bacteria 744
1575 Ga0587114_021939 3300059655 Bacteria 909
1576 Ga0587111_0073607 3300060346 Bacteria 802
1577 Ga0587111_0105233 3300060346 Bacteria 708
1578 Ga0501082_0030517 3300060353 Bacteria 4645
1579 Ga0501082_0417661 3300060353 Bacteria 1171
1580 Ga0501082_0640043 3300060353 Bacteria 930
1581 Ga0501082_0836609 3300060353 Bacteria 805
1582 Ga0466962_0004844 3300061719 Bacteria 6477
1583 Ga0466962_0012692 3300061719 Bacteria 4052
1584 Ga0466962_0018284 3300061719 Bacteria 3371
1585 Ga0466962_0230446 3300061719 Bacteria 908
1586 Ga0466962_0384634 3300061719 Bacteria 701
1587 Ga0530510_0025910 3300061734 Bacteria 4194
1588 Ga0530510_0191533 3300061734 Bacteria 1518
1589 Ga0530510_0208652 3300061734 Bacteria 1451
1590 Ga0530510_0346845 3300061734 Bacteria 1115
1591 Ga0530510_0422621 3300061734 Bacteria 1006
1592 Ga0530510_0671316 3300061734 Bacteria 789
1593 Ga0530510_0683938 3300061734 Bacteria 782
1594 Ga0530510_1045233 3300061734 Bacteria 625
1595 Ga0530510_1361355 3300061734 Bacteria 544
1596 Ga0206354_11410044
1597 JGI24750J21931_1007751
1598 JGI24745J21846_1022792
1599 JGI24749J21850_1008744
1600 JGI24744J21845_10055980
1601 JGI24742J22300_10043870
1602 Ga0058863_10051448
1603 Ga0070658_10012196
1604 Ga0070658_10040720
1605 Ga0070658_10087565
1606 Ga0070658_10288287
1607 Ga0070676_10026558
1608 Ga0070683_100009431
1609 Ga0070683_100562461
1610 Ga0070690_100020038
1611 Ga0070670_100124734
1612 Ga0070670_101389383
1613 Ga0068869_101021318
1614 Ga0070666_10208582
1615 Ga0070680_100129344
1616 Ga0070680_100159764
1617 Ga0070680_100403331
1618 Ga0070680_100447146
1619 Ga0070680_100522193
1620 Ga0070682_100004124
1621 Ga0070682_100122111
1622 Ga0070682_100146514
1623 Ga0070682_100241243
1624 Ga0070682_100247756
1625 Ga0068868_100147177
1626 Ga0068868_100167952
1627 Ga0068868_100298164
1628 Ga0068868_100345334
1629 Ga0068868_100539533
1630 Ga0070660_100030791
1631 Ga0070660_100089485
1632 Ga0070660_100185845
1633 Ga0070660_100304781
1634 Ga0070660_100457234
1635 Ga0070660_101022145
1636 Ga0070689_100019147
1637 Ga0070689_100024547
1638 Ga0070689_100469387
1639 Ga0070691_10319457
1640 Ga0070687_100129359
1641 Ga0070661_100741583
1642 Ga0070661_101085076
1643 Ga0070692_10026768
1644 Ga0070692_10091713
1645 Ga0070692_10697900
1646 Ga0070668_100082401
1647 Ga0070668_100091956
1648 Ga0070668_100400625
1649 Ga0070669_100064711
1650 Ga0070675_100324428
1651 Ga0070675_100339337
1652 Ga0070671_100042707
1653 Ga0070671_100163329
1654 Ga0070671_100164883
1655 Ga0070671_100299707
1656 Ga0070674_100034154
1657 Ga0070674_100420232
1658 Ga0070674_100805184
1659 Ga0070673_101009776
1660 Ga0070673_101061773
1661 Ga0070688_100021514
1662 Ga0070688_100132110
1663 Ga0070688_100504006
1664 Ga0070688_100533792
1665 Ga0070688_100763351
1666 Ga0070659_100048560
1667 Ga0070659_100093044
1668 Ga0070659_100149681
1669 Ga0070659_100212804
1670 Ga0070659_101223843
1671 Ga0070667_100290632
1672 Ga0070667_101029486
1673 Ga0070709_10268498
1674 Ga0070709_10301985
1675 Ga0070709_11217407
1676 Ga0070714_100016722
1677 Ga0070714_100035324
1678 Ga0070714_100061187
1679 Ga0070714_100130737
1680 Ga0070714_100501441
1681 Ga0070714_100525679
1682 Ga0070714_100993743
1683 Ga0070714_101047255
1684 Ga0070714_101243807
1685 Ga0070714_101405067
1686 Ga0070713_100043779
1687 Ga0070713_100297409
1688 Ga0070713_100861019
1689 Ga0070713_100907466
1690 Ga0070713_100909427
1691 Ga0070713_100913959
1692 Ga0070710_10005272
1693 Ga0070710_10015456
1694 Ga0070710_10383119
1695 Ga0070710_10615351
1696 Ga0070701_10002177
1697 Ga0070701_10013227
1698 Ga0070701_10134758
1699 Ga0070701_10338970
1700 Ga0070701_10394283
1701 Ga0070711_100004345
1702 Ga0070711_100007994
1703 Ga0070711_100063227
1704 Ga0070711_100405473
1705 Ga0070705_100050664
1706 Ga0070705_100053354
1707 Ga0070705_100424647
1708 Ga0070705_100710338
1709 Ga0070705_100743779
1710 Ga0070700_100052619
1711 Ga0070700_101085790
1712 Ga0070694_101140385
1713 Ga0070708_100120562
1714 Ga0070708_100130291
1715 Ga0070708_100512401
1716 Ga0070663_100097993
1717 Ga0070663_100559814
1718 Ga0070663_100781193
1719 Ga0070678_100007082
1720 Ga0070678_100026391
1721 Ga0070678_100041054
1722 Ga0070678_100140695
1723 Ga0070678_100174608
1724 Ga0070678_101008228
1725 Ga0070662_100400493
1726 Ga0070681_10015901
1727 Ga0070681_10180313
1728 Ga0070681_10242111
1729 Ga0070681_10279107
1730 Ga0070681_10393115
1731 Ga0070681_10961260
1732 Ga0068867_100005177
1733 Ga0068867_100028426
1734 Ga0068867_100082863
1735 Ga0070685_10001884
1736 Ga0070685_10007752
1737 Ga0070685_10042725
1738 Ga0070706_100123350
1739 Ga0070706_100708057
1740 Ga0070707_100001557
1741 Ga0070707_100033363
1742 Ga0070707_100163694
1743 Ga0070707_100417308
1744 Ga0070707_101100559
1745 Ga0070707_101320915
1746 Ga0070698_100024862
1747 Ga0070698_100062258
1748 Ga0070698_100073464
1749 Ga0070698_100837530
1750 Ga0070698_100974598
1751 Ga0070679_100020719
1752 Ga0070679_100250004
1753 Ga0070684_100023316
1754 Ga0070684_100024998
1755 Ga0070684_100076862
1756 Ga0070684_100158664
1757 Ga0070684_100161559
1758 Ga0070684_100482407
1759 Ga0070684_100599006
1760 Ga0070684_100735482
1761 Ga0070684_101175437
1762 Ga0070697_100106408
1763 Ga0070697_100390518
1764 Ga0070697_101408160
1765 Ga0068853_100010960
1766 Ga0070672_100005416
1767 Ga0070672_100160201
1768 Ga0070672_101356177
1769 Ga0070686_100001859
1770 Ga0070686_100020981
1771 Ga0070686_100056299
1772 Ga0070686_100119066
1773 Ga0070695_100002689
1774 Ga0070695_100667050
1775 Ga0070695_100853405
1776 Ga0070696_100167693
1777 Ga0070696_100686087
1778 Ga0070696_100944378
1779 Ga0070693_100004830
1780 Ga0070693_100110585
1781 Ga0070693_100555336
1782 Ga0070665_100572070
1783 Ga0070665_100752407
1784 Ga0070704_100093364
1785 Ga0070704_100312493
1786 Ga0070704_100494141
1787 Ga0070704_101594938
1788 Ga0068855_100443891
1789 Ga0070664_100045258
1790 Ga0070664_100071090
1791 Ga0070664_100081626
1792 Ga0070664_100109052
1793 Ga0068857_100018953
1794 Ga0068857_100227757
1795 Ga0068857_101308443
1796 Ga0068854_100076095
1797 Ga0068856_100014179
1798 Ga0068856_100090897
1799 Ga0068856_100232549
1800 Ga0068856_100254676
1801 Ga0068856_100321065
1802 Ga0068856_100333992
1803 Ga0068856_100967960
1804 Ga0068856_101003950
1805 Ga0068856_101273756
1806 Ga0068856_101591774
1807 Ga0070702_100202353
1808 Ga0070702_100448044
1809 Ga0070702_100912627
1810 Ga0070702_101081696
1811 Ga0068852_100047094
1812 Ga0068852_100327493
1813 Ga0068852_100426066
1814 Ga0068852_100929149
1815 Ga0068852_101056432
1816 Ga0068859_100124155
1817 Ga0068859_100661067
1818 Ga0068859_100784876
1819 Ga0068864_100014298
1820 Ga0068864_100272752
1821 Ga0068864_101624193
1822 Ga0068866_10008633
1823 Ga0068866_10069108
1824 Ga0068866_10195935
1825 Ga0068866_10388792
1826 Ga0068861_100033707
1827 Ga0068861_100285167
1828 Ga0068861_100402038
1829 Ga0068861_100886782
1830 Ga0068851_10110022
1831 Ga0068870_10009635
1832 Ga0068870_10061744
1833 Ga0068870_10558949
1834 Ga0068863_100222283
1835 Ga0068863_100255986
1836 Ga0068863_101340880
1837 Ga0068858_100159638
1838 Ga0068860_100654188
1839 Ga0068862_100243339
1840 Ga0068862_100713063
1841 Ga0068862_101302548
1842 Ga0081455_10064511
1843 Ga0081455_10065549
1844 Ga0081455_10067811
1845 Ga0081455_10194627
1846 Ga0081455_10354823
1847 Ga0081538_10000037
1848 Ga0081538_10013229
1849 Ga0081538_10014684
1850 Ga0081538_10015351
1851 Ga0081538_10039195
1852 Ga0081538_10069095
1853 Ga0081538_10209135
1854 Ga0081539_10002193
1855 Ga0081539_10003843
1856 Ga0070717_10011659
1857 Ga0070717_10013934
1858 Ga0070717_10206338
1859 Ga0070717_10639725
1860 Ga0070717_10693015
1861 Ga0075365_10100239
1862 Ga0075365_10808136
1863 Ga0075364_10024709
1864 Ga0075432_10061606
1865 Ga0075432_10077826
1866 Ga0070715_10000565
1867 Ga0070715_10036740
1868 Ga0070716_100006022
1869 Ga0070716_100494948
1870 Ga0070716_100594140
1871 Ga0070716_100621141
1872 Ga0070712_100006000
1873 Ga0070712_100056555
1874 Ga0070712_100289256
1875 Ga0070712_100301307
1876 Ga0070712_100342824
1877 Ga0070712_100743780
1878 Ga0070712_100808803
1879 Ga0075362_10022581
1880 Ga0097621_100204246
1881 Ga0097621_100223481
1882 Ga0097621_100422624
1883 Ga0068871_100059583
1884 Ga0068871_100065087
1885 Ga0075428_100515800
1886 Ga0075428_100871680
1887 Ga0075430_100083598
1888 Ga0075430_100341714
1889 Ga0075431_100121575
1890 Ga0075431_100244476
1891 Ga0075433_10084447
1892 Ga0075433_10172648
1893 Ga0075433_10253630
1894 Ga0075434_100016435
1895 Ga0075434_100042438
1896 Ga0075434_100276485
1897 Ga0075434_100502303
1898 Ga0075434_100610494
1899 Ga0075429_100658216
1900 Ga0068865_100004970
1901 Ga0068865_100020981
1902 Ga0068865_100168119
1903 Ga0068865_100301528
1904 Ga0068865_100441079
1905 Ga0068865_100721648
1906 Ga0075436_100303440
1907 Ga0097620_100124152
1908 Ga0097620_100661113
1909 Ga0097620_100784919
1910 Ga0075435_100113748
1911 Ga0075435_100420695
1912 Ga0075435_100459282
1913 Ga0075435_101204724
1914 Ga0111539_10122024
1915 Ga0111539_10312375
1916 Ga0111539_10499400
1917 Ga0111539_11051258
1918 Ga0111539_11509700
1919 Ga0111539_12848976
1920 Ga0105245_10051119
1921 Ga0105245_10099555
1922 Ga0105245_10106484
1923 Ga0105245_10167293
1924 Ga0105245_10288254
1925 Ga0105245_10290160
1926 Ga0105245_10917566
1927 Ga0105247_10580108
1928 Ga0105247_11297130
1929 Ga0114129_11453704
1930 Ga0114129_11576530
1931 Ga0114129_11590593
1932 Ga0114129_11628620
1933 Ga0105243_10002992
1934 Ga0105243_10055328
1935 Ga0105243_10244044
1936 Ga0105243_10271795
1937 Ga0105243_10448894
1938 Ga0105241_10072481
1939 Ga0105241_10238783
1940 Ga0105241_10541586
1941 Ga0105241_11304209
1942 Ga0105242_10148257
1943 Ga0105242_10167775
1944 Ga0105242_10197397
1945 Ga0105242_10362638
1946 Ga0105242_10369170
1947 Ga0105242_10644618
1948 Ga0105242_10941555
1949 Ga0105242_11374169
1950 Ga0105242_12141368
1951 Ga0105248_10015623
1952 Ga0105248_10745745
1953 Ga0105248_10958854
1954 Ga0105237_10079496
1955 Ga0105237_11079763
1956 Ga0105238_10043513
1957 Ga0105238_11180247
1958 Ga0105238_11301210
1959 Ga0105249_10009884
1960 Ga0105239_10325172
1961 Ga0105239_10485652
1962 Ga0105239_10526113
1963 Ga0105239_10645658
1964 Ga0105239_11304203
1965 Ga0105239_12072682
1966 Ga0105246_10515629
1967 Ga0105246_11415010
1968 Ga0157339_1005165
1969 Ga0157327_1014400
1970 Ga0157373_10517660
1971 Ga0157371_10884669
1972 Ga0157369_10283256
1973 Ga0157369_10599746
1974 Ga0157369_11498414
1975 Ga0157374_10284831
1976 Ga0157374_10401038
1977 Ga0157374_11242267
1978 Ga0157378_10217575
1979 Ga0157378_10260173
1980 Ga0157378_10406906
1981 Ga0157378_10410230
1982 Ga0157378_10869261
1983 Ga0157378_10976970
1984 Ga0157378_11061631
1985 Ga0157378_11607311
1986 Ga0157378_11715565
1987 Ga0163162_10199776
1988 Ga0163162_11593065
1989 Ga0163162_12189375
1990 Ga0157372_10660788
1991 Ga0157372_10664777
1992 Ga0157372_11237211
1993 Ga0157372_11496035
1994 Ga0157375_10161829
1995 Ga0157375_10198195
1996 Ga0157375_10289762
1997 Ga0157375_10419790
1998 Ga0157375_11273545
1999 Ga0157375_11719422
2000 Ga0163163_10020662
2001 Ga0163163_10382842
2002 Ga0157380_10282638
2003 Ga0157380_10446551
2004 Ga0157380_11064782
2005 Ga0157380_11270386
2006 Ga0182008_10004665
2007 Ga0182008_10461642
2008 Ga0182008_10753453
2009 Ga0157377_10031731
2010 Ga0157377_10086401
2011 Ga0157377_10382383
2012 Ga0157379_10288838
2013 Ga0157379_10605430
2014 Ga0157379_10943188
2015 Ga0157379_11617498
2016 Ga0157376_10011788
2017 Ga0157376_10104146
2018 Ga0157376_10566311
2019 Ga0157376_10677354
2020 Ga0157376_10815181
2021 Ga0157376_12786349
2022 Ga0182007_10015950
2023 Ga0163161_10389859
2024 Ga0197907_10978116
2025 Ga0197907_11392553
2026 Ga0206356_10239065
2027 Ga0206356_11088656
2028 Ga0206349_1037198
2029 Ga0206350_11457104
2030 Ga0206353_10918220
2031 Ga0206353_12001256
2032 Ga0213873_10012098
2033 Ga0213871_10035748
2034 Ga0224712_10132690
2035 Ga0207638_1003322
2036 Ga0207697_10037177
2037 Ga0207692_10147999
2038 Ga0207692_10209597
2039 Ga0207692_10342981
2040 Ga0207642_10023441
2041 Ga0207642_10165774
2042 Ga0207642_10195677
2043 Ga0207710_10168886
2044 Ga0207688_10011759
2045 Ga0207688_10305088
2046 Ga0207688_10507265
2047 Ga0207680_10590681
2048 Ga0207647_10041881
2049 Ga0207647_10074362
2050 Ga0207647_10432742
2051 Ga0207647_10505585
2052 Ga0207685_10039400
2053 Ga0207685_10039846
2054 Ga0207699_10002820
2055 Ga0207699_10156246
2056 Ga0207699_10420100
2057 Ga0207645_10020975
2058 Ga0207645_10129652
2059 Ga0207643_10020891
2060 Ga0207643_10067194
2061 Ga0207643_10243672
2062 Ga0207705_10068235
2063 Ga0207705_10264986
2064 Ga0207705_10577404
2065 Ga0207684_10168406
2066 Ga0207684_10341686
2067 Ga0207654_10096035
2068 Ga0207654_10322502
2069 Ga0207654_10753987
2070 Ga0207707_10003180
2071 Ga0207707_10017461
2072 Ga0207707_10068018
2073 Ga0207707_10091440
2074 Ga0207707_10241526
2075 Ga0207707_10295079
2076 Ga0207707_10909981
2077 Ga0207695_10043176
2078 Ga0207695_10467872
2079 Ga0207671_10041645
2080 Ga0207671_10908210
2081 Ga0207693_10008279
2082 Ga0207693_10019701
2083 Ga0207693_10288274
2084 Ga0207693_10345236
2085 Ga0207693_10414231
2086 Ga0207693_10416778
2087 Ga0207693_10624072
2088 Ga0207693_10849194
2089 Ga0207663_10001658
2090 Ga0207663_10067383
2091 Ga0207663_10076870
2092 Ga0207663_10295750
2093 Ga0207663_10980466
2094 Ga0207660_10003324
2095 Ga0207660_10085298
2096 Ga0207660_10243965
2097 Ga0207660_10414347
2098 Ga0207660_10960578
2099 Ga0207662_10251851
2100 Ga0207662_10316530
2101 Ga0207662_10522240
2102 Ga0207657_10023955
2103 Ga0207657_10104313
2104 Ga0207657_10152933
2105 Ga0207657_10531940
2106 Ga0207649_10066928
2107 Ga0207649_10126012
2108 Ga0207652_10026093
2109 Ga0207652_10032074
2110 Ga0207652_10141578
2111 Ga0207652_10612085
2112 Ga0207646_10000851
2113 Ga0207646_10006167
2114 Ga0207646_10350239
2115 Ga0207646_10470048
2116 Ga0207646_10873204
2117 Ga0207646_11255629
2118 Ga0207681_10141949
2119 Ga0207650_10102675
2120 Ga0207650_10211548
2121 Ga0207659_10054577
2122 Ga0207659_10439310
2123 Ga0207659_10525473
2124 Ga0207659_10809743
2125 Ga0207659_11222875
2126 Ga0207687_10040067
2127 Ga0207687_10051517
2128 Ga0207687_10095470
2129 Ga0207687_10172632
2130 Ga0207687_10178037
2131 Ga0207687_10363650
2132 Ga0207687_10552335
2133 Ga0207687_10773573
2134 Ga0207687_11343192
2135 Ga0207700_10000001
2136 Ga0207700_10026626
2137 Ga0207700_10038712
2138 Ga0207700_11080513
2139 Ga0207664_10001406
2140 Ga0207664_10020871
2141 Ga0207664_10022997
2142 Ga0207664_10033965
2143 Ga0207664_10274078
2144 Ga0207664_10290865
2145 Ga0207664_10447145
2146 Ga0207664_10447901
2147 Ga0207664_10868463
2148 Ga0207644_10220744
2149 Ga0207644_10248632
2150 Ga0207644_10393798
2151 Ga0207644_10605170
2152 Ga0207690_10185138
2153 Ga0207690_10387590
2154 Ga0207690_10434491
2155 Ga0207690_10845447
2156 Ga0207706_10198818
2157 Ga0207706_10509487
2158 Ga0207706_10953555
2159 Ga0207686_10007037
2160 Ga0207686_10692594
2161 Ga0207686_10863041
2162 Ga0207709_10001060
2163 Ga0207709_10036357
2164 Ga0207709_10082444
2165 Ga0207670_10023173
2166 Ga0207670_10329651
2167 Ga0207669_10074154
2168 Ga0207669_10190376
2169 Ga0207669_11009560
2170 Ga0207704_10000286
2171 Ga0207704_10046777
2172 Ga0207704_10149932
2173 Ga0207704_10168404
2174 Ga0207704_10231522
2175 Ga0207704_10443972
2176 Ga0207665_10006962
2177 Ga0207665_10113016
2178 Ga0207665_10117162
2179 Ga0207665_10226469
2180 Ga0207665_10630871
2181 Ga0207691_10011073
2182 Ga0207691_10049708
2183 Ga0207711_10021100
2184 Ga0207711_10063781
2185 Ga0207711_10812375
2186 Ga0207689_10326490
2187 Ga0207689_10820087
2188 Ga0207661_10003657
2189 Ga0207661_10022155
2190 Ga0207661_10062325
2191 Ga0207661_10141659
2192 Ga0207661_10242250
2193 Ga0207661_10615782
2194 Ga0207661_11751763
2195 Ga0207679_10019995
2196 Ga0207679_10047938
2197 Ga0207679_10056211
2198 Ga0207679_10066082
2199 Ga0207679_10174390
2200 Ga0207667_10719049
2201 Ga0207651_10035870
2202 Ga0207651_10100525
2203 Ga0207651_10517320
2204 Ga0207712_10003169
2205 Ga0207712_10557806
2206 Ga0207712_10780708
2207 Ga0207712_10782487
2208 Ga0207668_10055925
2209 Ga0207668_10081936
2210 Ga0207668_10461127
2211 Ga0207640_10103531
2212 Ga0207640_10302855
2213 Ga0207640_10643411
2214 Ga0207658_10205342
2215 Ga0207658_10263410
2216 Ga0207677_10118400
2217 Ga0207677_10174254
2218 Ga0207677_10197711
2219 Ga0207677_10650835
2220 Ga0207677_10703393
2221 Ga0207677_10829953
2222 Ga0207639_10037000
2223 Ga0207678_10074836
2224 Ga0207678_10264428
2225 Ga0207678_10410741
2226 Ga0207708_10018770
2227 Ga0207708_10074971
2228 Ga0207708_10380061
2229 Ga0207708_10769965
2230 Ga0207708_11112989
2231 Ga0207702_10045933
2232 Ga0207702_10087132
2233 Ga0207702_10324033
2234 Ga0207702_10582704
2235 Ga0207702_11212359
2236 Ga0207641_10168864
2237 Ga0207641_10940579
2238 Ga0207648_10011203
2239 Ga0207648_10041456
2240 Ga0207648_10124916
2241 Ga0207648_10152132
2242 Ga0207676_10295678
2243 Ga0207676_10568968
2244 Ga0207676_10601768
2245 Ga0207674_10039665
2246 Ga0207674_10305202
2247 Ga0207674_10798825
2248 Ga0207675_100149812
2249 Ga0207675_100183839
2250 Ga0207675_100395333
2251 Ga0207675_100619731
2252 Ga0207675_101222279
2253 Ga0207683_10009121
2254 Ga0207683_10104857
2255 Ga0207683_10197559
2256 Ga0207683_10209468
2257 Ga0207683_10697336
2258 Ga0207683_10812935
2259 Ga0207683_11101104
2260 Ga0207698_10046157
2261 Ga0207698_10383541
2262 Ga0207698_11661250
2263 Ga0207698_11720906
2264 Ga0209983_1018103
2265 Ga0209971_1076288
2266 Ga0207428_10013247
2267 Ga0207428_10030394
2268 Ga0207428_10502528
2269 Ga0268266_10069113
2270 Ga0268266_10509710
2271 Ga0268266_10629067
2272 Ga0268265_10222160
2273 Ga0268265_10441519
2274 Ga0268265_10937753
2275 Ga0268265_11538312
2276 Ga0268265_12009071
2277 Ga0268264_10332760
2278 Ga0265337_1054029
2279 Ga0265319_1001715
2280 Ga0265319_1002457
2281 Ga0265319_1017512
2282 Ga0265319_1024157
2283 Ga0265334_10003069
2284 Ga0265318_10002235
2285 Ga0265318_10005575
2286 Ga0265323_10065227
2287 Ga0265323_10131647
2288 Ga0265336_10001246
2289 Ga0265336_10074058
2290 Ga0265338_10001634
2291 Ga0265338_10004752
2292 Ga0265338_10006529
2293 Ga0265338_10006962
2294 Ga0265338_10012182
2295 Ga0265338_10035857
2296 Ga0265338_10295283
2297 Ga0265324_10008952
2298 Ga0265324_10172657
2299 Ga0265330_10002117
2300 Ga0265330_10007769
2301 Ga0265332_10003068
2302 Ga0265332_10287458
2303 Ga0265328_10009953
2304 Ga0265320_10011013
2305 Ga0265320_10045980
2306 Ga0265320_10120669
2307 Ga0265320_10182513
2308 Ga0265325_10002707
2309 Ga0265329_10004301
2310 Ga0265329_10012733
2311 Ga0265329_10191763
2312 Ga0265340_10002927
2313 Ga0265340_10082712
2314 Ga0265340_10227680
2315 Ga0265339_10007125
2316 Ga0265339_10016606
2317 Ga0265339_10208688
2318 Ga0265331_10001137
2319 Ga0265331_10193784
2320 Ga0265327_10013950
2321 Ga0265327_10072157
2322 Ga0265327_10136870
2323 Ga0265316_10005912
2324 Ga0265316_10010068
2325 Ga0265316_10018295
2326 Ga0265316_10163328
2327 Ga0265316_10331911
2328 Ga0307408_100138064
2329 Ga0307408_100235426
2330 Ga0265313_10011203
2331 Ga0265313_10032156
2332 Ga0265314_10008726
2333 Ga0265314_10012224
2334 Ga0265314_10017019
2335 Ga0265314_10180252
2336 Ga0265342_10009012
2337 Ga0265342_10018402
2338 Ga0265342_10051186
2339 Ga0307405_10189710
2340 Ga0307405_10319662
2341 Ga0307413_10083017
2342 Ga0307410_10109011
2343 Ga0307406_10118559
2344 Ga0307407_10027944
2345 Ga0307407_10264512
2346 Ga0307412_10045102
2347 Ga0307412_11158248
2348 Ga0307409_100202921
2349 Ga0307409_100503331
2350 Ga0307416_100076773
2351 Ga0307416_100127477
2352 Ga0307414_10016323
2353 Ga0307411_10014197
2354 Ga0307411_10235027
2355 Ga0307415_100104630
2356 Ga0373926_0131172
2357 Ga0373926_0178304
2358 Ga0373928_0141958
2359 Ga0373928_0206433
2360 Ga0373934_0153330
2361 Ga0373944_0038235
2362 Ga0373923_0004775
2363 Ga0373923_0203504
2364 Ga0373923_0342261
2365 Ga0373932_0069873
2366 Ga0373932_0240562
2367 Ga0373936_0135879
2368 Ga0373941_0127722
2369 Ga0373941_0271081
2370 Ga0373945_0046039
2371 Ga0373945_0048762
2372 Ga0373954_0120172
2373 Ga0373956_0047636
2374 Ga0373956_0201944
2375 Ga0373957_0053871
2376 Ga0373960_0061905
2377 Ga0373960_0212208
2378 Ga0373943_0001856
2379 Ga0373943_0017801
2380 Ga0373943_0325241
2381 Ga0373946_0403741
2382 Ga0373955_0288351
2383 Ga0373955_0329151
2384 Ga0373942_0358248
2385 Ga0373962_0100731
2386 Ga0373924_0067174
2387 Ga0373924_0149373
2388 Ga0373931_0040708
2389 Ga0373931_0241595
2390 Ga0373931_0382374
2391 Ga0373931_0685960
2392 Ga0373931_0798042
2393 Ga0373935_0053852
2394 Ga0373935_0102216
2395 Ga0373935_0150025
2396 Ga0373935_0246897
2397 Ga0373935_0690550
2398 Ga0373927_0108261
2399 Ga0373933_0048328
2400 Ga0373933_0207289
2401 Ga0373933_0213579
2402 Ga0373933_0507228
2403 Ga0373947_0000695
2404 Ga0373947_0006392
2405 Ga0373947_0246830
2406 Ga0373947_0363030
2407 Ga0373937_0001944
2408 Ga0373937_0017853
2409 Ga0373937_0037507
2410 Ga0373937_0125976
2411 Ga0373937_1387833
2412 Ga0316582_0250654
2413 Ga0373925_0004944
2414 Ga0373925_0243960
2415 Ga0373925_0650794
2416 Ga0373925_0858440
2417 Ga0373925_1271220
2418 Ga0395899_0026847
2419 Ga0395899_0027964
2420 Ga0395899_0033987
2421 Ga0395899_0051296
2422 Ga0395899_0066928
2423 Ga0395899_0079485
2424 Ga0395899_0271370
2425 Ga0395899_0576025
2426 Ga0395900_0003484
2427 Ga0395900_0005403
2428 Ga0395900_0008039
2429 Ga0395900_0013982
2430 Ga0395900_0020785
2431 Ga0395900_0032892
2432 Ga0395900_0055275
2433 Ga0395900_0092866
2434 Ga0395900_0260483
2435 Ga0395900_0476283
2436 Ga0395900_0632917
2437 Ga0395898_0005726
2438 Ga0395898_0006566
2439 Ga0395898_0008907
2440 Ga0395898_0015727
2441 Ga0395898_0030358
2442 Ga0395898_0100928
2443 Ga0395898_0165459
2444 Ga0395898_0346098
2445 Ga0395898_0465826
2446 Ga0395898_0532919
2447 Ga0395898_0938964
2448 Ga0395898_1409829
2449 Ga0395898_1529062
2450 Ga0395905_0002297
2451 Ga0395905_0002950
2452 Ga0395905_0020250
2453 Ga0395905_0024606
2454 Ga0395905_0065936
2455 Ga0395905_0067751
2456 Ga0395905_0117805
2457 Ga0395905_0118322
2458 Ga0395905_0143538
2459 Ga0395905_1085993
2460 Ga0395905_1121377
2461 Ga0436364_0821737
2462 Ga0395901_0000608
2463 Ga0395901_0007743
2464 Ga0395901_0022332
2465 Ga0395901_0027614
2466 Ga0395901_0030522
2467 Ga0395901_0045595
2468 Ga0395901_0097478
2469 Ga0395901_0112528
2470 Ga0395901_0117176
2471 Ga0395901_0277699
2472 Ga0395901_0284901
2473 Ga0395901_0313804
2474 Ga0395901_0665864
2475 Ga0395901_0813527
2476 Ga0395901_0860493
2477 Ga0395901_0970755
2478 Ga0395901_1359367
2479 Ga0436365_0656028
2480 Ga0436360_0776362
2481 Ga0436363_0952217
2482 Ga0436362_0380053
2483 Ga0436362_1147745
2484 Ga0439465_0094326
2485 Ga0451807_1368180
2486 Ga0451833_0863113
2487 Ga0451839_0797568
2488 Ga0451853_3840200
2489 Ga0439456_026426
2490 Ga0450920_022902
2491 Ga0439458_0102334
2492 Ga0439444_0073923
2493 Ga0439460_0092680
2494 Ga0451577_1389975
2495 Ga0466969_0004507
2496 Ga0466969_0010275
2497 Ga0466969_0091539
2498 Ga0466972_0046231
2499 Ga0466972_0213288
2500 Ga0466972_0223562
2501 Ga0466965_0024494
2502 Ga0466965_0051753
2503 Ga0466966_0009082
2504 Ga0466966_0010536
2505 Ga0466966_0026245
2506 Ga0466966_0068631
2507 Ga0466966_0171730
2508 Ga0466966_0667460
2509 Ga0466961_0009633
2510 Ga0466961_0026261
2511 Ga0466961_0026772
2512 Ga0466961_0125361
2513 Ga0466961_0338604
2514 Ga0466961_0457038
2515 Ga0466963_0003701
2516 Ga0466963_0004189
2517 Ga0466963_0004471
2518 Ga0466963_0014876
2519 Ga0466963_0021567
2520 Ga0466963_0045882
2521 Ga0466963_0063742
2522 Ga0466963_0101421
2523 Ga0466963_0159350
2524 Ga0466963_0207834
2525 Ga0466963_0237225
2526 Ga0466963_0247612
2527 Ga0466963_0406939
2528 Ga0466963_0503319
2529 Ga0466963_0553379
2530 Ga0466963_0654516
2531 Ga0466963_0852651
2532 Ga0466964_0013102
2533 Ga0466964_0110831
2534 Ga0466964_0156465
2535 Ga0466964_0196636
2536 Ga0466964_0208338
2537 Ga0466964_0235949
2538 Ga0466964_0274808
2539 Ga0466971_0000811
2540 Ga0466971_0029937
2541 Ga0466971_0176300
2542 Ga0466968_0001383
2543 Ga0466968_0008580
2544 Ga0466968_0412375
2545 Ga0466970_0013070
2546 Ga0466970_0044329
2547 Ga0466970_0166158
2548 Ga0466957_0005732
2549 Ga0466957_0017579
2550 Ga0466957_0027729
2551 Ga0466957_0028136
2552 Ga0466957_0038491
2553 Ga0466957_0053073
2554 Ga0466957_0063308
2555 Ga0466957_0186843
2556 Ga0466957_0272997
2557 Ga0466960_0006002
2558 Ga0466959_0005002
2559 Ga0466959_0005947
2560 Ga0466959_0025018
2561 Ga0466959_0027957
2562 Ga0466959_0128359
2563 Ga0466959_0258199
2564 Ga0466959_0688490
2565 Ga0466958_0004460
2566 Ga0466958_0012842
2567 Ga0466958_0021604
2568 Ga0466958_0036844
2569 Ga0466958_0054902
2570 Ga0466958_0078285
2571 Ga0466958_0100437
2572 Ga0466958_0239482
2573 Ga0466958_0366278
2574 Ga0466967_0006451
2575 Ga0466967_0011148
2576 Ga0466967_0013513
2577 Ga0466967_0015715
2578 Ga0466967_0021669
2579 Ga0466967_0035150
2580 Ga0466967_0038721
2581 Ga0466967_0041751
2582 Ga0466967_0045124
2583 Ga0466967_0048763
2584 Ga0466967_0068371
2585 Ga0466967_0086049
2586 Ga0466967_0104259
2587 Ga0466967_0129685
2588 Ga0466967_0193253
2589 Ga0466967_0319700
2590 Ga0466967_0846890
2591 Ga0466967_1801184
2592 Ga0466967_2050243
2593 Ga0495592_0000082
2594 Ga0495592_0109231
2595 Ga0495592_0226657
2596 Ga0495592_0736525
2597 Ga0495603_0006416
2598 Ga0495603_0016906
2599 Ga0495603_0019605
2600 Ga0495603_0055549
2601 Ga0495603_0079401
2602 Ga0495603_0184050
2603 Ga0495629_0007529
2604 Ga0495629_0010957
2605 Ga0495629_0025764
2606 Ga0495629_0102512
2607 Ga0495629_0339656
2608 Ga0495629_0455326
2609 Ga0495629_0459346
2610 Ga0495629_0547591
2611 Ga0495629_0928086
2612 Ga0495638_0582878
2613 Ga0495641_0032439
2614 Ga0495641_0050947
2615 Ga0495641_0145703
2616 Ga0495641_0200396
2617 Ga0495651_0000254
2618 Ga0495651_0118119
2619 Ga0495651_0330441
2620 Ga0495653_0033226
2621 Ga0495653_0056045
2622 Ga0495653_0062040
2623 Ga0495653_0331519
2624 Ga0495580_0015356
2625 Ga0495580_0414083
2626 Ga0495580_0450201
2627 Ga0495582_0015545
2628 Ga0495582_0015963
2629 Ga0495582_0023288
2630 Ga0495582_0073875
2631 Ga0495582_0125969
2632 Ga0495582_0294629
2633 Ga0495582_0411421
2634 Ga0495582_0549023
2635 Ga0495605_0016774
2636 Ga0495639_0001278
2637 Ga0495639_0008210
2638 Ga0495639_0133036
2639 Ga0495639_0312500
2640 Ga0495662_0002354
2641 Ga0495662_0107155
2642 Ga0495664_0037746
2643 Ga0495664_0105295
2644 Ga0495664_0109398
2645 Ga0495664_0250652
2646 Ga0495664_0358547
2647 Ga0495664_0726659
2648 Ga0495584_0087083
2649 Ga0495584_0495897
2650 Ga0495584_0664631
2651 Ga0495585_0095394
2652 Ga0495594_0024508
2653 Ga0495594_0053590
2654 Ga0495594_0084112
2655 Ga0495594_0609334
2656 Ga0495596_0022588
2657 Ga0495596_0073391
2658 Ga0495596_0102679
2659 Ga0495596_0106757
2660 Ga0495607_0048502
2661 Ga0495607_0188969
2662 Ga0495607_0333120
2663 Ga0495608_0004089
2664 Ga0495608_0091613
2665 Ga0495608_0268406
2666 Ga0495608_0271781
2667 Ga0495608_0335761
2668 Ga0495618_0002754
2669 Ga0495618_0072183
2670 Ga0495618_0127546
2671 Ga0495618_0216426
2672 Ga0495620_0074733
2673 Ga0495628_0005951
2674 Ga0495628_0101878
2675 Ga0495628_0115368
2676 Ga0495628_0124383
2677 Ga0495628_0201504
2678 Ga0495630_0025613
2679 Ga0495630_0048821
2680 Ga0495630_0063085
2681 Ga0495630_0224548
2682 Ga0495630_0346156
2683 Ga0495630_0409240
2684 Ga0495630_0673763
2685 Ga0495630_0946211
2686 Ga0495637_0066058
2687 Ga0495637_0144781
2688 Ga0495644_0002786
2689 Ga0495644_0054640
2690 Ga0495644_0135363
2691 Ga0495644_0164875
2692 Ga0495663_0262423
2693 Ga0495666_0011435
2694 Ga0495666_0014313
2695 Ga0495642_0132537
2696 Ga0495642_0172573
2697 Ga0495652_0000144
2698 Ga0495652_0028166
2699 Ga0495652_0029633
2700 Ga0495652_0066760
2701 Ga0495652_0260278
2702 Ga0495652_0383841
2703 Ga0495652_0422562
2704 Ga0495654_0170806
2705 Ga0495665_0030850
2706 Ga0495665_0041398
2707 Ga0495640_0034587
2708 Ga0495640_0198122
2709 Ga0495586_0041582
2710 Ga0495586_0093460
2711 Ga0495587_0000060
2712 Ga0495587_0049059
2713 Ga0495587_0068914
2714 Ga0495587_0072977
2715 Ga0495587_0080158
2716 Ga0495587_0092874
2717 Ga0495598_0038241
2718 Ga0495609_0123311
2719 Ga0495609_0249949
2720 Ga0495645_0000038
2721 Ga0495645_0006731
2722 Ga0495645_0228928
2723 Ga0495645_0399325
2724 Ga0495622_0115122
2725 Ga0495667_0101587
2726 Ga0495667_0106308
2727 Ga0495667_0138363
2728 Ga0495656_0026801
2729 Ga0495656_0068571
2730 Ga0495656_0110469
2731 Ga0495668_0108621
2732 Ga0495634_0029831
2733 Ga0495634_0047853
2734 Ga0495634_0049693
2735 Ga0495634_0257353
2736 Ga0495634_0315289
2737 Ga0495634_0683320
2738 Ga0495611_0039072
2739 Ga0495635_0009523
2740 Ga0495635_0013153
2741 Ga0495635_0041858
2742 Ga0495635_0095636
2743 Ga0495635_0142819
2744 Ga0495635_0327008
2745 Ga0495659_0009389
2746 Ga0495659_0161914
2747 Ga0495659_0173365
2748 Ga0495659_0190402
2749 Ga0495661_0166056
2750 Ga0495588_0183108
2751 Ga0495588_0378415
2752 Ga0495588_0508561
2753 Ga0495588_0527774
2754 Ga0495657_0015397
2755 Ga0495657_0103474
2756 Ga0495657_0345580
2757 Ga0495657_0538100
2758 Ga0495599_0000048
2759 Ga0495599_0032178
2760 Ga0495599_0218968
2761 Ga0495599_0318156
2762 Ga0495623_0001647
2763 Ga0495623_0274569
2764 Ga0495623_0402171
2765 Ga0495646_0015156
2766 Ga0495646_0091567
2767 Ga0495646_0100604
2768 Ga0495646_0106134
2769 Ga0495647_0001533
2770 Ga0495647_0001646
2771 Ga0495647_0015581
2772 Ga0495647_0028628
2773 Ga0495647_0156005
2774 Ga0495647_0180326
2775 Ga0495658_0001182
2776 Ga0495658_0010111
2777 Ga0495658_0058066
2778 Ga0495658_0074539
2779 Ga0495658_0097970
2780 Ga0495658_0314540
2781 Ga0495658_0317888
2782 Ga0495658_0510153
2783 Ga0495658_0806690
2784 Ga0495613_0033317
2785 Ga0495613_0038260
2786 Ga0495613_0045117
2787 Ga0495613_0057564
2788 Ga0495624_0014707
2789 Ga0495624_0054293
2790 Ga0495624_0154463
2791 Ga0495670_0022603
2792 Ga0495670_0326546
2793 Ga0495670_0479709
2794 Ga0495671_0301212
2795 Ga0495649_0486087
2796 Ga0495589_0038706
2797 Ga0495589_0102899
2798 Ga0495589_0217337
2799 Ga0495589_0256981
2800 Ga0495600_0059326
2801 Ga0495600_0192117
2802 Ga0495600_0423693
2803 Ga0495600_0451787
2804 Ga0495660_0204466
2805 Ga0495660_0255255
2806 Ga0495581_0007592
2807 Ga0495581_0035922
2808 Ga0495581_0474985
2809 Ga0495581_0564153
2810 Ga0495604_0000043
2811 Ga0495604_0159747
2812 Ga0495604_0287193
2813 Ga0495604_0412910
2814 Ga0495604_0921317
2815 Ga0495636_0329448
2816 Ga0495674_0031987
2817 Ga0495674_0063357
2818 Ga0495674_0157644
2819 Ga0495674_0188984
2820 Ga0495674_0251882
2821 Ga0495674_0283417
2822 Ga0495674_0469375
2823 Ga0495674_0556665
2824 Ga0495674_0717293
2825 Ga0495676_0003238
2826 Ga0495676_0037011
2827 Ga0495676_0351535
2828 Ga0495676_0606602
2829 Ga0495676_0625607
2830 Ga0495680_0001621
2831 Ga0495680_0006421
2832 Ga0495680_0012966
2833 Ga0495680_0034460
2834 Ga0495680_0111639
2835 Ga0495680_0143144
2836 Ga0495680_0223492
2837 Ga0495683_0079607
2838 Ga0495675_0000413
2839 Ga0495675_0005668
2840 Ga0495677_0232428
2841 Ga0495684_0099684
2842 Ga0495684_0103614
2843 Ga0495684_0267993
2844 Ga0495684_0358541
2845 Ga0495593_0008203
2846 Ga0495593_0008597
2847 Ga0495593_0074431
2848 Ga0495593_0412386
2849 Ga0495602_0008483
2850 Ga0495602_0016733
2851 Ga0495602_0273214
2852 Ga0495602_0427376
2853 Ga0495602_0611426
2854 Ga0495614_0006192
2855 Ga0495614_0035419
2856 Ga0495614_0285238
2857 Ga0495614_0307288
2858 Ga0495615_0156671
2859 Ga0495626_0264478
2860 Ga0496100_0025042
2861 Ga0496100_0094937
2862 Ga0496100_0134046
2863 Ga0496100_0349598
2864 Ga0496100_0372299
2865 Ga0496100_0389514
2866 Ga0496100_0594120
2867 Ga0496101_0000625
2868 Ga0496101_0001765
2869 Ga0496101_0019351
2870 Ga0496101_0026566
2871 Ga0496101_0108464
2872 Ga0496101_0190110
2873 Ga0496101_0205860
2874 Ga0496101_0287296
2875 Ga0496101_0560345
2876 Ga0496101_0568248
2877 Ga0496101_0706513
2878 Ga0496101_1130989
2879 Ga0496102_0003464
2880 Ga0496102_0004850
2881 Ga0496102_0009140
2882 Ga0496102_0010068
2883 Ga0496102_0010768
2884 Ga0496102_0108024
2885 Ga0496102_0192503
2886 Ga0496102_0199799
2887 Ga0496102_0213831
2888 Ga0496102_0511500
2889 Ga0496102_0785822
2890 Ga0496102_1059488
2891 Ga0496103_0000427
2892 Ga0496103_0004657
2893 Ga0496103_0028417
2894 Ga0496103_0063793
2895 Ga0496103_0064919
2896 Ga0496103_0091724
2897 Ga0496103_0561292
2898 Ga0496104_0016549
2899 Ga0496104_0016872
2900 Ga0496104_0077315
2901 Ga0496104_0088244
2902 Ga0496104_0120426
2903 Ga0496104_0168519
2904 Ga0496104_0186929
2905 Ga0496104_0308408
2906 Ga0496104_0354789
2907 Ga0496104_0686984
2908 Ga0496104_0979325
2909 Ga0496104_1029384
2910 Ga0496105_0003116
2911 Ga0496105_0006964
2912 Ga0496105_0022559
2913 Ga0496105_0030137
2914 Ga0496105_0034600
2915 Ga0496105_0047956
2916 Ga0496105_0097943
2917 Ga0496105_0157072
2918 Ga0496105_0216393
2919 Ga0496106_0000838
2920 Ga0496106_0002532
2921 Ga0496106_0011768
2922 Ga0496106_0108030
2923 Ga0496106_0395856
2924 Ga0496106_0428982
2925 Ga0496106_1373478
2926 Ga0496107_0000371
2927 Ga0496107_0000608
2928 Ga0496107_0001409
2929 Ga0496107_0031040
2930 Ga0496107_0085656
2931 Ga0496107_0238090
2932 Ga0496107_0288475
2933 Ga0496107_0411333
2934 Ga0496107_0457669
2935 Ga0496107_0774976
2936 Ga0496107_0866342
2937 Ga0496108_0005123
2938 Ga0496108_0007474
2939 Ga0496108_0025543
2940 Ga0496108_0055197
2941 Ga0496108_0056915
2942 Ga0496108_0086072
2943 Ga0496108_0100883
2944 Ga0496108_0190683
2945 Ga0496108_0243139
2946 Ga0496108_0336111
2947 Ga0496108_0486565
2948 Ga0496108_0964377
2949 Ga0496108_1046988
2950 Ga0496109_0010043
2951 Ga0496109_0010864
2952 Ga0496109_0011904
2953 Ga0496109_0012268
2954 Ga0496109_0016215
2955 Ga0496109_0016233
2956 Ga0496109_0037498
2957 Ga0496109_0039111
2958 Ga0496109_0050409
2959 Ga0496109_0060980
2960 Ga0496109_0080705
2961 Ga0496109_0232009
2962 Ga0496109_0370753
2963 Ga0496109_0415147
2964 Ga0496109_0687536
2965 Ga0496109_0704036
2966 Ga0496109_0787284
2967 Ga0496109_0889996
2968 Ga0496109_1412214
2969 Ga0496109_1490485
2970 Ga0496110_0004734
2971 Ga0496110_0005775
2972 Ga0496110_0006738
2973 Ga0496110_0038727
2974 Ga0496110_0064467
2975 Ga0496110_0129343
2976 Ga0496110_0167951
2977 Ga0496110_0193797
2978 Ga0496110_0207284
2979 Ga0496110_0289107
2980 Ga0496110_0317347
2981 Ga0496110_0492411
2982 Ga0496110_0638024
2983 Ga0496111_0002804
2984 Ga0496111_0009880
2985 Ga0496111_0030027
2986 Ga0496111_0031386
2987 Ga0496111_0057802
2988 Ga0496111_0061008
2989 Ga0496111_0063988
2990 Ga0496111_0084993
2991 Ga0496111_0086746
2992 Ga0496111_0362835
2993 Ga0496111_0401370
2994 Ga0496111_0480939
2995 Ga0496112_0010312
2996 Ga0496112_0027854
2997 Ga0496112_0030237
2998 Ga0496112_0037958
2999 Ga0496112_0044267
3000 Ga0496112_0047964
3001 Ga0496112_0048601
3002 Ga0496112_0111345
3003 Ga0496112_0262344
3004 Ga0496112_0292611
3005 Ga0496112_0349409
3006 Ga0496112_0895789
3007 Ga0496112_1005313
3008 Ga0496112_1411723
3009 Ga0496112_1492253
3010 Ga0496113_0123253
3011 Ga0496113_0220680
3012 Ga0496113_0241059
3013 Ga0496113_0302301
3014 Ga0496113_0348586
3015 Ga0496113_0572668
3016 Ga0496113_1028267
3017 Ga0496114_0014447
3018 Ga0496114_0019217
3019 Ga0496114_0022546
3020 Ga0496114_0046348
3021 Ga0496114_0061744
3022 Ga0496114_0092491
3023 Ga0496114_0104736
3024 Ga0496114_0118246
3025 Ga0496114_0294417
3026 Ga0496114_0405936
3027 Ga0496114_0715449
3028 Ga0496114_0818620
3029 Ga0496114_1108428
3030 Ga0496114_1379516
3031 Ga0496115_0039590
3032 Ga0496115_0052111
3033 Ga0496115_0080599
3034 Ga0496115_0104564
3035 Ga0496115_0310946
3036 Ga0496115_0474100
3037 Ga0496115_0521457
3038 Ga0501031_0559054
3039 Ga0501031_0982461
3040 Ga0501032_0042828
3041 Ga0501032_0043872
3042 Ga0501033_0071104
3043 Ga0501034_0045090
3044 Ga0501036_0139906
3045 Ga0501037_0490125
3046 Ga0501038_0002469
3047 Ga0501038_0860751
3048 Ga0501039_0401762
3049 Ga0501039_0662899
3050 Ga0501040_0003658
3051 Ga0501040_0156035
3052 Ga0501040_0601505
3053 Ga0501040_0763508
3054 Ga0501041_0004418
3055 Ga0501041_0169685
3056 Ga0501042_0000667
3057 Ga0501043_0005069
3058 Ga0501043_1001967
3059 Ga0501048_0014271
3060 Ga0501048_0260084
3061 Ga0501048_0634802
3062 Ga0501067_0036280
3063 Ga0501067_0051224
3064 Ga0501067_0127758
3065 Ga0501067_0217258
3066 Ga0501068_0015065
3067 Ga0501068_0029375
3068 Ga0501068_0187153
3069 Ga0501068_0735983
3070 Ga0501069_0008120
3071 Ga0501069_0052921
3072 Ga0501069_0063548
3073 Ga0501070_0071043
3074 Ga0501070_0273145
3075 Ga0501070_0345058
3076 Ga0501071_0007796
3077 Ga0501071_0193736
3078 Ga0501071_0522853
3079 Ga0501071_0764828
3080 Ga0501072_0072741
3081 Ga0501072_0374017
3082 Ga0501072_0589893
3083 Ga0501072_0705655
3084 Ga0501073_0068922
3085 Ga0501074_0007535
3086 Ga0501074_0014796
3087 Ga0501074_0546640
3088 Ga0501075_0002769
3089 Ga0501075_0184386
3090 Ga0501075_0437690
3091 Ga0501075_1244986
3092 Ga0501076_0010351
3093 Ga0501076_0455143
3094 Ga0501076_0621957
3095 Ga0501076_0645605
3096 Ga0501076_0821038
3097 Ga0501077_0021232
3098 Ga0501077_0029478
3099 Ga0501261_112525
3100 Ga0501225_0209194
3101 Ga0501079_0008491
3102 Ga0501079_0022136
3103 Ga0501080_0022647
3104 Ga0501080_0769264
3105 Ga0501081_0007966
3106 Ga0501081_0028001
3107 Ga0501083_0002257
3108 Ga0501035_0014204
3109 Ga0501044_0293432
3110 Ga0501045_0009808
3111 nmdc:mga03683_47425_c1
3112 nmdc:mga00v17_141770_c1
3113 nmdc:mga00v17_91256_c1
3114 nmdc:mga0yw44_190072_c1
3115 nmdc:mga0yw44_313445_c1
3116 nmdc:mga06z11_496463_c1
3117 nmdc:mga05p37_140955_c1
3118 nmdc:mga05p37_300216_c1
3119 nmdc:mga05p37_345361_c1
3120 nmdc:mga05p37_490630_c1
3121 nmdc:mga09592_67999_c1
3122 nmdc:mga0qj67_290980_c1
3123 nmdc:mga0qj67_364472_c1
3124 nmdc:mga06r32_163204_c1
3125 nmdc:mga06r32_262122_c1
3126 nmdc:mga06r32_702455_c1
3127 nmdc:mga08y16_107169_c1
3128 nmdc:mga08y16_376843_c1
3129 nmdc:mga08y16_941299_c1
3130 nmdc:mga0n895_56037_c1
3131 nmdc:mga0n895_90972_c1
3132 nmdc:mga0rr50_153180_c1
3133 nmdc:mga0rr50_89406_c1
3134 nmdc:mga08x19_1111876_c1
3135 nmdc:mga0a205_279421_c1
3136 nmdc:mga0a205_82813_c1
3137 Ga0495601_0002689
3138 Ga0495601_0070924
3139 Ga0495601_0071802
3140 Ga0495601_0105098
3141 Ga0495601_0128380
3142 Ga0495601_0132710
3143 Ga0495601_0179307
3144 Ga0495601_0210324
3145 Ga0495612_0007861
3146 Ga0495612_0038529
3147 Ga0495655_0011457
3148 Ga0495655_0196562
3149 Ga0495595_0087956
3150 Ga0495595_0217012
3151 Ga0495595_0534599
3152 Ga0495595_0745344
3153 Ga0495619_0005446
3154 Ga0495619_0006219
3155 Ga0495619_0081789
3156 Ga0495619_0087481
3157 Ga0495619_0088932
3158 Ga0495619_0129198
3159 Ga0495619_0191522
3160 Ga0495619_0571896
3161 Ga0495619_0605118
3162 Ga0500566_0036462
3163 Ga0500566_0524119
3164 Ga0501084_0001291
3165 Ga0501084_0102325
3166 Ga0501084_0628377
3167 Ga0501084_0635174
3168 Ga0587083_0067294
3169 Ga0587106_048776
3170 Ga0587114_021939
3171 Ga0587111_0073607
3172 Ga0587111_0105233
3173 Ga0501082_0030517
3174 Ga0501082_0417661
3175 Ga0501082_0640043
3176 Ga0501082_0836609
3177 Ga0466962_0004844
3178 Ga0466962_0012692
3179 Ga0466962_0018284
3180 Ga0466962_0230446
3181 Ga0466962_0384634
3182 Ga0530510_0025910
3183 Ga0530510_0191533
3184 Ga0530510_0208652
3185 Ga0530510_0346845
3186 Ga0530510_0422621
3187 Ga0530510_0671316
3188 Ga0530510_0683938
3189 Ga0530510_1045233
3190 Ga0530510_1361355

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00177

Ribosomal_S7

Ribosomal protein S7p/S5e

38

185

0.97

Structural Annotation

Top 5 Hits

ID Description Score Start End
8cgi-assembly1.cif.gz_G pentacycline tp038 bound to the 30s head 0.9807 10 124
8ca7-assembly1.cif.gz_G omadacycline and spectinomycin bound to the 30s ribosomal subunit head 0.9796 14 126
7nhl-assembly1.cif.gz_h vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus 0.9743 12 151
7nhn-assembly1.cif.gz_h vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes 0.973 12 151
7m4z-assembly1.cif.gz_g a. baumannii ribosome-eravacycline complex: hpf-bound 70s 0.9721 2 150
ID Description Score Start End Superfamily
5x8rg00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.955 4 151 1.10.455.10
af_P26783_20_225_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9526 22 148 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9518 2 156 1.10.455.10
1husA00 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9492 10 147 1.10.455.10
af_P48940_2_156_1.10.455.10 Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 0.9458 2 156 1.10.455.10
ID Description Score Start End GO Terms
AF-A0A7Y2PLF6-F1-model_v4 Ribosomal protein S7 0.9881 13 148 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A355GRF5-F1-model_v4 30S ribosomal protein S7 0.9877 52 145 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-A0A2H0WRL7-F1-model_v4 30S ribosomal protein S7 0.9819 3 138 GO:0003735
GO:0006412
GO:0015935
GO:0019843
AF-K2ATG9-F1-model_v4 30S ribosomal protein S7P RpsG 0.9783 3 94 GO:0005840
GO:0006412
GO:1990904
AF-A0A7X6UDU5-F1-model_v4 30S ribosomal protein S7 0.975 1 139 GO:0003735
GO:0006412
GO:0015935
GO:0019843

Map