F494962
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1595 | 460 | 3190 | 156 |
Family's Representative Sequence
| Representative Sequence | 3300020081|Ga0206354_11410044|Ga0206354_114100441 |
| Length | 192 |
| Sequence | MSAIMNWIAWFFPIGCPNASRCAAYFTDSSTQPCASPTASAEIAIRPVDADPVYSSRLVSQLINRVMLDGKRSTAEKIVYGALDRVGQKTGKPPVDVLEQAVKSVTPVLEVRSRRVGGANYQVPVEVPQRRARTLAVRWLVTFSRQRREKEMHEKLAAEILDASNQQGGAYKKKDDIYRMAQANKAFAHYRW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 2 | 3300002070 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 7 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 16 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 36 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 47 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 48 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 49 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 51 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 54 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 55 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 56 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 59 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 64 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 66 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 67 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 68 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 70 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 71 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 72 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 73 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 74 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 75 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 76 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 77 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 78 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 79 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 80 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 81 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 83 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 84 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 90 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 91 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 92 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 93 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 94 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 95 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 96 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 97 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 98 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 99 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 100 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 101 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 103 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 117 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 118 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 129 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 133 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 141 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300025227 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in- M7 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 209 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 213 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 215 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 216 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 217 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 220 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 223 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 225 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 226 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 227 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 228 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 230 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 231 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 232 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 233 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 234 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 235 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 236 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 237 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 238 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 239 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 240 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 241 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 242 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 243 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 244 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 245 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 246 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 247 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 250 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 254 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 255 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 256 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 257 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 258 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 260 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 261 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 262 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 263 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 264 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 265 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 266 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 267 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 268 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 269 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 270 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 271 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 272 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 273 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 274 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 275 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 276 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 277 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 278 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 279 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 280 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 281 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 282 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 283 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 284 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 285 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 286 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 287 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 288 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 289 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 290 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 291 | 3300042437 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 | Metagenome | Rhizosphere |
| 292 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 293 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 294 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 295 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 296 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 297 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 298 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 299 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 300 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 301 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 302 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 303 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 304 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 305 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 306 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 307 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 308 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 309 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 385 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 386 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 387 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 388 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 389 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 390 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 391 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 392 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 393 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 394 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 395 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 396 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 397 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 398 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 399 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 400 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 401 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 406 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 407 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 410 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 411 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 420 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 421 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 422 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 423 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 424 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 426 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 427 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 428 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 429 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 430 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 431 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 432 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 433 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 434 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 435 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 436 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 437 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 438 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 441 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 442 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 443 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 444 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 445 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 448 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 449 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 450 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 452 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 453 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 454 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 455 | 3300059605 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 456 | 3300059655 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 457 | 3300060346 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 458 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 459 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 460 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99 |
| Metatranscriptomes | 1 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.75 |
| Nodule | 0 |
| Rhizoplane | 11.22 |
| Rhizosphere | 87.65 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.19 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0206354_11410044 | 3300020081 | Bacteria | 761 |
| 2 | JGI24750J21931_1007751 | 3300002070 | Bacteria | 1355 |
| 3 | JGI24745J21846_1022792 | 3300002073 | Unclassified | 740 |
| 4 | JGI24749J21850_1008744 | 3300002076 | Bacteria | 1413 |
| 5 | JGI24744J21845_10055980 | 3300002077 | Unclassified | 724 |
| 6 | JGI24742J22300_10043870 | 3300002244 | Unclassified | 800 |
| 7 | Ga0058863_10051448 | 3300004799 | Bacteria | 1470 |
| 8 | Ga0070658_10012196 | 3300005327 | Bacteria | 6898 |
| 9 | Ga0070658_10040720 | 3300005327 | Bacteria | 3748 |
| 10 | Ga0070658_10087565 | 3300005327 | Bacteria | 2563 |
| 11 | Ga0070658_10288287 | 3300005327 | Bacteria | 1399 |
| 12 | Ga0070676_10026558 | 3300005328 | Bacteria | 3279 |
| 13 | Ga0070683_100009431 | 3300005329 | Bacteria | 8347 |
| 14 | Ga0070683_100562461 | 3300005329 | Bacteria | 1090 |
| 15 | Ga0070690_100020038 | 3300005330 | Bacteria | 4071 |
| 16 | Ga0070670_100124734 | 3300005331 | Bacteria | 2223 |
| 17 | Ga0070670_101389383 | 3300005331 | Bacteria | 644 |
| 18 | Ga0068869_101021318 | 3300005334 | Bacteria | 721 |
| 19 | Ga0070666_10208582 | 3300005335 | Bacteria | 1376 |
| 20 | Ga0070680_100129344 | 3300005336 | Bacteria | 2111 |
| 21 | Ga0070680_100159764 | 3300005336 | Bacteria | 1893 |
| 22 | Ga0070680_100403331 | 3300005336 | Bacteria | 1165 |
| 23 | Ga0070680_100447146 | 3300005336 | Bacteria | 1103 |
| 24 | Ga0070680_100522193 | 3300005336 | Bacteria | 1016 |
| 25 | Ga0070682_100004124 | 3300005337 | Bacteria | 8062 |
| 26 | Ga0070682_100122111 | 3300005337 | Bacteria | 1751 |
| 27 | Ga0070682_100146514 | 3300005337 | Bacteria | 1615 |
| 28 | Ga0070682_100241243 | 3300005337 | Bacteria | 1297 |
| 29 | Ga0070682_100247756 | 3300005337 | Bacteria | 1283 |
| 30 | Ga0068868_100147177 | 3300005338 | Bacteria | 1937 |
| 31 | Ga0068868_100167952 | 3300005338 | Bacteria | 1815 |
| 32 | Ga0068868_100298164 | 3300005338 | Bacteria | 1368 |
| 33 | Ga0068868_100345334 | 3300005338 | Bacteria | 1273 |
| 34 | Ga0068868_100539533 | 3300005338 | Bacteria | 1026 |
| 35 | Ga0070660_100030791 | 3300005339 | Bacteria | 4026 |
| 36 | Ga0070660_100089485 | 3300005339 | Bacteria | 2425 |
| 37 | Ga0070660_100185845 | 3300005339 | Bacteria | 1682 |
| 38 | Ga0070660_100304781 | 3300005339 | Bacteria | 1306 |
| 39 | Ga0070660_100457234 | 3300005339 | Bacteria | 1060 |
| 40 | Ga0070660_101022145 | 3300005339 | Bacteria | 699 |
| 41 | Ga0070689_100019147 | 3300005340 | Bacteria | 5057 |
| 42 | Ga0070689_100024547 | 3300005340 | Bacteria | 4523 |
| 43 | Ga0070689_100469387 | 3300005340 | Bacteria | 1073 |
| 44 | Ga0070691_10319457 | 3300005341 | Bacteria | 854 |
| 45 | Ga0070687_100129359 | 3300005343 | Bacteria | 1456 |
| 46 | Ga0070661_100741583 | 3300005344 | Bacteria | 802 |
| 47 | Ga0070661_101085076 | 3300005344 | Bacteria | 667 |
| 48 | Ga0070692_10026768 | 3300005345 | Bacteria | 2853 |
| 49 | Ga0070692_10091713 | 3300005345 | Bacteria | 1653 |
| 50 | Ga0070692_10697900 | 3300005345 | Bacteria | 683 |
| 51 | Ga0070668_100082401 | 3300005347 | Bacteria | 2523 |
| 52 | Ga0070668_100091956 | 3300005347 | Bacteria | 2392 |
| 53 | Ga0070668_100400625 | 3300005347 | Bacteria | 1172 |
| 54 | Ga0070669_100064711 | 3300005353 | Bacteria | 2693 |
| 55 | Ga0070675_100324428 | 3300005354 | Bacteria | 1361 |
| 56 | Ga0070675_100339337 | 3300005354 | Bacteria | 1331 |
| 57 | Ga0070671_100042707 | 3300005355 | Bacteria | 3769 |
| 58 | Ga0070671_100163329 | 3300005355 | Bacteria | 1882 |
| 59 | Ga0070671_100164883 | 3300005355 | Bacteria | 1873 |
| 60 | Ga0070671_100299707 | 3300005355 | Bacteria | 1369 |
| 61 | Ga0070674_100034154 | 3300005356 | Bacteria | 3394 |
| 62 | Ga0070674_100420232 | 3300005356 | Bacteria | 1097 |
| 63 | Ga0070674_100805184 | 3300005356 | Bacteria | 812 |
| 64 | Ga0070673_101009776 | 3300005364 | Bacteria | 775 |
| 65 | Ga0070673_101061773 | 3300005364 | Bacteria | 756 |
| 66 | Ga0070688_100021514 | 3300005365 | Bacteria | 3768 |
| 67 | Ga0070688_100132110 | 3300005365 | Bacteria | 1686 |
| 68 | Ga0070688_100504006 | 3300005365 | Bacteria | 913 |
| 69 | Ga0070688_100533792 | 3300005365 | Bacteria | 890 |
| 70 | Ga0070688_100763351 | 3300005365 | Bacteria | 754 |
| 71 | Ga0070659_100048560 | 3300005366 | Bacteria | 3334 |
| 72 | Ga0070659_100093044 | 3300005366 | Bacteria | 2419 |
| 73 | Ga0070659_100149681 | 3300005366 | Bacteria | 1903 |
| 74 | Ga0070659_100212804 | 3300005366 | Bacteria | 1593 |
| 75 | Ga0070659_101223843 | 3300005366 | Bacteria | 664 |
| 76 | Ga0070667_100290632 | 3300005367 | Bacteria | 1470 |
| 77 | Ga0070667_101029486 | 3300005367 | Bacteria | 769 |
| 78 | Ga0070709_10268498 | 3300005434 | Bacteria | 1235 |
| 79 | Ga0070709_10301985 | 3300005434 | Bacteria | 1169 |
| 80 | Ga0070709_11217407 | 3300005434 | Bacteria | 605 |
| 81 | Ga0070714_100016722 | 3300005435 | Bacteria | 5931 |
| 82 | Ga0070714_100035324 | 3300005435 | Bacteria | 4189 |
| 83 | Ga0070714_100061187 | 3300005435 | Bacteria | 3233 |
| 84 | Ga0070714_100130737 | 3300005435 | Bacteria | 2243 |
| 85 | Ga0070714_100501441 | 3300005435 | Bacteria | 1158 |
| 86 | Ga0070714_100525679 | 3300005435 | Bacteria | 1130 |
| 87 | Ga0070714_100993743 | 3300005435 | Bacteria | 816 |
| 88 | Ga0070714_101047255 | 3300005435 | Bacteria | 794 |
| 89 | Ga0070714_101243807 | 3300005435 | Bacteria | 726 |
| 90 | Ga0070714_101405067 | 3300005435 | Bacteria | 681 |
| 91 | Ga0070713_100043779 | 3300005436 | Bacteria | 3662 |
| 92 | Ga0070713_100297409 | 3300005436 | Bacteria | 1485 |
| 93 | Ga0070713_100861019 | 3300005436 | Bacteria | 870 |
| 94 | Ga0070713_100907466 | 3300005436 | Bacteria | 847 |
| 95 | Ga0070713_100909427 | 3300005436 | Bacteria | 847 |
| 96 | Ga0070713_100913959 | 3300005436 | Bacteria | 844 |
| 97 | Ga0070710_10005272 | 3300005437 | Bacteria | 6129 |
| 98 | Ga0070710_10015456 | 3300005437 | Bacteria | 3865 |
| 99 | Ga0070710_10383119 | 3300005437 | Bacteria | 938 |
| 100 | Ga0070710_10615351 | 3300005437 | Bacteria | 757 |
| 101 | Ga0070701_10002177 | 3300005438 | Bacteria | 7466 |
| 102 | Ga0070701_10013227 | 3300005438 | Bacteria | 3748 |
| 103 | Ga0070701_10134758 | 3300005438 | Bacteria | 1406 |
| 104 | Ga0070701_10338970 | 3300005438 | Bacteria | 936 |
| 105 | Ga0070701_10394283 | 3300005438 | Bacteria | 875 |
| 106 | Ga0070711_100004345 | 3300005439 | Bacteria | 8347 |
| 107 | Ga0070711_100007994 | 3300005439 | Bacteria | 6455 |
| 108 | Ga0070711_100063227 | 3300005439 | Bacteria | 2582 |
| 109 | Ga0070711_100405473 | 3300005439 | Bacteria | 1107 |
| 110 | Ga0070705_100050664 | 3300005440 | Bacteria | 2417 |
| 111 | Ga0070705_100053354 | 3300005440 | Bacteria | 2366 |
| 112 | Ga0070705_100424647 | 3300005440 | Bacteria | 991 |
| 113 | Ga0070705_100710338 | 3300005440 | Bacteria | 791 |
| 114 | Ga0070705_100743779 | 3300005440 | Bacteria | 774 |
| 115 | Ga0070700_100052619 | 3300005441 | Bacteria | 2539 |
| 116 | Ga0070700_101085790 | 3300005441 | Bacteria | 662 |
| 117 | Ga0070694_101140385 | 3300005444 | Bacteria | 651 |
| 118 | Ga0070708_100120562 | 3300005445 | Bacteria | 2419 |
| 119 | Ga0070708_100130291 | 3300005445 | Bacteria | 2327 |
| 120 | Ga0070708_100512401 | 3300005445 | Bacteria | 1132 |
| 121 | Ga0070663_100097993 | 3300005455 | Bacteria | 2183 |
| 122 | Ga0070663_100559814 | 3300005455 | Bacteria | 957 |
| 123 | Ga0070663_100781193 | 3300005455 | Bacteria | 818 |
| 124 | Ga0070678_100007082 | 3300005456 | Bacteria | 6631 |
| 125 | Ga0070678_100026391 | 3300005456 | Bacteria | 3926 |
| 126 | Ga0070678_100041054 | 3300005456 | Bacteria | 3277 |
| 127 | Ga0070678_100140695 | 3300005456 | Bacteria | 1931 |
| 128 | Ga0070678_100174608 | 3300005456 | Bacteria | 1753 |
| 129 | Ga0070678_101008228 | 3300005456 | Bacteria | 765 |
| 130 | Ga0070662_100400493 | 3300005457 | Bacteria | 1133 |
| 131 | Ga0070681_10015901 | 3300005458 | Bacteria | 7502 |
| 132 | Ga0070681_10180313 | 3300005458 | Bacteria | 2033 |
| 133 | Ga0070681_10242111 | 3300005458 | Bacteria | 1717 |
| 134 | Ga0070681_10279107 | 3300005458 | Bacteria | 1581 |
| 135 | Ga0070681_10393115 | 3300005458 | Bacteria | 1297 |
| 136 | Ga0070681_10961260 | 3300005458 | Bacteria | 773 |
| 137 | Ga0068867_100005177 | 3300005459 | Bacteria | 9200 |
| 138 | Ga0068867_100028426 | 3300005459 | Bacteria | 4026 |
| 139 | Ga0068867_100082863 | 3300005459 | Bacteria | 2420 |
| 140 | Ga0070685_10001884 | 3300005466 | Bacteria | 10938 |
| 141 | Ga0070685_10007752 | 3300005466 | Bacteria | 5496 |
| 142 | Ga0070685_10042725 | 3300005466 | Bacteria | 2588 |
| 143 | Ga0070706_100123350 | 3300005467 | Bacteria | 2415 |
| 144 | Ga0070706_100708057 | 3300005467 | Bacteria | 934 |
| 145 | Ga0070707_100001557 | 3300005468 | Bacteria | 22299 |
| 146 | Ga0070707_100033363 | 3300005468 | Bacteria | 4909 |
| 147 | Ga0070707_100163694 | 3300005468 | Bacteria | 2168 |
| 148 | Ga0070707_100417308 | 3300005468 | Bacteria | 1302 |
| 149 | Ga0070707_101100559 | 3300005468 | Bacteria | 760 |
| 150 | Ga0070707_101320915 | 3300005468 | Bacteria | 687 |
| 151 | Ga0070698_100024862 | 3300005471 | Bacteria | 6244 |
| 152 | Ga0070698_100062258 | 3300005471 | Bacteria | 3764 |
| 153 | Ga0070698_100073464 | 3300005471 | Bacteria | 3426 |
| 154 | Ga0070698_100837530 | 3300005471 | Bacteria | 864 |
| 155 | Ga0070698_100974598 | 3300005471 | Bacteria | 795 |
| 156 | Ga0070679_100020719 | 3300005530 | Bacteria | 6415 |
| 157 | Ga0070679_100250004 | 3300005530 | Bacteria | 1729 |
| 158 | Ga0070684_100023316 | 3300005535 | Bacteria | 5174 |
| 159 | Ga0070684_100024998 | 3300005535 | Bacteria | 5015 |
| 160 | Ga0070684_100076862 | 3300005535 | Bacteria | 2948 |
| 161 | Ga0070684_100158664 | 3300005535 | Bacteria | 2051 |
| 162 | Ga0070684_100161559 | 3300005535 | Bacteria | 2032 |
| 163 | Ga0070684_100482407 | 3300005535 | Bacteria | 1148 |
| 164 | Ga0070684_100599006 | 3300005535 | Bacteria | 1024 |
| 165 | Ga0070684_100735482 | 3300005535 | Bacteria | 920 |
| 166 | Ga0070684_101175437 | 3300005535 | Bacteria | 721 |
| 167 | Ga0070697_100106408 | 3300005536 | Bacteria | 2333 |
| 168 | Ga0070697_100390518 | 3300005536 | Bacteria | 1206 |
| 169 | Ga0070697_101408160 | 3300005536 | Bacteria | 622 |
| 170 | Ga0068853_100010960 | 3300005539 | Bacteria | 7347 |
| 171 | Ga0070672_100005416 | 3300005543 | Bacteria | 8455 |
| 172 | Ga0070672_100160201 | 3300005543 | Bacteria | 1866 |
| 173 | Ga0070672_101356177 | 3300005543 | Bacteria | 636 |
| 174 | Ga0070686_100001859 | 3300005544 | Bacteria | 11768 |
| 175 | Ga0070686_100020981 | 3300005544 | Bacteria | 3876 |
| 176 | Ga0070686_100056299 | 3300005544 | Bacteria | 2522 |
| 177 | Ga0070686_100119066 | 3300005544 | Bacteria | 1811 |
| 178 | Ga0070695_100002689 | 3300005545 | Bacteria | 10291 |
| 179 | Ga0070695_100667050 | 3300005545 | Bacteria | 822 |
| 180 | Ga0070695_100853405 | 3300005545 | Bacteria | 733 |
| 181 | Ga0070696_100167693 | 3300005546 | Bacteria | 1621 |
| 182 | Ga0070696_100686087 | 3300005546 | Bacteria | 834 |
| 183 | Ga0070696_100944378 | 3300005546 | Bacteria | 717 |
| 184 | Ga0070693_100004830 | 3300005547 | Bacteria | 6426 |
| 185 | Ga0070693_100110585 | 3300005547 | Bacteria | 1689 |
| 186 | Ga0070693_100555336 | 3300005547 | Bacteria | 822 |
| 187 | Ga0070665_100572070 | 3300005548 | Bacteria | 1143 |
| 188 | Ga0070665_100752407 | 3300005548 | Bacteria | 987 |
| 189 | Ga0070704_100093364 | 3300005549 | Bacteria | 2248 |
| 190 | Ga0070704_100312493 | 3300005549 | Bacteria | 1313 |
| 191 | Ga0070704_100494141 | 3300005549 | Bacteria | 1061 |
| 192 | Ga0070704_101594938 | 3300005549 | Bacteria | 602 |
| 193 | Ga0068855_100443891 | 3300005563 | Bacteria | 1416 |
| 194 | Ga0070664_100045258 | 3300005564 | Bacteria | 3717 |
| 195 | Ga0070664_100071090 | 3300005564 | Bacteria | 2981 |
| 196 | Ga0070664_100081626 | 3300005564 | Bacteria | 2787 |
| 197 | Ga0070664_100109052 | 3300005564 | Bacteria | 2414 |
| 198 | Ga0068857_100018953 | 3300005577 | Bacteria | 6037 |
| 199 | Ga0068857_100227757 | 3300005577 | Bacteria | 1704 |
| 200 | Ga0068857_101308443 | 3300005577 | Bacteria | 703 |
| 201 | Ga0068854_100076095 | 3300005578 | Bacteria | 2466 |
| 202 | Ga0068856_100014179 | 3300005614 | Bacteria | 7704 |
| 203 | Ga0068856_100090897 | 3300005614 | Bacteria | 3037 |
| 204 | Ga0068856_100232549 | 3300005614 | Bacteria | 1858 |
| 205 | Ga0068856_100254676 | 3300005614 | Bacteria | 1770 |
| 206 | Ga0068856_100321065 | 3300005614 | Bacteria | 1566 |
| 207 | Ga0068856_100333992 | 3300005614 | Bacteria | 1533 |
| 208 | Ga0068856_100967960 | 3300005614 | Bacteria | 869 |
| 209 | Ga0068856_101003950 | 3300005614 | Bacteria | 853 |
| 210 | Ga0068856_101273756 | 3300005614 | Bacteria | 751 |
| 211 | Ga0068856_101591774 | 3300005614 | Bacteria | 666 |
| 212 | Ga0070702_100202353 | 3300005615 | Bacteria | 1315 |
| 213 | Ga0070702_100448044 | 3300005615 | Bacteria | 936 |
| 214 | Ga0070702_100912627 | 3300005615 | Bacteria | 689 |
| 215 | Ga0070702_101081696 | 3300005615 | Bacteria | 640 |
| 216 | Ga0068852_100047094 | 3300005616 | Bacteria | 3676 |
| 217 | Ga0068852_100327493 | 3300005616 | Bacteria | 1489 |
| 218 | Ga0068852_100426066 | 3300005616 | Bacteria | 1309 |
| 219 | Ga0068852_100929149 | 3300005616 | Bacteria | 887 |
| 220 | Ga0068852_101056432 | 3300005616 | Bacteria | 832 |
| 221 | Ga0068859_100124155 | 3300005617 | Bacteria | 2650 |
| 222 | Ga0068859_100661067 | 3300005617 | Bacteria | 1137 |
| 223 | Ga0068859_100784876 | 3300005617 | Bacteria | 1041 |
| 224 | Ga0068864_100014298 | 3300005618 | Bacteria | 6593 |
| 225 | Ga0068864_100272752 | 3300005618 | Bacteria | 1577 |
| 226 | Ga0068864_101624193 | 3300005618 | Bacteria | 651 |
| 227 | Ga0068866_10008633 | 3300005718 | Bacteria | 4303 |
| 228 | Ga0068866_10069108 | 3300005718 | Bacteria | 1860 |
| 229 | Ga0068866_10195935 | 3300005718 | Bacteria | 1204 |
| 230 | Ga0068866_10388792 | 3300005718 | Bacteria | 897 |
| 231 | Ga0068861_100033707 | 3300005719 | Bacteria | 3780 |
| 232 | Ga0068861_100285167 | 3300005719 | Bacteria | 1424 |
| 233 | Ga0068861_100402038 | 3300005719 | Bacteria | 1216 |
| 234 | Ga0068861_100886782 | 3300005719 | Bacteria | 844 |
| 235 | Ga0068851_10110022 | 3300005834 | Bacteria | 1470 |
| 236 | Ga0068870_10009635 | 3300005840 | Bacteria | 4401 |
| 237 | Ga0068870_10061744 | 3300005840 | Bacteria | 2015 |
| 238 | Ga0068870_10558949 | 3300005840 | Bacteria | 772 |
| 239 | Ga0068863_100222283 | 3300005841 | Bacteria | 1820 |
| 240 | Ga0068863_100255986 | 3300005841 | Bacteria | 1692 |
| 241 | Ga0068863_101340880 | 3300005841 | Bacteria | 723 |
| 242 | Ga0068858_100159638 | 3300005842 | Bacteria | 2123 |
| 243 | Ga0068860_100654188 | 3300005843 | Bacteria | 1059 |
| 244 | Ga0068862_100243339 | 3300005844 | Bacteria | 1637 |
| 245 | Ga0068862_100713063 | 3300005844 | Bacteria | 973 |
| 246 | Ga0068862_101302548 | 3300005844 | Bacteria | 728 |
| 247 | Ga0081455_10064511 | 3300005937 | Bacteria | 3066 |
| 248 | Ga0081455_10065549 | 3300005937 | Bacteria | 3037 |
| 249 | Ga0081455_10067811 | 3300005937 | Bacteria | 2972 |
| 250 | Ga0081455_10194627 | 3300005937 | Bacteria | 1524 |
| 251 | Ga0081455_10354823 | 3300005937 | Bacteria | 1033 |
| 252 | Ga0081538_10000037 | 3300005981 | Bacteria | 119828 |
| 253 | Ga0081538_10013229 | 3300005981 | Bacteria | 6547 |
| 254 | Ga0081538_10014684 | 3300005981 | Bacteria | 6115 |
| 255 | Ga0081538_10015351 | 3300005981 | Bacteria | 5935 |
| 256 | Ga0081538_10039195 | 3300005981 | Bacteria | 3043 |
| 257 | Ga0081538_10069095 | 3300005981 | Bacteria | 1959 |
| 258 | Ga0081538_10209135 | 3300005981 | Bacteria | 789 |
| 259 | Ga0081539_10002193 | 3300005985 | Bacteria | 28646 |
| 260 | Ga0081539_10003843 | 3300005985 | Bacteria | 17623 |
| 261 | Ga0070717_10011659 | 3300006028 | Bacteria | 6683 |
| 262 | Ga0070717_10013934 | 3300006028 | Bacteria | 6175 |
| 263 | Ga0070717_10206338 | 3300006028 | Bacteria | 1723 |
| 264 | Ga0070717_10639725 | 3300006028 | Bacteria | 965 |
| 265 | Ga0070717_10693015 | 3300006028 | Bacteria | 925 |
| 266 | Ga0075365_10100239 | 3300006038 | Bacteria | 1982 |
| 267 | Ga0075365_10808136 | 3300006038 | Bacteria | 662 |
| 268 | Ga0075364_10024709 | 3300006051 | Bacteria | 3818 |
| 269 | Ga0075432_10061606 | 3300006058 | Bacteria | 1337 |
| 270 | Ga0075432_10077826 | 3300006058 | Bacteria | 1199 |
| 271 | Ga0070715_10000565 | 3300006163 | Bacteria | 9750 |
| 272 | Ga0070715_10036740 | 3300006163 | Bacteria | 2023 |
| 273 | Ga0070716_100006022 | 3300006173 | Bacteria | 5908 |
| 274 | Ga0070716_100494948 | 3300006173 | Bacteria | 900 |
| 275 | Ga0070716_100594140 | 3300006173 | Bacteria | 832 |
| 276 | Ga0070716_100621141 | 3300006173 | Bacteria | 815 |
| 277 | Ga0070712_100006000 | 3300006175 | Bacteria | 7517 |
| 278 | Ga0070712_100056555 | 3300006175 | Bacteria | 2752 |
| 279 | Ga0070712_100289256 | 3300006175 | Bacteria | 1322 |
| 280 | Ga0070712_100301307 | 3300006175 | Bacteria | 1297 |
| 281 | Ga0070712_100342824 | 3300006175 | Bacteria | 1220 |
| 282 | Ga0070712_100743780 | 3300006175 | Bacteria | 839 |
| 283 | Ga0070712_100808803 | 3300006175 | Bacteria | 804 |
| 284 | Ga0075362_10022581 | 3300006177 | Bacteria | 2653 |
| 285 | Ga0097621_100204246 | 3300006237 | Bacteria | 1717 |
| 286 | Ga0097621_100223481 | 3300006237 | Bacteria | 1641 |
| 287 | Ga0097621_100422624 | 3300006237 | Bacteria | 1196 |
| 288 | Ga0068871_100059583 | 3300006358 | Bacteria | 3111 |
| 289 | Ga0068871_100065087 | 3300006358 | Bacteria | 2985 |
| 290 | Ga0075428_100515800 | 3300006844 | Bacteria | 1278 |
| 291 | Ga0075428_100871680 | 3300006844 | Bacteria | 955 |
| 292 | Ga0075430_100083598 | 3300006846 | Bacteria | 2674 |
| 293 | Ga0075430_100341714 | 3300006846 | Bacteria | 1236 |
| 294 | Ga0075431_100121575 | 3300006847 | Bacteria | 2694 |
| 295 | Ga0075431_100244476 | 3300006847 | Bacteria | 1824 |
| 296 | Ga0075433_10084447 | 3300006852 | Bacteria | 2802 |
| 297 | Ga0075433_10172648 | 3300006852 | Bacteria | 1924 |
| 298 | Ga0075433_10253630 | 3300006852 | Bacteria | 1560 |
| 299 | Ga0075434_100016435 | 3300006871 | Bacteria | 7113 |
| 300 | Ga0075434_100042438 | 3300006871 | Bacteria | 4509 |
| 301 | Ga0075434_100276485 | 3300006871 | Bacteria | 1698 |
| 302 | Ga0075434_100502303 | 3300006871 | Bacteria | 1233 |
| 303 | Ga0075434_100610494 | 3300006871 | Bacteria | 1110 |
| 304 | Ga0075429_100658216 | 3300006880 | Bacteria | 918 |
| 305 | Ga0068865_100004970 | 3300006881 | Bacteria | 8041 |
| 306 | Ga0068865_100020981 | 3300006881 | Bacteria | 4244 |
| 307 | Ga0068865_100168119 | 3300006881 | Bacteria | 1678 |
| 308 | Ga0068865_100301528 | 3300006881 | Bacteria | 1283 |
| 309 | Ga0068865_100441079 | 3300006881 | Bacteria | 1075 |
| 310 | Ga0068865_100721648 | 3300006881 | Bacteria | 853 |
| 311 | Ga0075436_100303440 | 3300006914 | Bacteria | 1145 |
| 312 | Ga0097620_100124152 | 3300006931 | Bacteria | 2650 |
| 313 | Ga0097620_100661113 | 3300006931 | Bacteria | 1137 |
| 314 | Ga0097620_100784919 | 3300006931 | Bacteria | 1041 |
| 315 | Ga0075435_100113748 | 3300007076 | Bacteria | 2252 |
| 316 | Ga0075435_100420695 | 3300007076 | Bacteria | 1151 |
| 317 | Ga0075435_100459282 | 3300007076 | Bacteria | 1098 |
| 318 | Ga0075435_101204724 | 3300007076 | Bacteria | 662 |
| 319 | Ga0111539_10122024 | 3300009094 | Bacteria | 3053 |
| 320 | Ga0111539_10312375 | 3300009094 | Bacteria | 1829 |
| 321 | Ga0111539_10499400 | 3300009094 | Bacteria | 1417 |
| 322 | Ga0111539_11051258 | 3300009094 | Bacteria | 946 |
| 323 | Ga0111539_11509700 | 3300009094 | Bacteria | 779 |
| 324 | Ga0111539_12848976 | 3300009094 | Bacteria | 560 |
| 325 | Ga0105245_10051119 | 3300009098 | Bacteria | 3705 |
| 326 | Ga0105245_10099555 | 3300009098 | Bacteria | 2688 |
| 327 | Ga0105245_10106484 | 3300009098 | Bacteria | 2602 |
| 328 | Ga0105245_10167293 | 3300009098 | Bacteria | 2091 |
| 329 | Ga0105245_10288254 | 3300009098 | Bacteria | 1607 |
| 330 | Ga0105245_10290160 | 3300009098 | Bacteria | 1602 |
| 331 | Ga0105245_10917566 | 3300009098 | Bacteria | 918 |
| 332 | Ga0105247_10580108 | 3300009101 | Bacteria | 829 |
| 333 | Ga0105247_11297130 | 3300009101 | Bacteria | 584 |
| 334 | Ga0114129_11453704 | 3300009147 | Bacteria | 844 |
| 335 | Ga0114129_11576530 | 3300009147 | Bacteria | 805 |
| 336 | Ga0114129_11590593 | 3300009147 | Bacteria | 800 |
| 337 | Ga0114129_11628620 | 3300009147 | Bacteria | 789 |
| 338 | Ga0105243_10002992 | 3300009148 | Bacteria | 13963 |
| 339 | Ga0105243_10055328 | 3300009148 | Bacteria | 3153 |
| 340 | Ga0105243_10244044 | 3300009148 | Bacteria | 1600 |
| 341 | Ga0105243_10271795 | 3300009148 | Bacteria | 1522 |
| 342 | Ga0105243_10448894 | 3300009148 | Bacteria | 1209 |
| 343 | Ga0105241_10072481 | 3300009174 | Bacteria | 2677 |
| 344 | Ga0105241_10238783 | 3300009174 | Bacteria | 1535 |
| 345 | Ga0105241_10541586 | 3300009174 | Bacteria | 1044 |
| 346 | Ga0105241_11304209 | 3300009174 | Bacteria | 692 |
| 347 | Ga0105242_10148257 | 3300009176 | Bacteria | 2043 |
| 348 | Ga0105242_10167775 | 3300009176 | Bacteria | 1927 |
| 349 | Ga0105242_10197397 | 3300009176 | Bacteria | 1785 |
| 350 | Ga0105242_10362638 | 3300009176 | Bacteria | 1342 |
| 351 | Ga0105242_10369170 | 3300009176 | Bacteria | 1330 |
| 352 | Ga0105242_10644618 | 3300009176 | Bacteria | 1029 |
| 353 | Ga0105242_10941555 | 3300009176 | Bacteria | 867 |
| 354 | Ga0105242_11374169 | 3300009176 | Bacteria | 733 |
| 355 | Ga0105242_12141368 | 3300009176 | Bacteria | 604 |
| 356 | Ga0105248_10015623 | 3300009177 | Bacteria | 8368 |
| 357 | Ga0105248_10745745 | 3300009177 | Bacteria | 1105 |
| 358 | Ga0105248_10958854 | 3300009177 | Bacteria | 966 |
| 359 | Ga0105237_10079496 | 3300009545 | Bacteria | 3269 |
| 360 | Ga0105237_11079763 | 3300009545 | Bacteria | 809 |
| 361 | Ga0105238_10043513 | 3300009551 | Bacteria | 4543 |
| 362 | Ga0105238_11180247 | 3300009551 | Bacteria | 790 |
| 363 | Ga0105238_11301210 | 3300009551 | Bacteria | 753 |
| 364 | Ga0105249_10009884 | 3300009553 | Bacteria | 8363 |
| 365 | Ga0105239_10325172 | 3300010375 | Bacteria | 1734 |
| 366 | Ga0105239_10485652 | 3300010375 | Bacteria | 1403 |
| 367 | Ga0105239_10526113 | 3300010375 | Bacteria | 1345 |
| 368 | Ga0105239_10645658 | 3300010375 | Bacteria | 1209 |
| 369 | Ga0105239_11304203 | 3300010375 | Bacteria | 837 |
| 370 | Ga0105239_12072682 | 3300010375 | Bacteria | 661 |
| 371 | Ga0105246_10515629 | 3300011119 | Bacteria | 1018 |
| 372 | Ga0105246_11415010 | 3300011119 | Bacteria | 649 |
| 373 | Ga0157339_1005165 | 3300012505 | Bacteria | 1019 |
| 374 | Ga0157327_1014400 | 3300012512 | Bacteria | 808 |
| 375 | Ga0157373_10517660 | 3300013100 | Bacteria | 863 |
| 376 | Ga0157371_10884669 | 3300013102 | Bacteria | 677 |
| 377 | Ga0157369_10283256 | 3300013105 | Bacteria | 1726 |
| 378 | Ga0157369_10599746 | 3300013105 | Bacteria | 1137 |
| 379 | Ga0157369_11498414 | 3300013105 | Bacteria | 686 |
| 380 | Ga0157374_10284831 | 3300013296 | Bacteria | 1632 |
| 381 | Ga0157374_10401038 | 3300013296 | Bacteria | 1368 |
| 382 | Ga0157374_11242267 | 3300013296 | Bacteria | 767 |
| 383 | Ga0157378_10217575 | 3300013297 | Bacteria | 1814 |
| 384 | Ga0157378_10260173 | 3300013297 | Bacteria | 1664 |
| 385 | Ga0157378_10406906 | 3300013297 | Bacteria | 1342 |
| 386 | Ga0157378_10410230 | 3300013297 | Bacteria | 1337 |
| 387 | Ga0157378_10869261 | 3300013297 | Bacteria | 931 |
| 388 | Ga0157378_10976970 | 3300013297 | Bacteria | 880 |
| 389 | Ga0157378_11061631 | 3300013297 | Bacteria | 846 |
| 390 | Ga0157378_11607311 | 3300013297 | Bacteria | 696 |
| 391 | Ga0157378_11715565 | 3300013297 | Bacteria | 675 |
| 392 | Ga0163162_10199776 | 3300013306 | Bacteria | 2128 |
| 393 | Ga0163162_11593065 | 3300013306 | Bacteria | 745 |
| 394 | Ga0163162_12189375 | 3300013306 | Bacteria | 635 |
| 395 | Ga0157372_10660788 | 3300013307 | Bacteria | 1217 |
| 396 | Ga0157372_10664777 | 3300013307 | Bacteria | 1213 |
| 397 | Ga0157372_11237211 | 3300013307 | Bacteria | 862 |
| 398 | Ga0157372_11496035 | 3300013307 | Bacteria | 778 |
| 399 | Ga0157375_10161829 | 3300013308 | Bacteria | 2380 |
| 400 | Ga0157375_10198195 | 3300013308 | Bacteria | 2163 |
| 401 | Ga0157375_10289762 | 3300013308 | Bacteria | 1800 |
| 402 | Ga0157375_10419790 | 3300013308 | Bacteria | 1504 |
| 403 | Ga0157375_11273545 | 3300013308 | Bacteria | 864 |
| 404 | Ga0157375_11719422 | 3300013308 | Bacteria | 743 |
| 405 | Ga0163163_10020662 | 3300014325 | Bacteria | 6205 |
| 406 | Ga0163163_10382842 | 3300014325 | Bacteria | 1464 |
| 407 | Ga0157380_10282638 | 3300014326 | Bacteria | 1519 |
| 408 | Ga0157380_10446551 | 3300014326 | Bacteria | 1241 |
| 409 | Ga0157380_11064782 | 3300014326 | Bacteria | 846 |
| 410 | Ga0157380_11270386 | 3300014326 | Bacteria | 782 |
| 411 | Ga0182008_10004665 | 3300014497 | Bacteria | 7965 |
| 412 | Ga0182008_10461642 | 3300014497 | Bacteria | 692 |
| 413 | Ga0182008_10753453 | 3300014497 | Bacteria | 561 |
| 414 | Ga0157377_10031731 | 3300014745 | Bacteria | 2873 |
| 415 | Ga0157377_10086401 | 3300014745 | Bacteria | 1843 |
| 416 | Ga0157377_10382383 | 3300014745 | Bacteria | 953 |
| 417 | Ga0157379_10288838 | 3300014968 | Bacteria | 1493 |
| 418 | Ga0157379_10605430 | 3300014968 | Bacteria | 1023 |
| 419 | Ga0157379_10943188 | 3300014968 | Bacteria | 820 |
| 420 | Ga0157379_11617498 | 3300014968 | Bacteria | 633 |
| 421 | Ga0157376_10011788 | 3300014969 | Bacteria | 6459 |
| 422 | Ga0157376_10104146 | 3300014969 | Bacteria | 2486 |
| 423 | Ga0157376_10566311 | 3300014969 | Bacteria | 1126 |
| 424 | Ga0157376_10677354 | 3300014969 | Bacteria | 1034 |
| 425 | Ga0157376_10815181 | 3300014969 | Bacteria | 947 |
| 426 | Ga0157376_12786349 | 3300014969 | Bacteria | 529 |
| 427 | Ga0182007_10015950 | 3300015262 | Bacteria | 2786 |
| 428 | Ga0163161_10389859 | 3300017792 | Bacteria | 1115 |
| 429 | Ga0197907_10978116 | 3300020069 | Bacteria | 1469 |
| 430 | Ga0197907_11392553 | 3300020069 | Bacteria | 605 |
| 431 | Ga0206356_10239065 | 3300020070 | Bacteria | 1739 |
| 432 | Ga0206356_11088656 | 3300020070 | Bacteria | 1551 |
| 433 | Ga0206349_1037198 | 3300020075 | Bacteria | 653 |
| 434 | Ga0206350_11457104 | 3300020080 | Bacteria | 984 |
| 435 | Ga0206353_10918220 | 3300020082 | Bacteria | 1075 |
| 436 | Ga0206353_12001256 | 3300020082 | Bacteria | 1612 |
| 437 | Ga0213873_10012098 | 3300021358 | Bacteria | 1865 |
| 438 | Ga0213871_10035748 | 3300021441 | Bacteria | 1315 |
| 439 | Ga0224712_10132690 | 3300022467 | Bacteria | 1089 |
| 440 | Ga0207638_1003322 | 3300025227 | Bacteria | 638 |
| 441 | Ga0207697_10037177 | 3300025315 | Bacteria | 1994 |
| 442 | Ga0207692_10147999 | 3300025898 | Bacteria | 1342 |
| 443 | Ga0207692_10209597 | 3300025898 | Bacteria | 1150 |
| 444 | Ga0207692_10342981 | 3300025898 | Bacteria | 919 |
| 445 | Ga0207642_10023441 | 3300025899 | Bacteria | 2465 |
| 446 | Ga0207642_10165774 | 3300025899 | Bacteria | 1190 |
| 447 | Ga0207642_10195677 | 3300025899 | Bacteria | 1113 |
| 448 | Ga0207710_10168886 | 3300025900 | Bacteria | 1069 |
| 449 | Ga0207688_10011759 | 3300025901 | Bacteria | 4761 |
| 450 | Ga0207688_10305088 | 3300025901 | Bacteria | 974 |
| 451 | Ga0207688_10507265 | 3300025901 | Bacteria | 756 |
| 452 | Ga0207680_10590681 | 3300025903 | Bacteria | 794 |
| 453 | Ga0207647_10041881 | 3300025904 | Bacteria | 2876 |
| 454 | Ga0207647_10074362 | 3300025904 | Bacteria | 2047 |
| 455 | Ga0207647_10432742 | 3300025904 | Bacteria | 739 |
| 456 | Ga0207647_10505585 | 3300025904 | Bacteria | 673 |
| 457 | Ga0207685_10039400 | 3300025905 | Bacteria | 1754 |
| 458 | Ga0207685_10039846 | 3300025905 | Bacteria | 1747 |
| 459 | Ga0207699_10002820 | 3300025906 | Bacteria | 8226 |
| 460 | Ga0207699_10156246 | 3300025906 | Bacteria | 1514 |
| 461 | Ga0207699_10420100 | 3300025906 | Bacteria | 955 |
| 462 | Ga0207645_10020975 | 3300025907 | Bacteria | 4268 |
| 463 | Ga0207645_10129652 | 3300025907 | Bacteria | 1641 |
| 464 | Ga0207643_10020891 | 3300025908 | Bacteria | 3594 |
| 465 | Ga0207643_10067194 | 3300025908 | Bacteria | 2057 |
| 466 | Ga0207643_10243672 | 3300025908 | Bacteria | 1106 |
| 467 | Ga0207705_10068235 | 3300025909 | Bacteria | 2574 |
| 468 | Ga0207705_10264986 | 3300025909 | Bacteria | 1313 |
| 469 | Ga0207705_10577404 | 3300025909 | Bacteria | 874 |
| 470 | Ga0207684_10168406 | 3300025910 | Bacteria | 1888 |
| 471 | Ga0207684_10341686 | 3300025910 | Bacteria | 1289 |
| 472 | Ga0207654_10096035 | 3300025911 | Bacteria | 1817 |
| 473 | Ga0207654_10322502 | 3300025911 | Bacteria | 1056 |
| 474 | Ga0207654_10753987 | 3300025911 | Bacteria | 701 |
| 475 | Ga0207707_10003180 | 3300025912 | Bacteria | 14576 |
| 476 | Ga0207707_10017461 | 3300025912 | Bacteria | 6256 |
| 477 | Ga0207707_10068018 | 3300025912 | Bacteria | 3103 |
| 478 | Ga0207707_10091440 | 3300025912 | Bacteria | 2659 |
| 479 | Ga0207707_10241526 | 3300025912 | Bacteria | 1570 |
| 480 | Ga0207707_10295079 | 3300025912 | Bacteria | 1402 |
| 481 | Ga0207707_10909981 | 3300025912 | Bacteria | 727 |
| 482 | Ga0207695_10043176 | 3300025913 | Bacteria | 4807 |
| 483 | Ga0207695_10467872 | 3300025913 | Bacteria | 1143 |
| 484 | Ga0207671_10041645 | 3300025914 | Bacteria | 3399 |
| 485 | Ga0207671_10908210 | 3300025914 | Bacteria | 696 |
| 486 | Ga0207693_10008279 | 3300025915 | Bacteria | 8516 |
| 487 | Ga0207693_10019701 | 3300025915 | Bacteria | 5365 |
| 488 | Ga0207693_10288274 | 3300025915 | Bacteria | 1286 |
| 489 | Ga0207693_10345236 | 3300025915 | Bacteria | 1165 |
| 490 | Ga0207693_10414231 | 3300025915 | Bacteria | 1053 |
| 491 | Ga0207693_10416778 | 3300025915 | Bacteria | 1050 |
| 492 | Ga0207693_10624072 | 3300025915 | Bacteria | 838 |
| 493 | Ga0207693_10849194 | 3300025915 | Bacteria | 702 |
| 494 | Ga0207663_10001658 | 3300025916 | Bacteria | 10492 |
| 495 | Ga0207663_10067383 | 3300025916 | Bacteria | 2295 |
| 496 | Ga0207663_10076870 | 3300025916 | Bacteria | 2171 |
| 497 | Ga0207663_10295750 | 3300025916 | Bacteria | 1208 |
| 498 | Ga0207663_10980466 | 3300025916 | Bacteria | 677 |
| 499 | Ga0207660_10003324 | 3300025917 | Bacteria | 10497 |
| 500 | Ga0207660_10085298 | 3300025917 | Bacteria | 2329 |
| 501 | Ga0207660_10243965 | 3300025917 | Bacteria | 1416 |
| 502 | Ga0207660_10414347 | 3300025917 | Bacteria | 1086 |
| 503 | Ga0207660_10960578 | 3300025917 | Bacteria | 697 |
| 504 | Ga0207662_10251851 | 3300025918 | Bacteria | 1159 |
| 505 | Ga0207662_10316530 | 3300025918 | Bacteria | 1041 |
| 506 | Ga0207662_10522240 | 3300025918 | Bacteria | 820 |
| 507 | Ga0207657_10023955 | 3300025919 | Bacteria | 5668 |
| 508 | Ga0207657_10104313 | 3300025919 | Bacteria | 2349 |
| 509 | Ga0207657_10152933 | 3300025919 | Bacteria | 1878 |
| 510 | Ga0207657_10531940 | 3300025919 | Bacteria | 920 |
| 511 | Ga0207649_10066928 | 3300025920 | Bacteria | 2279 |
| 512 | Ga0207649_10126012 | 3300025920 | Bacteria | 1733 |
| 513 | Ga0207652_10026093 | 3300025921 | Bacteria | 4863 |
| 514 | Ga0207652_10032074 | 3300025921 | Bacteria | 4413 |
| 515 | Ga0207652_10141578 | 3300025921 | Bacteria | 2151 |
| 516 | Ga0207652_10612085 | 3300025921 | Bacteria | 976 |
| 517 | Ga0207646_10000851 | 3300025922 | Bacteria | 39515 |
| 518 | Ga0207646_10006167 | 3300025922 | Bacteria | 12463 |
| 519 | Ga0207646_10350239 | 3300025922 | Bacteria | 1334 |
| 520 | Ga0207646_10470048 | 3300025922 | Bacteria | 1134 |
| 521 | Ga0207646_10873204 | 3300025922 | Bacteria | 799 |
| 522 | Ga0207646_11255629 | 3300025922 | Bacteria | 648 |
| 523 | Ga0207681_10141949 | 3300025923 | Bacteria | 1790 |
| 524 | Ga0207650_10102675 | 3300025925 | Bacteria | 2203 |
| 525 | Ga0207650_10211548 | 3300025925 | Bacteria | 1557 |
| 526 | Ga0207659_10054577 | 3300025926 | Bacteria | 2854 |
| 527 | Ga0207659_10439310 | 3300025926 | Bacteria | 1097 |
| 528 | Ga0207659_10525473 | 3300025926 | Bacteria | 1004 |
| 529 | Ga0207659_10809743 | 3300025926 | Bacteria | 805 |
| 530 | Ga0207659_11222875 | 3300025926 | Bacteria | 646 |
| 531 | Ga0207687_10040067 | 3300025927 | Bacteria | 3210 |
| 532 | Ga0207687_10051517 | 3300025927 | Bacteria | 2870 |
| 533 | Ga0207687_10095470 | 3300025927 | Bacteria | 2177 |
| 534 | Ga0207687_10172632 | 3300025927 | Bacteria | 1669 |
| 535 | Ga0207687_10178037 | 3300025927 | Bacteria | 1645 |
| 536 | Ga0207687_10363650 | 3300025927 | Bacteria | 1182 |
| 537 | Ga0207687_10552335 | 3300025927 | Bacteria | 966 |
| 538 | Ga0207687_10773573 | 3300025927 | Bacteria | 818 |
| 539 | Ga0207687_11343192 | 3300025927 | Bacteria | 614 |
| 540 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 541 | Ga0207700_10026626 | 3300025928 | Bacteria | 4035 |
| 542 | Ga0207700_10038712 | 3300025928 | Bacteria | 3463 |
| 543 | Ga0207700_11080513 | 3300025928 | Bacteria | 717 |
| 544 | Ga0207664_10001406 | 3300025929 | Bacteria | 15838 |
| 545 | Ga0207664_10020871 | 3300025929 | Bacteria | 4861 |
| 546 | Ga0207664_10022997 | 3300025929 | Bacteria | 4664 |
| 547 | Ga0207664_10033965 | 3300025929 | Bacteria | 3924 |
| 548 | Ga0207664_10274078 | 3300025929 | Bacteria | 1479 |
| 549 | Ga0207664_10290865 | 3300025929 | Bacteria | 1436 |
| 550 | Ga0207664_10447145 | 3300025929 | Bacteria | 1153 |
| 551 | Ga0207664_10447901 | 3300025929 | Bacteria | 1152 |
| 552 | Ga0207664_10868463 | 3300025929 | Bacteria | 811 |
| 553 | Ga0207644_10220744 | 3300025931 | Bacteria | 1502 |
| 554 | Ga0207644_10248632 | 3300025931 | Bacteria | 1418 |
| 555 | Ga0207644_10393798 | 3300025931 | Bacteria | 1131 |
| 556 | Ga0207644_10605170 | 3300025931 | Bacteria | 910 |
| 557 | Ga0207690_10185138 | 3300025932 | Bacteria | 1571 |
| 558 | Ga0207690_10387590 | 3300025932 | Bacteria | 1112 |
| 559 | Ga0207690_10434491 | 3300025932 | Bacteria | 1052 |
| 560 | Ga0207690_10845447 | 3300025932 | Bacteria | 757 |
| 561 | Ga0207706_10198818 | 3300025933 | Bacteria | 1758 |
| 562 | Ga0207706_10509487 | 3300025933 | Bacteria | 1038 |
| 563 | Ga0207706_10953555 | 3300025933 | Bacteria | 723 |
| 564 | Ga0207686_10007037 | 3300025934 | Bacteria | 6053 |
| 565 | Ga0207686_10692594 | 3300025934 | Bacteria | 809 |
| 566 | Ga0207686_10863041 | 3300025934 | Bacteria | 729 |
| 567 | Ga0207709_10001060 | 3300025935 | Bacteria | 20295 |
| 568 | Ga0207709_10036357 | 3300025935 | Bacteria | 2918 |
| 569 | Ga0207709_10082444 | 3300025935 | Bacteria | 2077 |
| 570 | Ga0207670_10023173 | 3300025936 | Bacteria | 3860 |
| 571 | Ga0207670_10329651 | 3300025936 | Bacteria | 1203 |
| 572 | Ga0207669_10074154 | 3300025937 | Bacteria | 2150 |
| 573 | Ga0207669_10190376 | 3300025937 | Bacteria | 1479 |
| 574 | Ga0207669_11009560 | 3300025937 | Bacteria | 699 |
| 575 | Ga0207704_10000286 | 3300025938 | Bacteria | 23986 |
| 576 | Ga0207704_10046777 | 3300025938 | Bacteria | 2581 |
| 577 | Ga0207704_10149932 | 3300025938 | Bacteria | 1644 |
| 578 | Ga0207704_10168404 | 3300025938 | Bacteria | 1568 |
| 579 | Ga0207704_10231522 | 3300025938 | Bacteria | 1374 |
| 580 | Ga0207704_10443972 | 3300025938 | Bacteria | 1034 |
| 581 | Ga0207665_10006962 | 3300025939 | Bacteria | 7483 |
| 582 | Ga0207665_10113016 | 3300025939 | Bacteria | 1910 |
| 583 | Ga0207665_10117162 | 3300025939 | Bacteria | 1878 |
| 584 | Ga0207665_10226469 | 3300025939 | Bacteria | 1372 |
| 585 | Ga0207665_10630871 | 3300025939 | Bacteria | 839 |
| 586 | Ga0207691_10011073 | 3300025940 | Bacteria | 8655 |
| 587 | Ga0207691_10049708 | 3300025940 | Bacteria | 3842 |
| 588 | Ga0207711_10021100 | 3300025941 | Bacteria | 5441 |
| 589 | Ga0207711_10063781 | 3300025941 | Bacteria | 3181 |
| 590 | Ga0207711_10812375 | 3300025941 | Bacteria | 871 |
| 591 | Ga0207689_10326490 | 3300025942 | Bacteria | 1274 |
| 592 | Ga0207689_10820087 | 3300025942 | Bacteria | 785 |
| 593 | Ga0207661_10003657 | 3300025944 | Bacteria | 10711 |
| 594 | Ga0207661_10022155 | 3300025944 | Bacteria | 4778 |
| 595 | Ga0207661_10062325 | 3300025944 | Bacteria | 3016 |
| 596 | Ga0207661_10141659 | 3300025944 | Bacteria | 2070 |
| 597 | Ga0207661_10242250 | 3300025944 | Bacteria | 1600 |
| 598 | Ga0207661_10615782 | 3300025944 | Bacteria | 997 |
| 599 | Ga0207661_11751763 | 3300025944 | Bacteria | 567 |
| 600 | Ga0207679_10019995 | 3300025945 | Bacteria | 4511 |
| 601 | Ga0207679_10047938 | 3300025945 | Bacteria | 3107 |
| 602 | Ga0207679_10056211 | 3300025945 | Bacteria | 2904 |
| 603 | Ga0207679_10066082 | 3300025945 | Bacteria | 2709 |
| 604 | Ga0207679_10174390 | 3300025945 | Bacteria | 1773 |
| 605 | Ga0207667_10719049 | 3300025949 | Bacteria | 1000 |
| 606 | Ga0207651_10035870 | 3300025960 | Bacteria | 3231 |
| 607 | Ga0207651_10100525 | 3300025960 | Bacteria | 2144 |
| 608 | Ga0207651_10517320 | 3300025960 | Bacteria | 1034 |
| 609 | Ga0207712_10003169 | 3300025961 | Bacteria | 10480 |
| 610 | Ga0207712_10557806 | 3300025961 | Bacteria | 986 |
| 611 | Ga0207712_10780708 | 3300025961 | Bacteria | 839 |
| 612 | Ga0207712_10782487 | 3300025961 | Bacteria | 838 |
| 613 | Ga0207668_10055925 | 3300025972 | Bacteria | 2746 |
| 614 | Ga0207668_10081936 | 3300025972 | Bacteria | 2342 |
| 615 | Ga0207668_10461127 | 3300025972 | Bacteria | 1086 |
| 616 | Ga0207640_10103531 | 3300025981 | Bacteria | 2001 |
| 617 | Ga0207640_10302855 | 3300025981 | Bacteria | 1265 |
| 618 | Ga0207640_10643411 | 3300025981 | Bacteria | 903 |
| 619 | Ga0207658_10205342 | 3300025986 | Bacteria | 1648 |
| 620 | Ga0207658_10263410 | 3300025986 | Bacteria | 1470 |
| 621 | Ga0207677_10118400 | 3300026023 | Bacteria | 1987 |
| 622 | Ga0207677_10174254 | 3300026023 | Bacteria | 1686 |
| 623 | Ga0207677_10197711 | 3300026023 | Bacteria | 1595 |
| 624 | Ga0207677_10650835 | 3300026023 | Bacteria | 930 |
| 625 | Ga0207677_10703393 | 3300026023 | Bacteria | 897 |
| 626 | Ga0207677_10829953 | 3300026023 | Bacteria | 829 |
| 627 | Ga0207639_10037000 | 3300026041 | Bacteria | 3622 |
| 628 | Ga0207678_10074836 | 3300026067 | Bacteria | 2901 |
| 629 | Ga0207678_10264428 | 3300026067 | Bacteria | 1475 |
| 630 | Ga0207678_10410741 | 3300026067 | Bacteria | 1173 |
| 631 | Ga0207708_10018770 | 3300026075 | Bacteria | 5210 |
| 632 | Ga0207708_10074971 | 3300026075 | Bacteria | 2594 |
| 633 | Ga0207708_10380061 | 3300026075 | Bacteria | 1164 |
| 634 | Ga0207708_10769965 | 3300026075 | Bacteria | 827 |
| 635 | Ga0207708_11112989 | 3300026075 | Bacteria | 689 |
| 636 | Ga0207702_10045933 | 3300026078 | Bacteria | 3675 |
| 637 | Ga0207702_10087132 | 3300026078 | Bacteria | 2725 |
| 638 | Ga0207702_10324033 | 3300026078 | Bacteria | 1468 |
| 639 | Ga0207702_10582704 | 3300026078 | Bacteria | 1097 |
| 640 | Ga0207702_11212359 | 3300026078 | Bacteria | 749 |
| 641 | Ga0207641_10168864 | 3300026088 | Bacteria | 1995 |
| 642 | Ga0207641_10940579 | 3300026088 | Bacteria | 859 |
| 643 | Ga0207648_10011203 | 3300026089 | Bacteria | 8454 |
| 644 | Ga0207648_10041456 | 3300026089 | Bacteria | 4042 |
| 645 | Ga0207648_10124916 | 3300026089 | Bacteria | 2263 |
| 646 | Ga0207648_10152132 | 3300026089 | Bacteria | 2042 |
| 647 | Ga0207676_10295678 | 3300026095 | Bacteria | 1476 |
| 648 | Ga0207676_10568968 | 3300026095 | Bacteria | 1085 |
| 649 | Ga0207676_10601768 | 3300026095 | Bacteria | 1056 |
| 650 | Ga0207674_10039665 | 3300026116 | Bacteria | 4881 |
| 651 | Ga0207674_10305202 | 3300026116 | Bacteria | 1541 |
| 652 | Ga0207674_10798825 | 3300026116 | Bacteria | 911 |
| 653 | Ga0207675_100149812 | 3300026118 | Bacteria | 2220 |
| 654 | Ga0207675_100183839 | 3300026118 | Bacteria | 2002 |
| 655 | Ga0207675_100395333 | 3300026118 | Bacteria | 1361 |
| 656 | Ga0207675_100619731 | 3300026118 | Bacteria | 1086 |
| 657 | Ga0207675_101222279 | 3300026118 | Bacteria | 772 |
| 658 | Ga0207683_10009121 | 3300026121 | Bacteria | 8454 |
| 659 | Ga0207683_10104857 | 3300026121 | Bacteria | 2527 |
| 660 | Ga0207683_10197559 | 3300026121 | Bacteria | 1828 |
| 661 | Ga0207683_10209468 | 3300026121 | Bacteria | 1774 |
| 662 | Ga0207683_10697336 | 3300026121 | Bacteria | 941 |
| 663 | Ga0207683_10812935 | 3300026121 | Bacteria | 868 |
| 664 | Ga0207683_11101104 | 3300026121 | Bacteria | 737 |
| 665 | Ga0207698_10046157 | 3300026142 | Bacteria | 3287 |
| 666 | Ga0207698_10383541 | 3300026142 | Bacteria | 1338 |
| 667 | Ga0207698_11661250 | 3300026142 | Bacteria | 654 |
| 668 | Ga0207698_11720906 | 3300026142 | Bacteria | 642 |
| 669 | Ga0209983_1018103 | 3300027665 | Bacteria | 1462 |
| 670 | Ga0209971_1076288 | 3300027682 | Bacteria | 815 |
| 671 | Ga0207428_10013247 | 3300027907 | Bacteria | 7213 |
| 672 | Ga0207428_10030394 | 3300027907 | Bacteria | 4465 |
| 673 | Ga0207428_10502528 | 3300027907 | Bacteria | 880 |
| 674 | Ga0268266_10069113 | 3300028379 | Bacteria | 3060 |
| 675 | Ga0268266_10509710 | 3300028379 | Bacteria | 1149 |
| 676 | Ga0268266_10629067 | 3300028379 | Bacteria | 1032 |
| 677 | Ga0268265_10222160 | 3300028380 | Bacteria | 1654 |
| 678 | Ga0268265_10441519 | 3300028380 | Bacteria | 1213 |
| 679 | Ga0268265_10937753 | 3300028380 | Bacteria | 852 |
| 680 | Ga0268265_11538312 | 3300028380 | Bacteria | 669 |
| 681 | Ga0268265_12009071 | 3300028380 | Bacteria | 585 |
| 682 | Ga0268264_10332760 | 3300028381 | Bacteria | 1440 |
| 683 | Ga0265337_1054029 | 3300028556 | Bacteria | 1124 |
| 684 | Ga0265319_1001715 | 3300028563 | Bacteria | 12639 |
| 685 | Ga0265319_1002457 | 3300028563 | Bacteria | 10113 |
| 686 | Ga0265319_1017512 | 3300028563 | Bacteria | 2722 |
| 687 | Ga0265319_1024157 | 3300028563 | Bacteria | 2191 |
| 688 | Ga0265334_10003069 | 3300028573 | Bacteria | 7626 |
| 689 | Ga0265318_10002235 | 3300028577 | Bacteria | 10435 |
| 690 | Ga0265318_10005575 | 3300028577 | Bacteria | 5900 |
| 691 | Ga0265323_10065227 | 3300028653 | Bacteria | 1256 |
| 692 | Ga0265323_10131647 | 3300028653 | Bacteria | 809 |
| 693 | Ga0265336_10001246 | 3300028666 | Bacteria | 12055 |
| 694 | Ga0265336_10074058 | 3300028666 | Bacteria | 1018 |
| 695 | Ga0265338_10001634 | 3300028800 | Bacteria | 35869 |
| 696 | Ga0265338_10004752 | 3300028800 | Bacteria | 18169 |
| 697 | Ga0265338_10006529 | 3300028800 | Bacteria | 14826 |
| 698 | Ga0265338_10006962 | 3300028800 | Bacteria | 14212 |
| 699 | Ga0265338_10012182 | 3300028800 | Bacteria | 9822 |
| 700 | Ga0265338_10035857 | 3300028800 | Bacteria | 4756 |
| 701 | Ga0265338_10295283 | 3300028800 | Bacteria | 1179 |
| 702 | Ga0265324_10008952 | 3300029957 | Bacteria | 3939 |
| 703 | Ga0265324_10172657 | 3300029957 | Bacteria | 734 |
| 704 | Ga0265330_10002117 | 3300031235 | Bacteria | 10966 |
| 705 | Ga0265330_10007769 | 3300031235 | Bacteria | 5207 |
| 706 | Ga0265332_10003068 | 3300031238 | Bacteria | 8165 |
| 707 | Ga0265332_10287458 | 3300031238 | Bacteria | 679 |
| 708 | Ga0265328_10009953 | 3300031239 | Bacteria | 3845 |
| 709 | Ga0265320_10011013 | 3300031240 | Bacteria | 5345 |
| 710 | Ga0265320_10045980 | 3300031240 | Bacteria | 2142 |
| 711 | Ga0265320_10120669 | 3300031240 | Bacteria | 1195 |
| 712 | Ga0265320_10182513 | 3300031240 | Bacteria | 940 |
| 713 | Ga0265325_10002707 | 3300031241 | Bacteria | 11847 |
| 714 | Ga0265329_10004301 | 3300031242 | Bacteria | 5959 |
| 715 | Ga0265329_10012733 | 3300031242 | Bacteria | 3015 |
| 716 | Ga0265329_10191763 | 3300031242 | Bacteria | 671 |
| 717 | Ga0265340_10002927 | 3300031247 | Bacteria | 9724 |
| 718 | Ga0265340_10082712 | 3300031247 | Bacteria | 1509 |
| 719 | Ga0265340_10227680 | 3300031247 | Bacteria | 834 |
| 720 | Ga0265339_10007125 | 3300031249 | Bacteria | 7259 |
| 721 | Ga0265339_10016606 | 3300031249 | Bacteria | 4383 |
| 722 | Ga0265339_10208688 | 3300031249 | Bacteria | 960 |
| 723 | Ga0265331_10001137 | 3300031250 | Bacteria | 20282 |
| 724 | Ga0265331_10193784 | 3300031250 | Bacteria | 916 |
| 725 | Ga0265327_10013950 | 3300031251 | Bacteria | 5295 |
| 726 | Ga0265327_10072157 | 3300031251 | Bacteria | 1725 |
| 727 | Ga0265327_10136870 | 3300031251 | Bacteria | 1147 |
| 728 | Ga0265316_10005912 | 3300031344 | Bacteria | 11790 |
| 729 | Ga0265316_10010068 | 3300031344 | Bacteria | 8645 |
| 730 | Ga0265316_10018295 | 3300031344 | Bacteria | 6024 |
| 731 | Ga0265316_10163328 | 3300031344 | Bacteria | 1664 |
| 732 | Ga0265316_10331911 | 3300031344 | Bacteria | 1103 |
| 733 | Ga0307408_100138064 | 3300031548 | Bacteria | 1910 |
| 734 | Ga0307408_100235426 | 3300031548 | Bacteria | 1502 |
| 735 | Ga0265313_10011203 | 3300031595 | Bacteria | 5590 |
| 736 | Ga0265313_10032156 | 3300031595 | Bacteria | 2683 |
| 737 | Ga0265314_10008726 | 3300031711 | Bacteria | 8664 |
| 738 | Ga0265314_10012224 | 3300031711 | Bacteria | 7026 |
| 739 | Ga0265314_10017019 | 3300031711 | Bacteria | 5717 |
| 740 | Ga0265314_10180252 | 3300031711 | Bacteria | 1266 |
| 741 | Ga0265342_10009012 | 3300031712 | Bacteria | 7087 |
| 742 | Ga0265342_10018402 | 3300031712 | Bacteria | 4526 |
| 743 | Ga0265342_10051186 | 3300031712 | Bacteria | 2465 |
| 744 | Ga0307405_10189710 | 3300031731 | Bacteria | 1483 |
| 745 | Ga0307405_10319662 | 3300031731 | Bacteria | 1185 |
| 746 | Ga0307413_10083017 | 3300031824 | Bacteria | 2060 |
| 747 | Ga0307410_10109011 | 3300031852 | Bacteria | 2000 |
| 748 | Ga0307406_10118559 | 3300031901 | Bacteria | 1835 |
| 749 | Ga0307407_10027944 | 3300031903 | Bacteria | 3009 |
| 750 | Ga0307407_10264512 | 3300031903 | Bacteria | 1184 |
| 751 | Ga0307412_10045102 | 3300031911 | Bacteria | 2880 |
| 752 | Ga0307412_11158248 | 3300031911 | Bacteria | 691 |
| 753 | Ga0307409_100202921 | 3300031995 | Bacteria | 1775 |
| 754 | Ga0307409_100503331 | 3300031995 | Bacteria | 1180 |
| 755 | Ga0307416_100076773 | 3300032002 | Bacteria | 2802 |
| 756 | Ga0307416_100127477 | 3300032002 | Bacteria | 2282 |
| 757 | Ga0307414_10016323 | 3300032004 | Bacteria | 4512 |
| 758 | Ga0307411_10014197 | 3300032005 | Bacteria | 4425 |
| 759 | Ga0307411_10235027 | 3300032005 | Bacteria | 1431 |
| 760 | Ga0307415_100104630 | 3300032126 | Bacteria | 2085 |
| 761 | Ga0373926_0131172 | 3300035083 | Bacteria | 949 |
| 762 | Ga0373926_0178304 | 3300035083 | Bacteria | 814 |
| 763 | Ga0373928_0141958 | 3300035084 | Bacteria | 659 |
| 764 | Ga0373928_0206433 | 3300035084 | Bacteria | 569 |
| 765 | Ga0373934_0153330 | 3300035086 | Bacteria | 944 |
| 766 | Ga0373944_0038235 | 3300035089 | Bacteria | 1473 |
| 767 | Ga0373923_0004775 | 3300035111 | Bacteria | 4533 |
| 768 | Ga0373923_0203504 | 3300035111 | Bacteria | 916 |
| 769 | Ga0373923_0342261 | 3300035111 | Bacteria | 713 |
| 770 | Ga0373932_0069873 | 3300035112 | Bacteria | 1087 |
| 771 | Ga0373932_0240562 | 3300035112 | Bacteria | 657 |
| 772 | Ga0373936_0135879 | 3300035113 | Bacteria | 1059 |
| 773 | Ga0373941_0127722 | 3300035115 | Bacteria | 913 |
| 774 | Ga0373941_0271081 | 3300035115 | Bacteria | 669 |
| 775 | Ga0373945_0046039 | 3300035116 | Bacteria | 1590 |
| 776 | Ga0373945_0048762 | 3300035116 | Bacteria | 1552 |
| 777 | Ga0373954_0120172 | 3300035118 | Bacteria | 1275 |
| 778 | Ga0373956_0047636 | 3300035119 | Bacteria | 1918 |
| 779 | Ga0373956_0201944 | 3300035119 | Bacteria | 942 |
| 780 | Ga0373957_0053871 | 3300035120 | Bacteria | 1544 |
| 781 | Ga0373960_0061905 | 3300035121 | Bacteria | 1138 |
| 782 | Ga0373960_0212208 | 3300035121 | Bacteria | 689 |
| 783 | Ga0373943_0001856 | 3300035170 | Bacteria | 9548 |
| 784 | Ga0373943_0017801 | 3300035170 | Bacteria | 3255 |
| 785 | Ga0373943_0325241 | 3300035170 | Bacteria | 877 |
| 786 | Ga0373946_0403741 | 3300035171 | Bacteria | 690 |
| 787 | Ga0373955_0288351 | 3300035172 | Bacteria | 988 |
| 788 | Ga0373955_0329151 | 3300035172 | Bacteria | 923 |
| 789 | Ga0373942_0358248 | 3300035207 | Bacteria | 517 |
| 790 | Ga0373962_0100731 | 3300035242 | Bacteria | 901 |
| 791 | Ga0373924_0067174 | 3300035410 | Bacteria | 1508 |
| 792 | Ga0373924_0149373 | 3300035410 | Bacteria | 1022 |
| 793 | Ga0373931_0040708 | 3300035691 | Bacteria | 2439 |
| 794 | Ga0373931_0241595 | 3300035691 | Bacteria | 1095 |
| 795 | Ga0373931_0382374 | 3300035691 | Bacteria | 888 |
| 796 | Ga0373931_0685960 | 3300035691 | Bacteria | 675 |
| 797 | Ga0373931_0798042 | 3300035691 | Bacteria | 629 |
| 798 | Ga0373935_0053852 | 3300035692 | Bacteria | 2560 |
| 799 | Ga0373935_0102216 | 3300035692 | Bacteria | 1891 |
| 800 | Ga0373935_0150025 | 3300035692 | Bacteria | 1581 |
| 801 | Ga0373935_0246897 | 3300035692 | Bacteria | 1248 |
| 802 | Ga0373935_0690550 | 3300035692 | Bacteria | 750 |
| 803 | Ga0373927_0108261 | 3300035695 | Bacteria | 1810 |
| 804 | Ga0373933_0048328 | 3300035724 | Bacteria | 2533 |
| 805 | Ga0373933_0207289 | 3300035724 | Bacteria | 1255 |
| 806 | Ga0373933_0213579 | 3300035724 | Bacteria | 1236 |
| 807 | Ga0373933_0507228 | 3300035724 | Bacteria | 790 |
| 808 | Ga0373947_0000695 | 3300035725 | Bacteria | 20048 |
| 809 | Ga0373947_0006392 | 3300035725 | Bacteria | 6847 |
| 810 | Ga0373947_0246830 | 3300035725 | Bacteria | 1179 |
| 811 | Ga0373947_0363030 | 3300035725 | Bacteria | 973 |
| 812 | Ga0373937_0001944 | 3300036401 | Bacteria | 17289 |
| 813 | Ga0373937_0017853 | 3300036401 | Bacteria | 6330 |
| 814 | Ga0373937_0037507 | 3300036401 | Bacteria | 4417 |
| 815 | Ga0373937_0125976 | 3300036401 | Bacteria | 2389 |
| 816 | Ga0373937_1387833 | 3300036401 | Bacteria | 650 |
| 817 | Ga0316582_0250654 | 3300036647 | Bacteria | 1213 |
| 818 | Ga0373925_0004944 | 3300037068 | Bacteria | 10016 |
| 819 | Ga0373925_0243960 | 3300037068 | Bacteria | 1439 |
| 820 | Ga0373925_0650794 | 3300037068 | Bacteria | 868 |
| 821 | Ga0373925_0858440 | 3300037068 | Bacteria | 748 |
| 822 | Ga0373925_1271220 | 3300037068 | Bacteria | 604 |
| 823 | Ga0395899_0026847 | 3300037312 | Bacteria | 4344 |
| 824 | Ga0395899_0027964 | 3300037312 | Bacteria | 4247 |
| 825 | Ga0395899_0033987 | 3300037312 | Bacteria | 3828 |
| 826 | Ga0395899_0051296 | 3300037312 | Bacteria | 3062 |
| 827 | Ga0395899_0066928 | 3300037312 | Bacteria | 2637 |
| 828 | Ga0395899_0079485 | 3300037312 | Bacteria | 2388 |
| 829 | Ga0395899_0271370 | 3300037312 | Bacteria | 1157 |
| 830 | Ga0395899_0576025 | 3300037312 | Bacteria | 720 |
| 831 | Ga0395900_0003484 | 3300037418 | Bacteria | 16983 |
| 832 | Ga0395900_0005403 | 3300037418 | Bacteria | 13384 |
| 833 | Ga0395900_0008039 | 3300037418 | Bacteria | 10858 |
| 834 | Ga0395900_0013982 | 3300037418 | Bacteria | 8192 |
| 835 | Ga0395900_0020785 | 3300037418 | Bacteria | 6710 |
| 836 | Ga0395900_0032892 | 3300037418 | Bacteria | 5335 |
| 837 | Ga0395900_0055275 | 3300037418 | Bacteria | 4088 |
| 838 | Ga0395900_0092866 | 3300037418 | Bacteria | 3100 |
| 839 | Ga0395900_0260483 | 3300037418 | Bacteria | 1732 |
| 840 | Ga0395900_0476283 | 3300037418 | Bacteria | 1201 |
| 841 | Ga0395900_0632917 | 3300037418 | Bacteria | 1008 |
| 842 | Ga0395898_0005726 | 3300037466 | Bacteria | 13385 |
| 843 | Ga0395898_0006566 | 3300037466 | Bacteria | 12409 |
| 844 | Ga0395898_0008907 | 3300037466 | Bacteria | 10572 |
| 845 | Ga0395898_0015727 | 3300037466 | Bacteria | 7753 |
| 846 | Ga0395898_0030358 | 3300037466 | Bacteria | 5409 |
| 847 | Ga0395898_0100928 | 3300037466 | Bacteria | 2771 |
| 848 | Ga0395898_0165459 | 3300037466 | Bacteria | 2115 |
| 849 | Ga0395898_0346098 | 3300037466 | Bacteria | 1417 |
| 850 | Ga0395898_0465826 | 3300037466 | Bacteria | 1203 |
| 851 | Ga0395898_0532919 | 3300037466 | Bacteria | 1116 |
| 852 | Ga0395898_0938964 | 3300037466 | Bacteria | 802 |
| 853 | Ga0395898_1409829 | 3300037466 | Bacteria | 624 |
| 854 | Ga0395898_1529062 | 3300037466 | Bacteria | 593 |
| 855 | Ga0395905_0002297 | 3300037471 | Bacteria | 21445 |
| 856 | Ga0395905_0002950 | 3300037471 | Bacteria | 18479 |
| 857 | Ga0395905_0020250 | 3300037471 | Bacteria | 6302 |
| 858 | Ga0395905_0024606 | 3300037471 | Bacteria | 5681 |
| 859 | Ga0395905_0065936 | 3300037471 | Bacteria | 3390 |
| 860 | Ga0395905_0067751 | 3300037471 | Bacteria | 3343 |
| 861 | Ga0395905_0117805 | 3300037471 | Bacteria | 2496 |
| 862 | Ga0395905_0118322 | 3300037471 | Bacteria | 2490 |
| 863 | Ga0395905_0143538 | 3300037471 | Bacteria | 2246 |
| 864 | Ga0395905_1085993 | 3300037471 | Bacteria | 703 |
| 865 | Ga0395905_1121377 | 3300037471 | Bacteria | 690 |
| 866 | Ga0436364_0821737 | 3300037853 | Bacteria | 1051 |
| 867 | Ga0395901_0000608 | 3300038443 | Bacteria | 41717 |
| 868 | Ga0395901_0007743 | 3300038443 | Bacteria | 10837 |
| 869 | Ga0395901_0022332 | 3300038443 | Bacteria | 6484 |
| 870 | Ga0395901_0027614 | 3300038443 | Bacteria | 5832 |
| 871 | Ga0395901_0030522 | 3300038443 | Bacteria | 5553 |
| 872 | Ga0395901_0045595 | 3300038443 | Bacteria | 4551 |
| 873 | Ga0395901_0097478 | 3300038443 | Bacteria | 3082 |
| 874 | Ga0395901_0112528 | 3300038443 | Bacteria | 2859 |
| 875 | Ga0395901_0117176 | 3300038443 | Bacteria | 2798 |
| 876 | Ga0395901_0277699 | 3300038443 | Bacteria | 1741 |
| 877 | Ga0395901_0284901 | 3300038443 | Bacteria | 1716 |
| 878 | Ga0395901_0313804 | 3300038443 | Bacteria | 1623 |
| 879 | Ga0395901_0665864 | 3300038443 | Bacteria | 1042 |
| 880 | Ga0395901_0813527 | 3300038443 | Bacteria | 922 |
| 881 | Ga0395901_0860493 | 3300038443 | Bacteria | 891 |
| 882 | Ga0395901_0970755 | 3300038443 | Bacteria | 827 |
| 883 | Ga0395901_1359367 | 3300038443 | Bacteria | 670 |
| 884 | Ga0436365_0656028 | 3300039437 | Bacteria | 813 |
| 885 | Ga0436360_0776362 | 3300039438 | Bacteria | 4441 |
| 886 | Ga0436363_0952217 | 3300039450 | Bacteria | 851 |
| 887 | Ga0436362_0380053 | 3300039453 | Bacteria | 1160 |
| 888 | Ga0436362_1147745 | 3300039453 | Bacteria | 3284 |
| 889 | Ga0439465_0094326 | 3300041413 | Bacteria | 1027 |
| 890 | Ga0451807_1368180 | 3300041486 | Bacteria | 1154 |
| 891 | Ga0451833_0863113 | 3300041491 | Bacteria | 1030 |
| 892 | Ga0451839_0797568 | 3300041496 | Bacteria | 788 |
| 893 | Ga0451853_3840200 | 3300041512 | Bacteria | 627 |
| 894 | Ga0439456_026426 | 3300042013 | Bacteria | 1235 |
| 895 | Ga0450920_022902 | 3300042122 | Bacteria | 1211 |
| 896 | Ga0439458_0102334 | 3300042157 | Bacteria | 744 |
| 897 | Ga0439444_0073923 | 3300042437 | Bacteria | 735 |
| 898 | Ga0439460_0092680 | 3300042461 | Bacteria | 962 |
| 899 | Ga0451577_1389975 | 3300042876 | Bacteria | 623 |
| 900 | Ga0466969_0004507 | 3300044656 | Bacteria | 7416 |
| 901 | Ga0466969_0010275 | 3300044656 | Bacteria | 4964 |
| 902 | Ga0466969_0091539 | 3300044656 | Bacteria | 1441 |
| 903 | Ga0466972_0046231 | 3300044658 | Bacteria | 2108 |
| 904 | Ga0466972_0213288 | 3300044658 | Bacteria | 903 |
| 905 | Ga0466972_0223562 | 3300044658 | Bacteria | 881 |
| 906 | Ga0466965_0024494 | 3300044683 | Bacteria | 2920 |
| 907 | Ga0466965_0051753 | 3300044683 | Bacteria | 2038 |
| 908 | Ga0466966_0009082 | 3300044684 | Bacteria | 6587 |
| 909 | Ga0466966_0010536 | 3300044684 | Bacteria | 6143 |
| 910 | Ga0466966_0026245 | 3300044684 | Bacteria | 3804 |
| 911 | Ga0466966_0068631 | 3300044684 | Bacteria | 2225 |
| 912 | Ga0466966_0171730 | 3300044684 | Bacteria | 1317 |
| 913 | Ga0466966_0667460 | 3300044684 | Bacteria | 626 |
| 914 | Ga0466961_0009633 | 3300044693 | Bacteria | 6150 |
| 915 | Ga0466961_0026261 | 3300044693 | Bacteria | 3745 |
| 916 | Ga0466961_0026772 | 3300044693 | Bacteria | 3707 |
| 917 | Ga0466961_0125361 | 3300044693 | Bacteria | 1611 |
| 918 | Ga0466961_0338604 | 3300044693 | Bacteria | 916 |
| 919 | Ga0466961_0457038 | 3300044693 | Bacteria | 772 |
| 920 | Ga0466963_0003701 | 3300044694 | Bacteria | 8794 |
| 921 | Ga0466963_0004189 | 3300044694 | Bacteria | 8354 |
| 922 | Ga0466963_0004471 | 3300044694 | Bacteria | 8134 |
| 923 | Ga0466963_0014876 | 3300044694 | Bacteria | 4806 |
| 924 | Ga0466963_0021567 | 3300044694 | Bacteria | 4066 |
| 925 | Ga0466963_0045882 | 3300044694 | Bacteria | 2879 |
| 926 | Ga0466963_0063742 | 3300044694 | Bacteria | 2467 |
| 927 | Ga0466963_0101421 | 3300044694 | Bacteria | 1970 |
| 928 | Ga0466963_0159350 | 3300044694 | Bacteria | 1570 |
| 929 | Ga0466963_0207834 | 3300044694 | Bacteria | 1369 |
| 930 | Ga0466963_0237225 | 3300044694 | Bacteria | 1278 |
| 931 | Ga0466963_0247612 | 3300044694 | Bacteria | 1250 |
| 932 | Ga0466963_0406939 | 3300044694 | Bacteria | 959 |
| 933 | Ga0466963_0503319 | 3300044694 | Bacteria | 855 |
| 934 | Ga0466963_0553379 | 3300044694 | Bacteria | 812 |
| 935 | Ga0466963_0654516 | 3300044694 | Bacteria | 741 |
| 936 | Ga0466963_0852651 | 3300044694 | Bacteria | 642 |
| 937 | Ga0466964_0013102 | 3300044706 | Bacteria | 3143 |
| 938 | Ga0466964_0110831 | 3300044706 | Bacteria | 1223 |
| 939 | Ga0466964_0156465 | 3300044706 | Bacteria | 1061 |
| 940 | Ga0466964_0196636 | 3300044706 | Bacteria | 965 |
| 941 | Ga0466964_0208338 | 3300044706 | Bacteria | 943 |
| 942 | Ga0466964_0235949 | 3300044706 | Bacteria | 895 |
| 943 | Ga0466964_0274808 | 3300044706 | Bacteria | 840 |
| 944 | Ga0466971_0000811 | 3300044719 | Bacteria | 12589 |
| 945 | Ga0466971_0029937 | 3300044719 | Bacteria | 2435 |
| 946 | Ga0466971_0176300 | 3300044719 | Bacteria | 1004 |
| 947 | Ga0466968_0001383 | 3300044735 | Bacteria | 8679 |
| 948 | Ga0466968_0008580 | 3300044735 | Bacteria | 3915 |
| 949 | Ga0466968_0412375 | 3300044735 | Bacteria | 663 |
| 950 | Ga0466970_0013070 | 3300044765 | Bacteria | 4253 |
| 951 | Ga0466970_0044329 | 3300044765 | Bacteria | 2368 |
| 952 | Ga0466970_0166158 | 3300044765 | Bacteria | 1222 |
| 953 | Ga0466957_0005732 | 3300044842 | Bacteria | 6984 |
| 954 | Ga0466957_0017579 | 3300044842 | Bacteria | 4191 |
| 955 | Ga0466957_0027729 | 3300044842 | Bacteria | 3367 |
| 956 | Ga0466957_0028136 | 3300044842 | Bacteria | 3345 |
| 957 | Ga0466957_0038491 | 3300044842 | Bacteria | 2881 |
| 958 | Ga0466957_0053073 | 3300044842 | Bacteria | 2470 |
| 959 | Ga0466957_0063308 | 3300044842 | Bacteria | 2273 |
| 960 | Ga0466957_0186843 | 3300044842 | Bacteria | 1355 |
| 961 | Ga0466957_0272997 | 3300044842 | Bacteria | 1129 |
| 962 | Ga0466960_0006002 | 3300044901 | Bacteria | 4850 |
| 963 | Ga0466959_0005002 | 3300045049 | Bacteria | 8995 |
| 964 | Ga0466959_0005947 | 3300045049 | Bacteria | 8413 |
| 965 | Ga0466959_0025018 | 3300045049 | Bacteria | 4422 |
| 966 | Ga0466959_0027957 | 3300045049 | Bacteria | 4182 |
| 967 | Ga0466959_0128359 | 3300045049 | Bacteria | 1798 |
| 968 | Ga0466959_0258199 | 3300045049 | Bacteria | 1200 |
| 969 | Ga0466959_0688490 | 3300045049 | Bacteria | 685 |
| 970 | Ga0466958_0004460 | 3300045836 | Bacteria | 7391 |
| 971 | Ga0466958_0012842 | 3300045836 | Bacteria | 4753 |
| 972 | Ga0466958_0021604 | 3300045836 | Bacteria | 3763 |
| 973 | Ga0466958_0036844 | 3300045836 | Bacteria | 2929 |
| 974 | Ga0466958_0054902 | 3300045836 | Bacteria | 2416 |
| 975 | Ga0466958_0078285 | 3300045836 | Bacteria | 2031 |
| 976 | Ga0466958_0100437 | 3300045836 | Bacteria | 1798 |
| 977 | Ga0466958_0239482 | 3300045836 | Bacteria | 1159 |
| 978 | Ga0466958_0366278 | 3300045836 | Bacteria | 928 |
| 979 | Ga0466967_0006451 | 3300045976 | Bacteria | 8302 |
| 980 | Ga0466967_0011148 | 3300045976 | Bacteria | 6791 |
| 981 | Ga0466967_0013513 | 3300045976 | Bacteria | 6313 |
| 982 | Ga0466967_0015715 | 3300045976 | Bacteria | 5944 |
| 983 | Ga0466967_0021669 | 3300045976 | Bacteria | 5226 |
| 984 | Ga0466967_0035150 | 3300045976 | Bacteria | 4261 |
| 985 | Ga0466967_0038721 | 3300045976 | Bacteria | 4091 |
| 986 | Ga0466967_0041751 | 3300045976 | Bacteria | 3958 |
| 987 | Ga0466967_0045124 | 3300045976 | Bacteria | 3828 |
| 988 | Ga0466967_0048763 | 3300045976 | Bacteria | 3700 |
| 989 | Ga0466967_0068371 | 3300045976 | Bacteria | 3171 |
| 990 | Ga0466967_0086049 | 3300045976 | Bacteria | 2847 |
| 991 | Ga0466967_0104259 | 3300045976 | Bacteria | 2596 |
| 992 | Ga0466967_0129685 | 3300045976 | Bacteria | 2339 |
| 993 | Ga0466967_0193253 | 3300045976 | Bacteria | 1924 |
| 994 | Ga0466967_0319700 | 3300045976 | Bacteria | 1496 |
| 995 | Ga0466967_0846890 | 3300045976 | Bacteria | 908 |
| 996 | Ga0466967_1801184 | 3300045976 | Bacteria | 609 |
| 997 | Ga0466967_2050243 | 3300045976 | Bacteria | 568 |
| 998 | Ga0495592_0000082 | 3300046454 | Bacteria | 83312 |
| 999 | Ga0495592_0109231 | 3300046454 | Bacteria | 1959 |
| 1000 | Ga0495592_0226657 | 3300046454 | Bacteria | 1246 |
| 1001 | Ga0495592_0736525 | 3300046454 | Bacteria | 590 |
| 1002 | Ga0495603_0006416 | 3300046455 | Bacteria | 7041 |
| 1003 | Ga0495603_0016906 | 3300046455 | Bacteria | 4414 |
| 1004 | Ga0495603_0019605 | 3300046455 | Bacteria | 4094 |
| 1005 | Ga0495603_0055549 | 3300046455 | Bacteria | 2346 |
| 1006 | Ga0495603_0079401 | 3300046455 | Bacteria | 1923 |
| 1007 | Ga0495603_0184050 | 3300046455 | Bacteria | 1208 |
| 1008 | Ga0495629_0007529 | 3300046459 | Bacteria | 8026 |
| 1009 | Ga0495629_0010957 | 3300046459 | Bacteria | 6592 |
| 1010 | Ga0495629_0025764 | 3300046459 | Bacteria | 4180 |
| 1011 | Ga0495629_0102512 | 3300046459 | Bacteria | 1996 |
| 1012 | Ga0495629_0339656 | 3300046459 | Bacteria | 1025 |
| 1013 | Ga0495629_0455326 | 3300046459 | Bacteria | 866 |
| 1014 | Ga0495629_0459346 | 3300046459 | Bacteria | 862 |
| 1015 | Ga0495629_0547591 | 3300046459 | Bacteria | 777 |
| 1016 | Ga0495629_0928086 | 3300046459 | Bacteria | 569 |
| 1017 | Ga0495638_0582878 | 3300046460 | Bacteria | 552 |
| 1018 | Ga0495641_0032439 | 3300046461 | Bacteria | 2486 |
| 1019 | Ga0495641_0050947 | 3300046461 | Bacteria | 1891 |
| 1020 | Ga0495641_0145703 | 3300046461 | Bacteria | 1058 |
| 1021 | Ga0495641_0200396 | 3300046461 | Bacteria | 894 |
| 1022 | Ga0495651_0000254 | 3300046462 | Bacteria | 41379 |
| 1023 | Ga0495651_0118119 | 3300046462 | Bacteria | 1951 |
| 1024 | Ga0495651_0330441 | 3300046462 | Bacteria | 1013 |
| 1025 | Ga0495653_0033226 | 3300046463 | Bacteria | 4088 |
| 1026 | Ga0495653_0056045 | 3300046463 | Bacteria | 3006 |
| 1027 | Ga0495653_0062040 | 3300046463 | Bacteria | 2826 |
| 1028 | Ga0495653_0331519 | 3300046463 | Bacteria | 983 |
| 1029 | Ga0495580_0015356 | 3300046472 | Bacteria | 5777 |
| 1030 | Ga0495580_0414083 | 3300046472 | Bacteria | 907 |
| 1031 | Ga0495580_0450201 | 3300046472 | Bacteria | 864 |
| 1032 | Ga0495582_0015545 | 3300046473 | Bacteria | 4180 |
| 1033 | Ga0495582_0015963 | 3300046473 | Bacteria | 4117 |
| 1034 | Ga0495582_0023288 | 3300046473 | Bacteria | 3388 |
| 1035 | Ga0495582_0073875 | 3300046473 | Bacteria | 1887 |
| 1036 | Ga0495582_0125969 | 3300046473 | Bacteria | 1445 |
| 1037 | Ga0495582_0294629 | 3300046473 | Bacteria | 932 |
| 1038 | Ga0495582_0411421 | 3300046473 | Bacteria | 780 |
| 1039 | Ga0495582_0549023 | 3300046473 | Bacteria | 668 |
| 1040 | Ga0495605_0016774 | 3300046474 | Bacteria | 3958 |
| 1041 | Ga0495639_0001278 | 3300046475 | Bacteria | 11309 |
| 1042 | Ga0495639_0008210 | 3300046475 | Bacteria | 4484 |
| 1043 | Ga0495639_0133036 | 3300046475 | Bacteria | 1192 |
| 1044 | Ga0495639_0312500 | 3300046475 | Bacteria | 785 |
| 1045 | Ga0495662_0002354 | 3300046476 | Bacteria | 9524 |
| 1046 | Ga0495662_0107155 | 3300046476 | Bacteria | 1368 |
| 1047 | Ga0495664_0037746 | 3300046477 | Bacteria | 2851 |
| 1048 | Ga0495664_0105295 | 3300046477 | Bacteria | 1700 |
| 1049 | Ga0495664_0109398 | 3300046477 | Bacteria | 1667 |
| 1050 | Ga0495664_0250652 | 3300046477 | Bacteria | 1071 |
| 1051 | Ga0495664_0358547 | 3300046477 | Bacteria | 878 |
| 1052 | Ga0495664_0726659 | 3300046477 | Bacteria | 586 |
| 1053 | Ga0495584_0087083 | 3300046491 | Bacteria | 1574 |
| 1054 | Ga0495584_0495897 | 3300046491 | Bacteria | 622 |
| 1055 | Ga0495584_0664631 | 3300046491 | Bacteria | 531 |
| 1056 | Ga0495585_0095394 | 3300046492 | Bacteria | 1598 |
| 1057 | Ga0495594_0024508 | 3300046499 | Bacteria | 3241 |
| 1058 | Ga0495594_0053590 | 3300046499 | Bacteria | 2222 |
| 1059 | Ga0495594_0084112 | 3300046499 | Bacteria | 1779 |
| 1060 | Ga0495594_0609334 | 3300046499 | Bacteria | 619 |
| 1061 | Ga0495596_0022588 | 3300046500 | Bacteria | 2561 |
| 1062 | Ga0495596_0073391 | 3300046500 | Bacteria | 1329 |
| 1063 | Ga0495596_0102679 | 3300046500 | Bacteria | 1110 |
| 1064 | Ga0495596_0106757 | 3300046500 | Bacteria | 1088 |
| 1065 | Ga0495607_0048502 | 3300046501 | Bacteria | 2483 |
| 1066 | Ga0495607_0188969 | 3300046501 | Bacteria | 1027 |
| 1067 | Ga0495607_0333120 | 3300046501 | Bacteria | 705 |
| 1068 | Ga0495608_0004089 | 3300046511 | Bacteria | 10464 |
| 1069 | Ga0495608_0091613 | 3300046511 | Bacteria | 1965 |
| 1070 | Ga0495608_0268406 | 3300046511 | Bacteria | 1061 |
| 1071 | Ga0495608_0271781 | 3300046511 | Bacteria | 1053 |
| 1072 | Ga0495608_0335761 | 3300046511 | Bacteria | 932 |
| 1073 | Ga0495618_0002754 | 3300046514 | Bacteria | 11177 |
| 1074 | Ga0495618_0072183 | 3300046514 | Bacteria | 2196 |
| 1075 | Ga0495618_0127546 | 3300046514 | Bacteria | 1628 |
| 1076 | Ga0495618_0216426 | 3300046514 | Bacteria | 1209 |
| 1077 | Ga0495620_0074733 | 3300046515 | Bacteria | 1380 |
| 1078 | Ga0495628_0005951 | 3300046516 | Bacteria | 10673 |
| 1079 | Ga0495628_0101878 | 3300046516 | Bacteria | 2215 |
| 1080 | Ga0495628_0115368 | 3300046516 | Bacteria | 2063 |
| 1081 | Ga0495628_0124383 | 3300046516 | Bacteria | 1976 |
| 1082 | Ga0495628_0201504 | 3300046516 | Bacteria | 1499 |
| 1083 | Ga0495630_0025613 | 3300046517 | Bacteria | 4363 |
| 1084 | Ga0495630_0048821 | 3300046517 | Bacteria | 3167 |
| 1085 | Ga0495630_0063085 | 3300046517 | Bacteria | 2783 |
| 1086 | Ga0495630_0224548 | 3300046517 | Bacteria | 1434 |
| 1087 | Ga0495630_0346156 | 3300046517 | Bacteria | 1137 |
| 1088 | Ga0495630_0409240 | 3300046517 | Bacteria | 1039 |
| 1089 | Ga0495630_0673763 | 3300046517 | Bacteria | 792 |
| 1090 | Ga0495630_0946211 | 3300046517 | Bacteria | 655 |
| 1091 | Ga0495637_0066058 | 3300046520 | Bacteria | 1471 |
| 1092 | Ga0495637_0144781 | 3300046520 | Bacteria | 900 |
| 1093 | Ga0495644_0002786 | 3300046523 | Bacteria | 6926 |
| 1094 | Ga0495644_0054640 | 3300046523 | Bacteria | 1500 |
| 1095 | Ga0495644_0135363 | 3300046523 | Bacteria | 940 |
| 1096 | Ga0495644_0164875 | 3300046523 | Bacteria | 850 |
| 1097 | Ga0495663_0262423 | 3300046525 | Bacteria | 615 |
| 1098 | Ga0495666_0011435 | 3300046526 | Bacteria | 4423 |
| 1099 | Ga0495666_0014313 | 3300046526 | Bacteria | 3952 |
| 1100 | Ga0495642_0132537 | 3300046528 | Bacteria | 1073 |
| 1101 | Ga0495642_0172573 | 3300046528 | Bacteria | 940 |
| 1102 | Ga0495652_0000144 | 3300046529 | Bacteria | 80486 |
| 1103 | Ga0495652_0028166 | 3300046529 | Bacteria | 4947 |
| 1104 | Ga0495652_0029633 | 3300046529 | Bacteria | 4807 |
| 1105 | Ga0495652_0066760 | 3300046529 | Bacteria | 3017 |
| 1106 | Ga0495652_0260278 | 3300046529 | Bacteria | 1281 |
| 1107 | Ga0495652_0383841 | 3300046529 | Bacteria | 998 |
| 1108 | Ga0495652_0422562 | 3300046529 | Bacteria | 939 |
| 1109 | Ga0495654_0170806 | 3300046530 | Bacteria | 948 |
| 1110 | Ga0495665_0030850 | 3300046531 | Bacteria | 2867 |
| 1111 | Ga0495665_0041398 | 3300046531 | Bacteria | 2452 |
| 1112 | Ga0495640_0034587 | 3300046533 | Bacteria | 3582 |
| 1113 | Ga0495640_0198122 | 3300046533 | Bacteria | 1274 |
| 1114 | Ga0495586_0041582 | 3300046535 | Bacteria | 2475 |
| 1115 | Ga0495586_0093460 | 3300046535 | Bacteria | 1663 |
| 1116 | Ga0495587_0000060 | 3300046536 | Bacteria | 93780 |
| 1117 | Ga0495587_0049059 | 3300046536 | Bacteria | 2500 |
| 1118 | Ga0495587_0068914 | 3300046536 | Bacteria | 2060 |
| 1119 | Ga0495587_0072977 | 3300046536 | Bacteria | 1994 |
| 1120 | Ga0495587_0080158 | 3300046536 | Bacteria | 1892 |
| 1121 | Ga0495587_0092874 | 3300046536 | Bacteria | 1742 |
| 1122 | Ga0495598_0038241 | 3300046537 | Bacteria | 1389 |
| 1123 | Ga0495609_0123311 | 3300046538 | Bacteria | 1113 |
| 1124 | Ga0495609_0249949 | 3300046538 | Bacteria | 730 |
| 1125 | Ga0495645_0000038 | 3300046543 | Bacteria | 96124 |
| 1126 | Ga0495645_0006731 | 3300046543 | Bacteria | 7984 |
| 1127 | Ga0495645_0228928 | 3300046543 | Bacteria | 1246 |
| 1128 | Ga0495645_0399325 | 3300046543 | Bacteria | 876 |
| 1129 | Ga0495622_0115122 | 3300046557 | Bacteria | 1230 |
| 1130 | Ga0495667_0101587 | 3300046559 | Bacteria | 1860 |
| 1131 | Ga0495667_0106308 | 3300046559 | Bacteria | 1814 |
| 1132 | Ga0495667_0138363 | 3300046559 | Bacteria | 1569 |
| 1133 | Ga0495656_0026801 | 3300046615 | Bacteria | 2297 |
| 1134 | Ga0495656_0068571 | 3300046615 | Bacteria | 1568 |
| 1135 | Ga0495656_0110469 | 3300046615 | Bacteria | 1285 |
| 1136 | Ga0495668_0108621 | 3300046616 | Bacteria | 1517 |
| 1137 | Ga0495634_0029831 | 3300046642 | Bacteria | 3773 |
| 1138 | Ga0495634_0047853 | 3300046642 | Bacteria | 2880 |
| 1139 | Ga0495634_0049693 | 3300046642 | Bacteria | 2818 |
| 1140 | Ga0495634_0257353 | 3300046642 | Bacteria | 1066 |
| 1141 | Ga0495634_0315289 | 3300046642 | Bacteria | 943 |
| 1142 | Ga0495634_0683320 | 3300046642 | Bacteria | 591 |
| 1143 | Ga0495611_0039072 | 3300046648 | Bacteria | 2112 |
| 1144 | Ga0495635_0009523 | 3300046663 | Bacteria | 6791 |
| 1145 | Ga0495635_0013153 | 3300046663 | Bacteria | 5793 |
| 1146 | Ga0495635_0041858 | 3300046663 | Bacteria | 3164 |
| 1147 | Ga0495635_0095636 | 3300046663 | Bacteria | 2031 |
| 1148 | Ga0495635_0142819 | 3300046663 | Bacteria | 1630 |
| 1149 | Ga0495635_0327008 | 3300046663 | Bacteria | 1025 |
| 1150 | Ga0495659_0009389 | 3300046664 | Bacteria | 3121 |
| 1151 | Ga0495659_0161914 | 3300046664 | Bacteria | 904 |
| 1152 | Ga0495659_0173365 | 3300046664 | Bacteria | 876 |
| 1153 | Ga0495659_0190402 | 3300046664 | Bacteria | 838 |
| 1154 | Ga0495661_0166056 | 3300046665 | Bacteria | 1181 |
| 1155 | Ga0495588_0183108 | 3300046674 | Bacteria | 1107 |
| 1156 | Ga0495588_0378415 | 3300046674 | Bacteria | 743 |
| 1157 | Ga0495588_0508561 | 3300046674 | Bacteria | 631 |
| 1158 | Ga0495588_0527774 | 3300046674 | Bacteria | 619 |
| 1159 | Ga0495657_0015397 | 3300046675 | Bacteria | 5598 |
| 1160 | Ga0495657_0103474 | 3300046675 | Bacteria | 1811 |
| 1161 | Ga0495657_0345580 | 3300046675 | Bacteria | 881 |
| 1162 | Ga0495657_0538100 | 3300046675 | Bacteria | 679 |
| 1163 | Ga0495599_0000048 | 3300046678 | Bacteria | 85175 |
| 1164 | Ga0495599_0032178 | 3300046678 | Bacteria | 3292 |
| 1165 | Ga0495599_0218968 | 3300046678 | Bacteria | 1165 |
| 1166 | Ga0495599_0318156 | 3300046678 | Bacteria | 937 |
| 1167 | Ga0495623_0001647 | 3300046679 | Bacteria | 15000 |
| 1168 | Ga0495623_0274569 | 3300046679 | Bacteria | 940 |
| 1169 | Ga0495623_0402171 | 3300046679 | Bacteria | 736 |
| 1170 | Ga0495646_0015156 | 3300046680 | Bacteria | 4897 |
| 1171 | Ga0495646_0091567 | 3300046680 | Bacteria | 1754 |
| 1172 | Ga0495646_0100604 | 3300046680 | Bacteria | 1658 |
| 1173 | Ga0495646_0106134 | 3300046680 | Bacteria | 1604 |
| 1174 | Ga0495647_0001533 | 3300046681 | Bacteria | 7139 |
| 1175 | Ga0495647_0001646 | 3300046681 | Bacteria | 6920 |
| 1176 | Ga0495647_0015581 | 3300046681 | Bacteria | 2665 |
| 1177 | Ga0495647_0028628 | 3300046681 | Bacteria | 2055 |
| 1178 | Ga0495647_0156005 | 3300046681 | Bacteria | 981 |
| 1179 | Ga0495647_0180326 | 3300046681 | Bacteria | 918 |
| 1180 | Ga0495658_0001182 | 3300046683 | Bacteria | 13746 |
| 1181 | Ga0495658_0010111 | 3300046683 | Bacteria | 4714 |
| 1182 | Ga0495658_0058066 | 3300046683 | Bacteria | 2212 |
| 1183 | Ga0495658_0074539 | 3300046683 | Bacteria | 1978 |
| 1184 | Ga0495658_0097970 | 3300046683 | Bacteria | 1746 |
| 1185 | Ga0495658_0314540 | 3300046683 | Bacteria | 992 |
| 1186 | Ga0495658_0317888 | 3300046683 | Bacteria | 986 |
| 1187 | Ga0495658_0510153 | 3300046683 | Bacteria | 769 |
| 1188 | Ga0495658_0806690 | 3300046683 | Bacteria | 601 |
| 1189 | Ga0495613_0033317 | 3300046689 | Bacteria | 3828 |
| 1190 | Ga0495613_0038260 | 3300046689 | Bacteria | 3555 |
| 1191 | Ga0495613_0045117 | 3300046689 | Bacteria | 3260 |
| 1192 | Ga0495613_0057564 | 3300046689 | Bacteria | 2854 |
| 1193 | Ga0495624_0014707 | 3300046690 | Bacteria | 5299 |
| 1194 | Ga0495624_0054293 | 3300046690 | Bacteria | 2526 |
| 1195 | Ga0495624_0154463 | 3300046690 | Bacteria | 1403 |
| 1196 | Ga0495670_0022603 | 3300046691 | Bacteria | 3106 |
| 1197 | Ga0495670_0326546 | 3300046691 | Bacteria | 824 |
| 1198 | Ga0495670_0479709 | 3300046691 | Bacteria | 675 |
| 1199 | Ga0495671_0301212 | 3300046692 | Bacteria | 771 |
| 1200 | Ga0495649_0486087 | 3300046694 | Bacteria | 615 |
| 1201 | Ga0495589_0038706 | 3300046794 | Bacteria | 2385 |
| 1202 | Ga0495589_0102899 | 3300046794 | Bacteria | 1381 |
| 1203 | Ga0495589_0217337 | 3300046794 | Bacteria | 899 |
| 1204 | Ga0495589_0256981 | 3300046794 | Bacteria | 815 |
| 1205 | Ga0495600_0059326 | 3300046809 | Bacteria | 2499 |
| 1206 | Ga0495600_0192117 | 3300046809 | Bacteria | 1312 |
| 1207 | Ga0495600_0423693 | 3300046809 | Bacteria | 826 |
| 1208 | Ga0495600_0451787 | 3300046809 | Bacteria | 795 |
| 1209 | Ga0495660_0204466 | 3300046810 | Bacteria | 941 |
| 1210 | Ga0495660_0255255 | 3300046810 | Bacteria | 812 |
| 1211 | Ga0495581_0007592 | 3300047315 | Bacteria | 6269 |
| 1212 | Ga0495581_0035922 | 3300047315 | Bacteria | 2866 |
| 1213 | Ga0495581_0474985 | 3300047315 | Bacteria | 727 |
| 1214 | Ga0495581_0564153 | 3300047315 | Bacteria | 660 |
| 1215 | Ga0495604_0000043 | 3300047317 | Bacteria | 116335 |
| 1216 | Ga0495604_0159747 | 3300047317 | Bacteria | 1593 |
| 1217 | Ga0495604_0287193 | 3300047317 | Bacteria | 1109 |
| 1218 | Ga0495604_0412910 | 3300047317 | Bacteria | 887 |
| 1219 | Ga0495604_0921317 | 3300047317 | Bacteria | 545 |
| 1220 | Ga0495636_0329448 | 3300047318 | Bacteria | 718 |
| 1221 | Ga0495674_0031987 | 3300047319 | Bacteria | 4775 |
| 1222 | Ga0495674_0063357 | 3300047319 | Bacteria | 3216 |
| 1223 | Ga0495674_0157644 | 3300047319 | Bacteria | 1900 |
| 1224 | Ga0495674_0188984 | 3300047319 | Bacteria | 1712 |
| 1225 | Ga0495674_0251882 | 3300047319 | Bacteria | 1453 |
| 1226 | Ga0495674_0283417 | 3300047319 | Bacteria | 1357 |
| 1227 | Ga0495674_0469375 | 3300047319 | Bacteria | 1009 |
| 1228 | Ga0495674_0556665 | 3300047319 | Bacteria | 912 |
| 1229 | Ga0495674_0717293 | 3300047319 | Bacteria | 783 |
| 1230 | Ga0495676_0003238 | 3300047321 | Bacteria | 14724 |
| 1231 | Ga0495676_0037011 | 3300047321 | Bacteria | 4067 |
| 1232 | Ga0495676_0351535 | 3300047321 | Bacteria | 985 |
| 1233 | Ga0495676_0606602 | 3300047321 | Bacteria | 712 |
| 1234 | Ga0495676_0625607 | 3300047321 | Bacteria | 700 |
| 1235 | Ga0495680_0001621 | 3300047322 | Bacteria | 23946 |
| 1236 | Ga0495680_0006421 | 3300047322 | Bacteria | 10927 |
| 1237 | Ga0495680_0012966 | 3300047322 | Bacteria | 7297 |
| 1238 | Ga0495680_0034460 | 3300047322 | Bacteria | 4087 |
| 1239 | Ga0495680_0111639 | 3300047322 | Bacteria | 2025 |
| 1240 | Ga0495680_0143144 | 3300047322 | Bacteria | 1748 |
| 1241 | Ga0495680_0223492 | 3300047322 | Bacteria | 1343 |
| 1242 | Ga0495683_0079607 | 3300047323 | Bacteria | 1600 |
| 1243 | Ga0495675_0000413 | 3300047444 | Bacteria | 29216 |
| 1244 | Ga0495675_0005668 | 3300047444 | Bacteria | 7631 |
| 1245 | Ga0495677_0232428 | 3300047445 | Bacteria | 719 |
| 1246 | Ga0495684_0099684 | 3300047471 | Bacteria | 2196 |
| 1247 | Ga0495684_0103614 | 3300047471 | Bacteria | 2150 |
| 1248 | Ga0495684_0267993 | 3300047471 | Bacteria | 1236 |
| 1249 | Ga0495684_0358541 | 3300047471 | Bacteria | 1033 |
| 1250 | Ga0495593_0008203 | 3300047673 | Bacteria | 6076 |
| 1251 | Ga0495593_0008597 | 3300047673 | Bacteria | 5936 |
| 1252 | Ga0495593_0074431 | 3300047673 | Bacteria | 1761 |
| 1253 | Ga0495593_0412386 | 3300047673 | Bacteria | 676 |
| 1254 | Ga0495602_0008483 | 3300048088 | Bacteria | 10729 |
| 1255 | Ga0495602_0016733 | 3300048088 | Bacteria | 7365 |
| 1256 | Ga0495602_0273214 | 3300048088 | Bacteria | 1248 |
| 1257 | Ga0495602_0427376 | 3300048088 | Bacteria | 939 |
| 1258 | Ga0495602_0611426 | 3300048088 | Bacteria | 748 |
| 1259 | Ga0495614_0006192 | 3300048089 | Bacteria | 5376 |
| 1260 | Ga0495614_0035419 | 3300048089 | Bacteria | 2144 |
| 1261 | Ga0495614_0285238 | 3300048089 | Bacteria | 761 |
| 1262 | Ga0495614_0307288 | 3300048089 | Bacteria | 734 |
| 1263 | Ga0495615_0156671 | 3300048090 | Bacteria | 681 |
| 1264 | Ga0495626_0264478 | 3300048091 | Bacteria | 687 |
| 1265 | Ga0496100_0025042 | 3300048903 | Bacteria | 3645 |
| 1266 | Ga0496100_0094937 | 3300048903 | Bacteria | 2043 |
| 1267 | Ga0496100_0134046 | 3300048903 | Bacteria | 1748 |
| 1268 | Ga0496100_0349598 | 3300048903 | Bacteria | 1116 |
| 1269 | Ga0496100_0372299 | 3300048903 | Bacteria | 1083 |
| 1270 | Ga0496100_0389514 | 3300048903 | Bacteria | 1059 |
| 1271 | Ga0496100_0594120 | 3300048903 | Bacteria | 859 |
| 1272 | Ga0496101_0000625 | 3300048904 | Bacteria | 21507 |
| 1273 | Ga0496101_0001765 | 3300048904 | Bacteria | 12976 |
| 1274 | Ga0496101_0019351 | 3300048904 | Bacteria | 4646 |
| 1275 | Ga0496101_0026566 | 3300048904 | Bacteria | 4026 |
| 1276 | Ga0496101_0108464 | 3300048904 | Bacteria | 2087 |
| 1277 | Ga0496101_0190110 | 3300048904 | Bacteria | 1584 |
| 1278 | Ga0496101_0205860 | 3300048904 | Bacteria | 1522 |
| 1279 | Ga0496101_0287296 | 3300048904 | Bacteria | 1286 |
| 1280 | Ga0496101_0560345 | 3300048904 | Bacteria | 903 |
| 1281 | Ga0496101_0568248 | 3300048904 | Bacteria | 897 |
| 1282 | Ga0496101_0706513 | 3300048904 | Bacteria | 796 |
| 1283 | Ga0496101_1130989 | 3300048904 | Bacteria | 614 |
| 1284 | Ga0496102_0003464 | 3300048905 | Bacteria | 13382 |
| 1285 | Ga0496102_0004850 | 3300048905 | Bacteria | 11380 |
| 1286 | Ga0496102_0009140 | 3300048905 | Bacteria | 8500 |
| 1287 | Ga0496102_0010068 | 3300048905 | Bacteria | 8133 |
| 1288 | Ga0496102_0010768 | 3300048905 | Bacteria | 7877 |
| 1289 | Ga0496102_0108024 | 3300048905 | Bacteria | 2591 |
| 1290 | Ga0496102_0192503 | 3300048905 | Bacteria | 1922 |
| 1291 | Ga0496102_0199799 | 3300048905 | Bacteria | 1884 |
| 1292 | Ga0496102_0213831 | 3300048905 | Bacteria | 1817 |
| 1293 | Ga0496102_0511500 | 3300048905 | Bacteria | 1123 |
| 1294 | Ga0496102_0785822 | 3300048905 | Bacteria | 874 |
| 1295 | Ga0496102_1059488 | 3300048905 | Bacteria | 731 |
| 1296 | Ga0496103_0000427 | 3300048906 | Bacteria | 36647 |
| 1297 | Ga0496103_0004657 | 3300048906 | Bacteria | 8307 |
| 1298 | Ga0496103_0028417 | 3300048906 | Bacteria | 3393 |
| 1299 | Ga0496103_0063793 | 3300048906 | Bacteria | 2295 |
| 1300 | Ga0496103_0064919 | 3300048906 | Bacteria | 2276 |
| 1301 | Ga0496103_0091724 | 3300048906 | Bacteria | 1917 |
| 1302 | Ga0496103_0561292 | 3300048906 | Bacteria | 728 |
| 1303 | Ga0496104_0016549 | 3300048907 | Bacteria | 6701 |
| 1304 | Ga0496104_0016872 | 3300048907 | Bacteria | 6639 |
| 1305 | Ga0496104_0077315 | 3300048907 | Bacteria | 3171 |
| 1306 | Ga0496104_0088244 | 3300048907 | Bacteria | 2962 |
| 1307 | Ga0496104_0120426 | 3300048907 | Bacteria | 2519 |
| 1308 | Ga0496104_0168519 | 3300048907 | Bacteria | 2100 |
| 1309 | Ga0496104_0186929 | 3300048907 | Bacteria | 1982 |
| 1310 | Ga0496104_0308408 | 3300048907 | Bacteria | 1495 |
| 1311 | Ga0496104_0354789 | 3300048907 | Bacteria | 1379 |
| 1312 | Ga0496104_0686984 | 3300048907 | Bacteria | 931 |
| 1313 | Ga0496104_0979325 | 3300048907 | Bacteria | 750 |
| 1314 | Ga0496104_1029384 | 3300048907 | Bacteria | 727 |
| 1315 | Ga0496105_0003116 | 3300048908 | Bacteria | 12201 |
| 1316 | Ga0496105_0006964 | 3300048908 | Bacteria | 8710 |
| 1317 | Ga0496105_0022559 | 3300048908 | Bacteria | 5099 |
| 1318 | Ga0496105_0030137 | 3300048908 | Bacteria | 4445 |
| 1319 | Ga0496105_0034600 | 3300048908 | Bacteria | 4156 |
| 1320 | Ga0496105_0047956 | 3300048908 | Bacteria | 3526 |
| 1321 | Ga0496105_0097943 | 3300048908 | Bacteria | 2422 |
| 1322 | Ga0496105_0157072 | 3300048908 | Bacteria | 1868 |
| 1323 | Ga0496105_0216393 | 3300048908 | Bacteria | 1560 |
| 1324 | Ga0496106_0000838 | 3300048909 | Bacteria | 22301 |
| 1325 | Ga0496106_0002532 | 3300048909 | Bacteria | 13605 |
| 1326 | Ga0496106_0011768 | 3300048909 | Bacteria | 6458 |
| 1327 | Ga0496106_0108030 | 3300048909 | Bacteria | 2164 |
| 1328 | Ga0496106_0395856 | 3300048909 | Bacteria | 1110 |
| 1329 | Ga0496106_0428982 | 3300048909 | Bacteria | 1062 |
| 1330 | Ga0496106_1373478 | 3300048909 | Bacteria | 547 |
| 1331 | Ga0496107_0000371 | 3300048910 | Bacteria | 24322 |
| 1332 | Ga0496107_0000608 | 3300048910 | Bacteria | 19966 |
| 1333 | Ga0496107_0001409 | 3300048910 | Bacteria | 14833 |
| 1334 | Ga0496107_0031040 | 3300048910 | Bacteria | 3810 |
| 1335 | Ga0496107_0085656 | 3300048910 | Bacteria | 2299 |
| 1336 | Ga0496107_0238090 | 3300048910 | Bacteria | 1354 |
| 1337 | Ga0496107_0288475 | 3300048910 | Bacteria | 1221 |
| 1338 | Ga0496107_0411333 | 3300048910 | Bacteria | 1006 |
| 1339 | Ga0496107_0457669 | 3300048910 | Bacteria | 947 |
| 1340 | Ga0496107_0774976 | 3300048910 | Bacteria | 703 |
| 1341 | Ga0496107_0866342 | 3300048910 | Bacteria | 659 |
| 1342 | Ga0496108_0005123 | 3300048911 | Bacteria | 10594 |
| 1343 | Ga0496108_0007474 | 3300048911 | Bacteria | 8858 |
| 1344 | Ga0496108_0025543 | 3300048911 | Bacteria | 4868 |
| 1345 | Ga0496108_0055197 | 3300048911 | Bacteria | 3335 |
| 1346 | Ga0496108_0056915 | 3300048911 | Bacteria | 3285 |
| 1347 | Ga0496108_0086072 | 3300048911 | Bacteria | 2668 |
| 1348 | Ga0496108_0100883 | 3300048911 | Bacteria | 2462 |
| 1349 | Ga0496108_0190683 | 3300048911 | Bacteria | 1776 |
| 1350 | Ga0496108_0243139 | 3300048911 | Bacteria | 1565 |
| 1351 | Ga0496108_0336111 | 3300048911 | Bacteria | 1317 |
| 1352 | Ga0496108_0486565 | 3300048911 | Bacteria | 1078 |
| 1353 | Ga0496108_0964377 | 3300048911 | Bacteria | 729 |
| 1354 | Ga0496108_1046988 | 3300048911 | Bacteria | 695 |
| 1355 | Ga0496109_0010043 | 3300048912 | Bacteria | 8077 |
| 1356 | Ga0496109_0010864 | 3300048912 | Bacteria | 7793 |
| 1357 | Ga0496109_0011904 | 3300048912 | Bacteria | 7489 |
| 1358 | Ga0496109_0012268 | 3300048912 | Bacteria | 7397 |
| 1359 | Ga0496109_0016215 | 3300048912 | Bacteria | 6511 |
| 1360 | Ga0496109_0016233 | 3300048912 | Bacteria | 6509 |
| 1361 | Ga0496109_0037498 | 3300048912 | Bacteria | 4379 |
| 1362 | Ga0496109_0039111 | 3300048912 | Bacteria | 4292 |
| 1363 | Ga0496109_0050409 | 3300048912 | Bacteria | 3791 |
| 1364 | Ga0496109_0060980 | 3300048912 | Bacteria | 3447 |
| 1365 | Ga0496109_0080705 | 3300048912 | Bacteria | 2997 |
| 1366 | Ga0496109_0232009 | 3300048912 | Bacteria | 1736 |
| 1367 | Ga0496109_0370753 | 3300048912 | Bacteria | 1352 |
| 1368 | Ga0496109_0415147 | 3300048912 | Bacteria | 1271 |
| 1369 | Ga0496109_0687536 | 3300048912 | Bacteria | 960 |
| 1370 | Ga0496109_0704036 | 3300048912 | Bacteria | 947 |
| 1371 | Ga0496109_0787284 | 3300048912 | Bacteria | 889 |
| 1372 | Ga0496109_0889996 | 3300048912 | Bacteria | 828 |
| 1373 | Ga0496109_1412214 | 3300048912 | Bacteria | 631 |
| 1374 | Ga0496109_1490485 | 3300048912 | Bacteria | 611 |
| 1375 | Ga0496110_0004734 | 3300048913 | Bacteria | 10593 |
| 1376 | Ga0496110_0005775 | 3300048913 | Bacteria | 9724 |
| 1377 | Ga0496110_0006738 | 3300048913 | Bacteria | 9133 |
| 1378 | Ga0496110_0038727 | 3300048913 | Bacteria | 4149 |
| 1379 | Ga0496110_0064467 | 3300048913 | Bacteria | 3238 |
| 1380 | Ga0496110_0129343 | 3300048913 | Bacteria | 2279 |
| 1381 | Ga0496110_0167951 | 3300048913 | Bacteria | 1990 |
| 1382 | Ga0496110_0193797 | 3300048913 | Bacteria | 1845 |
| 1383 | Ga0496110_0207284 | 3300048913 | Bacteria | 1782 |
| 1384 | Ga0496110_0289107 | 3300048913 | Bacteria | 1493 |
| 1385 | Ga0496110_0317347 | 3300048913 | Bacteria | 1419 |
| 1386 | Ga0496110_0492411 | 3300048913 | Bacteria | 1116 |
| 1387 | Ga0496110_0638024 | 3300048913 | Bacteria | 964 |
| 1388 | Ga0496111_0002804 | 3300048914 | Bacteria | 10616 |
| 1389 | Ga0496111_0009880 | 3300048914 | Bacteria | 6377 |
| 1390 | Ga0496111_0030027 | 3300048914 | Bacteria | 3864 |
| 1391 | Ga0496111_0031386 | 3300048914 | Bacteria | 3784 |
| 1392 | Ga0496111_0057802 | 3300048914 | Bacteria | 2807 |
| 1393 | Ga0496111_0061008 | 3300048914 | Bacteria | 2733 |
| 1394 | Ga0496111_0063988 | 3300048914 | Bacteria | 2668 |
| 1395 | Ga0496111_0084993 | 3300048914 | Bacteria | 2313 |
| 1396 | Ga0496111_0086746 | 3300048914 | Bacteria | 2290 |
| 1397 | Ga0496111_0362835 | 3300048914 | Bacteria | 1072 |
| 1398 | Ga0496111_0401370 | 3300048914 | Bacteria | 1013 |
| 1399 | Ga0496111_0480939 | 3300048914 | Bacteria | 915 |
| 1400 | Ga0496112_0010312 | 3300048915 | Bacteria | 8474 |
| 1401 | Ga0496112_0027854 | 3300048915 | Bacteria | 5450 |
| 1402 | Ga0496112_0030237 | 3300048915 | Bacteria | 5240 |
| 1403 | Ga0496112_0037958 | 3300048915 | Bacteria | 4704 |
| 1404 | Ga0496112_0044267 | 3300048915 | Bacteria | 4361 |
| 1405 | Ga0496112_0047964 | 3300048915 | Bacteria | 4189 |
| 1406 | Ga0496112_0048601 | 3300048915 | Bacteria | 4159 |
| 1407 | Ga0496112_0111345 | 3300048915 | Bacteria | 2707 |
| 1408 | Ga0496112_0262344 | 3300048915 | Bacteria | 1677 |
| 1409 | Ga0496112_0292611 | 3300048915 | Bacteria | 1574 |
| 1410 | Ga0496112_0349409 | 3300048915 | Bacteria | 1421 |
| 1411 | Ga0496112_0895789 | 3300048915 | Bacteria | 809 |
| 1412 | Ga0496112_1005313 | 3300048915 | Bacteria | 754 |
| 1413 | Ga0496112_1411723 | 3300048915 | Bacteria | 611 |
| 1414 | Ga0496112_1492253 | 3300048915 | Bacteria | 590 |
| 1415 | Ga0496113_0123253 | 3300048916 | Bacteria | 2028 |
| 1416 | Ga0496113_0220680 | 3300048916 | Bacteria | 1510 |
| 1417 | Ga0496113_0241059 | 3300048916 | Bacteria | 1443 |
| 1418 | Ga0496113_0302301 | 3300048916 | Bacteria | 1281 |
| 1419 | Ga0496113_0348586 | 3300048916 | Bacteria | 1188 |
| 1420 | Ga0496113_0572668 | 3300048916 | Bacteria | 905 |
| 1421 | Ga0496113_1028267 | 3300048916 | Bacteria | 648 |
| 1422 | Ga0496114_0014447 | 3300048917 | Bacteria | 6341 |
| 1423 | Ga0496114_0019217 | 3300048917 | Bacteria | 5536 |
| 1424 | Ga0496114_0022546 | 3300048917 | Bacteria | 5132 |
| 1425 | Ga0496114_0046348 | 3300048917 | Bacteria | 3612 |
| 1426 | Ga0496114_0061744 | 3300048917 | Bacteria | 3135 |
| 1427 | Ga0496114_0092491 | 3300048917 | Bacteria | 2569 |
| 1428 | Ga0496114_0104736 | 3300048917 | Bacteria | 2419 |
| 1429 | Ga0496114_0118246 | 3300048917 | Bacteria | 2277 |
| 1430 | Ga0496114_0294417 | 3300048917 | Bacteria | 1432 |
| 1431 | Ga0496114_0405936 | 3300048917 | Bacteria | 1206 |
| 1432 | Ga0496114_0715449 | 3300048917 | Bacteria | 877 |
| 1433 | Ga0496114_0818620 | 3300048917 | Bacteria | 810 |
| 1434 | Ga0496114_1108428 | 3300048917 | Bacteria | 676 |
| 1435 | Ga0496114_1379516 | 3300048917 | Bacteria | 592 |
| 1436 | Ga0496115_0039590 | 3300048918 | Bacteria | 3744 |
| 1437 | Ga0496115_0052111 | 3300048918 | Bacteria | 3282 |
| 1438 | Ga0496115_0080599 | 3300048918 | Bacteria | 2650 |
| 1439 | Ga0496115_0104564 | 3300048918 | Bacteria | 2324 |
| 1440 | Ga0496115_0310946 | 3300048918 | Bacteria | 1290 |
| 1441 | Ga0496115_0474100 | 3300048918 | Bacteria | 1008 |
| 1442 | Ga0496115_0521457 | 3300048918 | Bacteria | 953 |
| 1443 | Ga0501031_0559054 | 3300049568 | Bacteria | 737 |
| 1444 | Ga0501031_0982461 | 3300049568 | Bacteria | 540 |
| 1445 | Ga0501032_0042828 | 3300049569 | Bacteria | 3070 |
| 1446 | Ga0501032_0043872 | 3300049569 | Bacteria | 3027 |
| 1447 | Ga0501033_0071104 | 3300049570 | Bacteria | 2556 |
| 1448 | Ga0501034_0045090 | 3300049571 | Bacteria | 4457 |
| 1449 | Ga0501036_0139906 | 3300049572 | Bacteria | 2043 |
| 1450 | Ga0501037_0490125 | 3300049573 | Bacteria | 835 |
| 1451 | Ga0501038_0002469 | 3300049574 | Bacteria | 17199 |
| 1452 | Ga0501038_0860751 | 3300049574 | Bacteria | 671 |
| 1453 | Ga0501039_0401762 | 3300049575 | Bacteria | 1076 |
| 1454 | Ga0501039_0662899 | 3300049575 | Bacteria | 817 |
| 1455 | Ga0501040_0003658 | 3300049576 | Bacteria | 9957 |
| 1456 | Ga0501040_0156035 | 3300049576 | Bacteria | 1612 |
| 1457 | Ga0501040_0601505 | 3300049576 | Bacteria | 794 |
| 1458 | Ga0501040_0763508 | 3300049576 | Bacteria | 699 |
| 1459 | Ga0501041_0004418 | 3300049577 | Bacteria | 8131 |
| 1460 | Ga0501041_0169685 | 3300049577 | Bacteria | 1365 |
| 1461 | Ga0501042_0000667 | 3300049578 | Bacteria | 18449 |
| 1462 | Ga0501043_0005069 | 3300049579 | Bacteria | 10654 |
| 1463 | Ga0501043_1001967 | 3300049579 | Bacteria | 594 |
| 1464 | Ga0501048_0014271 | 3300049582 | Bacteria | 5884 |
| 1465 | Ga0501048_0260084 | 3300049582 | Bacteria | 1233 |
| 1466 | Ga0501048_0634802 | 3300049582 | Bacteria | 767 |
| 1467 | Ga0501067_0036280 | 3300049583 | Bacteria | 2737 |
| 1468 | Ga0501067_0051224 | 3300049583 | Bacteria | 2289 |
| 1469 | Ga0501067_0127758 | 3300049583 | Bacteria | 1414 |
| 1470 | Ga0501067_0217258 | 3300049583 | Bacteria | 1064 |
| 1471 | Ga0501068_0015065 | 3300049584 | Bacteria | 4433 |
| 1472 | Ga0501068_0029375 | 3300049584 | Bacteria | 3254 |
| 1473 | Ga0501068_0187153 | 3300049584 | Bacteria | 1310 |
| 1474 | Ga0501068_0735983 | 3300049584 | Bacteria | 645 |
| 1475 | Ga0501069_0008120 | 3300049585 | Bacteria | 5516 |
| 1476 | Ga0501069_0052921 | 3300049585 | Bacteria | 2261 |
| 1477 | Ga0501069_0063548 | 3300049585 | Bacteria | 2062 |
| 1478 | Ga0501070_0071043 | 3300049586 | Bacteria | 2882 |
| 1479 | Ga0501070_0273145 | 3300049586 | Bacteria | 1380 |
| 1480 | Ga0501070_0345058 | 3300049586 | Bacteria | 1209 |
| 1481 | Ga0501071_0007796 | 3300049587 | Bacteria | 7059 |
| 1482 | Ga0501071_0193736 | 3300049587 | Bacteria | 1525 |
| 1483 | Ga0501071_0522853 | 3300049587 | Bacteria | 910 |
| 1484 | Ga0501071_0764828 | 3300049587 | Bacteria | 744 |
| 1485 | Ga0501072_0072741 | 3300049588 | Bacteria | 2717 |
| 1486 | Ga0501072_0374017 | 3300049588 | Bacteria | 1131 |
| 1487 | Ga0501072_0589893 | 3300049588 | Bacteria | 876 |
| 1488 | Ga0501072_0705655 | 3300049588 | Bacteria | 793 |
| 1489 | Ga0501073_0068922 | 3300049589 | Bacteria | 2465 |
| 1490 | Ga0501074_0007535 | 3300049590 | Bacteria | 7874 |
| 1491 | Ga0501074_0014796 | 3300049590 | Bacteria | 5676 |
| 1492 | Ga0501074_0546640 | 3300049590 | Bacteria | 820 |
| 1493 | Ga0501075_0002769 | 3300049591 | Bacteria | 11747 |
| 1494 | Ga0501075_0184386 | 3300049591 | Bacteria | 1592 |
| 1495 | Ga0501075_0437690 | 3300049591 | Bacteria | 997 |
| 1496 | Ga0501075_1244986 | 3300049591 | Bacteria | 564 |
| 1497 | Ga0501076_0010351 | 3300049592 | Bacteria | 6917 |
| 1498 | Ga0501076_0455143 | 3300049592 | Bacteria | 1054 |
| 1499 | Ga0501076_0621957 | 3300049592 | Bacteria | 891 |
| 1500 | Ga0501076_0645605 | 3300049592 | Bacteria | 873 |
| 1501 | Ga0501076_0821038 | 3300049592 | Bacteria | 767 |
| 1502 | Ga0501077_0021232 | 3300049593 | Bacteria | 4109 |
| 1503 | Ga0501077_0029478 | 3300049593 | Bacteria | 3488 |
| 1504 | Ga0501261_112525 | 3300049690 | Bacteria | 530 |
| 1505 | Ga0501225_0209194 | 3300049705 | Bacteria | 623 |
| 1506 | Ga0501079_0008491 | 3300049741 | Bacteria | 7788 |
| 1507 | Ga0501079_0022136 | 3300049741 | Bacteria | 4870 |
| 1508 | Ga0501080_0022647 | 3300049742 | Bacteria | 5819 |
| 1509 | Ga0501080_0769264 | 3300049742 | Bacteria | 846 |
| 1510 | Ga0501081_0007966 | 3300049743 | Bacteria | 6873 |
| 1511 | Ga0501081_0028001 | 3300049743 | Bacteria | 3800 |
| 1512 | Ga0501083_0002257 | 3300049744 | Bacteria | 13181 |
| 1513 | Ga0501035_0014204 | 3300049822 | Bacteria | 7350 |
| 1514 | Ga0501044_0293432 | 3300049823 | Bacteria | 1557 |
| 1515 | Ga0501045_0009808 | 3300049824 | Bacteria | 6699 |
| 1516 | nmdc:mga03683_47425_c1 | 3300050489 | Bacteria | 1783 |
| 1517 | nmdc:mga00v17_141770_c1 | 3300050491 | Bacteria | 1541 |
| 1518 | nmdc:mga00v17_91256_c1 | 3300050491 | Bacteria | 1914 |
| 1519 | nmdc:mga0yw44_190072_c1 | 3300050492 | Bacteria | 1354 |
| 1520 | nmdc:mga0yw44_313445_c1 | 3300050492 | Bacteria | 1053 |
| 1521 | nmdc:mga06z11_496463_c1 | 3300050494 | Bacteria | 739 |
| 1522 | nmdc:mga05p37_140955_c1 | 3300050507 | Bacteria | 2954 |
| 1523 | nmdc:mga05p37_300216_c1 | 3300050507 | Bacteria | 1908 |
| 1524 | nmdc:mga05p37_345361_c1 | 3300050507 | Bacteria | 1754 |
| 1525 | nmdc:mga05p37_490630_c1 | 3300050507 | Bacteria | 1412 |
| 1526 | nmdc:mga09592_67999_c1 | 3300050508 | Bacteria | 3022 |
| 1527 | nmdc:mga0qj67_290980_c1 | 3300050509 | Bacteria | 1324 |
| 1528 | nmdc:mga0qj67_364472_c1 | 3300050509 | Bacteria | 1168 |
| 1529 | nmdc:mga06r32_163204_c1 | 3300050510 | Bacteria | 2211 |
| 1530 | nmdc:mga06r32_262122_c1 | 3300050510 | Bacteria | 1716 |
| 1531 | nmdc:mga06r32_702455_c1 | 3300050510 | Bacteria | 977 |
| 1532 | nmdc:mga08y16_107169_c1 | 3300050511 | Bacteria | 2909 |
| 1533 | nmdc:mga08y16_376843_c1 | 3300050511 | Bacteria | 1455 |
| 1534 | nmdc:mga08y16_941299_c1 | 3300050511 | Bacteria | 847 |
| 1535 | nmdc:mga0n895_56037_c1 | 3300050512 | Bacteria | 3882 |
| 1536 | nmdc:mga0n895_90972_c1 | 3300050512 | Bacteria | 3053 |
| 1537 | nmdc:mga0rr50_153180_c1 | 3300050513 | Bacteria | 1865 |
| 1538 | nmdc:mga0rr50_89406_c1 | 3300050513 | Bacteria | 2394 |
| 1539 | nmdc:mga08x19_1111876_c1 | 3300050514 | Bacteria | 561 |
| 1540 | nmdc:mga0a205_279421_c1 | 3300050515 | Bacteria | 1545 |
| 1541 | nmdc:mga0a205_82813_c1 | 3300050515 | Bacteria | 3099 |
| 1542 | Ga0495601_0002689 | 3300053077 | Bacteria | 10079 |
| 1543 | Ga0495601_0070924 | 3300053077 | Bacteria | 2224 |
| 1544 | Ga0495601_0071802 | 3300053077 | Bacteria | 2210 |
| 1545 | Ga0495601_0105098 | 3300053077 | Bacteria | 1825 |
| 1546 | Ga0495601_0128380 | 3300053077 | Bacteria | 1650 |
| 1547 | Ga0495601_0132710 | 3300053077 | Bacteria | 1622 |
| 1548 | Ga0495601_0179307 | 3300053077 | Bacteria | 1385 |
| 1549 | Ga0495601_0210324 | 3300053077 | Bacteria | 1271 |
| 1550 | Ga0495612_0007861 | 3300053078 | Bacteria | 4348 |
| 1551 | Ga0495612_0038529 | 3300053078 | Bacteria | 1942 |
| 1552 | Ga0495655_0011457 | 3300053083 | Bacteria | 1783 |
| 1553 | Ga0495655_0196562 | 3300053083 | Bacteria | 657 |
| 1554 | Ga0495595_0087956 | 3300053084 | Bacteria | 1487 |
| 1555 | Ga0495595_0217012 | 3300053084 | Bacteria | 954 |
| 1556 | Ga0495595_0534599 | 3300053084 | Bacteria | 598 |
| 1557 | Ga0495595_0745344 | 3300053084 | Bacteria | 502 |
| 1558 | Ga0495619_0005446 | 3300053085 | Bacteria | 8067 |
| 1559 | Ga0495619_0006219 | 3300053085 | Bacteria | 7570 |
| 1560 | Ga0495619_0081789 | 3300053085 | Bacteria | 2175 |
| 1561 | Ga0495619_0087481 | 3300053085 | Bacteria | 2106 |
| 1562 | Ga0495619_0088932 | 3300053085 | Bacteria | 2089 |
| 1563 | Ga0495619_0129198 | 3300053085 | Bacteria | 1736 |
| 1564 | Ga0495619_0191522 | 3300053085 | Bacteria | 1415 |
| 1565 | Ga0495619_0571896 | 3300053085 | Bacteria | 774 |
| 1566 | Ga0495619_0605118 | 3300053085 | Bacteria | 750 |
| 1567 | Ga0500566_0036462 | 3300053094 | Bacteria | 2852 |
| 1568 | Ga0500566_0524119 | 3300053094 | Bacteria | 506 |
| 1569 | Ga0501084_0001291 | 3300054114 | Bacteria | 19731 |
| 1570 | Ga0501084_0102325 | 3300054114 | Bacteria | 2406 |
| 1571 | Ga0501084_0628377 | 3300054114 | Bacteria | 907 |
| 1572 | Ga0501084_0635174 | 3300054114 | Bacteria | 901 |
| 1573 | Ga0587083_0067294 | 3300059505 | Bacteria | 823 |
| 1574 | Ga0587106_048776 | 3300059605 | Bacteria | 744 |
| 1575 | Ga0587114_021939 | 3300059655 | Bacteria | 909 |
| 1576 | Ga0587111_0073607 | 3300060346 | Bacteria | 802 |
| 1577 | Ga0587111_0105233 | 3300060346 | Bacteria | 708 |
| 1578 | Ga0501082_0030517 | 3300060353 | Bacteria | 4645 |
| 1579 | Ga0501082_0417661 | 3300060353 | Bacteria | 1171 |
| 1580 | Ga0501082_0640043 | 3300060353 | Bacteria | 930 |
| 1581 | Ga0501082_0836609 | 3300060353 | Bacteria | 805 |
| 1582 | Ga0466962_0004844 | 3300061719 | Bacteria | 6477 |
| 1583 | Ga0466962_0012692 | 3300061719 | Bacteria | 4052 |
| 1584 | Ga0466962_0018284 | 3300061719 | Bacteria | 3371 |
| 1585 | Ga0466962_0230446 | 3300061719 | Bacteria | 908 |
| 1586 | Ga0466962_0384634 | 3300061719 | Bacteria | 701 |
| 1587 | Ga0530510_0025910 | 3300061734 | Bacteria | 4194 |
| 1588 | Ga0530510_0191533 | 3300061734 | Bacteria | 1518 |
| 1589 | Ga0530510_0208652 | 3300061734 | Bacteria | 1451 |
| 1590 | Ga0530510_0346845 | 3300061734 | Bacteria | 1115 |
| 1591 | Ga0530510_0422621 | 3300061734 | Bacteria | 1006 |
| 1592 | Ga0530510_0671316 | 3300061734 | Bacteria | 789 |
| 1593 | Ga0530510_0683938 | 3300061734 | Bacteria | 782 |
| 1594 | Ga0530510_1045233 | 3300061734 | Bacteria | 625 |
| 1595 | Ga0530510_1361355 | 3300061734 | Bacteria | 544 |
| 1596 | Ga0206354_11410044 | |||
| 1597 | JGI24750J21931_1007751 | |||
| 1598 | JGI24745J21846_1022792 | |||
| 1599 | JGI24749J21850_1008744 | |||
| 1600 | JGI24744J21845_10055980 | |||
| 1601 | JGI24742J22300_10043870 | |||
| 1602 | Ga0058863_10051448 | |||
| 1603 | Ga0070658_10012196 | |||
| 1604 | Ga0070658_10040720 | |||
| 1605 | Ga0070658_10087565 | |||
| 1606 | Ga0070658_10288287 | |||
| 1607 | Ga0070676_10026558 | |||
| 1608 | Ga0070683_100009431 | |||
| 1609 | Ga0070683_100562461 | |||
| 1610 | Ga0070690_100020038 | |||
| 1611 | Ga0070670_100124734 | |||
| 1612 | Ga0070670_101389383 | |||
| 1613 | Ga0068869_101021318 | |||
| 1614 | Ga0070666_10208582 | |||
| 1615 | Ga0070680_100129344 | |||
| 1616 | Ga0070680_100159764 | |||
| 1617 | Ga0070680_100403331 | |||
| 1618 | Ga0070680_100447146 | |||
| 1619 | Ga0070680_100522193 | |||
| 1620 | Ga0070682_100004124 | |||
| 1621 | Ga0070682_100122111 | |||
| 1622 | Ga0070682_100146514 | |||
| 1623 | Ga0070682_100241243 | |||
| 1624 | Ga0070682_100247756 | |||
| 1625 | Ga0068868_100147177 | |||
| 1626 | Ga0068868_100167952 | |||
| 1627 | Ga0068868_100298164 | |||
| 1628 | Ga0068868_100345334 | |||
| 1629 | Ga0068868_100539533 | |||
| 1630 | Ga0070660_100030791 | |||
| 1631 | Ga0070660_100089485 | |||
| 1632 | Ga0070660_100185845 | |||
| 1633 | Ga0070660_100304781 | |||
| 1634 | Ga0070660_100457234 | |||
| 1635 | Ga0070660_101022145 | |||
| 1636 | Ga0070689_100019147 | |||
| 1637 | Ga0070689_100024547 | |||
| 1638 | Ga0070689_100469387 | |||
| 1639 | Ga0070691_10319457 | |||
| 1640 | Ga0070687_100129359 | |||
| 1641 | Ga0070661_100741583 | |||
| 1642 | Ga0070661_101085076 | |||
| 1643 | Ga0070692_10026768 | |||
| 1644 | Ga0070692_10091713 | |||
| 1645 | Ga0070692_10697900 | |||
| 1646 | Ga0070668_100082401 | |||
| 1647 | Ga0070668_100091956 | |||
| 1648 | Ga0070668_100400625 | |||
| 1649 | Ga0070669_100064711 | |||
| 1650 | Ga0070675_100324428 | |||
| 1651 | Ga0070675_100339337 | |||
| 1652 | Ga0070671_100042707 | |||
| 1653 | Ga0070671_100163329 | |||
| 1654 | Ga0070671_100164883 | |||
| 1655 | Ga0070671_100299707 | |||
| 1656 | Ga0070674_100034154 | |||
| 1657 | Ga0070674_100420232 | |||
| 1658 | Ga0070674_100805184 | |||
| 1659 | Ga0070673_101009776 | |||
| 1660 | Ga0070673_101061773 | |||
| 1661 | Ga0070688_100021514 | |||
| 1662 | Ga0070688_100132110 | |||
| 1663 | Ga0070688_100504006 | |||
| 1664 | Ga0070688_100533792 | |||
| 1665 | Ga0070688_100763351 | |||
| 1666 | Ga0070659_100048560 | |||
| 1667 | Ga0070659_100093044 | |||
| 1668 | Ga0070659_100149681 | |||
| 1669 | Ga0070659_100212804 | |||
| 1670 | Ga0070659_101223843 | |||
| 1671 | Ga0070667_100290632 | |||
| 1672 | Ga0070667_101029486 | |||
| 1673 | Ga0070709_10268498 | |||
| 1674 | Ga0070709_10301985 | |||
| 1675 | Ga0070709_11217407 | |||
| 1676 | Ga0070714_100016722 | |||
| 1677 | Ga0070714_100035324 | |||
| 1678 | Ga0070714_100061187 | |||
| 1679 | Ga0070714_100130737 | |||
| 1680 | Ga0070714_100501441 | |||
| 1681 | Ga0070714_100525679 | |||
| 1682 | Ga0070714_100993743 | |||
| 1683 | Ga0070714_101047255 | |||
| 1684 | Ga0070714_101243807 | |||
| 1685 | Ga0070714_101405067 | |||
| 1686 | Ga0070713_100043779 | |||
| 1687 | Ga0070713_100297409 | |||
| 1688 | Ga0070713_100861019 | |||
| 1689 | Ga0070713_100907466 | |||
| 1690 | Ga0070713_100909427 | |||
| 1691 | Ga0070713_100913959 | |||
| 1692 | Ga0070710_10005272 | |||
| 1693 | Ga0070710_10015456 | |||
| 1694 | Ga0070710_10383119 | |||
| 1695 | Ga0070710_10615351 | |||
| 1696 | Ga0070701_10002177 | |||
| 1697 | Ga0070701_10013227 | |||
| 1698 | Ga0070701_10134758 | |||
| 1699 | Ga0070701_10338970 | |||
| 1700 | Ga0070701_10394283 | |||
| 1701 | Ga0070711_100004345 | |||
| 1702 | Ga0070711_100007994 | |||
| 1703 | Ga0070711_100063227 | |||
| 1704 | Ga0070711_100405473 | |||
| 1705 | Ga0070705_100050664 | |||
| 1706 | Ga0070705_100053354 | |||
| 1707 | Ga0070705_100424647 | |||
| 1708 | Ga0070705_100710338 | |||
| 1709 | Ga0070705_100743779 | |||
| 1710 | Ga0070700_100052619 | |||
| 1711 | Ga0070700_101085790 | |||
| 1712 | Ga0070694_101140385 | |||
| 1713 | Ga0070708_100120562 | |||
| 1714 | Ga0070708_100130291 | |||
| 1715 | Ga0070708_100512401 | |||
| 1716 | Ga0070663_100097993 | |||
| 1717 | Ga0070663_100559814 | |||
| 1718 | Ga0070663_100781193 | |||
| 1719 | Ga0070678_100007082 | |||
| 1720 | Ga0070678_100026391 | |||
| 1721 | Ga0070678_100041054 | |||
| 1722 | Ga0070678_100140695 | |||
| 1723 | Ga0070678_100174608 | |||
| 1724 | Ga0070678_101008228 | |||
| 1725 | Ga0070662_100400493 | |||
| 1726 | Ga0070681_10015901 | |||
| 1727 | Ga0070681_10180313 | |||
| 1728 | Ga0070681_10242111 | |||
| 1729 | Ga0070681_10279107 | |||
| 1730 | Ga0070681_10393115 | |||
| 1731 | Ga0070681_10961260 | |||
| 1732 | Ga0068867_100005177 | |||
| 1733 | Ga0068867_100028426 | |||
| 1734 | Ga0068867_100082863 | |||
| 1735 | Ga0070685_10001884 | |||
| 1736 | Ga0070685_10007752 | |||
| 1737 | Ga0070685_10042725 | |||
| 1738 | Ga0070706_100123350 | |||
| 1739 | Ga0070706_100708057 | |||
| 1740 | Ga0070707_100001557 | |||
| 1741 | Ga0070707_100033363 | |||
| 1742 | Ga0070707_100163694 | |||
| 1743 | Ga0070707_100417308 | |||
| 1744 | Ga0070707_101100559 | |||
| 1745 | Ga0070707_101320915 | |||
| 1746 | Ga0070698_100024862 | |||
| 1747 | Ga0070698_100062258 | |||
| 1748 | Ga0070698_100073464 | |||
| 1749 | Ga0070698_100837530 | |||
| 1750 | Ga0070698_100974598 | |||
| 1751 | Ga0070679_100020719 | |||
| 1752 | Ga0070679_100250004 | |||
| 1753 | Ga0070684_100023316 | |||
| 1754 | Ga0070684_100024998 | |||
| 1755 | Ga0070684_100076862 | |||
| 1756 | Ga0070684_100158664 | |||
| 1757 | Ga0070684_100161559 | |||
| 1758 | Ga0070684_100482407 | |||
| 1759 | Ga0070684_100599006 | |||
| 1760 | Ga0070684_100735482 | |||
| 1761 | Ga0070684_101175437 | |||
| 1762 | Ga0070697_100106408 | |||
| 1763 | Ga0070697_100390518 | |||
| 1764 | Ga0070697_101408160 | |||
| 1765 | Ga0068853_100010960 | |||
| 1766 | Ga0070672_100005416 | |||
| 1767 | Ga0070672_100160201 | |||
| 1768 | Ga0070672_101356177 | |||
| 1769 | Ga0070686_100001859 | |||
| 1770 | Ga0070686_100020981 | |||
| 1771 | Ga0070686_100056299 | |||
| 1772 | Ga0070686_100119066 | |||
| 1773 | Ga0070695_100002689 | |||
| 1774 | Ga0070695_100667050 | |||
| 1775 | Ga0070695_100853405 | |||
| 1776 | Ga0070696_100167693 | |||
| 1777 | Ga0070696_100686087 | |||
| 1778 | Ga0070696_100944378 | |||
| 1779 | Ga0070693_100004830 | |||
| 1780 | Ga0070693_100110585 | |||
| 1781 | Ga0070693_100555336 | |||
| 1782 | Ga0070665_100572070 | |||
| 1783 | Ga0070665_100752407 | |||
| 1784 | Ga0070704_100093364 | |||
| 1785 | Ga0070704_100312493 | |||
| 1786 | Ga0070704_100494141 | |||
| 1787 | Ga0070704_101594938 | |||
| 1788 | Ga0068855_100443891 | |||
| 1789 | Ga0070664_100045258 | |||
| 1790 | Ga0070664_100071090 | |||
| 1791 | Ga0070664_100081626 | |||
| 1792 | Ga0070664_100109052 | |||
| 1793 | Ga0068857_100018953 | |||
| 1794 | Ga0068857_100227757 | |||
| 1795 | Ga0068857_101308443 | |||
| 1796 | Ga0068854_100076095 | |||
| 1797 | Ga0068856_100014179 | |||
| 1798 | Ga0068856_100090897 | |||
| 1799 | Ga0068856_100232549 | |||
| 1800 | Ga0068856_100254676 | |||
| 1801 | Ga0068856_100321065 | |||
| 1802 | Ga0068856_100333992 | |||
| 1803 | Ga0068856_100967960 | |||
| 1804 | Ga0068856_101003950 | |||
| 1805 | Ga0068856_101273756 | |||
| 1806 | Ga0068856_101591774 | |||
| 1807 | Ga0070702_100202353 | |||
| 1808 | Ga0070702_100448044 | |||
| 1809 | Ga0070702_100912627 | |||
| 1810 | Ga0070702_101081696 | |||
| 1811 | Ga0068852_100047094 | |||
| 1812 | Ga0068852_100327493 | |||
| 1813 | Ga0068852_100426066 | |||
| 1814 | Ga0068852_100929149 | |||
| 1815 | Ga0068852_101056432 | |||
| 1816 | Ga0068859_100124155 | |||
| 1817 | Ga0068859_100661067 | |||
| 1818 | Ga0068859_100784876 | |||
| 1819 | Ga0068864_100014298 | |||
| 1820 | Ga0068864_100272752 | |||
| 1821 | Ga0068864_101624193 | |||
| 1822 | Ga0068866_10008633 | |||
| 1823 | Ga0068866_10069108 | |||
| 1824 | Ga0068866_10195935 | |||
| 1825 | Ga0068866_10388792 | |||
| 1826 | Ga0068861_100033707 | |||
| 1827 | Ga0068861_100285167 | |||
| 1828 | Ga0068861_100402038 | |||
| 1829 | Ga0068861_100886782 | |||
| 1830 | Ga0068851_10110022 | |||
| 1831 | Ga0068870_10009635 | |||
| 1832 | Ga0068870_10061744 | |||
| 1833 | Ga0068870_10558949 | |||
| 1834 | Ga0068863_100222283 | |||
| 1835 | Ga0068863_100255986 | |||
| 1836 | Ga0068863_101340880 | |||
| 1837 | Ga0068858_100159638 | |||
| 1838 | Ga0068860_100654188 | |||
| 1839 | Ga0068862_100243339 | |||
| 1840 | Ga0068862_100713063 | |||
| 1841 | Ga0068862_101302548 | |||
| 1842 | Ga0081455_10064511 | |||
| 1843 | Ga0081455_10065549 | |||
| 1844 | Ga0081455_10067811 | |||
| 1845 | Ga0081455_10194627 | |||
| 1846 | Ga0081455_10354823 | |||
| 1847 | Ga0081538_10000037 | |||
| 1848 | Ga0081538_10013229 | |||
| 1849 | Ga0081538_10014684 | |||
| 1850 | Ga0081538_10015351 | |||
| 1851 | Ga0081538_10039195 | |||
| 1852 | Ga0081538_10069095 | |||
| 1853 | Ga0081538_10209135 | |||
| 1854 | Ga0081539_10002193 | |||
| 1855 | Ga0081539_10003843 | |||
| 1856 | Ga0070717_10011659 | |||
| 1857 | Ga0070717_10013934 | |||
| 1858 | Ga0070717_10206338 | |||
| 1859 | Ga0070717_10639725 | |||
| 1860 | Ga0070717_10693015 | |||
| 1861 | Ga0075365_10100239 | |||
| 1862 | Ga0075365_10808136 | |||
| 1863 | Ga0075364_10024709 | |||
| 1864 | Ga0075432_10061606 | |||
| 1865 | Ga0075432_10077826 | |||
| 1866 | Ga0070715_10000565 | |||
| 1867 | Ga0070715_10036740 | |||
| 1868 | Ga0070716_100006022 | |||
| 1869 | Ga0070716_100494948 | |||
| 1870 | Ga0070716_100594140 | |||
| 1871 | Ga0070716_100621141 | |||
| 1872 | Ga0070712_100006000 | |||
| 1873 | Ga0070712_100056555 | |||
| 1874 | Ga0070712_100289256 | |||
| 1875 | Ga0070712_100301307 | |||
| 1876 | Ga0070712_100342824 | |||
| 1877 | Ga0070712_100743780 | |||
| 1878 | Ga0070712_100808803 | |||
| 1879 | Ga0075362_10022581 | |||
| 1880 | Ga0097621_100204246 | |||
| 1881 | Ga0097621_100223481 | |||
| 1882 | Ga0097621_100422624 | |||
| 1883 | Ga0068871_100059583 | |||
| 1884 | Ga0068871_100065087 | |||
| 1885 | Ga0075428_100515800 | |||
| 1886 | Ga0075428_100871680 | |||
| 1887 | Ga0075430_100083598 | |||
| 1888 | Ga0075430_100341714 | |||
| 1889 | Ga0075431_100121575 | |||
| 1890 | Ga0075431_100244476 | |||
| 1891 | Ga0075433_10084447 | |||
| 1892 | Ga0075433_10172648 | |||
| 1893 | Ga0075433_10253630 | |||
| 1894 | Ga0075434_100016435 | |||
| 1895 | Ga0075434_100042438 | |||
| 1896 | Ga0075434_100276485 | |||
| 1897 | Ga0075434_100502303 | |||
| 1898 | Ga0075434_100610494 | |||
| 1899 | Ga0075429_100658216 | |||
| 1900 | Ga0068865_100004970 | |||
| 1901 | Ga0068865_100020981 | |||
| 1902 | Ga0068865_100168119 | |||
| 1903 | Ga0068865_100301528 | |||
| 1904 | Ga0068865_100441079 | |||
| 1905 | Ga0068865_100721648 | |||
| 1906 | Ga0075436_100303440 | |||
| 1907 | Ga0097620_100124152 | |||
| 1908 | Ga0097620_100661113 | |||
| 1909 | Ga0097620_100784919 | |||
| 1910 | Ga0075435_100113748 | |||
| 1911 | Ga0075435_100420695 | |||
| 1912 | Ga0075435_100459282 | |||
| 1913 | Ga0075435_101204724 | |||
| 1914 | Ga0111539_10122024 | |||
| 1915 | Ga0111539_10312375 | |||
| 1916 | Ga0111539_10499400 | |||
| 1917 | Ga0111539_11051258 | |||
| 1918 | Ga0111539_11509700 | |||
| 1919 | Ga0111539_12848976 | |||
| 1920 | Ga0105245_10051119 | |||
| 1921 | Ga0105245_10099555 | |||
| 1922 | Ga0105245_10106484 | |||
| 1923 | Ga0105245_10167293 | |||
| 1924 | Ga0105245_10288254 | |||
| 1925 | Ga0105245_10290160 | |||
| 1926 | Ga0105245_10917566 | |||
| 1927 | Ga0105247_10580108 | |||
| 1928 | Ga0105247_11297130 | |||
| 1929 | Ga0114129_11453704 | |||
| 1930 | Ga0114129_11576530 | |||
| 1931 | Ga0114129_11590593 | |||
| 1932 | Ga0114129_11628620 | |||
| 1933 | Ga0105243_10002992 | |||
| 1934 | Ga0105243_10055328 | |||
| 1935 | Ga0105243_10244044 | |||
| 1936 | Ga0105243_10271795 | |||
| 1937 | Ga0105243_10448894 | |||
| 1938 | Ga0105241_10072481 | |||
| 1939 | Ga0105241_10238783 | |||
| 1940 | Ga0105241_10541586 | |||
| 1941 | Ga0105241_11304209 | |||
| 1942 | Ga0105242_10148257 | |||
| 1943 | Ga0105242_10167775 | |||
| 1944 | Ga0105242_10197397 | |||
| 1945 | Ga0105242_10362638 | |||
| 1946 | Ga0105242_10369170 | |||
| 1947 | Ga0105242_10644618 | |||
| 1948 | Ga0105242_10941555 | |||
| 1949 | Ga0105242_11374169 | |||
| 1950 | Ga0105242_12141368 | |||
| 1951 | Ga0105248_10015623 | |||
| 1952 | Ga0105248_10745745 | |||
| 1953 | Ga0105248_10958854 | |||
| 1954 | Ga0105237_10079496 | |||
| 1955 | Ga0105237_11079763 | |||
| 1956 | Ga0105238_10043513 | |||
| 1957 | Ga0105238_11180247 | |||
| 1958 | Ga0105238_11301210 | |||
| 1959 | Ga0105249_10009884 | |||
| 1960 | Ga0105239_10325172 | |||
| 1961 | Ga0105239_10485652 | |||
| 1962 | Ga0105239_10526113 | |||
| 1963 | Ga0105239_10645658 | |||
| 1964 | Ga0105239_11304203 | |||
| 1965 | Ga0105239_12072682 | |||
| 1966 | Ga0105246_10515629 | |||
| 1967 | Ga0105246_11415010 | |||
| 1968 | Ga0157339_1005165 | |||
| 1969 | Ga0157327_1014400 | |||
| 1970 | Ga0157373_10517660 | |||
| 1971 | Ga0157371_10884669 | |||
| 1972 | Ga0157369_10283256 | |||
| 1973 | Ga0157369_10599746 | |||
| 1974 | Ga0157369_11498414 | |||
| 1975 | Ga0157374_10284831 | |||
| 1976 | Ga0157374_10401038 | |||
| 1977 | Ga0157374_11242267 | |||
| 1978 | Ga0157378_10217575 | |||
| 1979 | Ga0157378_10260173 | |||
| 1980 | Ga0157378_10406906 | |||
| 1981 | Ga0157378_10410230 | |||
| 1982 | Ga0157378_10869261 | |||
| 1983 | Ga0157378_10976970 | |||
| 1984 | Ga0157378_11061631 | |||
| 1985 | Ga0157378_11607311 | |||
| 1986 | Ga0157378_11715565 | |||
| 1987 | Ga0163162_10199776 | |||
| 1988 | Ga0163162_11593065 | |||
| 1989 | Ga0163162_12189375 | |||
| 1990 | Ga0157372_10660788 | |||
| 1991 | Ga0157372_10664777 | |||
| 1992 | Ga0157372_11237211 | |||
| 1993 | Ga0157372_11496035 | |||
| 1994 | Ga0157375_10161829 | |||
| 1995 | Ga0157375_10198195 | |||
| 1996 | Ga0157375_10289762 | |||
| 1997 | Ga0157375_10419790 | |||
| 1998 | Ga0157375_11273545 | |||
| 1999 | Ga0157375_11719422 | |||
| 2000 | Ga0163163_10020662 | |||
| 2001 | Ga0163163_10382842 | |||
| 2002 | Ga0157380_10282638 | |||
| 2003 | Ga0157380_10446551 | |||
| 2004 | Ga0157380_11064782 | |||
| 2005 | Ga0157380_11270386 | |||
| 2006 | Ga0182008_10004665 | |||
| 2007 | Ga0182008_10461642 | |||
| 2008 | Ga0182008_10753453 | |||
| 2009 | Ga0157377_10031731 | |||
| 2010 | Ga0157377_10086401 | |||
| 2011 | Ga0157377_10382383 | |||
| 2012 | Ga0157379_10288838 | |||
| 2013 | Ga0157379_10605430 | |||
| 2014 | Ga0157379_10943188 | |||
| 2015 | Ga0157379_11617498 | |||
| 2016 | Ga0157376_10011788 | |||
| 2017 | Ga0157376_10104146 | |||
| 2018 | Ga0157376_10566311 | |||
| 2019 | Ga0157376_10677354 | |||
| 2020 | Ga0157376_10815181 | |||
| 2021 | Ga0157376_12786349 | |||
| 2022 | Ga0182007_10015950 | |||
| 2023 | Ga0163161_10389859 | |||
| 2024 | Ga0197907_10978116 | |||
| 2025 | Ga0197907_11392553 | |||
| 2026 | Ga0206356_10239065 | |||
| 2027 | Ga0206356_11088656 | |||
| 2028 | Ga0206349_1037198 | |||
| 2029 | Ga0206350_11457104 | |||
| 2030 | Ga0206353_10918220 | |||
| 2031 | Ga0206353_12001256 | |||
| 2032 | Ga0213873_10012098 | |||
| 2033 | Ga0213871_10035748 | |||
| 2034 | Ga0224712_10132690 | |||
| 2035 | Ga0207638_1003322 | |||
| 2036 | Ga0207697_10037177 | |||
| 2037 | Ga0207692_10147999 | |||
| 2038 | Ga0207692_10209597 | |||
| 2039 | Ga0207692_10342981 | |||
| 2040 | Ga0207642_10023441 | |||
| 2041 | Ga0207642_10165774 | |||
| 2042 | Ga0207642_10195677 | |||
| 2043 | Ga0207710_10168886 | |||
| 2044 | Ga0207688_10011759 | |||
| 2045 | Ga0207688_10305088 | |||
| 2046 | Ga0207688_10507265 | |||
| 2047 | Ga0207680_10590681 | |||
| 2048 | Ga0207647_10041881 | |||
| 2049 | Ga0207647_10074362 | |||
| 2050 | Ga0207647_10432742 | |||
| 2051 | Ga0207647_10505585 | |||
| 2052 | Ga0207685_10039400 | |||
| 2053 | Ga0207685_10039846 | |||
| 2054 | Ga0207699_10002820 | |||
| 2055 | Ga0207699_10156246 | |||
| 2056 | Ga0207699_10420100 | |||
| 2057 | Ga0207645_10020975 | |||
| 2058 | Ga0207645_10129652 | |||
| 2059 | Ga0207643_10020891 | |||
| 2060 | Ga0207643_10067194 | |||
| 2061 | Ga0207643_10243672 | |||
| 2062 | Ga0207705_10068235 | |||
| 2063 | Ga0207705_10264986 | |||
| 2064 | Ga0207705_10577404 | |||
| 2065 | Ga0207684_10168406 | |||
| 2066 | Ga0207684_10341686 | |||
| 2067 | Ga0207654_10096035 | |||
| 2068 | Ga0207654_10322502 | |||
| 2069 | Ga0207654_10753987 | |||
| 2070 | Ga0207707_10003180 | |||
| 2071 | Ga0207707_10017461 | |||
| 2072 | Ga0207707_10068018 | |||
| 2073 | Ga0207707_10091440 | |||
| 2074 | Ga0207707_10241526 | |||
| 2075 | Ga0207707_10295079 | |||
| 2076 | Ga0207707_10909981 | |||
| 2077 | Ga0207695_10043176 | |||
| 2078 | Ga0207695_10467872 | |||
| 2079 | Ga0207671_10041645 | |||
| 2080 | Ga0207671_10908210 | |||
| 2081 | Ga0207693_10008279 | |||
| 2082 | Ga0207693_10019701 | |||
| 2083 | Ga0207693_10288274 | |||
| 2084 | Ga0207693_10345236 | |||
| 2085 | Ga0207693_10414231 | |||
| 2086 | Ga0207693_10416778 | |||
| 2087 | Ga0207693_10624072 | |||
| 2088 | Ga0207693_10849194 | |||
| 2089 | Ga0207663_10001658 | |||
| 2090 | Ga0207663_10067383 | |||
| 2091 | Ga0207663_10076870 | |||
| 2092 | Ga0207663_10295750 | |||
| 2093 | Ga0207663_10980466 | |||
| 2094 | Ga0207660_10003324 | |||
| 2095 | Ga0207660_10085298 | |||
| 2096 | Ga0207660_10243965 | |||
| 2097 | Ga0207660_10414347 | |||
| 2098 | Ga0207660_10960578 | |||
| 2099 | Ga0207662_10251851 | |||
| 2100 | Ga0207662_10316530 | |||
| 2101 | Ga0207662_10522240 | |||
| 2102 | Ga0207657_10023955 | |||
| 2103 | Ga0207657_10104313 | |||
| 2104 | Ga0207657_10152933 | |||
| 2105 | Ga0207657_10531940 | |||
| 2106 | Ga0207649_10066928 | |||
| 2107 | Ga0207649_10126012 | |||
| 2108 | Ga0207652_10026093 | |||
| 2109 | Ga0207652_10032074 | |||
| 2110 | Ga0207652_10141578 | |||
| 2111 | Ga0207652_10612085 | |||
| 2112 | Ga0207646_10000851 | |||
| 2113 | Ga0207646_10006167 | |||
| 2114 | Ga0207646_10350239 | |||
| 2115 | Ga0207646_10470048 | |||
| 2116 | Ga0207646_10873204 | |||
| 2117 | Ga0207646_11255629 | |||
| 2118 | Ga0207681_10141949 | |||
| 2119 | Ga0207650_10102675 | |||
| 2120 | Ga0207650_10211548 | |||
| 2121 | Ga0207659_10054577 | |||
| 2122 | Ga0207659_10439310 | |||
| 2123 | Ga0207659_10525473 | |||
| 2124 | Ga0207659_10809743 | |||
| 2125 | Ga0207659_11222875 | |||
| 2126 | Ga0207687_10040067 | |||
| 2127 | Ga0207687_10051517 | |||
| 2128 | Ga0207687_10095470 | |||
| 2129 | Ga0207687_10172632 | |||
| 2130 | Ga0207687_10178037 | |||
| 2131 | Ga0207687_10363650 | |||
| 2132 | Ga0207687_10552335 | |||
| 2133 | Ga0207687_10773573 | |||
| 2134 | Ga0207687_11343192 | |||
| 2135 | Ga0207700_10000001 | |||
| 2136 | Ga0207700_10026626 | |||
| 2137 | Ga0207700_10038712 | |||
| 2138 | Ga0207700_11080513 | |||
| 2139 | Ga0207664_10001406 | |||
| 2140 | Ga0207664_10020871 | |||
| 2141 | Ga0207664_10022997 | |||
| 2142 | Ga0207664_10033965 | |||
| 2143 | Ga0207664_10274078 | |||
| 2144 | Ga0207664_10290865 | |||
| 2145 | Ga0207664_10447145 | |||
| 2146 | Ga0207664_10447901 | |||
| 2147 | Ga0207664_10868463 | |||
| 2148 | Ga0207644_10220744 | |||
| 2149 | Ga0207644_10248632 | |||
| 2150 | Ga0207644_10393798 | |||
| 2151 | Ga0207644_10605170 | |||
| 2152 | Ga0207690_10185138 | |||
| 2153 | Ga0207690_10387590 | |||
| 2154 | Ga0207690_10434491 | |||
| 2155 | Ga0207690_10845447 | |||
| 2156 | Ga0207706_10198818 | |||
| 2157 | Ga0207706_10509487 | |||
| 2158 | Ga0207706_10953555 | |||
| 2159 | Ga0207686_10007037 | |||
| 2160 | Ga0207686_10692594 | |||
| 2161 | Ga0207686_10863041 | |||
| 2162 | Ga0207709_10001060 | |||
| 2163 | Ga0207709_10036357 | |||
| 2164 | Ga0207709_10082444 | |||
| 2165 | Ga0207670_10023173 | |||
| 2166 | Ga0207670_10329651 | |||
| 2167 | Ga0207669_10074154 | |||
| 2168 | Ga0207669_10190376 | |||
| 2169 | Ga0207669_11009560 | |||
| 2170 | Ga0207704_10000286 | |||
| 2171 | Ga0207704_10046777 | |||
| 2172 | Ga0207704_10149932 | |||
| 2173 | Ga0207704_10168404 | |||
| 2174 | Ga0207704_10231522 | |||
| 2175 | Ga0207704_10443972 | |||
| 2176 | Ga0207665_10006962 | |||
| 2177 | Ga0207665_10113016 | |||
| 2178 | Ga0207665_10117162 | |||
| 2179 | Ga0207665_10226469 | |||
| 2180 | Ga0207665_10630871 | |||
| 2181 | Ga0207691_10011073 | |||
| 2182 | Ga0207691_10049708 | |||
| 2183 | Ga0207711_10021100 | |||
| 2184 | Ga0207711_10063781 | |||
| 2185 | Ga0207711_10812375 | |||
| 2186 | Ga0207689_10326490 | |||
| 2187 | Ga0207689_10820087 | |||
| 2188 | Ga0207661_10003657 | |||
| 2189 | Ga0207661_10022155 | |||
| 2190 | Ga0207661_10062325 | |||
| 2191 | Ga0207661_10141659 | |||
| 2192 | Ga0207661_10242250 | |||
| 2193 | Ga0207661_10615782 | |||
| 2194 | Ga0207661_11751763 | |||
| 2195 | Ga0207679_10019995 | |||
| 2196 | Ga0207679_10047938 | |||
| 2197 | Ga0207679_10056211 | |||
| 2198 | Ga0207679_10066082 | |||
| 2199 | Ga0207679_10174390 | |||
| 2200 | Ga0207667_10719049 | |||
| 2201 | Ga0207651_10035870 | |||
| 2202 | Ga0207651_10100525 | |||
| 2203 | Ga0207651_10517320 | |||
| 2204 | Ga0207712_10003169 | |||
| 2205 | Ga0207712_10557806 | |||
| 2206 | Ga0207712_10780708 | |||
| 2207 | Ga0207712_10782487 | |||
| 2208 | Ga0207668_10055925 | |||
| 2209 | Ga0207668_10081936 | |||
| 2210 | Ga0207668_10461127 | |||
| 2211 | Ga0207640_10103531 | |||
| 2212 | Ga0207640_10302855 | |||
| 2213 | Ga0207640_10643411 | |||
| 2214 | Ga0207658_10205342 | |||
| 2215 | Ga0207658_10263410 | |||
| 2216 | Ga0207677_10118400 | |||
| 2217 | Ga0207677_10174254 | |||
| 2218 | Ga0207677_10197711 | |||
| 2219 | Ga0207677_10650835 | |||
| 2220 | Ga0207677_10703393 | |||
| 2221 | Ga0207677_10829953 | |||
| 2222 | Ga0207639_10037000 | |||
| 2223 | Ga0207678_10074836 | |||
| 2224 | Ga0207678_10264428 | |||
| 2225 | Ga0207678_10410741 | |||
| 2226 | Ga0207708_10018770 | |||
| 2227 | Ga0207708_10074971 | |||
| 2228 | Ga0207708_10380061 | |||
| 2229 | Ga0207708_10769965 | |||
| 2230 | Ga0207708_11112989 | |||
| 2231 | Ga0207702_10045933 | |||
| 2232 | Ga0207702_10087132 | |||
| 2233 | Ga0207702_10324033 | |||
| 2234 | Ga0207702_10582704 | |||
| 2235 | Ga0207702_11212359 | |||
| 2236 | Ga0207641_10168864 | |||
| 2237 | Ga0207641_10940579 | |||
| 2238 | Ga0207648_10011203 | |||
| 2239 | Ga0207648_10041456 | |||
| 2240 | Ga0207648_10124916 | |||
| 2241 | Ga0207648_10152132 | |||
| 2242 | Ga0207676_10295678 | |||
| 2243 | Ga0207676_10568968 | |||
| 2244 | Ga0207676_10601768 | |||
| 2245 | Ga0207674_10039665 | |||
| 2246 | Ga0207674_10305202 | |||
| 2247 | Ga0207674_10798825 | |||
| 2248 | Ga0207675_100149812 | |||
| 2249 | Ga0207675_100183839 | |||
| 2250 | Ga0207675_100395333 | |||
| 2251 | Ga0207675_100619731 | |||
| 2252 | Ga0207675_101222279 | |||
| 2253 | Ga0207683_10009121 | |||
| 2254 | Ga0207683_10104857 | |||
| 2255 | Ga0207683_10197559 | |||
| 2256 | Ga0207683_10209468 | |||
| 2257 | Ga0207683_10697336 | |||
| 2258 | Ga0207683_10812935 | |||
| 2259 | Ga0207683_11101104 | |||
| 2260 | Ga0207698_10046157 | |||
| 2261 | Ga0207698_10383541 | |||
| 2262 | Ga0207698_11661250 | |||
| 2263 | Ga0207698_11720906 | |||
| 2264 | Ga0209983_1018103 | |||
| 2265 | Ga0209971_1076288 | |||
| 2266 | Ga0207428_10013247 | |||
| 2267 | Ga0207428_10030394 | |||
| 2268 | Ga0207428_10502528 | |||
| 2269 | Ga0268266_10069113 | |||
| 2270 | Ga0268266_10509710 | |||
| 2271 | Ga0268266_10629067 | |||
| 2272 | Ga0268265_10222160 | |||
| 2273 | Ga0268265_10441519 | |||
| 2274 | Ga0268265_10937753 | |||
| 2275 | Ga0268265_11538312 | |||
| 2276 | Ga0268265_12009071 | |||
| 2277 | Ga0268264_10332760 | |||
| 2278 | Ga0265337_1054029 | |||
| 2279 | Ga0265319_1001715 | |||
| 2280 | Ga0265319_1002457 | |||
| 2281 | Ga0265319_1017512 | |||
| 2282 | Ga0265319_1024157 | |||
| 2283 | Ga0265334_10003069 | |||
| 2284 | Ga0265318_10002235 | |||
| 2285 | Ga0265318_10005575 | |||
| 2286 | Ga0265323_10065227 | |||
| 2287 | Ga0265323_10131647 | |||
| 2288 | Ga0265336_10001246 | |||
| 2289 | Ga0265336_10074058 | |||
| 2290 | Ga0265338_10001634 | |||
| 2291 | Ga0265338_10004752 | |||
| 2292 | Ga0265338_10006529 | |||
| 2293 | Ga0265338_10006962 | |||
| 2294 | Ga0265338_10012182 | |||
| 2295 | Ga0265338_10035857 | |||
| 2296 | Ga0265338_10295283 | |||
| 2297 | Ga0265324_10008952 | |||
| 2298 | Ga0265324_10172657 | |||
| 2299 | Ga0265330_10002117 | |||
| 2300 | Ga0265330_10007769 | |||
| 2301 | Ga0265332_10003068 | |||
| 2302 | Ga0265332_10287458 | |||
| 2303 | Ga0265328_10009953 | |||
| 2304 | Ga0265320_10011013 | |||
| 2305 | Ga0265320_10045980 | |||
| 2306 | Ga0265320_10120669 | |||
| 2307 | Ga0265320_10182513 | |||
| 2308 | Ga0265325_10002707 | |||
| 2309 | Ga0265329_10004301 | |||
| 2310 | Ga0265329_10012733 | |||
| 2311 | Ga0265329_10191763 | |||
| 2312 | Ga0265340_10002927 | |||
| 2313 | Ga0265340_10082712 | |||
| 2314 | Ga0265340_10227680 | |||
| 2315 | Ga0265339_10007125 | |||
| 2316 | Ga0265339_10016606 | |||
| 2317 | Ga0265339_10208688 | |||
| 2318 | Ga0265331_10001137 | |||
| 2319 | Ga0265331_10193784 | |||
| 2320 | Ga0265327_10013950 | |||
| 2321 | Ga0265327_10072157 | |||
| 2322 | Ga0265327_10136870 | |||
| 2323 | Ga0265316_10005912 | |||
| 2324 | Ga0265316_10010068 | |||
| 2325 | Ga0265316_10018295 | |||
| 2326 | Ga0265316_10163328 | |||
| 2327 | Ga0265316_10331911 | |||
| 2328 | Ga0307408_100138064 | |||
| 2329 | Ga0307408_100235426 | |||
| 2330 | Ga0265313_10011203 | |||
| 2331 | Ga0265313_10032156 | |||
| 2332 | Ga0265314_10008726 | |||
| 2333 | Ga0265314_10012224 | |||
| 2334 | Ga0265314_10017019 | |||
| 2335 | Ga0265314_10180252 | |||
| 2336 | Ga0265342_10009012 | |||
| 2337 | Ga0265342_10018402 | |||
| 2338 | Ga0265342_10051186 | |||
| 2339 | Ga0307405_10189710 | |||
| 2340 | Ga0307405_10319662 | |||
| 2341 | Ga0307413_10083017 | |||
| 2342 | Ga0307410_10109011 | |||
| 2343 | Ga0307406_10118559 | |||
| 2344 | Ga0307407_10027944 | |||
| 2345 | Ga0307407_10264512 | |||
| 2346 | Ga0307412_10045102 | |||
| 2347 | Ga0307412_11158248 | |||
| 2348 | Ga0307409_100202921 | |||
| 2349 | Ga0307409_100503331 | |||
| 2350 | Ga0307416_100076773 | |||
| 2351 | Ga0307416_100127477 | |||
| 2352 | Ga0307414_10016323 | |||
| 2353 | Ga0307411_10014197 | |||
| 2354 | Ga0307411_10235027 | |||
| 2355 | Ga0307415_100104630 | |||
| 2356 | Ga0373926_0131172 | |||
| 2357 | Ga0373926_0178304 | |||
| 2358 | Ga0373928_0141958 | |||
| 2359 | Ga0373928_0206433 | |||
| 2360 | Ga0373934_0153330 | |||
| 2361 | Ga0373944_0038235 | |||
| 2362 | Ga0373923_0004775 | |||
| 2363 | Ga0373923_0203504 | |||
| 2364 | Ga0373923_0342261 | |||
| 2365 | Ga0373932_0069873 | |||
| 2366 | Ga0373932_0240562 | |||
| 2367 | Ga0373936_0135879 | |||
| 2368 | Ga0373941_0127722 | |||
| 2369 | Ga0373941_0271081 | |||
| 2370 | Ga0373945_0046039 | |||
| 2371 | Ga0373945_0048762 | |||
| 2372 | Ga0373954_0120172 | |||
| 2373 | Ga0373956_0047636 | |||
| 2374 | Ga0373956_0201944 | |||
| 2375 | Ga0373957_0053871 | |||
| 2376 | Ga0373960_0061905 | |||
| 2377 | Ga0373960_0212208 | |||
| 2378 | Ga0373943_0001856 | |||
| 2379 | Ga0373943_0017801 | |||
| 2380 | Ga0373943_0325241 | |||
| 2381 | Ga0373946_0403741 | |||
| 2382 | Ga0373955_0288351 | |||
| 2383 | Ga0373955_0329151 | |||
| 2384 | Ga0373942_0358248 | |||
| 2385 | Ga0373962_0100731 | |||
| 2386 | Ga0373924_0067174 | |||
| 2387 | Ga0373924_0149373 | |||
| 2388 | Ga0373931_0040708 | |||
| 2389 | Ga0373931_0241595 | |||
| 2390 | Ga0373931_0382374 | |||
| 2391 | Ga0373931_0685960 | |||
| 2392 | Ga0373931_0798042 | |||
| 2393 | Ga0373935_0053852 | |||
| 2394 | Ga0373935_0102216 | |||
| 2395 | Ga0373935_0150025 | |||
| 2396 | Ga0373935_0246897 | |||
| 2397 | Ga0373935_0690550 | |||
| 2398 | Ga0373927_0108261 | |||
| 2399 | Ga0373933_0048328 | |||
| 2400 | Ga0373933_0207289 | |||
| 2401 | Ga0373933_0213579 | |||
| 2402 | Ga0373933_0507228 | |||
| 2403 | Ga0373947_0000695 | |||
| 2404 | Ga0373947_0006392 | |||
| 2405 | Ga0373947_0246830 | |||
| 2406 | Ga0373947_0363030 | |||
| 2407 | Ga0373937_0001944 | |||
| 2408 | Ga0373937_0017853 | |||
| 2409 | Ga0373937_0037507 | |||
| 2410 | Ga0373937_0125976 | |||
| 2411 | Ga0373937_1387833 | |||
| 2412 | Ga0316582_0250654 | |||
| 2413 | Ga0373925_0004944 | |||
| 2414 | Ga0373925_0243960 | |||
| 2415 | Ga0373925_0650794 | |||
| 2416 | Ga0373925_0858440 | |||
| 2417 | Ga0373925_1271220 | |||
| 2418 | Ga0395899_0026847 | |||
| 2419 | Ga0395899_0027964 | |||
| 2420 | Ga0395899_0033987 | |||
| 2421 | Ga0395899_0051296 | |||
| 2422 | Ga0395899_0066928 | |||
| 2423 | Ga0395899_0079485 | |||
| 2424 | Ga0395899_0271370 | |||
| 2425 | Ga0395899_0576025 | |||
| 2426 | Ga0395900_0003484 | |||
| 2427 | Ga0395900_0005403 | |||
| 2428 | Ga0395900_0008039 | |||
| 2429 | Ga0395900_0013982 | |||
| 2430 | Ga0395900_0020785 | |||
| 2431 | Ga0395900_0032892 | |||
| 2432 | Ga0395900_0055275 | |||
| 2433 | Ga0395900_0092866 | |||
| 2434 | Ga0395900_0260483 | |||
| 2435 | Ga0395900_0476283 | |||
| 2436 | Ga0395900_0632917 | |||
| 2437 | Ga0395898_0005726 | |||
| 2438 | Ga0395898_0006566 | |||
| 2439 | Ga0395898_0008907 | |||
| 2440 | Ga0395898_0015727 | |||
| 2441 | Ga0395898_0030358 | |||
| 2442 | Ga0395898_0100928 | |||
| 2443 | Ga0395898_0165459 | |||
| 2444 | Ga0395898_0346098 | |||
| 2445 | Ga0395898_0465826 | |||
| 2446 | Ga0395898_0532919 | |||
| 2447 | Ga0395898_0938964 | |||
| 2448 | Ga0395898_1409829 | |||
| 2449 | Ga0395898_1529062 | |||
| 2450 | Ga0395905_0002297 | |||
| 2451 | Ga0395905_0002950 | |||
| 2452 | Ga0395905_0020250 | |||
| 2453 | Ga0395905_0024606 | |||
| 2454 | Ga0395905_0065936 | |||
| 2455 | Ga0395905_0067751 | |||
| 2456 | Ga0395905_0117805 | |||
| 2457 | Ga0395905_0118322 | |||
| 2458 | Ga0395905_0143538 | |||
| 2459 | Ga0395905_1085993 | |||
| 2460 | Ga0395905_1121377 | |||
| 2461 | Ga0436364_0821737 | |||
| 2462 | Ga0395901_0000608 | |||
| 2463 | Ga0395901_0007743 | |||
| 2464 | Ga0395901_0022332 | |||
| 2465 | Ga0395901_0027614 | |||
| 2466 | Ga0395901_0030522 | |||
| 2467 | Ga0395901_0045595 | |||
| 2468 | Ga0395901_0097478 | |||
| 2469 | Ga0395901_0112528 | |||
| 2470 | Ga0395901_0117176 | |||
| 2471 | Ga0395901_0277699 | |||
| 2472 | Ga0395901_0284901 | |||
| 2473 | Ga0395901_0313804 | |||
| 2474 | Ga0395901_0665864 | |||
| 2475 | Ga0395901_0813527 | |||
| 2476 | Ga0395901_0860493 | |||
| 2477 | Ga0395901_0970755 | |||
| 2478 | Ga0395901_1359367 | |||
| 2479 | Ga0436365_0656028 | |||
| 2480 | Ga0436360_0776362 | |||
| 2481 | Ga0436363_0952217 | |||
| 2482 | Ga0436362_0380053 | |||
| 2483 | Ga0436362_1147745 | |||
| 2484 | Ga0439465_0094326 | |||
| 2485 | Ga0451807_1368180 | |||
| 2486 | Ga0451833_0863113 | |||
| 2487 | Ga0451839_0797568 | |||
| 2488 | Ga0451853_3840200 | |||
| 2489 | Ga0439456_026426 | |||
| 2490 | Ga0450920_022902 | |||
| 2491 | Ga0439458_0102334 | |||
| 2492 | Ga0439444_0073923 | |||
| 2493 | Ga0439460_0092680 | |||
| 2494 | Ga0451577_1389975 | |||
| 2495 | Ga0466969_0004507 | |||
| 2496 | Ga0466969_0010275 | |||
| 2497 | Ga0466969_0091539 | |||
| 2498 | Ga0466972_0046231 | |||
| 2499 | Ga0466972_0213288 | |||
| 2500 | Ga0466972_0223562 | |||
| 2501 | Ga0466965_0024494 | |||
| 2502 | Ga0466965_0051753 | |||
| 2503 | Ga0466966_0009082 | |||
| 2504 | Ga0466966_0010536 | |||
| 2505 | Ga0466966_0026245 | |||
| 2506 | Ga0466966_0068631 | |||
| 2507 | Ga0466966_0171730 | |||
| 2508 | Ga0466966_0667460 | |||
| 2509 | Ga0466961_0009633 | |||
| 2510 | Ga0466961_0026261 | |||
| 2511 | Ga0466961_0026772 | |||
| 2512 | Ga0466961_0125361 | |||
| 2513 | Ga0466961_0338604 | |||
| 2514 | Ga0466961_0457038 | |||
| 2515 | Ga0466963_0003701 | |||
| 2516 | Ga0466963_0004189 | |||
| 2517 | Ga0466963_0004471 | |||
| 2518 | Ga0466963_0014876 | |||
| 2519 | Ga0466963_0021567 | |||
| 2520 | Ga0466963_0045882 | |||
| 2521 | Ga0466963_0063742 | |||
| 2522 | Ga0466963_0101421 | |||
| 2523 | Ga0466963_0159350 | |||
| 2524 | Ga0466963_0207834 | |||
| 2525 | Ga0466963_0237225 | |||
| 2526 | Ga0466963_0247612 | |||
| 2527 | Ga0466963_0406939 | |||
| 2528 | Ga0466963_0503319 | |||
| 2529 | Ga0466963_0553379 | |||
| 2530 | Ga0466963_0654516 | |||
| 2531 | Ga0466963_0852651 | |||
| 2532 | Ga0466964_0013102 | |||
| 2533 | Ga0466964_0110831 | |||
| 2534 | Ga0466964_0156465 | |||
| 2535 | Ga0466964_0196636 | |||
| 2536 | Ga0466964_0208338 | |||
| 2537 | Ga0466964_0235949 | |||
| 2538 | Ga0466964_0274808 | |||
| 2539 | Ga0466971_0000811 | |||
| 2540 | Ga0466971_0029937 | |||
| 2541 | Ga0466971_0176300 | |||
| 2542 | Ga0466968_0001383 | |||
| 2543 | Ga0466968_0008580 | |||
| 2544 | Ga0466968_0412375 | |||
| 2545 | Ga0466970_0013070 | |||
| 2546 | Ga0466970_0044329 | |||
| 2547 | Ga0466970_0166158 | |||
| 2548 | Ga0466957_0005732 | |||
| 2549 | Ga0466957_0017579 | |||
| 2550 | Ga0466957_0027729 | |||
| 2551 | Ga0466957_0028136 | |||
| 2552 | Ga0466957_0038491 | |||
| 2553 | Ga0466957_0053073 | |||
| 2554 | Ga0466957_0063308 | |||
| 2555 | Ga0466957_0186843 | |||
| 2556 | Ga0466957_0272997 | |||
| 2557 | Ga0466960_0006002 | |||
| 2558 | Ga0466959_0005002 | |||
| 2559 | Ga0466959_0005947 | |||
| 2560 | Ga0466959_0025018 | |||
| 2561 | Ga0466959_0027957 | |||
| 2562 | Ga0466959_0128359 | |||
| 2563 | Ga0466959_0258199 | |||
| 2564 | Ga0466959_0688490 | |||
| 2565 | Ga0466958_0004460 | |||
| 2566 | Ga0466958_0012842 | |||
| 2567 | Ga0466958_0021604 | |||
| 2568 | Ga0466958_0036844 | |||
| 2569 | Ga0466958_0054902 | |||
| 2570 | Ga0466958_0078285 | |||
| 2571 | Ga0466958_0100437 | |||
| 2572 | Ga0466958_0239482 | |||
| 2573 | Ga0466958_0366278 | |||
| 2574 | Ga0466967_0006451 | |||
| 2575 | Ga0466967_0011148 | |||
| 2576 | Ga0466967_0013513 | |||
| 2577 | Ga0466967_0015715 | |||
| 2578 | Ga0466967_0021669 | |||
| 2579 | Ga0466967_0035150 | |||
| 2580 | Ga0466967_0038721 | |||
| 2581 | Ga0466967_0041751 | |||
| 2582 | Ga0466967_0045124 | |||
| 2583 | Ga0466967_0048763 | |||
| 2584 | Ga0466967_0068371 | |||
| 2585 | Ga0466967_0086049 | |||
| 2586 | Ga0466967_0104259 | |||
| 2587 | Ga0466967_0129685 | |||
| 2588 | Ga0466967_0193253 | |||
| 2589 | Ga0466967_0319700 | |||
| 2590 | Ga0466967_0846890 | |||
| 2591 | Ga0466967_1801184 | |||
| 2592 | Ga0466967_2050243 | |||
| 2593 | Ga0495592_0000082 | |||
| 2594 | Ga0495592_0109231 | |||
| 2595 | Ga0495592_0226657 | |||
| 2596 | Ga0495592_0736525 | |||
| 2597 | Ga0495603_0006416 | |||
| 2598 | Ga0495603_0016906 | |||
| 2599 | Ga0495603_0019605 | |||
| 2600 | Ga0495603_0055549 | |||
| 2601 | Ga0495603_0079401 | |||
| 2602 | Ga0495603_0184050 | |||
| 2603 | Ga0495629_0007529 | |||
| 2604 | Ga0495629_0010957 | |||
| 2605 | Ga0495629_0025764 | |||
| 2606 | Ga0495629_0102512 | |||
| 2607 | Ga0495629_0339656 | |||
| 2608 | Ga0495629_0455326 | |||
| 2609 | Ga0495629_0459346 | |||
| 2610 | Ga0495629_0547591 | |||
| 2611 | Ga0495629_0928086 | |||
| 2612 | Ga0495638_0582878 | |||
| 2613 | Ga0495641_0032439 | |||
| 2614 | Ga0495641_0050947 | |||
| 2615 | Ga0495641_0145703 | |||
| 2616 | Ga0495641_0200396 | |||
| 2617 | Ga0495651_0000254 | |||
| 2618 | Ga0495651_0118119 | |||
| 2619 | Ga0495651_0330441 | |||
| 2620 | Ga0495653_0033226 | |||
| 2621 | Ga0495653_0056045 | |||
| 2622 | Ga0495653_0062040 | |||
| 2623 | Ga0495653_0331519 | |||
| 2624 | Ga0495580_0015356 | |||
| 2625 | Ga0495580_0414083 | |||
| 2626 | Ga0495580_0450201 | |||
| 2627 | Ga0495582_0015545 | |||
| 2628 | Ga0495582_0015963 | |||
| 2629 | Ga0495582_0023288 | |||
| 2630 | Ga0495582_0073875 | |||
| 2631 | Ga0495582_0125969 | |||
| 2632 | Ga0495582_0294629 | |||
| 2633 | Ga0495582_0411421 | |||
| 2634 | Ga0495582_0549023 | |||
| 2635 | Ga0495605_0016774 | |||
| 2636 | Ga0495639_0001278 | |||
| 2637 | Ga0495639_0008210 | |||
| 2638 | Ga0495639_0133036 | |||
| 2639 | Ga0495639_0312500 | |||
| 2640 | Ga0495662_0002354 | |||
| 2641 | Ga0495662_0107155 | |||
| 2642 | Ga0495664_0037746 | |||
| 2643 | Ga0495664_0105295 | |||
| 2644 | Ga0495664_0109398 | |||
| 2645 | Ga0495664_0250652 | |||
| 2646 | Ga0495664_0358547 | |||
| 2647 | Ga0495664_0726659 | |||
| 2648 | Ga0495584_0087083 | |||
| 2649 | Ga0495584_0495897 | |||
| 2650 | Ga0495584_0664631 | |||
| 2651 | Ga0495585_0095394 | |||
| 2652 | Ga0495594_0024508 | |||
| 2653 | Ga0495594_0053590 | |||
| 2654 | Ga0495594_0084112 | |||
| 2655 | Ga0495594_0609334 | |||
| 2656 | Ga0495596_0022588 | |||
| 2657 | Ga0495596_0073391 | |||
| 2658 | Ga0495596_0102679 | |||
| 2659 | Ga0495596_0106757 | |||
| 2660 | Ga0495607_0048502 | |||
| 2661 | Ga0495607_0188969 | |||
| 2662 | Ga0495607_0333120 | |||
| 2663 | Ga0495608_0004089 | |||
| 2664 | Ga0495608_0091613 | |||
| 2665 | Ga0495608_0268406 | |||
| 2666 | Ga0495608_0271781 | |||
| 2667 | Ga0495608_0335761 | |||
| 2668 | Ga0495618_0002754 | |||
| 2669 | Ga0495618_0072183 | |||
| 2670 | Ga0495618_0127546 | |||
| 2671 | Ga0495618_0216426 | |||
| 2672 | Ga0495620_0074733 | |||
| 2673 | Ga0495628_0005951 | |||
| 2674 | Ga0495628_0101878 | |||
| 2675 | Ga0495628_0115368 | |||
| 2676 | Ga0495628_0124383 | |||
| 2677 | Ga0495628_0201504 | |||
| 2678 | Ga0495630_0025613 | |||
| 2679 | Ga0495630_0048821 | |||
| 2680 | Ga0495630_0063085 | |||
| 2681 | Ga0495630_0224548 | |||
| 2682 | Ga0495630_0346156 | |||
| 2683 | Ga0495630_0409240 | |||
| 2684 | Ga0495630_0673763 | |||
| 2685 | Ga0495630_0946211 | |||
| 2686 | Ga0495637_0066058 | |||
| 2687 | Ga0495637_0144781 | |||
| 2688 | Ga0495644_0002786 | |||
| 2689 | Ga0495644_0054640 | |||
| 2690 | Ga0495644_0135363 | |||
| 2691 | Ga0495644_0164875 | |||
| 2692 | Ga0495663_0262423 | |||
| 2693 | Ga0495666_0011435 | |||
| 2694 | Ga0495666_0014313 | |||
| 2695 | Ga0495642_0132537 | |||
| 2696 | Ga0495642_0172573 | |||
| 2697 | Ga0495652_0000144 | |||
| 2698 | Ga0495652_0028166 | |||
| 2699 | Ga0495652_0029633 | |||
| 2700 | Ga0495652_0066760 | |||
| 2701 | Ga0495652_0260278 | |||
| 2702 | Ga0495652_0383841 | |||
| 2703 | Ga0495652_0422562 | |||
| 2704 | Ga0495654_0170806 | |||
| 2705 | Ga0495665_0030850 | |||
| 2706 | Ga0495665_0041398 | |||
| 2707 | Ga0495640_0034587 | |||
| 2708 | Ga0495640_0198122 | |||
| 2709 | Ga0495586_0041582 | |||
| 2710 | Ga0495586_0093460 | |||
| 2711 | Ga0495587_0000060 | |||
| 2712 | Ga0495587_0049059 | |||
| 2713 | Ga0495587_0068914 | |||
| 2714 | Ga0495587_0072977 | |||
| 2715 | Ga0495587_0080158 | |||
| 2716 | Ga0495587_0092874 | |||
| 2717 | Ga0495598_0038241 | |||
| 2718 | Ga0495609_0123311 | |||
| 2719 | Ga0495609_0249949 | |||
| 2720 | Ga0495645_0000038 | |||
| 2721 | Ga0495645_0006731 | |||
| 2722 | Ga0495645_0228928 | |||
| 2723 | Ga0495645_0399325 | |||
| 2724 | Ga0495622_0115122 | |||
| 2725 | Ga0495667_0101587 | |||
| 2726 | Ga0495667_0106308 | |||
| 2727 | Ga0495667_0138363 | |||
| 2728 | Ga0495656_0026801 | |||
| 2729 | Ga0495656_0068571 | |||
| 2730 | Ga0495656_0110469 | |||
| 2731 | Ga0495668_0108621 | |||
| 2732 | Ga0495634_0029831 | |||
| 2733 | Ga0495634_0047853 | |||
| 2734 | Ga0495634_0049693 | |||
| 2735 | Ga0495634_0257353 | |||
| 2736 | Ga0495634_0315289 | |||
| 2737 | Ga0495634_0683320 | |||
| 2738 | Ga0495611_0039072 | |||
| 2739 | Ga0495635_0009523 | |||
| 2740 | Ga0495635_0013153 | |||
| 2741 | Ga0495635_0041858 | |||
| 2742 | Ga0495635_0095636 | |||
| 2743 | Ga0495635_0142819 | |||
| 2744 | Ga0495635_0327008 | |||
| 2745 | Ga0495659_0009389 | |||
| 2746 | Ga0495659_0161914 | |||
| 2747 | Ga0495659_0173365 | |||
| 2748 | Ga0495659_0190402 | |||
| 2749 | Ga0495661_0166056 | |||
| 2750 | Ga0495588_0183108 | |||
| 2751 | Ga0495588_0378415 | |||
| 2752 | Ga0495588_0508561 | |||
| 2753 | Ga0495588_0527774 | |||
| 2754 | Ga0495657_0015397 | |||
| 2755 | Ga0495657_0103474 | |||
| 2756 | Ga0495657_0345580 | |||
| 2757 | Ga0495657_0538100 | |||
| 2758 | Ga0495599_0000048 | |||
| 2759 | Ga0495599_0032178 | |||
| 2760 | Ga0495599_0218968 | |||
| 2761 | Ga0495599_0318156 | |||
| 2762 | Ga0495623_0001647 | |||
| 2763 | Ga0495623_0274569 | |||
| 2764 | Ga0495623_0402171 | |||
| 2765 | Ga0495646_0015156 | |||
| 2766 | Ga0495646_0091567 | |||
| 2767 | Ga0495646_0100604 | |||
| 2768 | Ga0495646_0106134 | |||
| 2769 | Ga0495647_0001533 | |||
| 2770 | Ga0495647_0001646 | |||
| 2771 | Ga0495647_0015581 | |||
| 2772 | Ga0495647_0028628 | |||
| 2773 | Ga0495647_0156005 | |||
| 2774 | Ga0495647_0180326 | |||
| 2775 | Ga0495658_0001182 | |||
| 2776 | Ga0495658_0010111 | |||
| 2777 | Ga0495658_0058066 | |||
| 2778 | Ga0495658_0074539 | |||
| 2779 | Ga0495658_0097970 | |||
| 2780 | Ga0495658_0314540 | |||
| 2781 | Ga0495658_0317888 | |||
| 2782 | Ga0495658_0510153 | |||
| 2783 | Ga0495658_0806690 | |||
| 2784 | Ga0495613_0033317 | |||
| 2785 | Ga0495613_0038260 | |||
| 2786 | Ga0495613_0045117 | |||
| 2787 | Ga0495613_0057564 | |||
| 2788 | Ga0495624_0014707 | |||
| 2789 | Ga0495624_0054293 | |||
| 2790 | Ga0495624_0154463 | |||
| 2791 | Ga0495670_0022603 | |||
| 2792 | Ga0495670_0326546 | |||
| 2793 | Ga0495670_0479709 | |||
| 2794 | Ga0495671_0301212 | |||
| 2795 | Ga0495649_0486087 | |||
| 2796 | Ga0495589_0038706 | |||
| 2797 | Ga0495589_0102899 | |||
| 2798 | Ga0495589_0217337 | |||
| 2799 | Ga0495589_0256981 | |||
| 2800 | Ga0495600_0059326 | |||
| 2801 | Ga0495600_0192117 | |||
| 2802 | Ga0495600_0423693 | |||
| 2803 | Ga0495600_0451787 | |||
| 2804 | Ga0495660_0204466 | |||
| 2805 | Ga0495660_0255255 | |||
| 2806 | Ga0495581_0007592 | |||
| 2807 | Ga0495581_0035922 | |||
| 2808 | Ga0495581_0474985 | |||
| 2809 | Ga0495581_0564153 | |||
| 2810 | Ga0495604_0000043 | |||
| 2811 | Ga0495604_0159747 | |||
| 2812 | Ga0495604_0287193 | |||
| 2813 | Ga0495604_0412910 | |||
| 2814 | Ga0495604_0921317 | |||
| 2815 | Ga0495636_0329448 | |||
| 2816 | Ga0495674_0031987 | |||
| 2817 | Ga0495674_0063357 | |||
| 2818 | Ga0495674_0157644 | |||
| 2819 | Ga0495674_0188984 | |||
| 2820 | Ga0495674_0251882 | |||
| 2821 | Ga0495674_0283417 | |||
| 2822 | Ga0495674_0469375 | |||
| 2823 | Ga0495674_0556665 | |||
| 2824 | Ga0495674_0717293 | |||
| 2825 | Ga0495676_0003238 | |||
| 2826 | Ga0495676_0037011 | |||
| 2827 | Ga0495676_0351535 | |||
| 2828 | Ga0495676_0606602 | |||
| 2829 | Ga0495676_0625607 | |||
| 2830 | Ga0495680_0001621 | |||
| 2831 | Ga0495680_0006421 | |||
| 2832 | Ga0495680_0012966 | |||
| 2833 | Ga0495680_0034460 | |||
| 2834 | Ga0495680_0111639 | |||
| 2835 | Ga0495680_0143144 | |||
| 2836 | Ga0495680_0223492 | |||
| 2837 | Ga0495683_0079607 | |||
| 2838 | Ga0495675_0000413 | |||
| 2839 | Ga0495675_0005668 | |||
| 2840 | Ga0495677_0232428 | |||
| 2841 | Ga0495684_0099684 | |||
| 2842 | Ga0495684_0103614 | |||
| 2843 | Ga0495684_0267993 | |||
| 2844 | Ga0495684_0358541 | |||
| 2845 | Ga0495593_0008203 | |||
| 2846 | Ga0495593_0008597 | |||
| 2847 | Ga0495593_0074431 | |||
| 2848 | Ga0495593_0412386 | |||
| 2849 | Ga0495602_0008483 | |||
| 2850 | Ga0495602_0016733 | |||
| 2851 | Ga0495602_0273214 | |||
| 2852 | Ga0495602_0427376 | |||
| 2853 | Ga0495602_0611426 | |||
| 2854 | Ga0495614_0006192 | |||
| 2855 | Ga0495614_0035419 | |||
| 2856 | Ga0495614_0285238 | |||
| 2857 | Ga0495614_0307288 | |||
| 2858 | Ga0495615_0156671 | |||
| 2859 | Ga0495626_0264478 | |||
| 2860 | Ga0496100_0025042 | |||
| 2861 | Ga0496100_0094937 | |||
| 2862 | Ga0496100_0134046 | |||
| 2863 | Ga0496100_0349598 | |||
| 2864 | Ga0496100_0372299 | |||
| 2865 | Ga0496100_0389514 | |||
| 2866 | Ga0496100_0594120 | |||
| 2867 | Ga0496101_0000625 | |||
| 2868 | Ga0496101_0001765 | |||
| 2869 | Ga0496101_0019351 | |||
| 2870 | Ga0496101_0026566 | |||
| 2871 | Ga0496101_0108464 | |||
| 2872 | Ga0496101_0190110 | |||
| 2873 | Ga0496101_0205860 | |||
| 2874 | Ga0496101_0287296 | |||
| 2875 | Ga0496101_0560345 | |||
| 2876 | Ga0496101_0568248 | |||
| 2877 | Ga0496101_0706513 | |||
| 2878 | Ga0496101_1130989 | |||
| 2879 | Ga0496102_0003464 | |||
| 2880 | Ga0496102_0004850 | |||
| 2881 | Ga0496102_0009140 | |||
| 2882 | Ga0496102_0010068 | |||
| 2883 | Ga0496102_0010768 | |||
| 2884 | Ga0496102_0108024 | |||
| 2885 | Ga0496102_0192503 | |||
| 2886 | Ga0496102_0199799 | |||
| 2887 | Ga0496102_0213831 | |||
| 2888 | Ga0496102_0511500 | |||
| 2889 | Ga0496102_0785822 | |||
| 2890 | Ga0496102_1059488 | |||
| 2891 | Ga0496103_0000427 | |||
| 2892 | Ga0496103_0004657 | |||
| 2893 | Ga0496103_0028417 | |||
| 2894 | Ga0496103_0063793 | |||
| 2895 | Ga0496103_0064919 | |||
| 2896 | Ga0496103_0091724 | |||
| 2897 | Ga0496103_0561292 | |||
| 2898 | Ga0496104_0016549 | |||
| 2899 | Ga0496104_0016872 | |||
| 2900 | Ga0496104_0077315 | |||
| 2901 | Ga0496104_0088244 | |||
| 2902 | Ga0496104_0120426 | |||
| 2903 | Ga0496104_0168519 | |||
| 2904 | Ga0496104_0186929 | |||
| 2905 | Ga0496104_0308408 | |||
| 2906 | Ga0496104_0354789 | |||
| 2907 | Ga0496104_0686984 | |||
| 2908 | Ga0496104_0979325 | |||
| 2909 | Ga0496104_1029384 | |||
| 2910 | Ga0496105_0003116 | |||
| 2911 | Ga0496105_0006964 | |||
| 2912 | Ga0496105_0022559 | |||
| 2913 | Ga0496105_0030137 | |||
| 2914 | Ga0496105_0034600 | |||
| 2915 | Ga0496105_0047956 | |||
| 2916 | Ga0496105_0097943 | |||
| 2917 | Ga0496105_0157072 | |||
| 2918 | Ga0496105_0216393 | |||
| 2919 | Ga0496106_0000838 | |||
| 2920 | Ga0496106_0002532 | |||
| 2921 | Ga0496106_0011768 | |||
| 2922 | Ga0496106_0108030 | |||
| 2923 | Ga0496106_0395856 | |||
| 2924 | Ga0496106_0428982 | |||
| 2925 | Ga0496106_1373478 | |||
| 2926 | Ga0496107_0000371 | |||
| 2927 | Ga0496107_0000608 | |||
| 2928 | Ga0496107_0001409 | |||
| 2929 | Ga0496107_0031040 | |||
| 2930 | Ga0496107_0085656 | |||
| 2931 | Ga0496107_0238090 | |||
| 2932 | Ga0496107_0288475 | |||
| 2933 | Ga0496107_0411333 | |||
| 2934 | Ga0496107_0457669 | |||
| 2935 | Ga0496107_0774976 | |||
| 2936 | Ga0496107_0866342 | |||
| 2937 | Ga0496108_0005123 | |||
| 2938 | Ga0496108_0007474 | |||
| 2939 | Ga0496108_0025543 | |||
| 2940 | Ga0496108_0055197 | |||
| 2941 | Ga0496108_0056915 | |||
| 2942 | Ga0496108_0086072 | |||
| 2943 | Ga0496108_0100883 | |||
| 2944 | Ga0496108_0190683 | |||
| 2945 | Ga0496108_0243139 | |||
| 2946 | Ga0496108_0336111 | |||
| 2947 | Ga0496108_0486565 | |||
| 2948 | Ga0496108_0964377 | |||
| 2949 | Ga0496108_1046988 | |||
| 2950 | Ga0496109_0010043 | |||
| 2951 | Ga0496109_0010864 | |||
| 2952 | Ga0496109_0011904 | |||
| 2953 | Ga0496109_0012268 | |||
| 2954 | Ga0496109_0016215 | |||
| 2955 | Ga0496109_0016233 | |||
| 2956 | Ga0496109_0037498 | |||
| 2957 | Ga0496109_0039111 | |||
| 2958 | Ga0496109_0050409 | |||
| 2959 | Ga0496109_0060980 | |||
| 2960 | Ga0496109_0080705 | |||
| 2961 | Ga0496109_0232009 | |||
| 2962 | Ga0496109_0370753 | |||
| 2963 | Ga0496109_0415147 | |||
| 2964 | Ga0496109_0687536 | |||
| 2965 | Ga0496109_0704036 | |||
| 2966 | Ga0496109_0787284 | |||
| 2967 | Ga0496109_0889996 | |||
| 2968 | Ga0496109_1412214 | |||
| 2969 | Ga0496109_1490485 | |||
| 2970 | Ga0496110_0004734 | |||
| 2971 | Ga0496110_0005775 | |||
| 2972 | Ga0496110_0006738 | |||
| 2973 | Ga0496110_0038727 | |||
| 2974 | Ga0496110_0064467 | |||
| 2975 | Ga0496110_0129343 | |||
| 2976 | Ga0496110_0167951 | |||
| 2977 | Ga0496110_0193797 | |||
| 2978 | Ga0496110_0207284 | |||
| 2979 | Ga0496110_0289107 | |||
| 2980 | Ga0496110_0317347 | |||
| 2981 | Ga0496110_0492411 | |||
| 2982 | Ga0496110_0638024 | |||
| 2983 | Ga0496111_0002804 | |||
| 2984 | Ga0496111_0009880 | |||
| 2985 | Ga0496111_0030027 | |||
| 2986 | Ga0496111_0031386 | |||
| 2987 | Ga0496111_0057802 | |||
| 2988 | Ga0496111_0061008 | |||
| 2989 | Ga0496111_0063988 | |||
| 2990 | Ga0496111_0084993 | |||
| 2991 | Ga0496111_0086746 | |||
| 2992 | Ga0496111_0362835 | |||
| 2993 | Ga0496111_0401370 | |||
| 2994 | Ga0496111_0480939 | |||
| 2995 | Ga0496112_0010312 | |||
| 2996 | Ga0496112_0027854 | |||
| 2997 | Ga0496112_0030237 | |||
| 2998 | Ga0496112_0037958 | |||
| 2999 | Ga0496112_0044267 | |||
| 3000 | Ga0496112_0047964 | |||
| 3001 | Ga0496112_0048601 | |||
| 3002 | Ga0496112_0111345 | |||
| 3003 | Ga0496112_0262344 | |||
| 3004 | Ga0496112_0292611 | |||
| 3005 | Ga0496112_0349409 | |||
| 3006 | Ga0496112_0895789 | |||
| 3007 | Ga0496112_1005313 | |||
| 3008 | Ga0496112_1411723 | |||
| 3009 | Ga0496112_1492253 | |||
| 3010 | Ga0496113_0123253 | |||
| 3011 | Ga0496113_0220680 | |||
| 3012 | Ga0496113_0241059 | |||
| 3013 | Ga0496113_0302301 | |||
| 3014 | Ga0496113_0348586 | |||
| 3015 | Ga0496113_0572668 | |||
| 3016 | Ga0496113_1028267 | |||
| 3017 | Ga0496114_0014447 | |||
| 3018 | Ga0496114_0019217 | |||
| 3019 | Ga0496114_0022546 | |||
| 3020 | Ga0496114_0046348 | |||
| 3021 | Ga0496114_0061744 | |||
| 3022 | Ga0496114_0092491 | |||
| 3023 | Ga0496114_0104736 | |||
| 3024 | Ga0496114_0118246 | |||
| 3025 | Ga0496114_0294417 | |||
| 3026 | Ga0496114_0405936 | |||
| 3027 | Ga0496114_0715449 | |||
| 3028 | Ga0496114_0818620 | |||
| 3029 | Ga0496114_1108428 | |||
| 3030 | Ga0496114_1379516 | |||
| 3031 | Ga0496115_0039590 | |||
| 3032 | Ga0496115_0052111 | |||
| 3033 | Ga0496115_0080599 | |||
| 3034 | Ga0496115_0104564 | |||
| 3035 | Ga0496115_0310946 | |||
| 3036 | Ga0496115_0474100 | |||
| 3037 | Ga0496115_0521457 | |||
| 3038 | Ga0501031_0559054 | |||
| 3039 | Ga0501031_0982461 | |||
| 3040 | Ga0501032_0042828 | |||
| 3041 | Ga0501032_0043872 | |||
| 3042 | Ga0501033_0071104 | |||
| 3043 | Ga0501034_0045090 | |||
| 3044 | Ga0501036_0139906 | |||
| 3045 | Ga0501037_0490125 | |||
| 3046 | Ga0501038_0002469 | |||
| 3047 | Ga0501038_0860751 | |||
| 3048 | Ga0501039_0401762 | |||
| 3049 | Ga0501039_0662899 | |||
| 3050 | Ga0501040_0003658 | |||
| 3051 | Ga0501040_0156035 | |||
| 3052 | Ga0501040_0601505 | |||
| 3053 | Ga0501040_0763508 | |||
| 3054 | Ga0501041_0004418 | |||
| 3055 | Ga0501041_0169685 | |||
| 3056 | Ga0501042_0000667 | |||
| 3057 | Ga0501043_0005069 | |||
| 3058 | Ga0501043_1001967 | |||
| 3059 | Ga0501048_0014271 | |||
| 3060 | Ga0501048_0260084 | |||
| 3061 | Ga0501048_0634802 | |||
| 3062 | Ga0501067_0036280 | |||
| 3063 | Ga0501067_0051224 | |||
| 3064 | Ga0501067_0127758 | |||
| 3065 | Ga0501067_0217258 | |||
| 3066 | Ga0501068_0015065 | |||
| 3067 | Ga0501068_0029375 | |||
| 3068 | Ga0501068_0187153 | |||
| 3069 | Ga0501068_0735983 | |||
| 3070 | Ga0501069_0008120 | |||
| 3071 | Ga0501069_0052921 | |||
| 3072 | Ga0501069_0063548 | |||
| 3073 | Ga0501070_0071043 | |||
| 3074 | Ga0501070_0273145 | |||
| 3075 | Ga0501070_0345058 | |||
| 3076 | Ga0501071_0007796 | |||
| 3077 | Ga0501071_0193736 | |||
| 3078 | Ga0501071_0522853 | |||
| 3079 | Ga0501071_0764828 | |||
| 3080 | Ga0501072_0072741 | |||
| 3081 | Ga0501072_0374017 | |||
| 3082 | Ga0501072_0589893 | |||
| 3083 | Ga0501072_0705655 | |||
| 3084 | Ga0501073_0068922 | |||
| 3085 | Ga0501074_0007535 | |||
| 3086 | Ga0501074_0014796 | |||
| 3087 | Ga0501074_0546640 | |||
| 3088 | Ga0501075_0002769 | |||
| 3089 | Ga0501075_0184386 | |||
| 3090 | Ga0501075_0437690 | |||
| 3091 | Ga0501075_1244986 | |||
| 3092 | Ga0501076_0010351 | |||
| 3093 | Ga0501076_0455143 | |||
| 3094 | Ga0501076_0621957 | |||
| 3095 | Ga0501076_0645605 | |||
| 3096 | Ga0501076_0821038 | |||
| 3097 | Ga0501077_0021232 | |||
| 3098 | Ga0501077_0029478 | |||
| 3099 | Ga0501261_112525 | |||
| 3100 | Ga0501225_0209194 | |||
| 3101 | Ga0501079_0008491 | |||
| 3102 | Ga0501079_0022136 | |||
| 3103 | Ga0501080_0022647 | |||
| 3104 | Ga0501080_0769264 | |||
| 3105 | Ga0501081_0007966 | |||
| 3106 | Ga0501081_0028001 | |||
| 3107 | Ga0501083_0002257 | |||
| 3108 | Ga0501035_0014204 | |||
| 3109 | Ga0501044_0293432 | |||
| 3110 | Ga0501045_0009808 | |||
| 3111 | nmdc:mga03683_47425_c1 | |||
| 3112 | nmdc:mga00v17_141770_c1 | |||
| 3113 | nmdc:mga00v17_91256_c1 | |||
| 3114 | nmdc:mga0yw44_190072_c1 | |||
| 3115 | nmdc:mga0yw44_313445_c1 | |||
| 3116 | nmdc:mga06z11_496463_c1 | |||
| 3117 | nmdc:mga05p37_140955_c1 | |||
| 3118 | nmdc:mga05p37_300216_c1 | |||
| 3119 | nmdc:mga05p37_345361_c1 | |||
| 3120 | nmdc:mga05p37_490630_c1 | |||
| 3121 | nmdc:mga09592_67999_c1 | |||
| 3122 | nmdc:mga0qj67_290980_c1 | |||
| 3123 | nmdc:mga0qj67_364472_c1 | |||
| 3124 | nmdc:mga06r32_163204_c1 | |||
| 3125 | nmdc:mga06r32_262122_c1 | |||
| 3126 | nmdc:mga06r32_702455_c1 | |||
| 3127 | nmdc:mga08y16_107169_c1 | |||
| 3128 | nmdc:mga08y16_376843_c1 | |||
| 3129 | nmdc:mga08y16_941299_c1 | |||
| 3130 | nmdc:mga0n895_56037_c1 | |||
| 3131 | nmdc:mga0n895_90972_c1 | |||
| 3132 | nmdc:mga0rr50_153180_c1 | |||
| 3133 | nmdc:mga0rr50_89406_c1 | |||
| 3134 | nmdc:mga08x19_1111876_c1 | |||
| 3135 | nmdc:mga0a205_279421_c1 | |||
| 3136 | nmdc:mga0a205_82813_c1 | |||
| 3137 | Ga0495601_0002689 | |||
| 3138 | Ga0495601_0070924 | |||
| 3139 | Ga0495601_0071802 | |||
| 3140 | Ga0495601_0105098 | |||
| 3141 | Ga0495601_0128380 | |||
| 3142 | Ga0495601_0132710 | |||
| 3143 | Ga0495601_0179307 | |||
| 3144 | Ga0495601_0210324 | |||
| 3145 | Ga0495612_0007861 | |||
| 3146 | Ga0495612_0038529 | |||
| 3147 | Ga0495655_0011457 | |||
| 3148 | Ga0495655_0196562 | |||
| 3149 | Ga0495595_0087956 | |||
| 3150 | Ga0495595_0217012 | |||
| 3151 | Ga0495595_0534599 | |||
| 3152 | Ga0495595_0745344 | |||
| 3153 | Ga0495619_0005446 | |||
| 3154 | Ga0495619_0006219 | |||
| 3155 | Ga0495619_0081789 | |||
| 3156 | Ga0495619_0087481 | |||
| 3157 | Ga0495619_0088932 | |||
| 3158 | Ga0495619_0129198 | |||
| 3159 | Ga0495619_0191522 | |||
| 3160 | Ga0495619_0571896 | |||
| 3161 | Ga0495619_0605118 | |||
| 3162 | Ga0500566_0036462 | |||
| 3163 | Ga0500566_0524119 | |||
| 3164 | Ga0501084_0001291 | |||
| 3165 | Ga0501084_0102325 | |||
| 3166 | Ga0501084_0628377 | |||
| 3167 | Ga0501084_0635174 | |||
| 3168 | Ga0587083_0067294 | |||
| 3169 | Ga0587106_048776 | |||
| 3170 | Ga0587114_021939 | |||
| 3171 | Ga0587111_0073607 | |||
| 3172 | Ga0587111_0105233 | |||
| 3173 | Ga0501082_0030517 | |||
| 3174 | Ga0501082_0417661 | |||
| 3175 | Ga0501082_0640043 | |||
| 3176 | Ga0501082_0836609 | |||
| 3177 | Ga0466962_0004844 | |||
| 3178 | Ga0466962_0012692 | |||
| 3179 | Ga0466962_0018284 | |||
| 3180 | Ga0466962_0230446 | |||
| 3181 | Ga0466962_0384634 | |||
| 3182 | Ga0530510_0025910 | |||
| 3183 | Ga0530510_0191533 | |||
| 3184 | Ga0530510_0208652 | |||
| 3185 | Ga0530510_0346845 | |||
| 3186 | Ga0530510_0422621 | |||
| 3187 | Ga0530510_0671316 | |||
| 3188 | Ga0530510_0683938 | |||
| 3189 | Ga0530510_1045233 | |||
| 3190 | Ga0530510_1361355 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8cgi-assembly1.cif.gz_G | pentacycline tp038 bound to the 30s head | 0.9807 | 10 | 124 |
| 8ca7-assembly1.cif.gz_G | omadacycline and spectinomycin bound to the 30s ribosomal subunit head | 0.9796 | 14 | 126 |
| 7nhl-assembly1.cif.gz_h | vgaa-lc, an antibiotic resistance abcf, in complex with 70s ribosome from staphylococcus aureus | 0.9743 | 12 | 151 |
| 7nhn-assembly1.cif.gz_h | vgal, an antibiotic resistance abcf, in complex with 70s ribosome from listeria monocytogenes | 0.973 | 12 | 151 |
| 7m4z-assembly1.cif.gz_g | a. baumannii ribosome-eravacycline complex: hpf-bound 70s | 0.9721 | 2 | 150 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5x8rg00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.955 | 4 | 151 | 1.10.455.10 |
| af_P26783_20_225_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9526 | 22 | 148 | 1.10.455.10 |
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9518 | 2 | 156 | 1.10.455.10 |
| 1husA00 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9492 | 10 | 147 | 1.10.455.10 |
| af_P48940_2_156_1.10.455.10 | Mainly Alpha;Orthogonal Bundle;Ribosomal Protein S7;Ribosomal protein S7/S5 | 0.9458 | 2 | 156 | 1.10.455.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Y2PLF6-F1-model_v4 | Ribosomal protein S7 | 0.9881 | 13 | 148 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A355GRF5-F1-model_v4 | 30S ribosomal protein S7 | 0.9877 | 52 | 145 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-A0A2H0WRL7-F1-model_v4 | 30S ribosomal protein S7 | 0.9819 | 3 | 138 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |
| AF-K2ATG9-F1-model_v4 | 30S ribosomal protein S7P RpsG | 0.9783 | 3 | 94 |
GO:0005840
GO:0006412 GO:1990904 |
| AF-A0A7X6UDU5-F1-model_v4 | 30S ribosomal protein S7 | 0.975 | 1 | 139 |
GO:0003735
GO:0006412 GO:0015935 GO:0019843 |