F494897

General Info

Members Datasets Scaffolds Average Seq Length
1582 438 1582 166

Family's Representative Sequence

Representative Sequence 3300005336|Ga0070680_100041046|Ga0070680_1000410462
Length 197
Sequence MSYVNISPSVLLPTFGPGIIFTFVGIKCVIMGAPEFNQLLVSNADFLKPFAITLTRDSEAAKDLFQETLYRAIANKEKYNVGTNIKAWLYTIMRNIFINNYRRKSKQKTIFDASPNDYLLNNSQSAVISDSAESNLRIRDIQGAIHNLPDIFRNPFLLYFDGYKYHEIADMLREPLGTIKSRIHFARKLLKAQIQLF

Samples

Sample ID Description Type Environment
1 2818991444 Filimonas endophytica 3197 Isolate Unclassified
2 2914759650 Rhizosphaericola mali Isolate Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
5 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
6 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300003300 Avena fatua rhizosphere microbial communities - H1_Rhizo_Litter_1 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
9 3300003305 Avena fatua rhizosphere microbial communities - H3_Rhizo_Litter_13 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003579 Grassland soil microbial communities from Hopland, California, USA - Sample H4_Rhizo_45 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
15 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
17 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
18 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
32 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
33 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
34 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
42 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
43 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
44 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
45 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
54 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
74 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
75 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
76 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
77 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
80 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
84 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
85 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
86 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
88 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
89 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
94 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
95 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
96 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
97 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
98 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
99 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
100 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
101 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
102 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
103 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
104 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
105 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
106 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
107 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
108 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
109 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
110 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
111 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
112 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
113 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
114 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
123 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
124 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
125 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
126 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
127 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
128 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
129 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
130 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
132 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
133 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
191 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
192 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
196 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
197 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
198 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
199 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
200 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
201 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
202 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
203 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
204 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
205 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
206 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
207 3300031814 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
213 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
214 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
215 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
216 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
217 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
218 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
219 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
220 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
221 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
222 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
223 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
224 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
225 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
226 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
227 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
229 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
230 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
231 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
232 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
233 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
234 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
235 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
236 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
237 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
238 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
239 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
240 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
241 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
242 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
243 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
244 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
245 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
246 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
247 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
248 3300041916 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaT_extra_run Metatranscriptome Unclassified
249 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
250 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
251 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
252 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
253 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
254 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
255 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
256 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
257 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
258 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
259 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
260 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
261 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
262 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
263 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
264 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
265 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
266 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
267 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
268 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
273 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
274 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
275 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
276 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
277 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
278 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
279 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
280 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
281 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
282 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
283 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
284 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
285 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
286 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
289 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
290 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
291 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
292 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
293 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
294 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
295 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
296 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
297 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
298 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
299 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
300 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
301 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
302 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
303 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
304 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
305 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
306 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
307 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
308 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
309 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
310 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
311 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
312 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
313 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
314 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
315 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
316 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
317 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
318 3300049127 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
319 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
320 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
321 3300049130 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J3_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
322 3300049131 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_B_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
323 3300049132 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
324 3300049133 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
325 3300049160 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
326 3300049161 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_A_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
327 3300049162 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
328 3300049163 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
329 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
330 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
331 3300049527 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_B_0_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
332 3300049528 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
333 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
334 3300049530 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
335 3300049531 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
336 3300049532 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
337 3300049533 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
338 3300049535 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049537 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B12_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300049538 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300049540 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300049550 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
344 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
345 3300049556 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
346 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
351 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
352 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
353 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
354 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
357 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
360 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
361 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
362 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
363 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
364 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
365 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
366 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
367 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
368 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
369 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
370 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
371 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
373 3300050005 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_A_7_drought Metagenome Rhizosphere
374 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
375 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
376 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
377 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
378 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
379 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
380 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
381 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
382 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
383 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
384 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
387 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
388 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
389 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
390 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
391 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
392 3300053126 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 endosphere Metagenome Endosphere
393 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
394 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
395 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
396 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
397 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
398 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
399 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
400 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
401 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
402 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
403 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
404 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
405 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
406 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
407 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
408 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
409 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
410 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059507 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 98R_CW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
423 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059625 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 151R_CD_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059631 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 168R_SD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
431 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
432 3300059648 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 65R_SW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
433 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
434 3300059653 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 145R_CW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
435 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
436 3300059660 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 161R_SW_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
437 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
438 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.28
Metatranscriptomes 8.6
Isolates 0.13

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 4.36
Nodule 0
Rhizoplane 1.58
Rhizosphere 91.09
Stem 0
Stem Tuber 0
Unclassified 2.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 ARSoilOldRDRAFT_c002956 3300000044 Bacteria 1474
2 JGI24740J21852_10017260 3300001979 Bacteria 2585
3 JGI24743J22301_10043241 3300001991 Bacteria 908
4 JGI24744J21845_10044495 3300002077 Bacteria 825
5 JGI24751J29686_10083622 3300002459 Bacteria 662
6 Ga0006758J48902_1010223 3300003300 Bacteria 681
7 Ga0006770J48903_1024384 3300003305 Bacteria 706
8 rootH1_10032312 3300003316 Bacteria 7632
9 rootH1_10183904 3300003316 Bacteria 1324
10 rootH2_10010709 3300003320 Bacteria 8116
11 rootH2_10012234 3300003320 Bacteria 6053
12 rootH2_10013030 3300003320 Bacteria 7264
13 rootH2_10140117 3300003320 Bacteria 1209
14 rootH2_10262330 3300003320 Bacteria 2965
15 rootH2_10299253 3300003320 Bacteria 1136
16 rootL2_10029799 3300003322 Bacteria 5218
17 rootL2_10068385 3300003322 Bacteria 5147
18 rootL2_10358562 3300003322 Bacteria 1500
19 rootH1_10012052 3300003316 Bacteria 7951
20 rootH1_10012052 3300003323 Bacteria 55556
21 rootH1_10021882 3300003323 Bacteria 5598
22 rootH1_10077153 3300003323 Bacteria 2260
23 rootH1_10113418 3300003316 Bacteria 2315
24 rootH1_10113418 3300003323 Bacteria 10728
25 rootH1_10205358 3300003323 Bacteria 3597
26 Ga0007429J51699_1027948 3300003579 Bacteria 620
27 Ga0065714_10111103 3300005288 Bacteria 1475
28 Ga0065712_10095869 3300005290 Bacteria 2192
29 Ga0065715_10185105 3300005293 Bacteria 1450
30 Ga0065715_10330196 3300005293 Bacteria 985
31 Ga0065715_10503462 3300005293 Bacteria 777
32 Ga0065707_10133431 3300005295 Bacteria 1844
33 Ga0070658_10045494 3300005327 Unclassified 3549
34 Ga0070658_10056607 3300005327 Bacteria 3188
35 Ga0070658_10549210 3300005327 Bacteria 1000
36 Ga0070658_11005114 3300005327 Bacteria 725
37 Ga0070676_10002621 3300005328 Bacteria 9253
38 Ga0070676_10004336 3300005328 Bacteria 7453
39 Ga0070676_10051756 3300005328 Bacteria 2412
40 Ga0070676_10085879 3300005328 Bacteria 1918
41 Ga0070676_10088645 3300005328 Bacteria 1891
42 Ga0070676_10124096 3300005328 Unclassified 1625
43 Ga0070676_10237666 3300005328 Bacteria 1210
44 Ga0070683_100001188 3300005329 Bacteria 19784
45 Ga0070683_100017900 3300005329 Bacteria 6264
46 Ga0070683_100042954 3300005329 Bacteria 4164
47 Ga0070683_100430377 3300005329 Bacteria 1259
48 Ga0070683_100622796 3300005329 Bacteria 1033
49 Ga0070690_100004203 3300005330 Bacteria 7967
50 Ga0070690_100078347 3300005330 Bacteria 2159
51 Ga0070690_100226398 3300005330 Bacteria 1312
52 Ga0070690_100579057 3300005330 Bacteria 850
53 Ga0070690_100812064 3300005330 Unclassified 726
54 Ga0070670_100004105 3300005331 Bacteria 12167
55 Ga0070670_100078263 3300005331 Bacteria 2840
56 Ga0070670_100089178 3300005331 Bacteria 2651
57 Ga0070670_100128773 3300005331 Bacteria 2185
58 Ga0070670_100139038 3300005331 Bacteria 2100
59 Ga0070670_100159745 3300005331 Bacteria 1953
60 Ga0070670_100170069 3300005331 Bacteria 1890
61 Ga0070670_100257504 3300005331 Bacteria 1521
62 Ga0070670_100284893 3300005331 Bacteria 1443
63 Ga0070670_100330777 3300005331 Bacteria 1336
64 Ga0070670_100746009 3300005331 Unclassified 882
65 Ga0070670_100762962 3300005331 Bacteria 872
66 Ga0070670_100950710 3300005331 Bacteria 780
67 Ga0070670_101181105 3300005331 Bacteria 699
68 Ga0070677_10073220 3300005333 Bacteria 1447
69 Ga0070677_10087130 3300005333 Bacteria 1350
70 Ga0070677_10237420 3300005333 Bacteria 898
71 Ga0068869_100003261 3300005334 Bacteria 9915
72 Ga0068869_100005652 3300005334 Bacteria 7881
73 Ga0068869_100009654 3300005334 Bacteria 6267
74 Ga0068869_100011899 3300005334 Bacteria 5724
75 Ga0068869_100043566 3300005334 Bacteria 3224
76 Ga0068869_100054291 3300005334 Bacteria 2916
77 Ga0068869_100068795 3300005334 Bacteria 2616
78 Ga0068869_100073099 3300005334 Unclassified 2542
79 Ga0068869_100121653 3300005334 Bacteria 1997
80 Ga0070666_10000050 3300005335 Bacteria 100280
81 Ga0070666_10013296 3300005335 Bacteria 5219
82 Ga0070666_10075155 3300005335 Unclassified 2304
83 Ga0070666_10105517 3300005335 Bacteria 1946
84 Ga0070666_10126016 3300005335 Bacteria 1778
85 Ga0070666_10416283 3300005335 Bacteria 967
86 Ga0070666_10504604 3300005335 Bacteria 877
87 Ga0070666_10584328 3300005335 Bacteria 814
88 Ga0070680_100041046 3300005336 Bacteria 3751
89 Ga0070680_100066036 3300005336 Bacteria 2966
90 Ga0070680_100160066 3300005336 Bacteria 1892
91 Ga0070682_100000019 3300005337 Bacteria 220844
92 Ga0070682_100003137 3300005337 Bacteria 9155
93 Ga0070682_100004566 3300005337 Bacteria 7699
94 Ga0070682_100010606 3300005337 Bacteria 5233
95 Ga0070682_100098274 3300005337 Unclassified 1928
96 Ga0070682_100249292 3300005337 Bacteria 1279
97 Ga0068868_100001389 3300005338 Bacteria 16714
98 Ga0068868_100002193 3300005338 Bacteria 13467
99 Ga0068868_100020680 3300005338 Bacteria 4950
100 Ga0068868_100208769 3300005338 Bacteria 1631
101 Ga0068868_100528593 3300005338 Bacteria 1037
102 Ga0068868_101297443 3300005338 Bacteria 676
103 Ga0068868_101524847 3300005338 Bacteria 626
104 Ga0070660_100030338 3300005339 Bacteria 4056
105 Ga0070660_100095968 3300005339 Unclassified 2344
106 Ga0070660_100172150 3300005339 Bacteria 1749
107 Ga0070660_101057994 3300005339 Unclassified 686
108 Ga0070689_100004250 3300005340 Bacteria 9651
109 Ga0070689_100010789 3300005340 Bacteria 6528
110 Ga0070689_100022658 3300005340 Bacteria 4692
111 Ga0070689_100114036 3300005340 Bacteria 2153
112 Ga0070689_100301205 3300005340 Bacteria 1334
113 Ga0070691_10041815 3300005341 Bacteria 2168
114 Ga0070691_10109066 3300005341 Bacteria 1383
115 Ga0070687_100117034 3300005343 Bacteria 1518
116 Ga0070687_100305408 3300005343 Bacteria 1011
117 Ga0070661_100000521 3300005344 Bacteria 29488
118 Ga0070661_100008647 3300005344 Bacteria 7043
119 Ga0070661_100020346 3300005344 Bacteria 4731
120 Ga0070661_100148133 3300005344 Bacteria 1773
121 Ga0070661_100583596 3300005344 Bacteria 902
122 Ga0070668_100015362 3300005347 Bacteria 5722
123 Ga0070668_100092617 3300005347 Bacteria 2384
124 Ga0070668_100120610 3300005347 Bacteria 2095
125 Ga0070668_100276622 3300005347 Bacteria 1401
126 Ga0070668_100392605 3300005347 Bacteria 1183
127 Ga0070668_100494914 3300005347 Bacteria 1057
128 Ga0070668_101321528 3300005347 Bacteria 656
129 Ga0070669_100007084 3300005353 Bacteria 8054
130 Ga0070669_100064076 3300005353 Unclassified 2706
131 Ga0070669_100228827 3300005353 Bacteria 1473
132 Ga0070669_100271156 3300005353 Bacteria 1357
133 Ga0070669_100682382 3300005353 Bacteria 866
134 Ga0070669_100986643 3300005353 Bacteria 722
135 Ga0070669_101494879 3300005353 Bacteria 587
136 Ga0070675_100009761 3300005354 Bacteria 7476
137 Ga0070675_100053362 3300005354 Bacteria 3325
138 Ga0070675_100095781 3300005354 Bacteria 2493
139 Ga0070675_100451048 3300005354 Bacteria 1153
140 Ga0070675_100645777 3300005354 Bacteria 961
141 Ga0070675_100653155 3300005354 Unclassified 956
142 Ga0070675_100726638 3300005354 Bacteria 905
143 Ga0070675_101036401 3300005354 Unclassified 754
144 Ga0070671_100015427 3300005355 Bacteria 6172
145 Ga0070671_100038053 3300005355 Bacteria 3993
146 Ga0070671_100059111 3300005355 Bacteria 3190
147 Ga0070671_100072533 3300005355 Bacteria 2876
148 Ga0070671_100121636 3300005355 Bacteria 2197
149 Ga0070671_100215932 3300005355 Bacteria 1627
150 Ga0070674_100035222 3300005356 Bacteria 3351
151 Ga0070674_100115713 3300005356 Unclassified 1977
152 Ga0070674_100127185 3300005356 Bacteria 1895
153 Ga0070674_100146462 3300005356 Bacteria 1778
154 Ga0070674_100222072 3300005356 Bacteria 1470
155 Ga0070674_100223381 3300005356 Bacteria 1466
156 Ga0070673_100019908 3300005364 Bacteria 4828
157 Ga0070673_100043192 3300005364 Bacteria 3481
158 Ga0070673_100183060 3300005364 Bacteria 1794
159 Ga0070673_100188551 3300005364 Bacteria 1770
160 Ga0070673_100321768 3300005364 Bacteria 1366
161 Ga0070673_100454444 3300005364 Bacteria 1153
162 Ga0070673_100919470 3300005364 Bacteria 812
163 Ga0070673_101122036 3300005364 Bacteria 735
164 Ga0070688_100000950 3300005365 Bacteria 14486
165 Ga0070688_100221759 3300005365 Bacteria 1333
166 Ga0070688_100377262 3300005365 Bacteria 1044
167 Ga0070688_100386989 3300005365 Unclassified 1032
168 Ga0070688_100421083 3300005365 Bacteria 993
169 Ga0070659_100006321 3300005366 Bacteria 8555
170 Ga0070659_100015108 3300005366 Bacteria 5776
171 Ga0070667_100000240 3300005367 Bacteria 62100
172 Ga0070667_100004077 3300005367 Bacteria 12356
173 Ga0070667_100019648 3300005367 Bacteria 5604
174 Ga0070667_100032749 3300005367 Bacteria 4337
175 Ga0070667_100060370 3300005367 Bacteria 3208
176 Ga0070667_100087983 3300005367 Bacteria 2667
177 Ga0070667_100105447 3300005367 Bacteria 2439
178 Ga0070667_100225565 3300005367 Bacteria 1669
179 Ga0070667_100443397 3300005367 Bacteria 1186
180 Ga0070667_100485482 3300005367 Bacteria 1131
181 Ga0070667_100534574 3300005367 Bacteria 1076
182 Ga0070667_100819055 3300005367 Bacteria 865
183 Ga0070667_100903124 3300005367 Bacteria 822
184 Ga0070701_10666900 3300005438 Bacteria 696
185 Ga0070700_100647491 3300005441 Bacteria 834
186 Ga0070700_100664238 3300005441 Bacteria 824
187 Ga0070663_100545270 3300005455 Bacteria 969
188 Ga0070663_100711789 3300005455 Bacteria 854
189 Ga0070678_100026957 3300005456 Bacteria 3894
190 Ga0070678_100034684 3300005456 Bacteria 3516
191 Ga0070678_100194798 3300005456 Bacteria 1668
192 Ga0070678_100408415 3300005456 Bacteria 1181
193 Ga0070678_100545084 3300005456 Bacteria 1029
194 Ga0070678_100657857 3300005456 Bacteria 940
195 Ga0070662_100011043 3300005457 Bacteria 5947
196 Ga0070662_100068957 3300005457 Unclassified 2601
197 Ga0070662_100084868 3300005457 Bacteria 2366
198 Ga0070662_100127760 3300005457 Bacteria 1956
199 Ga0070662_100297892 3300005457 Bacteria 1309
200 Ga0070681_10035416 3300005458 Bacteria 5014
201 Ga0070681_10040017 3300005458 Bacteria 4700
202 Ga0070681_10073049 3300005458 Bacteria 3392
203 Ga0070681_10241122 3300005458 Bacteria 1721
204 Ga0070681_10272292 3300005458 Unclassified 1605
205 Ga0070681_11250561 3300005458 Bacteria 665
206 Ga0068867_100007586 3300005459 Bacteria 7677
207 Ga0068867_100027529 3300005459 Bacteria 4086
208 Ga0068867_100054642 3300005459 Unclassified 2950
209 Ga0068867_100124969 3300005459 Bacteria 1992
210 Ga0068867_100126218 3300005459 Bacteria 1983
211 Ga0068867_100256063 3300005459 Bacteria 1425
212 Ga0068867_100303354 3300005459 Bacteria 1317
213 Ga0068867_100313999 3300005459 Bacteria 1296
214 Ga0068867_100681821 3300005459 Bacteria 905
215 Ga0068867_100692973 3300005459 Bacteria 898
216 Ga0070685_10011927 3300005466 Bacteria 4557
217 Ga0070685_10043939 3300005466 Bacteria 2556
218 Ga0070685_10044583 3300005466 Bacteria 2539
219 Ga0070685_10252501 3300005466 Bacteria 1169
220 Ga0070698_100038199 3300005471 Bacteria 4947
221 Ga0070698_100646882 3300005471 Bacteria 998
222 Ga0070679_100028954 3300005530 Bacteria 5463
223 Ga0070679_100402634 3300005530 Bacteria 1314
224 Ga0070684_100001055 3300005535 Bacteria 19689
225 Ga0070684_100009989 3300005535 Bacteria 7504
226 Ga0070684_100083885 3300005535 Bacteria 2824
227 Ga0070684_100405921 3300005535 Bacteria 1256
228 Ga0070684_101223109 3300005535 Bacteria 706
229 Ga0068853_100000422 3300005539 Bacteria 28780
230 Ga0068853_100005510 3300005539 Bacteria 9925
231 Ga0068853_100009975 3300005539 Bacteria 7670
232 Ga0068853_100023984 3300005539 Bacteria 5114
233 Ga0068853_100026506 3300005539 Bacteria 4866
234 Ga0068853_100051580 3300005539 Unclassified 3541
235 Ga0068853_100099675 3300005539 Bacteria 2567
236 Ga0068853_100138689 3300005539 Bacteria 2182
237 Ga0068853_100155255 3300005539 Bacteria 2062
238 Ga0068853_100157921 3300005539 Bacteria 2044
239 Ga0068853_100384100 3300005539 Bacteria 1312
240 Ga0068853_100564309 3300005539 Bacteria 1079
241 Ga0068853_100804465 3300005539 Bacteria 900
242 Ga0070672_100013181 3300005543 Bacteria 5831
243 Ga0070672_100017583 3300005543 Bacteria 5150
244 Ga0070672_100045111 3300005543 Bacteria 3407
245 Ga0070672_100048441 3300005543 Bacteria 3302
246 Ga0070672_100142908 3300005543 Bacteria 1975
247 Ga0070672_100413836 3300005543 Bacteria 1157
248 Ga0070672_100569190 3300005543 Bacteria 985
249 Ga0070672_100694463 3300005543 Bacteria 891
250 Ga0070672_101126248 3300005543 Bacteria 698
251 Ga0070686_100095829 3300005544 Bacteria 1994
252 Ga0070686_100116717 3300005544 Bacteria 1827
253 Ga0070686_100300570 3300005544 Bacteria 1190
254 Ga0070686_100330065 3300005544 Bacteria 1140
255 Ga0070693_100050727 3300005547 Bacteria 2373
256 Ga0070693_100088450 3300005547 Bacteria 1862
257 Ga0070693_100218917 3300005547 Bacteria 1246
258 Ga0070665_100000014 3300005548 Bacteria 484881
259 Ga0070665_100010319 3300005548 Bacteria 9448
260 Ga0070665_100063719 3300005548 Bacteria 3696
261 Ga0070665_100350904 3300005548 Bacteria 1481
262 Ga0070665_100410831 3300005548 Bacteria 1362
263 Ga0070665_100840123 3300005548 Bacteria 931
264 Ga0070665_100935316 3300005548 Bacteria 879
265 Ga0070665_100967016 3300005548 Bacteria 864
266 Ga0070704_100372062 3300005549 Bacteria 1212
267 Ga0068855_100000284 3300005563 Bacteria 62592
268 Ga0068855_100014854 3300005563 Bacteria 9377
269 Ga0068855_100022141 3300005563 Bacteria 7616
270 Ga0068855_100047133 3300005563 Bacteria 5093
271 Ga0068855_100071901 3300005563 Unclassified 4021
272 Ga0068855_100184999 3300005563 Bacteria 2353
273 Ga0068855_100281507 3300005563 Bacteria 1846
274 Ga0068855_100624529 3300005563 Unclassified 1160
275 Ga0068855_100933231 3300005563 Bacteria 915
276 Ga0070664_100003640 3300005564 Bacteria 12413
277 Ga0070664_100134641 3300005564 Bacteria 2172
278 Ga0070664_100401548 3300005564 Bacteria 1253
279 Ga0070664_100521208 3300005564 Unclassified 1097
280 Ga0070664_101269385 3300005564 Bacteria 695
281 Ga0068857_100000997 3300005577 Bacteria 21768
282 Ga0068857_100026116 3300005577 Bacteria 5145
283 Ga0068857_100039979 3300005577 Bacteria 4158
284 Ga0068857_100058363 3300005577 Bacteria 3427
285 Ga0068857_100077626 3300005577 Bacteria 2964
286 Ga0068857_100114646 3300005577 Bacteria 2424
287 Ga0068857_100833932 3300005577 Bacteria 882
288 Ga0068857_100867978 3300005577 Bacteria 864
289 Ga0068857_101634986 3300005577 Bacteria 629
290 Ga0068854_100013099 3300005578 Bacteria 5435
291 Ga0068854_100013860 3300005578 Bacteria 5301
292 Ga0068854_100029069 3300005578 Bacteria 3823
293 Ga0068854_100093898 3300005578 Bacteria 2237
294 Ga0068854_100123458 3300005578 Unclassified 1969
295 Ga0068854_100124714 3300005578 Bacteria 1960
296 Ga0068854_100148615 3300005578 Bacteria 1804
297 Ga0068854_100435320 3300005578 Bacteria 1092
298 Ga0068854_100954495 3300005578 Bacteria 756
299 Ga0068854_101256088 3300005578 Unclassified 665
300 Ga0068854_101404214 3300005578 Bacteria 631
301 Ga0068856_100004457 3300005614 Bacteria 13946
302 Ga0068856_100021107 3300005614 Bacteria 6329
303 Ga0068856_100158995 3300005614 Unclassified 2270
304 Ga0068856_100159602 3300005614 Bacteria 2265
305 Ga0068856_100441983 3300005614 Bacteria 1321
306 Ga0068856_100990977 3300005614 Bacteria 859
307 Ga0070702_100626949 3300005615 Bacteria 810
308 Ga0070702_101477493 3300005615 Bacteria 558
309 Ga0068852_100004569 3300005616 Bacteria 9798
310 Ga0068852_100005952 3300005616 Bacteria 8777
311 Ga0068852_100023569 3300005616 Bacteria 4957
312 Ga0068852_100052562 3300005616 Bacteria 3502
313 Ga0068852_100095801 3300005616 Bacteria 2666
314 Ga0068852_100114031 3300005616 Bacteria 2462
315 Ga0068852_100167642 3300005616 Bacteria 2056
316 Ga0068852_100168318 3300005616 Unclassified 2052
317 Ga0068852_100229965 3300005616 Bacteria 1767
318 Ga0068852_100364853 3300005616 Bacteria 1413
319 Ga0068852_100377424 3300005616 Bacteria 1390
320 Ga0068852_100708269 3300005616 Bacteria 1017
321 Ga0068852_100713804 3300005616 Bacteria 1013
322 Ga0068852_100816887 3300005616 Bacteria 947
323 Ga0068852_100848629 3300005616 Bacteria 929
324 Ga0068852_100853406 3300005616 Bacteria 926
325 Ga0068852_101052638 3300005616 Unclassified 833
326 Ga0068859_100000025 3300005617 Bacteria 191679
327 Ga0068859_100011247 3300005617 Bacteria 9003
328 Ga0068859_100021012 3300005617 Bacteria 6552
329 Ga0068859_100037181 3300005617 Bacteria 4886
330 Ga0068859_100043053 3300005617 Bacteria 4537
331 Ga0068859_100097716 3300005617 Bacteria 2989
332 Ga0068859_100150915 3300005617 Bacteria 2399
333 Ga0068859_100167071 3300005617 Bacteria 2280
334 Ga0068859_100204155 3300005617 Bacteria 2061
335 Ga0068859_100231414 3300005617 Bacteria 1936
336 Ga0068859_100374398 3300005617 Unclassified 1520
337 Ga0068859_100395580 3300005617 Bacteria 1477
338 Ga0068859_100553384 3300005617 Bacteria 1245
339 Ga0068859_100767695 3300005617 Bacteria 1052
340 Ga0068859_101377470 3300005617 Bacteria 778
341 Ga0068859_102445076 3300005617 Unclassified 575
342 Ga0068864_100011190 3300005618 Bacteria 7415
343 Ga0068864_100027400 3300005618 Unclassified 4813
344 Ga0068864_100031001 3300005618 Unclassified 4535
345 Ga0068864_100196428 3300005618 Bacteria 1852
346 Ga0068864_100313562 3300005618 Bacteria 1471
347 Ga0068864_100343921 3300005618 Bacteria 1406
348 Ga0068864_100648386 3300005618 Bacteria 1028
349 Ga0068864_100993763 3300005618 Bacteria 832
350 Ga0068864_101058369 3300005618 Bacteria 806
351 Ga0068864_101113970 3300005618 Bacteria 786
352 Ga0068866_10003836 3300005718 Bacteria 6169
353 Ga0068866_10010825 3300005718 Bacteria 3924
354 Ga0068866_10108214 3300005718 Bacteria 1546
355 Ga0068866_10156800 3300005718 Bacteria 1324
356 Ga0068861_100006242 3300005719 Bacteria 8107
357 Ga0068861_100012159 3300005719 Bacteria 5999
358 Ga0068861_100135032 3300005719 Bacteria 2006
359 Ga0068861_100266649 3300005719 Bacteria 1468
360 Ga0068861_100432091 3300005719 Bacteria 1176
361 Ga0068851_10007997 3300005834 Bacteria 4877
362 Ga0068851_10033795 3300005834 Bacteria 2550
363 Ga0068851_10115544 3300005834 Bacteria 1437
364 Ga0068870_10002683 3300005840 Bacteria 7454
365 Ga0068870_10015498 3300005840 Bacteria 3617
366 Ga0068870_10036736 3300005840 Bacteria 2521
367 Ga0068870_10085287 3300005840 Bacteria 1755
368 Ga0068863_100002841 3300005841 Bacteria 17144
369 Ga0068863_100009555 3300005841 Bacteria 9456
370 Ga0068863_100015478 3300005841 Bacteria 7331
371 Ga0068863_100022990 3300005841 Bacteria 5959
372 Ga0068863_100211538 3300005841 Bacteria 1868
373 Ga0068863_100391394 3300005841 Bacteria 1358
374 Ga0068863_100429059 3300005841 Bacteria 1295
375 Ga0068863_100462989 3300005841 Bacteria 1245
376 Ga0068863_101025571 3300005841 Bacteria 828
377 Ga0068858_100042829 3300005842 Bacteria 4197
378 Ga0068858_100045256 3300005842 Bacteria 4077
379 Ga0068858_100099117 3300005842 Bacteria 2717
380 Ga0068858_100311113 3300005842 Bacteria 1504
381 Ga0068858_100323117 3300005842 Bacteria 1475
382 Ga0068858_100370212 3300005842 Bacteria 1374
383 Ga0068858_100438336 3300005842 Unclassified 1258
384 Ga0068858_100654865 3300005842 Bacteria 1021
385 Ga0068858_100698461 3300005842 Bacteria 987
386 Ga0068858_101146589 3300005842 Bacteria 764
387 Ga0068860_100000061 3300005843 Bacteria 192548
388 Ga0068860_100003010 3300005843 Bacteria 17411
389 Ga0068860_100019031 3300005843 Bacteria 6668
390 Ga0068860_100114924 3300005843 Bacteria 2573
391 Ga0068860_100153923 3300005843 Bacteria 2215
392 Ga0068860_100160687 3300005843 Bacteria 2166
393 Ga0068860_100205908 3300005843 Bacteria 1908
394 Ga0068860_100302078 3300005843 Bacteria 1568
395 Ga0068860_100332627 3300005843 Bacteria 1492
396 Ga0068860_100352433 3300005843 Bacteria 1449
397 Ga0068860_100405663 3300005843 Bacteria 1349
398 Ga0068860_100434216 3300005843 Bacteria 1303
399 Ga0068860_100519053 3300005843 Bacteria 1191
400 Ga0068860_100622361 3300005843 Bacteria 1086
401 Ga0068860_100656102 3300005843 Bacteria 1057
402 Ga0068860_100659135 3300005843 Bacteria 1055
403 Ga0068860_100950695 3300005843 Bacteria 876
404 Ga0068860_101308498 3300005843 Bacteria 745
405 Ga0068860_101793729 3300005843 Bacteria 635
406 Ga0068860_101973380 3300005843 Unclassified 605
407 Ga0068862_100023190 3300005844 Bacteria 5197
408 Ga0068862_100029075 3300005844 Bacteria 4655
409 Ga0068862_100250636 3300005844 Bacteria 1613
410 Ga0068862_100252716 3300005844 Unclassified 1607
411 Ga0068862_100313195 3300005844 Bacteria 1447
412 Ga0068862_100728059 3300005844 Bacteria 963
413 Ga0068862_101005248 3300005844 Bacteria 825
414 Ga0068862_101229978 3300005844 Bacteria 748
415 Ga0081540_1024808 3300005983 Bacteria 3469
416 Ga0075364_10439631 3300006051 Bacteria 891
417 Ga0070715_10010886 3300006163 Bacteria 3256
418 Ga0075366_10002847 3300006195 Bacteria 8960
419 Ga0075366_10018639 3300006195 Bacteria 4009
420 Ga0075366_10021764 3300006195 Bacteria 3728
421 Ga0075366_10067537 3300006195 Bacteria 2128
422 Ga0075366_10103210 3300006195 Bacteria 1712
423 Ga0075366_10302664 3300006195 Bacteria 978
424 Ga0075366_10519459 3300006195 Unclassified 737
425 Ga0097621_100000465 3300006237 Bacteria 28387
426 Ga0097621_100007122 3300006237 Bacteria 7973
427 Ga0097621_100011137 3300006237 Bacteria 6617
428 Ga0097621_100022862 3300006237 Bacteria 4858
429 Ga0097621_100048247 3300006237 Bacteria 3454
430 Ga0097621_100055128 3300006237 Bacteria 3245
431 Ga0097621_100100770 3300006237 Bacteria 2430
432 Ga0097621_100113847 3300006237 Bacteria 2288
433 Ga0097621_100147290 3300006237 Bacteria 2017
434 Ga0097621_100160720 3300006237 Bacteria 1931
435 Ga0097621_100204450 3300006237 Bacteria 1716
436 Ga0097621_100478577 3300006237 Bacteria 1125
437 Ga0097621_100724406 3300006237 Bacteria 917
438 Ga0097621_101049945 3300006237 Bacteria 763
439 Ga0097621_101202598 3300006237 Unclassified 714
440 Ga0097621_101379502 3300006237 Bacteria 667
441 Ga0097621_101555984 3300006237 Bacteria 628
442 Ga0068871_100001644 3300006358 Bacteria 15052
443 Ga0068871_100008210 3300006358 Bacteria 7499
444 Ga0068871_100017469 3300006358 Bacteria 5429
445 Ga0068871_100023517 3300006358 Bacteria 4769
446 Ga0068871_100047473 3300006358 Bacteria 3463
447 Ga0068871_100068734 3300006358 Bacteria 2909
448 Ga0068871_100128755 3300006358 Bacteria 2144
449 Ga0068871_100187840 3300006358 Bacteria 1778
450 Ga0068871_100284107 3300006358 Unclassified 1448
451 Ga0068871_100312350 3300006358 Bacteria 1382
452 Ga0068871_100611021 3300006358 Bacteria 992
453 Ga0068871_100613802 3300006358 Bacteria 990
454 Ga0068871_100815909 3300006358 Bacteria 861
455 Ga0068871_100820835 3300006358 Bacteria 858
456 Ga0068871_101009170 3300006358 Unclassified 775
457 Ga0075434_100084958 3300006871 Bacteria 3164
458 Ga0068865_100007033 3300006881 Bacteria 6907
459 Ga0068865_100027470 3300006881 Bacteria 3760
460 Ga0068865_100037175 3300006881 Bacteria 3286
461 Ga0068865_100041865 3300006881 Bacteria 3120
462 Ga0068865_100343549 3300006881 Bacteria 1207
463 Ga0068865_100440478 3300006881 Bacteria 1075
464 Ga0068865_100478164 3300006881 Bacteria 1035
465 Ga0068865_100663977 3300006881 Bacteria 887
466 Ga0068865_100802134 3300006881 Bacteria 812
467 Ga0068865_100866263 3300006881 Bacteria 783
468 Ga0068865_100986991 3300006881 Bacteria 737
469 Ga0097620_100000025 3300006931 Bacteria 191679
470 Ga0097620_100011247 3300006931 Bacteria 9003
471 Ga0097620_100021012 3300006931 Bacteria 6552
472 Ga0097620_100037181 3300006931 Bacteria 4886
473 Ga0097620_100043054 3300006931 Bacteria 4537
474 Ga0097620_100097715 3300006931 Bacteria 2989
475 Ga0097620_100150911 3300006931 Bacteria 2399
476 Ga0097620_100167075 3300006931 Bacteria 2280
477 Ga0097620_100204141 3300006931 Bacteria 2061
478 Ga0097620_100231415 3300006931 Bacteria 1936
479 Ga0097620_100374422 3300006931 Unclassified 1520
480 Ga0097620_100395586 3300006931 Bacteria 1477
481 Ga0097620_100553401 3300006931 Bacteria 1245
482 Ga0097620_100767715 3300006931 Bacteria 1052
483 Ga0097620_101377436 3300006931 Bacteria 778
484 Ga0097620_102445847 3300006931 Unclassified 575
485 Ga0075435_100911868 3300007076 Bacteria 766
486 Ga0099795_10197078 3300007788 Bacteria 848
487 Ga0105251_10121983 3300009011 Bacteria 1183
488 Ga0105251_10488448 3300009011 Unclassified 574
489 Ga0105240_10000198 3300009093 Bacteria 122388
490 Ga0105240_10015994 3300009093 Bacteria 10170
491 Ga0105240_10027122 3300009093 Bacteria 7505
492 Ga0105240_10034622 3300009093 Bacteria 6513
493 Ga0105240_10046395 3300009093 Bacteria 5506
494 Ga0105240_10049957 3300009093 Bacteria 5275
495 Ga0105240_10098017 3300009093 Bacteria 3571
496 Ga0105240_10114329 3300009093 Bacteria 3260
497 Ga0105240_10154049 3300009093 Bacteria 2735
498 Ga0105240_10344372 3300009093 Bacteria 1692
499 Ga0105240_10514428 3300009093 Bacteria 1329
500 Ga0105240_10514890 3300009093 Bacteria 1328
501 Ga0111539_10001644 3300009094 Bacteria 29841
502 Ga0111539_10444323 3300009094 Bacteria 1510
503 Ga0111539_10824223 3300009094 Bacteria 1080
504 Ga0105245_10349519 3300009098 Bacteria 1464
505 Ga0105247_10002225 3300009101 Bacteria 13361
506 Ga0105247_10005450 3300009101 Bacteria 8017
507 Ga0105247_10050542 3300009101 Bacteria 2558
508 Ga0105247_10059813 3300009101 Unclassified 2360
509 Ga0105247_10290865 3300009101 Bacteria 1130
510 Ga0105247_10727643 3300009101 Bacteria 750
511 Ga0114129_10072767 3300009147 Bacteria 4791
512 Ga0105243_10452829 3300009148 Bacteria 1205
513 Ga0105243_10667404 3300009148 Unclassified 1009
514 Ga0105243_11120059 3300009148 Unclassified 796
515 Ga0105241_10002300 3300009174 Bacteria 14357
516 Ga0105241_10006585 3300009174 Bacteria 8557
517 Ga0105241_10006947 3300009174 Bacteria 8332
518 Ga0105241_10083775 3300009174 Bacteria 2502
519 Ga0105241_10302383 3300009174 Bacteria 1373
520 Ga0105241_10427724 3300009174 Bacteria 1167
521 Ga0105241_10488066 3300009174 Bacteria 1096
522 Ga0105241_10731076 3300009174 Bacteria 906
523 Ga0105241_11040507 3300009174 Bacteria 768
524 Ga0105241_11413056 3300009174 Bacteria 667
525 Ga0105242_10032792 3300009176 Bacteria 4155
526 Ga0105242_10082475 3300009176 Unclassified 2691
527 Ga0105242_10224094 3300009176 Bacteria 1682
528 Ga0105242_10503567 3300009176 Bacteria 1152
529 Ga0105242_10836365 3300009176 Bacteria 915
530 Ga0105242_10850890 3300009176 Bacteria 908
531 Ga0105242_10883030 3300009176 Bacteria 892
532 Ga0105242_11136377 3300009176 Bacteria 797
533 Ga0105242_11759863 3300009176 Bacteria 657
534 Ga0105248_10027947 3300009177 Bacteria 6281
535 Ga0105248_10060553 3300009177 Unclassified 4250
536 Ga0105248_10591575 3300009177 Bacteria 1252
537 Ga0105248_10811422 3300009177 Bacteria 1056
538 Ga0105248_11124136 3300009177 Bacteria 888
539 Ga0105237_10000409 3300009545 Bacteria 61096
540 Ga0105237_10000577 3300009545 Bacteria 51264
541 Ga0105237_10005234 3300009545 Bacteria 14676
542 Ga0105237_10005617 3300009545 Bacteria 14137
543 Ga0105237_10006807 3300009545 Bacteria 12603
544 Ga0105237_10009021 3300009545 Bacteria 10719
545 Ga0105237_10010186 3300009545 Bacteria 10017
546 Ga0105237_10010415 3300009545 Bacteria 9893
547 Ga0105237_10120174 3300009545 Bacteria 2621
548 Ga0105237_10129325 3300009545 Bacteria 2520
549 Ga0105237_10483019 3300009545 Bacteria 1245
550 Ga0105237_10809517 3300009545 Bacteria 944
551 Ga0105237_10969481 3300009545 Bacteria 857
552 Ga0105237_11173636 3300009545 Bacteria 774
553 Ga0105237_11818588 3300009545 Bacteria 617
554 Ga0105238_10007301 3300009551 Bacteria 11064
555 Ga0105238_10084102 3300009551 Bacteria 3171
556 Ga0105238_10098761 3300009551 Bacteria 2903
557 Ga0105238_10170233 3300009551 Bacteria 2154
558 Ga0105249_10020448 3300009553 Bacteria 5917
559 Ga0105249_10021479 3300009553 Bacteria 5779
560 Ga0105249_10032930 3300009553 Bacteria 4691
561 Ga0105249_10049926 3300009553 Bacteria 3815
562 Ga0105249_10110043 3300009553 Bacteria 2603
563 Ga0105249_10112374 3300009553 Bacteria 2576
564 Ga0105249_10121976 3300009553 Bacteria 2478
565 Ga0105249_10169249 3300009553 Bacteria 2118
566 Ga0105249_10176424 3300009553 Bacteria 2076
567 Ga0105249_10181883 3300009553 Unclassified 2046
568 Ga0105249_10383106 3300009553 Bacteria 1433
569 Ga0105249_10608287 3300009553 Bacteria 1148
570 Ga0105249_11227097 3300009553 Bacteria 821
571 Ga0105249_12666249 3300009553 Bacteria 572
572 Ga0105239_10000019 3300010375 Bacteria 273836
573 Ga0105239_10000343 3300010375 Bacteria 67956
574 Ga0105239_10000659 3300010375 Bacteria 49123
575 Ga0105239_10001227 3300010375 Bacteria 34941
576 Ga0105239_10005439 3300010375 Bacteria 14944
577 Ga0105239_10014750 3300010375 Bacteria 8665
578 Ga0105239_10041485 3300010375 Bacteria 5043
579 Ga0105239_10053665 3300010375 Bacteria 4421
580 Ga0105239_10093829 3300010375 Bacteria 3314
581 Ga0105239_10120279 3300010375 Bacteria 2916
582 Ga0105239_10191856 3300010375 Bacteria 2287
583 Ga0105239_10253293 3300010375 Bacteria 1978
584 Ga0105239_10265527 3300010375 Bacteria 1930
585 Ga0105239_10305490 3300010375 Bacteria 1792
586 Ga0105239_10560199 3300010375 Bacteria 1302
587 Ga0105239_10599380 3300010375 Bacteria 1257
588 Ga0105239_11129094 3300010375 Bacteria 902
589 Ga0105246_10032151 3300011119 Bacteria 3478
590 Ga0105246_10084639 3300011119 Bacteria 2269
591 Ga0105246_10127719 3300011119 Bacteria 1894
592 Ga0105246_10130463 3300011119 Bacteria 1877
593 Ga0105246_10329089 3300011119 Unclassified 1244
594 Ga0105246_10512057 3300011119 Bacteria 1021
595 Ga0157373_10007794 3300013100 Bacteria 7960
596 Ga0157373_10008801 3300013100 Bacteria 7478
597 Ga0157373_10011698 3300013100 Bacteria 6444
598 Ga0157373_10483018 3300013100 Bacteria 894
599 Ga0157371_10029953 3300013102 Bacteria 3929
600 Ga0157371_10357213 3300013102 Bacteria 1064
601 Ga0157370_10002115 3300013104 Bacteria 24264
602 Ga0157370_10010926 3300013104 Bacteria 9533
603 Ga0157370_10012060 3300013104 Bacteria 8996
604 Ga0157370_10100635 3300013104 Bacteria 2708
605 Ga0157370_10307518 3300013104 Unclassified 1463
606 Ga0157370_10757721 3300013104 Bacteria 884
607 Ga0157370_11023994 3300013104 Unclassified 747
608 Ga0157370_11267000 3300013104 Bacteria 664
609 Ga0157369_10008539 3300013105 Bacteria 11746
610 Ga0157369_10023988 3300013105 Bacteria 6786
611 Ga0157369_10044786 3300013105 Bacteria 4815
612 Ga0157369_10311980 3300013105 Bacteria 1635
613 Ga0157369_10980657 3300013105 Unclassified 865
614 Ga0157369_11156009 3300013105 Unclassified 790
615 Ga0157374_10000011 3300013296 Bacteria 466749
616 Ga0157374_10003749 3300013296 Bacteria 12771
617 Ga0157374_10004107 3300013296 Bacteria 12225
618 Ga0157374_10004768 3300013296 Bacteria 11371
619 Ga0157374_10012057 3300013296 Bacteria 7505
620 Ga0157374_10025377 3300013296 Bacteria 5321
621 Ga0157374_10028328 3300013296 Bacteria 5061
622 Ga0157374_10036793 3300013296 Bacteria 4487
623 Ga0157374_10046057 3300013296 Bacteria 4037
624 Ga0157374_10080774 3300013296 Bacteria 3084
625 Ga0157374_10107499 3300013296 Unclassified 2681
626 Ga0157374_10169500 3300013296 Bacteria 2129
627 Ga0157374_10833283 3300013296 Unclassified 939
628 Ga0157374_10929497 3300013296 Bacteria 888
629 Ga0157374_10962872 3300013296 Bacteria 872
630 Ga0157374_11113769 3300013296 Bacteria 810
631 Ga0157378_10002905 3300013297 Bacteria 15257
632 Ga0157378_10012666 3300013297 Bacteria 7378
633 Ga0157378_10035819 3300013297 Unclassified 4392
634 Ga0157378_10044839 3300013297 Bacteria 3928
635 Ga0157378_10089113 3300013297 Bacteria 2801
636 Ga0157378_10095139 3300013297 Bacteria 2713
637 Ga0157378_10120123 3300013297 Bacteria 2421
638 Ga0157378_10139797 3300013297 Bacteria 2248
639 Ga0157378_10189621 3300013297 Unclassified 1938
640 Ga0157378_10209824 3300013297 Unclassified 1846
641 Ga0157378_10220287 3300013297 Bacteria 1804
642 Ga0157378_10223040 3300013297 Unclassified 1793
643 Ga0157378_10225657 3300013297 Unclassified 1783
644 Ga0157378_10275097 3300013297 Bacteria 1621
645 Ga0157378_10789674 3300013297 Bacteria 975
646 Ga0163162_10000151 3300013306 Bacteria 64454
647 Ga0163162_10000344 3300013306 Bacteria 42218
648 Ga0163162_10000782 3300013306 Bacteria 29601
649 Ga0163162_10000827 3300013306 Bacteria 28791
650 Ga0163162_10002957 3300013306 Bacteria 16219
651 Ga0163162_10010911 3300013306 Bacteria 8846
652 Ga0163162_10014906 3300013306 Bacteria 7590
653 Ga0163162_10021159 3300013306 Bacteria 6399
654 Ga0163162_10068998 3300013306 Bacteria 3587
655 Ga0163162_10089929 3300013306 Bacteria 3151
656 Ga0163162_10136540 3300013306 Bacteria 2563
657 Ga0163162_10251118 3300013306 Bacteria 1901
658 Ga0163162_10263138 3300013306 Bacteria 1856
659 Ga0163162_10575924 3300013306 Bacteria 1253
660 Ga0163162_10796723 3300013306 Bacteria 1062
661 Ga0163162_10852866 3300013306 Bacteria 1026
662 Ga0163162_11086642 3300013306 Bacteria 906
663 Ga0163162_11122652 3300013306 Bacteria 891
664 Ga0163162_11122755 3300013306 Unclassified 891
665 Ga0163162_11584769 3300013306 Bacteria 747
666 Ga0163162_11584770 3300013306 Bacteria 747
667 Ga0163162_12417306 3300013306 Bacteria 604
668 Ga0157372_10003342 3300013307 Bacteria 17320
669 Ga0157372_10050769 3300013307 Bacteria 4614
670 Ga0157372_10056150 3300013307 Bacteria 4399
671 Ga0157372_10098575 3300013307 Bacteria 3334
672 Ga0157372_10127461 3300013307 Unclassified 2926
673 Ga0157372_10216330 3300013307 Unclassified 2221
674 Ga0157372_10220399 3300013307 Bacteria 2199
675 Ga0157372_10715884 3300013307 Unclassified 1165
676 Ga0157372_10847590 3300013307 Bacteria 1061
677 Ga0157372_11669407 3300013307 Unclassified 733
678 Ga0157375_10000911 3300013308 Bacteria 25700
679 Ga0157375_10003934 3300013308 Bacteria 12883
680 Ga0157375_10052035 3300013308 Bacteria 4024
681 Ga0157375_10060880 3300013308 Bacteria 3746
682 Ga0157375_10103328 3300013308 Unclassified 2936
683 Ga0157375_10137861 3300013308 Unclassified 2565
684 Ga0157375_10202726 3300013308 Bacteria 2140
685 Ga0157375_10251467 3300013308 Bacteria 1928
686 Ga0157375_10257424 3300013308 Bacteria 1907
687 Ga0157375_10390622 3300013308 Bacteria 1558
688 Ga0157375_10875850 3300013308 Bacteria 1043
689 Ga0157375_11423458 3300013308 Bacteria 817
690 Ga0157375_13006033 3300013308 Unclassified 563
691 Ga0163163_10000215 3300014325 Bacteria 60028
692 Ga0163163_10007541 3300014325 Bacteria 9606
693 Ga0163163_10011287 3300014325 Bacteria 8096
694 Ga0163163_10090713 3300014325 Bacteria 3070
695 Ga0163163_10147060 3300014325 Bacteria 2401
696 Ga0163163_10189538 3300014325 Bacteria 2105
697 Ga0163163_10226380 3300014325 Bacteria 1919
698 Ga0163163_10259849 3300014325 Bacteria 1787
699 Ga0163163_10314707 3300014325 Bacteria 1619
700 Ga0163163_10336472 3300014325 Bacteria 1564
701 Ga0163163_10809863 3300014325 Bacteria 1000
702 Ga0163163_10951994 3300014325 Unclassified 922
703 Ga0163163_10955758 3300014325 Bacteria 920
704 Ga0163163_11219158 3300014325 Bacteria 815
705 Ga0163163_11298999 3300014325 Bacteria 790
706 Ga0157380_10004165 3300014326 Bacteria 9990
707 Ga0157380_10015686 3300014326 Bacteria 5571
708 Ga0157380_10057056 3300014326 Unclassified 3108
709 Ga0157380_10253140 3300014326 Bacteria 1595
710 Ga0157380_10276805 3300014326 Bacteria 1533
711 Ga0157380_10296999 3300014326 Bacteria 1486
712 Ga0157380_10451809 3300014326 Bacteria 1234
713 Ga0157380_10863772 3300014326 Bacteria 928
714 Ga0157380_11101733 3300014326 Bacteria 833
715 Ga0157380_11466641 3300014326 Bacteria 734
716 Ga0157377_10005894 3300014745 Bacteria 5799
717 Ga0157377_10091088 3300014745 Bacteria 1801
718 Ga0157377_10104700 3300014745 Unclassified 1692
719 Ga0157377_10207421 3300014745 Unclassified 1248
720 Ga0157377_10261232 3300014745 Bacteria 1127
721 Ga0157377_10714477 3300014745 Bacteria 729
722 Ga0157379_10001465 3300014968 Bacteria 19448
723 Ga0157379_10025037 3300014968 Bacteria 5298
724 Ga0157379_10085296 3300014968 Bacteria 2830
725 Ga0157379_10132218 3300014968 Bacteria 2246
726 Ga0157379_10147775 3300014968 Bacteria 2119
727 Ga0157379_10154542 3300014968 Bacteria 2070
728 Ga0157379_10184606 3300014968 Bacteria 1884
729 Ga0157379_10226909 3300014968 Bacteria 1693
730 Ga0157379_10252836 3300014968 Bacteria 1600
731 Ga0157379_10380509 3300014968 Bacteria 1295
732 Ga0157379_10418814 3300014968 Bacteria 1233
733 Ga0157379_10814892 3300014968 Bacteria 882
734 Ga0157376_10003091 3300014969 Bacteria 11426
735 Ga0157376_10003806 3300014969 Bacteria 10437
736 Ga0157376_10009971 3300014969 Bacteria 6932
737 Ga0157376_10033522 3300014969 Bacteria 4135
738 Ga0157376_10037872 3300014969 Bacteria 3920
739 Ga0157376_10050256 3300014969 Bacteria 3458
740 Ga0157376_10103479 3300014969 Unclassified 2493
741 Ga0157376_10183788 3300014969 Bacteria 1913
742 Ga0157376_10211903 3300014969 Bacteria 1789
743 Ga0157376_10537169 3300014969 Unclassified 1155
744 Ga0157376_10676587 3300014969 Bacteria 1035
745 Ga0157376_11363165 3300014969 Bacteria 740
746 Ga0157376_11844482 3300014969 Bacteria 641
747 Ga0163161_10006068 3300017792 Bacteria 8374
748 Ga0163161_10015639 3300017792 Bacteria 5292
749 Ga0163161_10017879 3300017792 Bacteria 4967
750 Ga0163161_10022905 3300017792 Bacteria 4401
751 Ga0163161_10034766 3300017792 Bacteria 3605
752 Ga0163161_10063649 3300017792 Bacteria 2689
753 Ga0163161_10190044 3300017792 Unclassified 1578
754 Ga0163161_10192794 3300017792 Bacteria 1567
755 Ga0163161_10227210 3300017792 Bacteria 1447
756 Ga0163161_10386491 3300017792 Bacteria 1119
757 Ga0163161_10487437 3300017792 Bacteria 1002
758 Ga0163161_10605179 3300017792 Bacteria 904
759 Ga0197907_10995076 3300020069 Bacteria 786
760 Ga0197907_11045296 3300020069 Bacteria 1000
761 Ga0197907_11115152 3300020069 Bacteria 1423
762 Ga0206356_10869258 3300020070 Bacteria 1996
763 Ga0206356_11038156 3300020070 Bacteria 715
764 Ga0206356_11208083 3300020070 Bacteria 807
765 Ga0206356_11287791 3300020070 Unclassified 689
766 Ga0206356_11576714 3300020070 Bacteria 578
767 Ga0206356_11620720 3300020070 Bacteria 899
768 Ga0206349_1234662 3300020075 Bacteria 900
769 Ga0206349_1272832 3300020075 Bacteria 1515
770 Ga0206349_1793318 3300020075 Bacteria 701
771 Ga0206355_1288808 3300020076 Bacteria 787
772 Ga0206355_1701830 3300020076 Bacteria 707
773 Ga0206351_10840370 3300020077 Bacteria 901
774 Ga0206351_10857268 3300020077 Unclassified 826
775 Ga0206352_10259686 3300020078 Bacteria 736
776 Ga0206352_10359923 3300020078 Unclassified 2094
777 Ga0206352_10615519 3300020078 Bacteria 635
778 Ga0206352_10977901 3300020078 Unclassified 839
779 Ga0206352_11013407 3300020078 Bacteria 1033
780 Ga0206352_11155741 3300020078 Bacteria 1200
781 Ga0206350_10482065 3300020080 Bacteria 657
782 Ga0206350_10497323 3300020080 Bacteria 851
783 Ga0206350_10802927 3300020080 Bacteria 702
784 Ga0206350_11247711 3300020080 Unclassified 1748
785 Ga0206350_11629336 3300020080 Bacteria 641
786 Ga0206354_10457372 3300020081 Bacteria 1067
787 Ga0206354_10909307 3300020081 Bacteria 576
788 Ga0206354_11042613 3300020081 Bacteria 962
789 Ga0206353_11122960 3300020082 Bacteria 1064
790 Ga0206353_12050348 3300020082 Bacteria 719
791 Ga0154015_1552988 3300020610 Unclassified 984
792 Ga0213876_10005782 3300021384 Bacteria 6773
793 Ga0224712_10040477 3300022467 Unclassified 1754
794 Ga0224712_10117179 3300022467 Bacteria 1149
795 Ga0209646_1002933 3300025246 Bacteria 3550
796 Ga0207673_1038215 3300025290 Bacteria 672
797 Ga0207697_10105069 3300025315 Bacteria 1206
798 Ga0207656_10012744 3300025321 Bacteria 3202
799 Ga0207656_10130031 3300025321 Bacteria 1179
800 Ga0207656_10144775 3300025321 Bacteria 1122
801 Ga0207656_10285700 3300025321 Bacteria 814
802 Ga0207713_1098921 3300025735 Bacteria 1010
803 Ga0207682_10057890 3300025893 Bacteria 1617
804 Ga0207682_10062397 3300025893 Bacteria 1562
805 Ga0207682_10078561 3300025893 Bacteria 1410
806 Ga0207642_10093236 3300025899 Unclassified 1493
807 Ga0207642_10321094 3300025899 Bacteria 904
808 Ga0207642_10391464 3300025899 Bacteria 829
809 Ga0207642_10730793 3300025899 Bacteria 626
810 Ga0207710_10010275 3300025900 Bacteria 3940
811 Ga0207710_10204929 3300025900 Bacteria 975
812 Ga0207688_10052388 3300025901 Bacteria 2287
813 Ga0207680_10000032 3300025903 Bacteria 77485
814 Ga0207680_10001858 3300025903 Bacteria 9924
815 Ga0207680_10065662 3300025903 Bacteria 2229
816 Ga0207680_10173601 3300025903 Bacteria 1453
817 Ga0207680_10270317 3300025903 Bacteria 1179
818 Ga0207680_10695424 3300025903 Unclassified 729
819 Ga0207680_10770023 3300025903 Unclassified 690
820 Ga0207647_10008403 3300025904 Bacteria 7405
821 Ga0207647_10015067 3300025904 Bacteria 5313
822 Ga0207647_10020104 3300025904 Bacteria 4482
823 Ga0207647_10084937 3300025904 Bacteria 1894
824 Ga0207647_10499755 3300025904 Bacteria 678
825 Ga0207645_10001037 3300025907 Bacteria 22957
826 Ga0207645_10015523 3300025907 Bacteria 5057
827 Ga0207645_10017482 3300025907 Bacteria 4733
828 Ga0207645_10020806 3300025907 Unclassified 4287
829 Ga0207645_10047256 3300025907 Bacteria 2748
830 Ga0207645_10051420 3300025907 Bacteria 2633
831 Ga0207645_10136914 3300025907 Bacteria 1595
832 Ga0207643_10032899 3300025908 Bacteria 2899
833 Ga0207643_10037977 3300025908 Bacteria 2704
834 Ga0207643_10061490 3300025908 Bacteria 2145
835 Ga0207643_10241248 3300025908 Bacteria 1111
836 Ga0207705_10018695 3300025909 Bacteria 4958
837 Ga0207705_10081762 3300025909 Bacteria 2355
838 Ga0207705_10084378 3300025909 Bacteria 2319
839 Ga0207654_10003193 3300025911 Bacteria 8286
840 Ga0207654_10011353 3300025911 Bacteria 4545
841 Ga0207654_10051196 3300025911 Bacteria 2376
842 Ga0207654_10298556 3300025911 Bacteria 1095
843 Ga0207654_10339453 3300025911 Bacteria 1032
844 Ga0207707_10012036 3300025912 Bacteria 7521
845 Ga0207707_10049929 3300025912 Bacteria 3645
846 Ga0207707_10176805 3300025912 Bacteria 1865
847 Ga0207695_10000212 3300025913 Bacteria 156450
848 Ga0207695_10000346 3300025913 Bacteria 107028
849 Ga0207695_10001638 3300025913 Bacteria 36175
850 Ga0207695_10050880 3300025913 Bacteria 4355
851 Ga0207695_10054308 3300025913 Bacteria 4185
852 Ga0207695_10062575 3300025913 Bacteria 3841
853 Ga0207695_10079628 3300025913 Bacteria 3320
854 Ga0207695_10996822 3300025913 Bacteria 717
855 Ga0207671_10000402 3300025914 Bacteria 60371
856 Ga0207671_10001317 3300025914 Bacteria 29052
857 Ga0207671_10002977 3300025914 Bacteria 17383
858 Ga0207671_10013351 3300025914 Bacteria 6545
859 Ga0207671_10013961 3300025914 Bacteria 6374
860 Ga0207671_10071447 3300025914 Bacteria 2589
861 Ga0207671_10093965 3300025914 Bacteria 2263
862 Ga0207671_10115538 3300025914 Bacteria 2046
863 Ga0207671_10226165 3300025914 Bacteria 1467
864 Ga0207671_10713587 3300025914 Bacteria 797
865 Ga0207671_10896111 3300025914 Bacteria 701
866 Ga0207660_10084322 3300025917 Bacteria 2342
867 Ga0207660_10129589 3300025917 Bacteria 1919
868 Ga0207662_10107448 3300025918 Bacteria 1736
869 Ga0207662_10143487 3300025918 Bacteria 1514
870 Ga0207662_10252308 3300025918 Bacteria 1158
871 Ga0207657_10004720 3300025919 Bacteria 14380
872 Ga0207657_10353903 3300025919 Bacteria 1158
873 Ga0207657_10363098 3300025919 Bacteria 1141
874 Ga0207649_10001499 3300025920 Bacteria 13709
875 Ga0207649_10054800 3300025920 Bacteria 2483
876 Ga0207649_10112777 3300025920 Bacteria 1820
877 Ga0207649_10524291 3300025920 Bacteria 904
878 Ga0207649_10810143 3300025920 Bacteria 731
879 Ga0207649_11281419 3300025920 Bacteria 580
880 Ga0207652_10292723 3300025921 Bacteria 1469
881 Ga0207681_10069963 3300025923 Bacteria 2443
882 Ga0207681_10090697 3300025923 Unclassified 2182
883 Ga0207681_10248616 3300025923 Bacteria 1387
884 Ga0207681_10299388 3300025923 Bacteria 1272
885 Ga0207681_10804460 3300025923 Bacteria 785
886 Ga0207681_11121260 3300025923 Bacteria 661
887 Ga0207681_11228748 3300025923 Bacteria 629
888 Ga0207694_10006626 3300025924 Bacteria 8801
889 Ga0207694_10180164 3300025924 Bacteria 1713
890 Ga0207694_10307992 3300025924 Bacteria 1305
891 Ga0207694_10517761 3300025924 Bacteria 999
892 Ga0207650_10018439 3300025925 Bacteria 4898
893 Ga0207650_10064928 3300025925 Bacteria 2733
894 Ga0207650_10088885 3300025925 Bacteria 2357
895 Ga0207650_10136667 3300025925 Bacteria 1923
896 Ga0207650_10182983 3300025925 Bacteria 1671
897 Ga0207650_10193656 3300025925 Bacteria 1625
898 Ga0207650_10212060 3300025925 Bacteria 1555
899 Ga0207650_10247907 3300025925 Bacteria 1441
900 Ga0207650_10314320 3300025925 Bacteria 1282
901 Ga0207650_10621260 3300025925 Bacteria 909
902 Ga0207650_11455151 3300025925 Bacteria 583
903 Ga0207659_10005427 3300025926 Bacteria 7726
904 Ga0207659_10022872 3300025926 Bacteria 4167
905 Ga0207659_10064313 3300025926 Bacteria 2654
906 Ga0207659_10131521 3300025926 Bacteria 1932
907 Ga0207659_10141105 3300025926 Bacteria 1870
908 Ga0207659_10633080 3300025926 Bacteria 913
909 Ga0207659_10750568 3300025926 Unclassified 837
910 Ga0207659_10986683 3300025926 Bacteria 725
911 Ga0207644_10011068 3300025931 Bacteria 5959
912 Ga0207644_10049616 3300025931 Bacteria 3006
913 Ga0207644_10056362 3300025931 Bacteria 2836
914 Ga0207644_10058563 3300025931 Bacteria 2785
915 Ga0207644_10253986 3300025931 Bacteria 1404
916 Ga0207644_10413004 3300025931 Bacteria 1105
917 Ga0207644_10657001 3300025931 Bacteria 873
918 Ga0207690_10081996 3300025932 Bacteria 2255
919 Ga0207690_10359899 3300025932 Unclassified 1152
920 Ga0207706_10019629 3300025933 Bacteria 6080
921 Ga0207706_10024662 3300025933 Bacteria 5390
922 Ga0207706_10032960 3300025933 Bacteria 4610
923 Ga0207706_10051313 3300025933 Bacteria 3642
924 Ga0207706_10052481 3300025933 Bacteria 3600
925 Ga0207706_10058898 3300025933 Bacteria 3383
926 Ga0207706_10189648 3300025933 Bacteria 1805
927 Ga0207686_10047655 3300025934 Bacteria 2650
928 Ga0207686_10110306 3300025934 Bacteria 1854
929 Ga0207686_10247829 3300025934 Bacteria 1300
930 Ga0207686_10976831 3300025934 Bacteria 686
931 Ga0207709_10404473 3300025935 Unclassified 1044
932 Ga0207670_10002959 3300025936 Bacteria 8969
933 Ga0207670_10060183 3300025936 Bacteria 2586
934 Ga0207670_10344085 3300025936 Bacteria 1179
935 Ga0207669_10100583 3300025937 Unclassified 1910
936 Ga0207669_10124225 3300025937 Bacteria 1759
937 Ga0207669_10204591 3300025937 Unclassified 1436
938 Ga0207669_10366340 3300025937 Bacteria 1118
939 Ga0207669_10477447 3300025937 Bacteria 993
940 Ga0207704_10017234 3300025938 Bacteria 3738
941 Ga0207704_10052814 3300025938 Bacteria 2466
942 Ga0207704_10104999 3300025938 Bacteria 1894
943 Ga0207704_10105173 3300025938 Unclassified 1893
944 Ga0207704_10163266 3300025938 Bacteria 1588
945 Ga0207704_10329125 3300025938 Bacteria 1181
946 Ga0207704_10354290 3300025938 Bacteria 1144
947 Ga0207704_10374328 3300025938 Bacteria 1116
948 Ga0207704_10834726 3300025938 Bacteria 771
949 Ga0207691_10000076 3300025940 Bacteria 83005
950 Ga0207691_10050794 3300025940 Bacteria 3794
951 Ga0207691_10054463 3300025940 Bacteria 3648
952 Ga0207691_10058866 3300025940 Bacteria 3494
953 Ga0207691_10065911 3300025940 Bacteria 3277
954 Ga0207691_10083028 3300025940 Bacteria 2877
955 Ga0207691_10233946 3300025940 Bacteria 1590
956 Ga0207691_10282896 3300025940 Bacteria 1427
957 Ga0207691_10392539 3300025940 Bacteria 1184
958 Ga0207691_10593283 3300025940 Bacteria 938
959 Ga0207691_10951916 3300025940 Bacteria 718
960 Ga0207711_10047631 3300025941 Bacteria 3666
961 Ga0207711_10335400 3300025941 Bacteria 1399
962 Ga0207711_10649584 3300025941 Bacteria 984
963 Ga0207711_11107212 3300025941 Bacteria 733
964 Ga0207689_10001853 3300025942 Bacteria 20012
965 Ga0207689_10002225 3300025942 Bacteria 18170
966 Ga0207689_10003970 3300025942 Bacteria 13455
967 Ga0207689_10009828 3300025942 Bacteria 8245
968 Ga0207689_10013487 3300025942 Bacteria 6981
969 Ga0207689_10016179 3300025942 Bacteria 6316
970 Ga0207689_10030548 3300025942 Unclassified 4490
971 Ga0207689_10065690 3300025942 Unclassified 2984
972 Ga0207689_10082022 3300025942 Unclassified 2651
973 Ga0207689_10083732 3300025942 Bacteria 2622
974 Ga0207689_10092853 3300025942 Bacteria 2479
975 Ga0207689_10095473 3300025942 Bacteria 2442
976 Ga0207689_10114825 3300025942 Bacteria 2213
977 Ga0207689_10318562 3300025942 Bacteria 1290
978 Ga0207661_10007676 3300025944 Bacteria 7676
979 Ga0207661_10074126 3300025944 Bacteria 2790
980 Ga0207661_10134065 3300025944 Bacteria 2125
981 Ga0207661_10204533 3300025944 Unclassified 1737
982 Ga0207661_10435425 3300025944 Bacteria 1192
983 Ga0207679_10000159 3300025945 Bacteria 55990
984 Ga0207679_10011961 3300025945 Bacteria 5640
985 Ga0207679_10091755 3300025945 Bacteria 2351
986 Ga0207679_10439790 3300025945 Bacteria 1155
987 Ga0207679_10488798 3300025945 Unclassified 1097
988 Ga0207679_10775443 3300025945 Bacteria 873
989 Ga0207679_11071114 3300025945 Bacteria 739
990 Ga0207667_10000414 3300025949 Bacteria 57815
991 Ga0207667_10006159 3300025949 Bacteria 14576
992 Ga0207667_10006640 3300025949 Bacteria 13981
993 Ga0207667_10018745 3300025949 Bacteria 7750
994 Ga0207667_10043492 3300025949 Bacteria 4766
995 Ga0207667_10179079 3300025949 Bacteria 2177
996 Ga0207667_10456143 3300025949 Bacteria 1299
997 Ga0207667_10953695 3300025949 Bacteria 847
998 Ga0207651_10006374 3300025960 Bacteria 6171
999 Ga0207651_10067155 3300025960 Bacteria 2522
1000 Ga0207651_10084255 3300025960 Bacteria 2302
1001 Ga0207651_10084359 3300025960 Unclassified 2301
1002 Ga0207651_10155585 3300025960 Bacteria 1785
1003 Ga0207651_10245204 3300025960 Bacteria 1463
1004 Ga0207651_10317385 3300025960 Bacteria 1301
1005 Ga0207651_10323206 3300025960 Bacteria 1290
1006 Ga0207651_10473966 3300025960 Bacteria 1078
1007 Ga0207651_11013462 3300025960 Bacteria 742
1008 Ga0207712_10010020 3300025961 Bacteria 6007
1009 Ga0207712_10066018 3300025961 Bacteria 2585
1010 Ga0207712_10080961 3300025961 Bacteria 2363
1011 Ga0207712_10119385 3300025961 Bacteria 1992
1012 Ga0207712_10169635 3300025961 Bacteria 1704
1013 Ga0207712_10172080 3300025961 Bacteria 1694
1014 Ga0207712_10188807 3300025961 Unclassified 1625
1015 Ga0207712_10204977 3300025961 Bacteria 1566
1016 Ga0207712_10232661 3300025961 Bacteria 1480
1017 Ga0207712_10372763 3300025961 Unclassified 1192
1018 Ga0207668_10044565 3300025972 Unclassified 3019
1019 Ga0207668_10109202 3300025972 Bacteria 2072
1020 Ga0207668_10121465 3300025972 Unclassified 1979
1021 Ga0207668_10166582 3300025972 Bacteria 1723
1022 Ga0207668_10310758 3300025972 Unclassified 1304
1023 Ga0207668_10364071 3300025972 Bacteria 1212
1024 Ga0207668_10455724 3300025972 Bacteria 1092
1025 Ga0207668_11216751 3300025972 Bacteria 677
1026 Ga0207640_10010753 3300025981 Bacteria 5163
1027 Ga0207640_10099604 3300025981 Bacteria 2034
1028 Ga0207640_10160459 3300025981 Bacteria 1663
1029 Ga0207640_10184971 3300025981 Bacteria 1566
1030 Ga0207640_10389178 3300025981 Bacteria 1132
1031 Ga0207640_10567969 3300025981 Bacteria 956
1032 Ga0207640_10967919 3300025981 Bacteria 747
1033 Ga0207640_11076881 3300025981 Bacteria 710
1034 Ga0207658_10008424 3300025986 Bacteria 7019
1035 Ga0207658_10066629 3300025986 Bacteria 2709
1036 Ga0207658_10120749 3300025986 Bacteria 2089
1037 Ga0207658_10286395 3300025986 Bacteria 1414
1038 Ga0207658_10293237 3300025986 Bacteria 1399
1039 Ga0207658_10306699 3300025986 Bacteria 1370
1040 Ga0207658_10309279 3300025986 Bacteria 1364
1041 Ga0207658_10337813 3300025986 Bacteria 1308
1042 Ga0207658_10411796 3300025986 Bacteria 1190
1043 Ga0207658_10678139 3300025986 Bacteria 930
1044 Ga0207658_10810434 3300025986 Bacteria 850
1045 Ga0207658_10840490 3300025986 Bacteria 835
1046 Ga0207658_11078671 3300025986 Bacteria 733
1047 Ga0207677_10003307 3300026023 Bacteria 8525
1048 Ga0207677_10043994 3300026023 Unclassified 2972
1049 Ga0207677_10054520 3300026023 Bacteria 2729
1050 Ga0207677_10062680 3300026023 Bacteria 2580
1051 Ga0207677_10074356 3300026023 Unclassified 2411
1052 Ga0207677_10183855 3300026023 Bacteria 1646
1053 Ga0207677_10807523 3300026023 Bacteria 840
1054 Ga0207677_11051138 3300026023 Bacteria 740
1055 Ga0207677_11261764 3300026023 Bacteria 678
1056 Ga0207703_10051094 3300026035 Bacteria 3349
1057 Ga0207703_10144851 3300026035 Unclassified 2065
1058 Ga0207703_10172139 3300026035 Bacteria 1905
1059 Ga0207703_10255085 3300026035 Bacteria 1583
1060 Ga0207703_10314055 3300026035 Bacteria 1433
1061 Ga0207703_10400728 3300026035 Unclassified 1273
1062 Ga0207703_10612624 3300026035 Bacteria 1031
1063 Ga0207703_10657660 3300026035 Bacteria 994
1064 Ga0207703_11058663 3300026035 Bacteria 779
1065 Ga0207639_10003794 3300026041 Bacteria 10171
1066 Ga0207639_10067276 3300026041 Bacteria 2787
1067 Ga0207639_10083233 3300026041 Bacteria 2539
1068 Ga0207639_10167410 3300026041 Bacteria 1858
1069 Ga0207639_10211589 3300026041 Bacteria 1669
1070 Ga0207639_10229390 3300026041 Bacteria 1608
1071 Ga0207639_10242431 3300026041 Bacteria 1568
1072 Ga0207639_10244092 3300026041 Bacteria 1563
1073 Ga0207639_10338536 3300026041 Bacteria 1341
1074 Ga0207639_10536705 3300026041 Bacteria 1073
1075 Ga0207678_10271375 3300026067 Bacteria 1455
1076 Ga0207678_10514694 3300026067 Bacteria 1044
1077 Ga0207678_10979479 3300026067 Unclassified 748
1078 Ga0207708_10597580 3300026075 Unclassified 934
1079 Ga0207702_10020850 3300026078 Bacteria 5422
1080 Ga0207702_10080465 3300026078 Bacteria 2827
1081 Ga0207702_10759369 3300026078 Bacteria 957
1082 Ga0207641_10000111 3300026088 Bacteria 120527
1083 Ga0207641_10000661 3300026088 Bacteria 37590
1084 Ga0207641_10033650 3300026088 Bacteria 4258
1085 Ga0207641_10138975 3300026088 Bacteria 2189
1086 Ga0207641_10240177 3300026088 Bacteria 1688
1087 Ga0207641_10335249 3300026088 Bacteria 1438
1088 Ga0207641_10363845 3300026088 Bacteria 1382
1089 Ga0207641_10439788 3300026088 Bacteria 1259
1090 Ga0207641_10468528 3300026088 Bacteria 1219
1091 Ga0207641_10767568 3300026088 Bacteria 952
1092 Ga0207641_10886595 3300026088 Bacteria 885
1093 Ga0207648_10001550 3300026089 Bacteria 25309
1094 Ga0207648_10002106 3300026089 Bacteria 21685
1095 Ga0207648_10002777 3300026089 Bacteria 18581
1096 Ga0207648_10021535 3300026089 Bacteria 5794
1097 Ga0207648_10082006 3300026089 Bacteria 2812
1098 Ga0207648_10118716 3300026089 Bacteria 2324
1099 Ga0207648_10188889 3300026089 Bacteria 1825
1100 Ga0207648_10224355 3300026089 Bacteria 1671
1101 Ga0207648_10533323 3300026089 Bacteria 1076
1102 Ga0207648_10537286 3300026089 Bacteria 1073
1103 Ga0207648_10618409 3300026089 Bacteria 999
1104 Ga0207648_10641433 3300026089 Bacteria 981
1105 Ga0207648_10837418 3300026089 Bacteria 858
1106 Ga0207676_10050667 3300026095 Unclassified 3238
1107 Ga0207676_10053119 3300026095 Bacteria 3170
1108 Ga0207676_10065397 3300026095 Bacteria 2895
1109 Ga0207676_10093940 3300026095 Bacteria 2470
1110 Ga0207676_10511272 3300026095 Bacteria 1142
1111 Ga0207676_10521235 3300026095 Bacteria 1131
1112 Ga0207676_10606465 3300026095 Bacteria 1052
1113 Ga0207676_10650081 3300026095 Bacteria 1017
1114 Ga0207676_10718557 3300026095 Bacteria 969
1115 Ga0207676_12089784 3300026095 Bacteria 565
1116 Ga0207674_10003288 3300026116 Bacteria 19877
1117 Ga0207674_10003475 3300026116 Bacteria 19268
1118 Ga0207674_10048957 3300026116 Bacteria 4323
1119 Ga0207674_10083735 3300026116 Unclassified 3188
1120 Ga0207674_10095134 3300026116 Bacteria 2965
1121 Ga0207674_10107427 3300026116 Bacteria 2768
1122 Ga0207674_10147535 3300026116 Bacteria 2310
1123 Ga0207674_10230182 3300026116 Bacteria 1801
1124 Ga0207674_10682528 3300026116 Bacteria 992
1125 Ga0207675_100001864 3300026118 Bacteria 21105
1126 Ga0207675_100009737 3300026118 Bacteria 8998
1127 Ga0207675_100015472 3300026118 Bacteria 7116
1128 Ga0207675_100068468 3300026118 Unclassified 3317
1129 Ga0207675_100192217 3300026118 Bacteria 1958
1130 Ga0207675_100229178 3300026118 Bacteria 1792
1131 Ga0207675_100531824 3300026118 Bacteria 1173
1132 Ga0207675_100839473 3300026118 Bacteria 933
1133 Ga0207675_101028849 3300026118 Bacteria 842
1134 Ga0207675_101044009 3300026118 Unclassified 836
1135 Ga0207675_101077052 3300026118 Bacteria 823
1136 Ga0207675_101177511 3300026118 Bacteria 787
1137 Ga0207675_102263589 3300026118 Bacteria 558
1138 Ga0207683_10003417 3300026121 Bacteria 13829
1139 Ga0207683_10010127 3300026121 Bacteria 8044
1140 Ga0207683_10054465 3300026121 Bacteria 3508
1141 Ga0207683_10068803 3300026121 Bacteria 3126
1142 Ga0207683_10112602 3300026121 Bacteria 2437
1143 Ga0207683_10297195 3300026121 Bacteria 1477
1144 Ga0207683_10559009 3300026121 Bacteria 1058
1145 Ga0207683_10581102 3300026121 Bacteria 1036
1146 Ga0207683_10700970 3300026121 Unclassified 939
1147 Ga0207683_11810061 3300026121 Unclassified 560
1148 Ga0207698_10003425 3300026142 Bacteria 9545
1149 Ga0207698_10009487 3300026142 Bacteria 6209
1150 Ga0207698_10021613 3300026142 Bacteria 4455
1151 Ga0207698_10046965 3300026142 Bacteria 3266
1152 Ga0207698_10081677 3300026142 Bacteria 2610
1153 Ga0207698_10182854 3300026142 Unclassified 1859
1154 Ga0207698_10250726 3300026142 Bacteria 1620
1155 Ga0207698_10278190 3300026142 Bacteria 1546
1156 Ga0207698_10319386 3300026142 Bacteria 1453
1157 Ga0207698_10320148 3300026142 Bacteria 1452
1158 Ga0207698_10419572 3300026142 Bacteria 1284
1159 Ga0207698_10517869 3300026142 Bacteria 1163
1160 Ga0207698_10607661 3300026142 Bacteria 1079
1161 Ga0207698_10971626 3300026142 Bacteria 859
1162 Ga0207698_10998083 3300026142 Bacteria 848
1163 Ga0209996_1048052 3300027395 Bacteria 643
1164 Ga0207428_10009365 3300027907 Bacteria 8785
1165 Ga0268266_10000068 3300028379 Bacteria 241100
1166 Ga0268266_10024264 3300028379 Bacteria 5160
1167 Ga0268266_10113619 3300028379 Bacteria 2402
1168 Ga0268266_10365168 3300028379 Bacteria 1359
1169 Ga0268266_10403331 3300028379 Bacteria 1293
1170 Ga0268266_10591881 3300028379 Bacteria 1065
1171 Ga0268266_11890212 3300028379 Bacteria 571
1172 Ga0268265_10006095 3300028380 Bacteria 8186
1173 Ga0268265_10099857 3300028380 Bacteria 2341
1174 Ga0268265_10334141 3300028380 Bacteria 1377
1175 Ga0268265_10341654 3300028380 Unclassified 1363
1176 Ga0268265_10362237 3300028380 Bacteria 1328
1177 Ga0268265_10616475 3300028380 Bacteria 1039
1178 Ga0268265_11817972 3300028380 Bacteria 616
1179 Ga0268264_10000079 3300028381 Bacteria 249516
1180 Ga0268264_10002203 3300028381 Bacteria 17296
1181 Ga0268264_10004438 3300028381 Bacteria 11968
1182 Ga0268264_10008001 3300028381 Bacteria 8792
1183 Ga0268264_10019796 3300028381 Bacteria 5498
1184 Ga0268264_10078043 3300028381 Bacteria 2822
1185 Ga0268264_10113975 3300028381 Bacteria 2373
1186 Ga0268264_10133846 3300028381 Bacteria 2201
1187 Ga0268264_10144967 3300028381 Bacteria 2122
1188 Ga0268264_10230957 3300028381 Unclassified 1709
1189 Ga0268264_10286460 3300028381 Bacteria 1545
1190 Ga0268264_10303017 3300028381 Bacteria 1505
1191 Ga0268264_10310894 3300028381 Bacteria 1487
1192 Ga0268264_10797505 3300028381 Bacteria 943
1193 Ga0268264_10880282 3300028381 Bacteria 898
1194 Ga0268264_11324138 3300028381 Bacteria 730
1195 Ga0307517_10002947 3300028786 Bacteria 26911
1196 Ga0307517_10063397 3300028786 Bacteria 3457
1197 Ga0307515_10000162 3300028794 Bacteria 163720
1198 Ga0265338_10085655 3300028800 Bacteria 2626
1199 Ga0307511_10002426 3300030521 Bacteria 19480
1200 Ga0307512_10242718 3300030522 Bacteria 909
1201 Ga0265762_1028110 3300030760 Bacteria 1058
1202 Ga0265327_10000211 3300031251 Bacteria 121722
1203 Ga0265327_10056221 3300031251 Bacteria 2028
1204 Ga0265327_10164882 3300031251 Bacteria 1021
1205 Ga0307513_10011825 3300031456 Bacteria 10818
1206 Ga0307513_10030364 3300031456 Bacteria 6141
1207 Ga0307513_10424886 3300031456 Bacteria 1058
1208 Ga0307513_10440001 3300031456 Bacteria 1030
1209 Ga0307513_10470463 3300031456 Bacteria 978
1210 Ga0307509_10025814 3300031507 Bacteria 6561
1211 Ga0307509_10068967 3300031507 Bacteria 3698
1212 Ga0307509_10073437 3300031507 Bacteria 3561
1213 Ga0265313_10009958 3300031595 Bacteria 6099
1214 Ga0307508_10000686 3300031616 Bacteria 40604
1215 Ga0307516_10003590 3300031730 Bacteria 19774
1216 Ga0307516_10109739 3300031730 Bacteria 2563
1217 Ga0247548_103414 3300031814 Bacteria 715
1218 Ga0307413_10437849 3300031824 Bacteria 1034
1219 Ga0307410_10032504 3300031852 Unclassified 3359
1220 Ga0307410_10542314 3300031852 Bacteria 963
1221 Ga0307407_10346717 3300031903 Unclassified 1050
1222 Ga0307416_101792331 3300032002 Bacteria 718
1223 Ga0307411_11041394 3300032005 Bacteria 735
1224 Ga0316053_106418 3300032120 Bacteria 765
1225 Ga0307510_10009449 3300033180 Bacteria 11612
1226 Ga0373934_0024384 3300035086 Bacteria 2339
1227 Ga0373952_0031785 3300035092 Unclassified 1175
1228 Ga0373953_0062896 3300035117 Bacteria 1520
1229 Ga0373956_0014883 3300035119 Bacteria 3253
1230 Ga0373943_0200393 3300035170 Bacteria 1105
1231 Ga0373955_0362955 3300035172 Bacteria 878
1232 Ga0373924_0047247 3300035410 Unclassified 1776
1233 Ga0373931_0200936 3300035691 Bacteria 1191
1234 Ga0373935_0188483 3300035692 Bacteria 1420
1235 Ga0373927_0421245 3300035695 Bacteria 881
1236 Ga0373947_0417939 3300035725 Bacteria 906
1237 Ga0373937_1165108 3300036401 Bacteria 719
1238 Ga0265778_009790 3300036457 Bacteria 1083
1239 Ga0395899_0302972 3300037312 Bacteria 1081
1240 Ga0395900_0860640 3300037418 Bacteria 832
1241 Ga0395901_0264140 3300038443 Bacteria 1791
1242 Ga0436365_1006175 3300039437 Bacteria 964
1243 Ga0439436_0001808 3300041404 Bacteria 6298
1244 Ga0439436_0068781 3300041404 Bacteria 988
1245 Ga0439439_0073858 3300041406 Bacteria 916
1246 Ga0451791_0561649 3300041451 Bacteria 1216
1247 Ga0451791_0610277 3300041451 Bacteria 927
1248 Ga0451797_1589118 3300041453 Bacteria 1067
1249 Ga0451795_0658710 3300041456 Bacteria 641
1250 Ga0451800_0870425 3300041459 Bacteria 660
1251 Ga0451802_1270985 3300041460 Bacteria 547
1252 Ga0451804_1163584 3300041463 Bacteria 2034
1253 Ga0451807_2034630 3300041486 Bacteria 634
1254 Ga0451807_2520669 3300041486 Bacteria 929
1255 Ga0451835_0796468 3300041492 Bacteria 644
1256 Ga0451837_0151272 3300041494 Bacteria 663
1257 Ga0451839_0417715 3300041496 Bacteria 730
1258 Ga0451841_0638555 3300041498 Unclassified 624
1259 Ga0451851_1315133 3300041507 Bacteria 1817
1260 Ga0451843_0280491 3300041509 Bacteria 1080
1261 Ga0451853_2369279 3300041512 Bacteria 836
1262 Ga0451853_3113474 3300041512 Bacteria 797
1263 Ga0452271_00284 3300041916 Bacteria 804
1264 Ga0439449_0017943 3300042007 Bacteria 2656
1265 Ga0439454_022306 3300042011 Bacteria 942
1266 Ga0439455_0093612 3300042012 Bacteria 826
1267 Ga0439457_007741 3300042014 Bacteria 2567
1268 Ga0439462_0000316 3300042015 Bacteria 8967
1269 Ga0439462_0016281 3300042015 Bacteria 1921
1270 Ga0450894_003510 3300042131 Bacteria 2049
1271 Ga0439434_0031310 3300042435 Bacteria 1617
1272 Ga0450893_0034783 3300042532 Bacteria 908
1273 Ga0451577_0010418 3300042876 Bacteria 8892
1274 Ga0451577_0077486 3300042876 Bacteria 2964
1275 Ga0451577_0115853 3300042876 Bacteria 2400
1276 Ga0466969_0001839 3300044656 Bacteria 11340
1277 Ga0466972_0000026 3300044658 Bacteria 184739
1278 Ga0466972_0000047 3300044658 Bacteria 122901
1279 Ga0466972_0016295 3300044658 Bacteria 3714
1280 Ga0466972_0020214 3300044658 Unclassified 3327
1281 Ga0466972_0245505 3300044658 Unclassified 837
1282 Ga0453683_0512605 3300044673 Unclassified 779
1283 Ga0466965_0041591 3300044683 Bacteria 2265
1284 Ga0466965_0687980 3300044683 Bacteria 586
1285 Ga0466966_0000047 3300044684 Bacteria 91962
1286 Ga0466961_0143690 3300044693 Bacteria 1493
1287 Ga0466961_0233268 3300044693 Bacteria 1132
1288 Ga0466964_0064418 3300044706 Bacteria 1533
1289 Ga0453684_0457166 3300044712 Bacteria 1420
1290 Ga0453684_0906061 3300044712 Unclassified 944
1291 Ga0466971_0473029 3300044719 Bacteria 616
1292 Ga0466968_0269485 3300044735 Bacteria 812
1293 Ga0466970_0015920 3300044765 Bacteria 3872
1294 Ga0466970_0290958 3300044765 Unclassified 920
1295 Ga0466957_0000937 3300044842 Bacteria 14932
1296 Ga0466957_0023370 3300044842 Bacteria 3655
1297 Ga0466957_0690407 3300044842 Bacteria 720
1298 Ga0466959_0000065 3300045049 Bacteria 73931
1299 Ga0466967_0202462 3300045976 Bacteria 1881
1300 Ga0495592_0143158 3300046454 Bacteria 1660
1301 Ga0495592_0551554 3300046454 Bacteria 709
1302 Ga0495638_0087756 3300046460 Bacteria 1879
1303 Ga0495638_0147545 3300046460 Bacteria 1367
1304 Ga0495638_0437710 3300046460 Bacteria 670
1305 Ga0495653_0072165 3300046463 Bacteria 2579
1306 Ga0495650_0014356 3300046471 Bacteria 4128
1307 Ga0495580_0160391 3300046472 Bacteria 1557
1308 Ga0495582_0279297 3300046473 Bacteria 959
1309 Ga0495594_0474533 3300046499 Bacteria 711
1310 Ga0495608_0142584 3300046511 Bacteria 1529
1311 Ga0495618_0179402 3300046514 Bacteria 1346
1312 Ga0495628_0046468 3300046516 Bacteria 3448
1313 Ga0495630_0043935 3300046517 Bacteria 3339
1314 Ga0495630_0273931 3300046517 Bacteria 1289
1315 Ga0495632_0273517 3300046519 Bacteria 753
1316 Ga0495643_0107254 3300046522 Bacteria 1424
1317 Ga0495648_0003925 3300046524 Bacteria 12873
1318 Ga0495652_0654985 3300046529 Bacteria 711
1319 Ga0495640_0527989 3300046533 Bacteria 717
1320 Ga0495587_0077150 3300046536 Bacteria 1935
1321 Ga0495609_0233480 3300046538 Unclassified 761
1322 Ga0495633_0166331 3300046558 Bacteria 1017
1323 Ga0495668_0001854 3300046616 Bacteria 19009
1324 Ga0495634_0099901 3300046642 Bacteria 1876
1325 Ga0495611_0000435 3300046648 Bacteria 25748
1326 Ga0495611_0054059 3300046648 Bacteria 1814
1327 Ga0495611_0172206 3300046648 Unclassified 1012
1328 Ga0495625_0171459 3300046660 Unclassified 1449
1329 Ga0495625_0235621 3300046660 Bacteria 1194
1330 Ga0495646_0185718 3300046680 Bacteria 1139
1331 Ga0495647_0183159 3300046681 Bacteria 912
1332 Ga0495658_0577004 3300046683 Bacteria 720
1333 Ga0495658_0605059 3300046683 Bacteria 702
1334 Ga0495613_0241201 3300046689 Bacteria 1264
1335 Ga0495670_0284332 3300046691 Bacteria 885
1336 Ga0495649_0020964 3300046694 Bacteria 3663
1337 Ga0495649_0165133 3300046694 Bacteria 1160
1338 Ga0495649_0359783 3300046694 Unclassified 734
1339 Ga0495600_0210469 3300046809 Bacteria 1246
1340 Ga0495674_0516196 3300047319 Unclassified 954
1341 Ga0495672_0032233 3300047320 Bacteria 3263
1342 Ga0495672_0045647 3300047320 Bacteria 2620
1343 Ga0495687_000058 3300047443 Bacteria 185830
1344 Ga0495675_0164974 3300047444 Bacteria 1363
1345 Ga0495686_0000005 3300047472 Bacteria 827143
1346 Ga0495686_0314362 3300047472 Bacteria 860
1347 Ga0495593_0465706 3300047673 Bacteria 633
1348 Ga0496100_0022116 3300048903 Bacteria 3843
1349 Ga0496100_1071295 3300048903 Bacteria 635
1350 Ga0496101_0078704 3300048904 Bacteria 2433
1351 Ga0496102_0431248 3300048905 Bacteria 1238
1352 Ga0496102_0785145 3300048905 Bacteria 875
1353 Ga0496104_0102316 3300048907 Bacteria 2744
1354 Ga0496104_0294681 3300048907 Bacteria 1535
1355 Ga0496104_0562736 3300048907 Bacteria 1051
1356 Ga0496104_0690172 3300048907 Unclassified 929
1357 Ga0496105_0104890 3300048908 Bacteria 2333
1358 Ga0496110_0009120 3300048913 Bacteria 8009
1359 Ga0496110_0583184 3300048913 Bacteria 1015
1360 Ga0496111_0888989 3300048914 Bacteria 642
1361 Ga0496114_0060428 3300048917 Bacteria 3168
1362 Ga0496114_0542910 3300048917 Bacteria 1027
1363 Ga0496115_0311462 3300048918 Bacteria 1289
1364 Ga0496124_0025722 3300048927 Bacteria 5324
1365 Ga0501306_020602 3300049127 Bacteria 918
1366 Ga0501306_023486 3300049127 Bacteria 876
1367 Ga0501306_029430 3300049127 Bacteria 810
1368 Ga0501306_029588 3300049127 Bacteria 808
1369 Ga0501306_073237 3300049127 Bacteria 581
1370 Ga0501306_076822 3300049127 Bacteria 571
1371 Ga0501306_095068 3300049127 Bacteria 527
1372 Ga0501308_015523 3300049128 Bacteria 903
1373 Ga0501308_019267 3300049128 Bacteria 841
1374 Ga0501308_044528 3300049128 Bacteria 634
1375 Ga0501308_048431 3300049128 Bacteria 616
1376 Ga0501308_085917 3300049128 Bacteria 506
1377 Ga0501309_026316 3300049129 Unclassified 839
1378 Ga0501309_045566 3300049129 Bacteria 679
1379 Ga0501309_083157 3300049129 Unclassified 539
1380 Ga0501310_035532 3300049130 Bacteria 677
1381 Ga0501310_038151 3300049130 Bacteria 661
1382 Ga0501341_16378 3300049131 Bacteria 526
1383 Ga0501343_014432 3300049132 Bacteria 667
1384 Ga0501343_017103 3300049132 Bacteria 625
1385 Ga0501343_025956 3300049132 Bacteria 530
1386 Ga0501344_06775 3300049133 Bacteria 666
1387 Ga0501304_009793 3300049160 Bacteria 828
1388 Ga0501304_030658 3300049160 Bacteria 571
1389 Ga0501305_011364 3300049161 Bacteria 1201
1390 Ga0501305_023982 3300049161 Bacteria 916
1391 Ga0501305_060459 3300049161 Bacteria 651
1392 Ga0501307_015588 3300049162 Bacteria 939
1393 Ga0501307_071311 3300049162 Bacteria 554
1394 Ga0501342_04422 3300049163 Bacteria 517
1395 Ga0501290_023419 3300049513 Bacteria 856
1396 Ga0501300_024987 3300049523 Bacteria 875
1397 Ga0501311_039794 3300049527 Bacteria 709
1398 Ga0501311_051601 3300049527 Bacteria 646
1399 Ga0501311_091461 3300049527 Bacteria 529
1400 Ga0501312_020191 3300049528 Bacteria 984
1401 Ga0501312_036407 3300049528 Bacteria 790
1402 Ga0501312_057184 3300049528 Bacteria 669
1403 Ga0501312_082985 3300049528 Bacteria 582
1404 Ga0501313_020182 3300049529 Bacteria 819
1405 Ga0501313_036866 3300049529 Bacteria 648
1406 Ga0501314_019372 3300049530 Bacteria 698
1407 Ga0501314_027304 3300049530 Bacteria 621
1408 Ga0501315_006608 3300049531 Bacteria 1296
1409 Ga0501315_029210 3300049531 Bacteria 786
1410 Ga0501315_034424 3300049531 Bacteria 743
1411 Ga0501315_038411 3300049531 Bacteria 716
1412 Ga0501316_038392 3300049532 Bacteria 661
1413 Ga0501317_023266 3300049533 Bacteria 854
1414 Ga0501317_073580 3300049533 Bacteria 580
1415 Ga0501319_013389 3300049535 Bacteria 680
1416 Ga0501321_032085 3300049537 Bacteria 706
1417 Ga0501321_055231 3300049537 Bacteria 589
1418 Ga0501322_030399 3300049538 Bacteria 508
1419 Ga0501323_068822 3300049539 Bacteria 564
1420 Ga0501324_018982 3300049540 Bacteria 692
1421 Ga0501334_08988 3300049550 Bacteria 706
1422 Ga0501336_013424 3300049552 Bacteria 685
1423 Ga0501336_023667 3300049552 Bacteria 572
1424 Ga0501336_024268 3300049552 Bacteria 568
1425 Ga0501340_011543 3300049556 Bacteria 660
1426 Ga0501031_0011346 3300049568 Bacteria 5804
1427 Ga0501032_0016212 3300049569 Bacteria 5242
1428 Ga0501033_0148587 3300049570 Bacteria 1692
1429 Ga0501034_0000004 3300049571 Bacteria 382255
1430 Ga0501034_0038295 3300049571 Bacteria 4856
1431 Ga0501034_0156703 3300049571 Bacteria 2250
1432 Ga0501034_0221323 3300049571 Bacteria 1845
1433 Ga0501036_0064864 3300049572 Bacteria 3090
1434 Ga0501037_0073362 3300049573 Bacteria 2488
1435 Ga0501037_0094630 3300049573 Bacteria 2160
1436 Ga0501038_0031875 3300049574 Bacteria 4655
1437 Ga0501038_0160713 3300049574 Bacteria 1826
1438 Ga0501038_0341423 3300049574 Bacteria 1168
1439 Ga0501039_0069150 3300049575 Bacteria 2742
1440 Ga0501039_0440216 3300049575 Bacteria 1023
1441 Ga0501042_0667506 3300049578 Bacteria 756
1442 Ga0501043_0182147 3300049579 Bacteria 1636
1443 Ga0501043_0696340 3300049579 Bacteria 742
1444 Ga0501046_0059769 3300049580 Bacteria 2985
1445 Ga0501046_0070301 3300049580 Bacteria 2721
1446 Ga0501047_0104968 3300049581 Bacteria 2706
1447 Ga0501047_0324513 3300049581 Bacteria 1379
1448 Ga0501047_0684518 3300049581 Bacteria 843
1449 Ga0501048_0052768 3300049582 Bacteria 2894
1450 Ga0501048_0166124 3300049582 Bacteria 1563
1451 Ga0501067_0078807 3300049583 Bacteria 1826
1452 Ga0501067_0178652 3300049583 Bacteria 1182
1453 Ga0501067_0605946 3300049583 Bacteria 614
1454 Ga0501068_0116026 3300049584 Bacteria 1668
1455 Ga0501069_0265062 3300049585 Bacteria 1003
1456 Ga0501071_0079981 3300049587 Bacteria 2390
1457 Ga0501072_0378227 3300049588 Bacteria 1124
1458 Ga0501072_0839155 3300049588 Bacteria 719
1459 Ga0501073_0136283 3300049589 Bacteria 1701
1460 Ga0501074_0016995 3300049590 Bacteria 5277
1461 Ga0501225_0004193 3300049705 Bacteria 4309
1462 Ga0501079_1426242 3300049741 Bacteria 545
1463 Ga0501080_0241525 3300049742 Unclassified 1649
1464 Ga0501080_0665087 3300049742 Bacteria 921
1465 Ga0501080_0697459 3300049742 Unclassified 895
1466 Ga0501083_0038490 3300049744 Bacteria 3251
1467 Ga0501083_0066762 3300049744 Unclassified 2395
1468 Ga0501083_0075836 3300049744 Bacteria 2232
1469 Ga0501035_0082386 3300049822 Bacteria 2839
1470 Ga0501035_0216770 3300049822 Bacteria 1636
1471 Ga0501035_0326710 3300049822 Bacteria 1288
1472 Ga0501035_0486912 3300049822 Bacteria 1017
1473 Ga0501035_0488862 3300049822 Bacteria 1014
1474 Ga0501044_0092260 3300049823 Bacteria 3054
1475 Ga0501044_0209997 3300049823 Bacteria 1901
1476 Ga0501044_0709142 3300049823 Bacteria 891
1477 Ga0501044_0846074 3300049823 Bacteria 792
1478 Ga0501204_047562 3300049850 Bacteria 648
1479 Ga0501284_00017 3300050005 Bacteria 96362
1480 nmdc:mga00v17_468702_c1 3300050491 Bacteria 817
1481 nmdc:mga0k408_15433_c1 3300050493 Bacteria 4225
1482 nmdc:mga0k408_173576_c1 3300050493 Bacteria 1285
1483 nmdc:mga0k408_210511_c1 3300050493 Bacteria 1161
1484 nmdc:mga0k408_57726_c1 3300050493 Unclassified 2254
1485 nmdc:mga0k408_60000_c1 3300050493 Bacteria 2210
1486 nmdc:mga0k408_71296_c1 3300050493 Bacteria 2028
1487 nmdc:mga0k408_849998_c1 3300050493 Bacteria 531
1488 nmdc:mga0k408_88131_c1 3300050493 Bacteria 1823
1489 nmdc:mga07m45_285829_c1 3300050496 Bacteria 959
1490 nmdc:mga07m45_424286_c1 3300050496 Bacteria 771
1491 nmdc:mga05p37_450122_c1 3300050507 Bacteria 1491
1492 nmdc:mga08y16_13908_c1 3300050511 Bacteria 8469
1493 nmdc:mga08y16_181367_c1 3300050511 Bacteria 2186
1494 nmdc:mga0n895_26949_c1 3300050512 Bacteria 5452
1495 nmdc:mga0rr50_521263_c1 3300050513 Bacteria 1011
1496 nmdc:mga0rr50_804147_c1 3300050513 Bacteria 802
1497 Ga0500578_0000765 3300053086 Bacteria 37890
1498 Ga0500578_0071393 3300053086 Bacteria 2213
1499 Ga0500578_0461766 3300053086 Bacteria 721
1500 Ga0500643_166056 3300053087 Unclassified 592
1501 Ga0500646_0005187 3300053090 Bacteria 3299
1502 Ga0500646_0023739 3300053090 Unclassified 1647
1503 Ga0500646_0111081 3300053090 Bacteria 871
1504 Ga0500583_0000003 3300053092 Bacteria 229587
1505 Ga0500583_0008462 3300053092 Unclassified 3693
1506 Ga0500583_0242794 3300053092 Bacteria 890
1507 Ga0500641_0008479 3300053096 Bacteria 3670
1508 Ga0500641_0292843 3300053096 Bacteria 671
1509 Ga0500650_0011604 3300053098 Bacteria 3635
1510 Ga0500654_199620 3300053099 Unclassified 605
1511 Ga0500555_002160 3300053103 Bacteria 5763
1512 Ga0500556_0016645 3300053104 Bacteria 2290
1513 Ga0500562_032145 3300053108 Unclassified 1385
1514 Ga0500594_0166233 3300053118 Bacteria 715
1515 Ga0500621_129805 3300053126 Bacteria 967
1516 Ga0500642_0006418 3300053130 Bacteria 3871
1517 Ga0500642_0008766 3300053130 Bacteria 3478
1518 Ga0500642_0176466 3300053130 Bacteria 999
1519 Ga0500642_0291480 3300053130 Bacteria 739
1520 Ga0500652_089437 3300053131 Bacteria 1285
1521 Ga0500652_126792 3300053131 Bacteria 1066
1522 Ga0500655_004076 3300053133 Bacteria 2631
1523 Ga0500655_016378 3300053133 Bacteria 1365
1524 Ga0500658_0092683 3300053134 Bacteria 1309
1525 Ga0500559_0096701 3300053136 Bacteria 1357
1526 Ga0500568_0033671 3300053139 Unclassified 2101
1527 Ga0500568_0136927 3300053139 Bacteria 909
1528 Ga0500573_0318135 3300053140 Bacteria 770
1529 Ga0500588_0000576 3300053146 Bacteria 6002
1530 Ga0500588_0011679 3300053146 Bacteria 2157
1531 Ga0500589_051369 3300053147 Bacteria 1911
1532 Ga0500589_149284 3300053147 Bacteria 953
1533 Ga0500604_0004024 3300053151 Bacteria 3920
1534 Ga0500604_0065920 3300053151 Bacteria 1146
1535 Ga0500604_0066789 3300053151 Bacteria 1140
1536 Ga0500616_0003349 3300053153 Bacteria 12329
1537 Ga0500616_0187851 3300053153 Bacteria 925
1538 Ga0500622_0020789 3300053156 Unclassified 3483
1539 Ga0500622_0046969 3300053156 Bacteria 2230
1540 Ga0500622_0398529 3300053156 Unclassified 559
1541 Ga0500633_0240254 3300053160 Bacteria 674
1542 Ga0500639_102242 3300053163 Bacteria 1408
1543 Ga0500637_0042051 3300053178 Bacteria 2583
1544 Ga0500637_0042775 3300053178 Bacteria 2562
1545 Ga0500637_0199242 3300053178 Bacteria 1141
1546 Ga0500611_000155 3300053727 Bacteria 10865
1547 Ga0501084_0456261 3300054114 Unclassified 1080
1548 Ga0587084_018264 3300059477 Bacteria 1021
1549 Ga0587073_0065816 3300059492 Unclassified 863
1550 Ga0587077_026657 3300059493 Bacteria 1069
1551 Ga0587080_052881 3300059503 Bacteria 772
1552 Ga0587080_058819 3300059503 Bacteria 744
1553 Ga0587082_067543 3300059504 Bacteria 719
1554 Ga0587083_0035801 3300059505 Bacteria 1014
1555 Ga0587085_033012 3300059506 Bacteria 862
1556 Ga0587086_033745 3300059507 Bacteria 765
1557 Ga0587088_014397 3300059508 Bacteria 1231
1558 Ga0587088_058532 3300059508 Bacteria 774
1559 Ga0587088_059318 3300059508 Unclassified 771
1560 Ga0587089_072571 3300059509 Bacteria 587
1561 Ga0587090_018239 3300059510 Bacteria 1070
1562 Ga0587090_105753 3300059510 Bacteria 594
1563 Ga0587098_045543 3300059604 Bacteria 651
1564 Ga0587106_081430 3300059605 Bacteria 631
1565 Ga0587099_027090 3300059622 Bacteria 679
1566 Ga0587101_009100 3300059623 Bacteria 1218
1567 Ga0587109_048730 3300059624 Bacteria 862
1568 Ga0587113_034899 3300059625 Bacteria 584
1569 Ga0587128_049683 3300059630 Bacteria 762
1570 Ga0587130_015633 3300059631 Bacteria 784
1571 Ga0587062_008766 3300059639 Bacteria 1215
1572 Ga0587067_029795 3300059640 Bacteria 999
1573 Ga0587067_081838 3300059640 Bacteria 716
1574 Ga0587076_010100 3300059645 Bacteria 1356
1575 Ga0587100_020743 3300059648 Bacteria 640
1576 Ga0587107_021210 3300059652 Bacteria 908
1577 Ga0587107_083939 3300059652 Bacteria 604
1578 Ga0587108_009588 3300059653 Bacteria 801
1579 Ga0587114_088944 3300059655 Bacteria 586
1580 Ga0587124_023954 3300059660 Bacteria 640
1581 Ga0587111_0050904 3300060346 Bacteria 914
1582 Ga0501082_0531371 3300060353 Bacteria 1028

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300009093 Ga0105240_10514890 Ga0105240_105148901 143
2 3300026095 Ga0207676_12089784 Ga0207676_120897841 143
3 3300049741 Ga0501079_1426242 Ga0501079_1426242_18_455 145
4 3300035092 Ga0373952_0031785 Ga0373952_0031785_335_835 146
5 3300003323 rootH1_10077153 rootH1_100771534 154
6 3300005356 Ga0070674_100222072 Ga0070674_1002220722 154
7 3300005456 Ga0070678_100545084 Ga0070678_1005450841 154
8 3300005459 Ga0068867_100692973 Ga0068867_1006929732 154
9 3300005543 Ga0070672_101126248 Ga0070672_1011262481 154
10 3300014325 Ga0163163_10090713 Ga0163163_100907132 154
11 3300014326 Ga0157380_10004165 Ga0157380_100041659 154
12 3300017792 Ga0163161_10034766 Ga0163161_100347662 154
13 3300025937 Ga0207669_10124225 Ga0207669_101242252 154
14 3300025940 Ga0207691_10951916 Ga0207691_109519161 154
15 3300026089 Ga0207648_10224355 Ga0207648_102243552 154
16 3300049132 Ga0501343_025956 Ga0501343_025956_30_500 156
17 3300049527 Ga0501311_091461 Ga0501311_091461_29_499 156
18 3300049528 Ga0501312_082985 Ga0501312_082985_83_553 156
19 3300049538 Ga0501322_030399 Ga0501322_030399_12_482 156
20 3300049552 Ga0501336_023667 Ga0501336_023667_83_553 156
21 3300025931 Ga0207644_10657001 Ga0207644_106570012 157
22 3300005331 Ga0070670_100170069 Ga0070670_1001700692 158
23 3300005355 Ga0070671_100072533 Ga0070671_1000725332 158
24 3300009176 Ga0105242_11136377 Ga0105242_111363771 158
25 3300025923 Ga0207681_11228748 Ga0207681_112287481 158
26 3300041460 Ga0451802_1270985 Ga0451802_1270985_54_530 158
27 3300041498 Ga0451841_0638555 Ga0451841_0638555_48_524 158
28 3300049127 Ga0501306_076822 Ga0501306_076822_75_551 158
29 3300049127 Ga0501306_095068 Ga0501306_095068_21_497 158
30 3300049128 Ga0501308_085917 Ga0501308_085917_10_486 158
31 3300049129 Ga0501309_083157 Ga0501309_083157_23_502 158
32 3300049131 Ga0501341_16378 Ga0501341_16378_28_504 158
33 3300049132 Ga0501343_017103 Ga0501343_017103_123_599 158
34 3300049161 Ga0501305_060459 Ga0501305_060459_125_601 158
35 3300049163 Ga0501342_04422 Ga0501342_04422_16_492 158
36 3300049513 Ga0501290_023419 Ga0501290_023419_64_540 158
37 3300049523 Ga0501300_024987 Ga0501300_024987_289_765 158
38 3300049529 Ga0501313_036866 Ga0501313_036866_16_492 158
39 3300049530 Ga0501314_027304 Ga0501314_027304_102_578 158
40 3300049537 Ga0501321_055231 Ga0501321_055231_47_523 158
41 3300050005 Ga0501284_00017 Ga0501284_00017_167_643 158
42 3300050493 nmdc:mga0k408_849998_c1 nmdc:mga0k408_849998_c1_45_521 158
43 3300053092 Ga0500583_0242794 Ga0500583_0242794_294_770 158
44 3300053156 Ga0500622_0398529 Ga0500622_0398529_18_494 158
45 3300044658 Ga0466972_0000026 Ga0466972_0000026_127682_128182 159
46 3300044765 Ga0466970_0015920 Ga0466970_0015920_1156_1656 159
47 3300005718 Ga0068866_10108214 Ga0068866_101082142 161
48 3300044683 Ga0466965_0687980 Ga0466965_0687980_49_537 161
49 iso_pu_bacteria 2818991444 2819589768 162
50 3300001991 JGI24743J22301_10043241 JGI24743J22301_100432412 163
51 3300005327 Ga0070658_11005114 Ga0070658_110051141 163
52 3300005329 Ga0070683_100017900 Ga0070683_1000179003 163
53 3300005331 Ga0070670_100330777 Ga0070670_1003307772 163
54 3300005336 Ga0070680_100066036 Ga0070680_1000660362 163
55 3300005337 Ga0070682_100003137 Ga0070682_10000313711 163
56 3300005338 Ga0068868_100528593 Ga0068868_1005285932 163
57 3300005339 Ga0070660_100030338 Ga0070660_1000303383 163
58 3300005344 Ga0070661_100020346 Ga0070661_1000203464 163
59 3300005355 Ga0070671_100038053 Ga0070671_1000380532 163
60 3300005364 Ga0070673_100454444 Ga0070673_1004544442 163
61 3300005366 Ga0070659_100006321 Ga0070659_1000063216 163
62 3300005458 Ga0070681_10241122 Ga0070681_102411221 163
63 3300005530 Ga0070679_100028954 Ga0070679_1000289541 163
64 3300005535 Ga0070684_101223109 Ga0070684_1012231091 163
65 3300005539 Ga0068853_100026506 Ga0068853_1000265065 163
66 3300005544 Ga0070686_100095829 Ga0070686_1000958292 163
67 3300005547 Ga0070693_100088450 Ga0070693_1000884502 163
68 3300005563 Ga0068855_100047133 Ga0068855_1000471333 163
69 3300005577 Ga0068857_100077626 Ga0068857_1000776263 163
70 3300005578 Ga0068854_100954495 Ga0068854_1009544951 163
71 3300005616 Ga0068852_100364853 Ga0068852_1003648532 163
72 3300005616 Ga0068852_100713804 Ga0068852_1007138041 163
73 3300005618 Ga0068864_100343921 Ga0068864_1003439212 163
74 3300005834 Ga0068851_10033795 Ga0068851_100337952 163
75 3300006237 Ga0097621_100100770 Ga0097621_1001007702 163
76 3300006358 Ga0068871_100128755 Ga0068871_1001287552 163
77 3300010375 Ga0105239_10305490 Ga0105239_103054902 163
78 3300013100 Ga0157373_10007794 Ga0157373_100077942 163
79 3300013105 Ga0157369_10023988 Ga0157369_100239885 163
80 3300013296 Ga0157374_10046057 Ga0157374_100460573 163
81 3300013297 Ga0157378_10044839 Ga0157378_100448393 163
82 3300013307 Ga0157372_10220399 Ga0157372_102203992 163
83 3300014325 Ga0163163_11298999 Ga0163163_112989991 163
84 3300014745 Ga0157377_10207421 Ga0157377_102074211 163
85 3300014969 Ga0157376_10050256 Ga0157376_100502561 163
86 3300025321 Ga0207656_10285700 Ga0207656_102857002 163
87 3300025904 Ga0207647_10084937 Ga0207647_100849371 163
88 3300025912 Ga0207707_10176805 Ga0207707_101768052 163
89 3300025919 Ga0207657_10004720 Ga0207657_100047206 163
90 3300025920 Ga0207649_10054800 Ga0207649_100548002 163
91 3300025926 Ga0207659_10064313 Ga0207659_100643131 163
92 3300025931 Ga0207644_10058563 Ga0207644_100585634 163
93 3300025932 Ga0207690_10081996 Ga0207690_100819961 163
94 3300025933 Ga0207706_10189648 Ga0207706_101896482 163
95 3300025944 Ga0207661_10134065 Ga0207661_101340652 163
96 3300025945 Ga0207679_10091755 Ga0207679_100917552 163
97 3300025949 Ga0207667_10043492 Ga0207667_100434921 163
98 3300025960 Ga0207651_10317385 Ga0207651_103173852 163
99 3300026023 Ga0207677_10807523 Ga0207677_108075232 163
100 3300026116 Ga0207674_10095134 Ga0207674_100951343 163
101 3300026142 Ga0207698_10319386 Ga0207698_103193862 163
102 3300045976 Ga0466967_0202462 Ga0466967_0202462_231_728 163
103 3300049850 Ga0501204_047562 Ga0501204_047562_112_603 163
104 iso_pu_bacteria 2914759650 2914763715 163
105 3300003323 rootH1_10113418 rootH1_101134188 165
106 3300003323 rootH1_10205358 rootH1_102053582 165
107 3300007076 Ga0075435_100911868 Ga0075435_1009118682 165
108 3300009176 Ga0105242_10836365 Ga0105242_108363652 165
109 3300026121 Ga0207683_10297195 Ga0207683_102971951 165
110 3300046691 Ga0495670_0284332 Ga0495670_0284332_167_664 165
111 3300050513 nmdc:mga0rr50_804147_c1 nmdc:mga0rr50_804147_c1_176_673 165
112 3300000044 ARSoilOldRDRAFT_c002956 ARSoilOldRDRAFT_0029561 166
113 3300001979 JGI24740J21852_10017260 JGI24740J21852_100172602 166
114 3300002077 JGI24744J21845_10044495 JGI24744J21845_100444951 166
115 3300002459 JGI24751J29686_10083622 JGI24751J29686_100836221 166
116 3300003300 Ga0006758J48902_1010223 Ga0006758J48902_10102231 166
117 3300003305 Ga0006770J48903_1024384 Ga0006770J48903_10243841 166
118 3300003316 rootH1_10032312 rootH1_100323122 166
119 3300003316 rootH1_10183904 rootH1_101839042 166
120 3300003320 rootH2_10010709 rootH2_100107096 166
121 3300003320 rootH2_10012234 rootH2_100122345 166
122 3300003320 rootH2_10013030 rootH2_100130305 166
123 3300003320 rootH2_10140117 rootH2_101401172 166
124 3300003320 rootH2_10262330 rootH2_102623303 166
125 3300003320 rootH2_10299253 rootH2_102992532 166
126 3300003322 rootL2_10029799 rootL2_100297994 166
127 3300003322 rootL2_10068385 rootL2_100683856 166
128 3300003322 rootL2_10358562 rootL2_103585622 166
129 3300003323 rootH1_10012052 rootH1_1001205244 166
130 3300003323 rootH1_10021882 rootH1_100218823 166
131 3300003579 Ga0007429J51699_1027948 Ga0007429J51699_10279481 166
132 3300005288 Ga0065714_10111103 Ga0065714_101111032 166
133 3300005290 Ga0065712_10095869 Ga0065712_100958692 166
134 3300005293 Ga0065715_10185105 Ga0065715_101851052 166
135 3300005293 Ga0065715_10330196 Ga0065715_103301961 166
136 3300005293 Ga0065715_10503462 Ga0065715_105034622 166
137 3300005295 Ga0065707_10133431 Ga0065707_101334312 166
138 3300005327 Ga0070658_10045494 Ga0070658_100454944 166
139 3300005327 Ga0070658_10056607 Ga0070658_100566072 166
140 3300005327 Ga0070658_10549210 Ga0070658_105492102 166
141 3300005328 Ga0070676_10002621 Ga0070676_100026214 166
142 3300005328 Ga0070676_10004336 Ga0070676_100043366 166
143 3300005328 Ga0070676_10051756 Ga0070676_100517563 166
144 3300005328 Ga0070676_10085879 Ga0070676_100858792 166
145 3300005328 Ga0070676_10088645 Ga0070676_100886452 166
146 3300005328 Ga0070676_10124096 Ga0070676_101240962 166
147 3300005328 Ga0070676_10237666 Ga0070676_102376661 166
148 3300005329 Ga0070683_100001188 Ga0070683_1000011888 166
149 3300005329 Ga0070683_100042954 Ga0070683_1000429544 166
150 3300005329 Ga0070683_100430377 Ga0070683_1004303772 166
151 3300005329 Ga0070683_100622796 Ga0070683_1006227961 166
152 3300005330 Ga0070690_100004203 Ga0070690_1000042035 166
153 3300005330 Ga0070690_100078347 Ga0070690_1000783472 166
154 3300005330 Ga0070690_100226398 Ga0070690_1002263982 166
155 3300005330 Ga0070690_100579057 Ga0070690_1005790571 166
156 3300005330 Ga0070690_100812064 Ga0070690_1008120641 166
157 3300005331 Ga0070670_100004105 Ga0070670_1000041055 166
158 3300005331 Ga0070670_100078263 Ga0070670_1000782633 166
159 3300005331 Ga0070670_100089178 Ga0070670_1000891782 166
160 3300005331 Ga0070670_100128773 Ga0070670_1001287732 166
161 3300005331 Ga0070670_100139038 Ga0070670_1001390382 166
162 3300005331 Ga0070670_100159745 Ga0070670_1001597453 166
163 3300005331 Ga0070670_100257504 Ga0070670_1002575042 166
164 3300005331 Ga0070670_100284893 Ga0070670_1002848932 166
165 3300005331 Ga0070670_100746009 Ga0070670_1007460092 166
166 3300005331 Ga0070670_100762962 Ga0070670_1007629621 166
167 3300005331 Ga0070670_100950710 Ga0070670_1009507102 166
168 3300005331 Ga0070670_101181105 Ga0070670_1011811052 166
169 3300005333 Ga0070677_10073220 Ga0070677_100732202 166
170 3300005333 Ga0070677_10087130 Ga0070677_100871302 166
171 3300005333 Ga0070677_10237420 Ga0070677_102374202 166
172 3300005334 Ga0068869_100003261 Ga0068869_1000032614 166
173 3300005334 Ga0068869_100005652 Ga0068869_1000056524 166
174 3300005334 Ga0068869_100009654 Ga0068869_1000096545 166
175 3300005334 Ga0068869_100011899 Ga0068869_1000118995 166
176 3300005334 Ga0068869_100043566 Ga0068869_1000435662 166
177 3300005334 Ga0068869_100054291 Ga0068869_1000542912 166
178 3300005334 Ga0068869_100068795 Ga0068869_1000687953 166
179 3300005334 Ga0068869_100073099 Ga0068869_1000730993 166
180 3300005334 Ga0068869_100121653 Ga0068869_1001216532 166
181 3300005335 Ga0070666_10000050 Ga0070666_1000005075 166
182 3300005335 Ga0070666_10013296 Ga0070666_100132964 166
183 3300005335 Ga0070666_10075155 Ga0070666_100751552 166
184 3300005335 Ga0070666_10105517 Ga0070666_101055172 166
185 3300005335 Ga0070666_10126016 Ga0070666_101260162 166
186 3300005335 Ga0070666_10416283 Ga0070666_104162832 166
187 3300005335 Ga0070666_10504604 Ga0070666_105046041 166
188 3300005335 Ga0070666_10584328 Ga0070666_105843281 166
189 3300005336 Ga0070680_100041046 Ga0070680_1000410462 166
190 3300005336 Ga0070680_100160066 Ga0070680_1001600662 166
191 3300005337 Ga0070682_100000019 Ga0070682_10000001945 166
192 3300005337 Ga0070682_100004566 Ga0070682_1000045664 166
193 3300005337 Ga0070682_100010606 Ga0070682_1000106064 166
194 3300005337 Ga0070682_100098274 Ga0070682_1000982743 166
195 3300005337 Ga0070682_100249292 Ga0070682_1002492922 166
196 3300005338 Ga0068868_100001389 Ga0068868_10000138912 166
197 3300005338 Ga0068868_100002193 Ga0068868_1000021934 166
198 3300005338 Ga0068868_100020680 Ga0068868_1000206802 166
199 3300005338 Ga0068868_100208769 Ga0068868_1002087692 166
200 3300005338 Ga0068868_101297443 Ga0068868_1012974431 166
201 3300005338 Ga0068868_101524847 Ga0068868_1015248471 166
202 3300005339 Ga0070660_100095968 Ga0070660_1000959683 166
203 3300005339 Ga0070660_100172150 Ga0070660_1001721501 166
204 3300005339 Ga0070660_101057994 Ga0070660_1010579941 166
205 3300005340 Ga0070689_100004250 Ga0070689_1000042504 166
206 3300005340 Ga0070689_100010789 Ga0070689_1000107895 166
207 3300005340 Ga0070689_100022658 Ga0070689_1000226582 166
208 3300005340 Ga0070689_100114036 Ga0070689_1001140362 166
209 3300005340 Ga0070689_100301205 Ga0070689_1003012051 166
210 3300005341 Ga0070691_10041815 Ga0070691_100418152 166
211 3300005341 Ga0070691_10109066 Ga0070691_101090662 166
212 3300005343 Ga0070687_100117034 Ga0070687_1001170341 166
213 3300005343 Ga0070687_100305408 Ga0070687_1003054082 166
214 3300005344 Ga0070661_100000521 Ga0070661_10000052116 166
215 3300005344 Ga0070661_100008647 Ga0070661_1000086472 166
216 3300005344 Ga0070661_100148133 Ga0070661_1001481332 166
217 3300005344 Ga0070661_100583596 Ga0070661_1005835962 166
218 3300005347 Ga0070668_100015362 Ga0070668_1000153626 166
219 3300005347 Ga0070668_100092617 Ga0070668_1000926172 166
220 3300005347 Ga0070668_100120610 Ga0070668_1001206103 166
221 3300005347 Ga0070668_100276622 Ga0070668_1002766222 166
222 3300005347 Ga0070668_100392605 Ga0070668_1003926052 166
223 3300005347 Ga0070668_100494914 Ga0070668_1004949142 166
224 3300005347 Ga0070668_101321528 Ga0070668_1013215282 166
225 3300005353 Ga0070669_100007084 Ga0070669_1000070847 166
226 3300005353 Ga0070669_100064076 Ga0070669_1000640762 166
227 3300005353 Ga0070669_100228827 Ga0070669_1002288272 166
228 3300005353 Ga0070669_100271156 Ga0070669_1002711562 166
229 3300005353 Ga0070669_100682382 Ga0070669_1006823821 166
230 3300005353 Ga0070669_100986643 Ga0070669_1009866431 166
231 3300005353 Ga0070669_101494879 Ga0070669_1014948791 166
232 3300005354 Ga0070675_100009761 Ga0070675_1000097617 166
233 3300005354 Ga0070675_100053362 Ga0070675_1000533624 166
234 3300005354 Ga0070675_100095781 Ga0070675_1000957813 166
235 3300005354 Ga0070675_100451048 Ga0070675_1004510482 166
236 3300005354 Ga0070675_100645777 Ga0070675_1006457772 166
237 3300005354 Ga0070675_100653155 Ga0070675_1006531552 166
238 3300005354 Ga0070675_100726638 Ga0070675_1007266381 166
239 3300005354 Ga0070675_101036401 Ga0070675_1010364011 166
240 3300005355 Ga0070671_100015427 Ga0070671_1000154274 166
241 3300005355 Ga0070671_100059111 Ga0070671_1000591112 166
242 3300005355 Ga0070671_100121636 Ga0070671_1001216362 166
243 3300005355 Ga0070671_100215932 Ga0070671_1002159322 166
244 3300005356 Ga0070674_100035222 Ga0070674_1000352224 166
245 3300005356 Ga0070674_100115713 Ga0070674_1001157132 166
246 3300005356 Ga0070674_100127185 Ga0070674_1001271853 166
247 3300005356 Ga0070674_100146462 Ga0070674_1001464622 166
248 3300005356 Ga0070674_100223381 Ga0070674_1002233812 166
249 3300005364 Ga0070673_100019908 Ga0070673_1000199083 166
250 3300005364 Ga0070673_100043192 Ga0070673_1000431921 166
251 3300005364 Ga0070673_100183060 Ga0070673_1001830601 166
252 3300005364 Ga0070673_100188551 Ga0070673_1001885512 166
253 3300005364 Ga0070673_100321768 Ga0070673_1003217682 166
254 3300005364 Ga0070673_100919470 Ga0070673_1009194701 166
255 3300005364 Ga0070673_101122036 Ga0070673_1011220362 166
256 3300005365 Ga0070688_100000950 Ga0070688_10000095012 166
257 3300005365 Ga0070688_100221759 Ga0070688_1002217591 166
258 3300005365 Ga0070688_100377262 Ga0070688_1003772622 166
259 3300005365 Ga0070688_100386989 Ga0070688_1003869891 166
260 3300005365 Ga0070688_100421083 Ga0070688_1004210831 166
261 3300005366 Ga0070659_100015108 Ga0070659_1000151084 166
262 3300005367 Ga0070667_100000240 Ga0070667_10000024043 166
263 3300005367 Ga0070667_100004077 Ga0070667_10000407710 166
264 3300005367 Ga0070667_100019648 Ga0070667_1000196483 166
265 3300005367 Ga0070667_100032749 Ga0070667_1000327491 166
266 3300005367 Ga0070667_100060370 Ga0070667_1000603702 166
267 3300005367 Ga0070667_100087983 Ga0070667_1000879832 166
268 3300005367 Ga0070667_100105447 Ga0070667_1001054473 166
269 3300005367 Ga0070667_100225565 Ga0070667_1002255652 166
270 3300005367 Ga0070667_100443397 Ga0070667_1004433972 166
271 3300005367 Ga0070667_100485482 Ga0070667_1004854821 166
272 3300005367 Ga0070667_100534574 Ga0070667_1005345741 166
273 3300005367 Ga0070667_100819055 Ga0070667_1008190551 166
274 3300005367 Ga0070667_100903124 Ga0070667_1009031241 166
275 3300005438 Ga0070701_10666900 Ga0070701_106669002 166
276 3300005441 Ga0070700_100647491 Ga0070700_1006474912 166
277 3300005441 Ga0070700_100664238 Ga0070700_1006642382 166
278 3300005455 Ga0070663_100545270 Ga0070663_1005452701 166
279 3300005455 Ga0070663_100711789 Ga0070663_1007117891 166
280 3300005456 Ga0070678_100026957 Ga0070678_1000269571 166
281 3300005456 Ga0070678_100034684 Ga0070678_1000346844 166
282 3300005456 Ga0070678_100194798 Ga0070678_1001947982 166
283 3300005456 Ga0070678_100408415 Ga0070678_1004084152 166
284 3300005456 Ga0070678_100657857 Ga0070678_1006578572 166
285 3300005457 Ga0070662_100011043 Ga0070662_1000110434 166
286 3300005457 Ga0070662_100068957 Ga0070662_1000689574 166
287 3300005457 Ga0070662_100084868 Ga0070662_1000848681 166
288 3300005457 Ga0070662_100127760 Ga0070662_1001277602 166
289 3300005457 Ga0070662_100297892 Ga0070662_1002978921 166
290 3300005458 Ga0070681_10035416 Ga0070681_100354164 166
291 3300005458 Ga0070681_10040017 Ga0070681_100400174 166
292 3300005458 Ga0070681_10073049 Ga0070681_100730492 166
293 3300005458 Ga0070681_10272292 Ga0070681_102722922 166
294 3300005458 Ga0070681_11250561 Ga0070681_112505611 166
295 3300005459 Ga0068867_100007586 Ga0068867_1000075867 166
296 3300005459 Ga0068867_100027529 Ga0068867_1000275292 166
297 3300005459 Ga0068867_100054642 Ga0068867_1000546422 166
298 3300005459 Ga0068867_100124969 Ga0068867_1001249692 166
299 3300005459 Ga0068867_100126218 Ga0068867_1001262182 166
300 3300005459 Ga0068867_100256063 Ga0068867_1002560632 166
301 3300005459 Ga0068867_100303354 Ga0068867_1003033542 166
302 3300005459 Ga0068867_100313999 Ga0068867_1003139991 166
303 3300005459 Ga0068867_100681821 Ga0068867_1006818211 166
304 3300005466 Ga0070685_10011927 Ga0070685_100119275 166
305 3300005466 Ga0070685_10043939 Ga0070685_100439392 166
306 3300005466 Ga0070685_10044583 Ga0070685_100445832 166
307 3300005466 Ga0070685_10252501 Ga0070685_102525012 166
308 3300005471 Ga0070698_100038199 Ga0070698_1000381994 166
309 3300005471 Ga0070698_100646882 Ga0070698_1006468821 166
310 3300005530 Ga0070679_100402634 Ga0070679_1004026341 166
311 3300005535 Ga0070684_100001055 Ga0070684_10000105511 166
312 3300005535 Ga0070684_100009989 Ga0070684_1000099898 166
313 3300005535 Ga0070684_100083885 Ga0070684_1000838853 166
314 3300005535 Ga0070684_100405921 Ga0070684_1004059211 166
315 3300005539 Ga0068853_100000422 Ga0068853_1000004228 166
316 3300005539 Ga0068853_100005510 Ga0068853_1000055106 166
317 3300005539 Ga0068853_100009975 Ga0068853_1000099753 166
318 3300005539 Ga0068853_100023984 Ga0068853_1000239842 166
319 3300005539 Ga0068853_100051580 Ga0068853_1000515804 166
320 3300005539 Ga0068853_100099675 Ga0068853_1000996751 166
321 3300005539 Ga0068853_100138689 Ga0068853_1001386892 166
322 3300005539 Ga0068853_100155255 Ga0068853_1001552553 166
323 3300005539 Ga0068853_100157921 Ga0068853_1001579212 166
324 3300005539 Ga0068853_100384100 Ga0068853_1003841001 166
325 3300005539 Ga0068853_100564309 Ga0068853_1005643092 166
326 3300005539 Ga0068853_100804465 Ga0068853_1008044651 166
327 3300005543 Ga0070672_100013181 Ga0070672_1000131812 166
328 3300005543 Ga0070672_100017583 Ga0070672_1000175836 166
329 3300005543 Ga0070672_100045111 Ga0070672_1000451112 166
330 3300005543 Ga0070672_100048441 Ga0070672_1000484412 166
331 3300005543 Ga0070672_100142908 Ga0070672_1001429082 166
332 3300005543 Ga0070672_100413836 Ga0070672_1004138362 166
333 3300005543 Ga0070672_100569190 Ga0070672_1005691902 166
334 3300005543 Ga0070672_100694463 Ga0070672_1006944631 166
335 3300005544 Ga0070686_100116717 Ga0070686_1001167171 166
336 3300005544 Ga0070686_100300570 Ga0070686_1003005702 166
337 3300005544 Ga0070686_100330065 Ga0070686_1003300652 166
338 3300005547 Ga0070693_100050727 Ga0070693_1000507272 166
339 3300005547 Ga0070693_100218917 Ga0070693_1002189173 166
340 3300005548 Ga0070665_100000014 Ga0070665_100000014364 166
341 3300005548 Ga0070665_100010319 Ga0070665_1000103199 166
342 3300005548 Ga0070665_100063719 Ga0070665_1000637194 166
343 3300005548 Ga0070665_100350904 Ga0070665_1003509042 166
344 3300005548 Ga0070665_100410831 Ga0070665_1004108312 166
345 3300005548 Ga0070665_100840123 Ga0070665_1008401232 166
346 3300005548 Ga0070665_100935316 Ga0070665_1009353162 166
347 3300005548 Ga0070665_100967016 Ga0070665_1009670162 166
348 3300005549 Ga0070704_100372062 Ga0070704_1003720621 166
349 3300005563 Ga0068855_100000284 Ga0068855_10000028437 166
350 3300005563 Ga0068855_100014854 Ga0068855_1000148548 166
351 3300005563 Ga0068855_100022141 Ga0068855_1000221416 166
352 3300005563 Ga0068855_100071901 Ga0068855_1000719017 166
353 3300005563 Ga0068855_100184999 Ga0068855_1001849992 166
354 3300005563 Ga0068855_100281507 Ga0068855_1002815072 166
355 3300005563 Ga0068855_100624529 Ga0068855_1006245292 166
356 3300005563 Ga0068855_100933231 Ga0068855_1009332312 166
357 3300005564 Ga0070664_100003640 Ga0070664_1000036408 166
358 3300005564 Ga0070664_100134641 Ga0070664_1001346412 166
359 3300005564 Ga0070664_100401548 Ga0070664_1004015482 166
360 3300005564 Ga0070664_100521208 Ga0070664_1005212082 166
361 3300005564 Ga0070664_101269385 Ga0070664_1012693851 166
362 3300005577 Ga0068857_100000997 Ga0068857_1000009975 166
363 3300005577 Ga0068857_100026116 Ga0068857_1000261162 166
364 3300005577 Ga0068857_100039979 Ga0068857_1000399791 166
365 3300005577 Ga0068857_100058363 Ga0068857_1000583634 166
366 3300005577 Ga0068857_100114646 Ga0068857_1001146462 166
367 3300005577 Ga0068857_100833932 Ga0068857_1008339322 166
368 3300005577 Ga0068857_100867978 Ga0068857_1008679781 166
369 3300005577 Ga0068857_101634986 Ga0068857_1016349861 166
370 3300005578 Ga0068854_100013099 Ga0068854_1000130996 166
371 3300005578 Ga0068854_100013860 Ga0068854_1000138602 166
372 3300005578 Ga0068854_100029069 Ga0068854_1000290694 166
373 3300005578 Ga0068854_100093898 Ga0068854_1000938982 166
374 3300005578 Ga0068854_100123458 Ga0068854_1001234582 166
375 3300005578 Ga0068854_100124714 Ga0068854_1001247142 166
376 3300005578 Ga0068854_100148615 Ga0068854_1001486151 166
377 3300005578 Ga0068854_100435320 Ga0068854_1004353202 166
378 3300005578 Ga0068854_101256088 Ga0068854_1012560881 166
379 3300005578 Ga0068854_101404214 Ga0068854_1014042141 166
380 3300005614 Ga0068856_100004457 Ga0068856_1000044572 166
381 3300005614 Ga0068856_100021107 Ga0068856_1000211077 166
382 3300005614 Ga0068856_100158995 Ga0068856_1001589953 166
383 3300005614 Ga0068856_100159602 Ga0068856_1001596023 166
384 3300005614 Ga0068856_100441983 Ga0068856_1004419832 166
385 3300005614 Ga0068856_100990977 Ga0068856_1009909772 166
386 3300005615 Ga0070702_100626949 Ga0070702_1006269492 166
387 3300005615 Ga0070702_101477493 Ga0070702_1014774931 166
388 3300005616 Ga0068852_100004569 Ga0068852_1000045696 166
389 3300005616 Ga0068852_100005952 Ga0068852_1000059529 166
390 3300005616 Ga0068852_100023569 Ga0068852_1000235694 166
391 3300005616 Ga0068852_100052562 Ga0068852_1000525623 166
392 3300005616 Ga0068852_100095801 Ga0068852_1000958012 166
393 3300005616 Ga0068852_100114031 Ga0068852_1001140314 166
394 3300005616 Ga0068852_100167642 Ga0068852_1001676423 166
395 3300005616 Ga0068852_100168318 Ga0068852_1001683184 166
396 3300005616 Ga0068852_100229965 Ga0068852_1002299651 166
397 3300005616 Ga0068852_100377424 Ga0068852_1003774242 166
398 3300005616 Ga0068852_100708269 Ga0068852_1007082691 166
399 3300005616 Ga0068852_100816887 Ga0068852_1008168872 166
400 3300005616 Ga0068852_100848629 Ga0068852_1008486291 166
401 3300005616 Ga0068852_100853406 Ga0068852_1008534062 166
402 3300005616 Ga0068852_101052638 Ga0068852_1010526382 166
403 3300005617 Ga0068859_100000025 Ga0068859_10000002595 166
404 3300005617 Ga0068859_100011247 Ga0068859_1000112472 166
405 3300005617 Ga0068859_100021012 Ga0068859_1000210127 166
406 3300005617 Ga0068859_100037181 Ga0068859_1000371814 166
407 3300005617 Ga0068859_100043053 Ga0068859_1000430535 166
408 3300005617 Ga0068859_100097716 Ga0068859_1000977162 166
409 3300005617 Ga0068859_100150915 Ga0068859_1001509153 166
410 3300005617 Ga0068859_100167071 Ga0068859_1001670713 166
411 3300005617 Ga0068859_100204155 Ga0068859_1002041552 166
412 3300005617 Ga0068859_100231414 Ga0068859_1002314141 166
413 3300005617 Ga0068859_100374398 Ga0068859_1003743983 166
414 3300005617 Ga0068859_100395580 Ga0068859_1003955802 166
415 3300005617 Ga0068859_100553384 Ga0068859_1005533842 166
416 3300005617 Ga0068859_100767695 Ga0068859_1007676951 166
417 3300005617 Ga0068859_101377470 Ga0068859_1013774702 166
418 3300005617 Ga0068859_102445076 Ga0068859_1024450761 166
419 3300005618 Ga0068864_100011190 Ga0068864_1000111908 166
420 3300005618 Ga0068864_100027400 Ga0068864_1000274004 166
421 3300005618 Ga0068864_100031001 Ga0068864_1000310014 166
422 3300005618 Ga0068864_100196428 Ga0068864_1001964282 166
423 3300005618 Ga0068864_100313562 Ga0068864_1003135621 166
424 3300005618 Ga0068864_100648386 Ga0068864_1006483862 166
425 3300005618 Ga0068864_100993763 Ga0068864_1009937632 166
426 3300005618 Ga0068864_101058369 Ga0068864_1010583692 166
427 3300005618 Ga0068864_101113970 Ga0068864_1011139702 166
428 3300005718 Ga0068866_10003836 Ga0068866_100038364 166
429 3300005718 Ga0068866_10010825 Ga0068866_100108255 166
430 3300005718 Ga0068866_10156800 Ga0068866_101568001 166
431 3300005719 Ga0068861_100006242 Ga0068861_1000062426 166
432 3300005719 Ga0068861_100012159 Ga0068861_1000121596 166
433 3300005719 Ga0068861_100135032 Ga0068861_1001350322 166
434 3300005719 Ga0068861_100266649 Ga0068861_1002666492 166
435 3300005719 Ga0068861_100432091 Ga0068861_1004320913 166
436 3300005834 Ga0068851_10007997 Ga0068851_100079974 166
437 3300005834 Ga0068851_10115544 Ga0068851_101155442 166
438 3300005840 Ga0068870_10002683 Ga0068870_100026834 166
439 3300005840 Ga0068870_10015498 Ga0068870_100154983 166
440 3300005840 Ga0068870_10036736 Ga0068870_100367363 166
441 3300005840 Ga0068870_10085287 Ga0068870_100852872 166
442 3300005841 Ga0068863_100002841 Ga0068863_10000284114 166
443 3300005841 Ga0068863_100009555 Ga0068863_1000095559 166
444 3300005841 Ga0068863_100015478 Ga0068863_1000154787 166
445 3300005841 Ga0068863_100022990 Ga0068863_1000229903 166
446 3300005841 Ga0068863_100211538 Ga0068863_1002115382 166
447 3300005841 Ga0068863_100391394 Ga0068863_1003913942 166
448 3300005841 Ga0068863_100429059 Ga0068863_1004290592 166
449 3300005841 Ga0068863_100462989 Ga0068863_1004629892 166
450 3300005841 Ga0068863_101025571 Ga0068863_1010255712 166
451 3300005842 Ga0068858_100042829 Ga0068858_1000428294 166
452 3300005842 Ga0068858_100045256 Ga0068858_1000452563 166
453 3300005842 Ga0068858_100099117 Ga0068858_1000991172 166
454 3300005842 Ga0068858_100311113 Ga0068858_1003111131 166
455 3300005842 Ga0068858_100323117 Ga0068858_1003231172 166
456 3300005842 Ga0068858_100370212 Ga0068858_1003702122 166
457 3300005842 Ga0068858_100438336 Ga0068858_1004383362 166
458 3300005842 Ga0068858_100654865 Ga0068858_1006548652 166
459 3300005842 Ga0068858_100698461 Ga0068858_1006984611 166
460 3300005842 Ga0068858_101146589 Ga0068858_1011465892 166
461 3300005843 Ga0068860_100000061 Ga0068860_100000061159 166
462 3300005843 Ga0068860_100003010 Ga0068860_1000030106 166
463 3300005843 Ga0068860_100019031 Ga0068860_1000190317 166
464 3300005843 Ga0068860_100114924 Ga0068860_1001149242 166
465 3300005843 Ga0068860_100153923 Ga0068860_1001539232 166
466 3300005843 Ga0068860_100160687 Ga0068860_1001606872 166
467 3300005843 Ga0068860_100205908 Ga0068860_1002059083 166
468 3300005843 Ga0068860_100302078 Ga0068860_1003020783 166
469 3300005843 Ga0068860_100332627 Ga0068860_1003326271 166
470 3300005843 Ga0068860_100352433 Ga0068860_1003524332 166
471 3300005843 Ga0068860_100405663 Ga0068860_1004056631 166
472 3300005843 Ga0068860_100434216 Ga0068860_1004342164 166
473 3300005843 Ga0068860_100519053 Ga0068860_1005190532 166
474 3300005843 Ga0068860_100622361 Ga0068860_1006223611 166
475 3300005843 Ga0068860_100656102 Ga0068860_1006561022 166
476 3300005843 Ga0068860_100659135 Ga0068860_1006591352 166
477 3300005843 Ga0068860_100950695 Ga0068860_1009506951 166
478 3300005843 Ga0068860_101308498 Ga0068860_1013084981 166
479 3300005843 Ga0068860_101793729 Ga0068860_1017937291 166
480 3300005843 Ga0068860_101973380 Ga0068860_1019733801 166
481 3300005844 Ga0068862_100023190 Ga0068862_1000231903 166
482 3300005844 Ga0068862_100029075 Ga0068862_1000290752 166
483 3300005844 Ga0068862_100250636 Ga0068862_1002506362 166
484 3300005844 Ga0068862_100252716 Ga0068862_1002527162 166
485 3300005844 Ga0068862_100313195 Ga0068862_1003131952 166
486 3300005844 Ga0068862_100728059 Ga0068862_1007280592 166
487 3300005844 Ga0068862_101005248 Ga0068862_1010052482 166
488 3300005844 Ga0068862_101229978 Ga0068862_1012299781 166
489 3300005983 Ga0081540_1024808 Ga0081540_10248084 166
490 3300006051 Ga0075364_10439631 Ga0075364_104396311 166
491 3300006163 Ga0070715_10010886 Ga0070715_100108862 166
492 3300006195 Ga0075366_10002847 Ga0075366_100028473 166
493 3300006195 Ga0075366_10018639 Ga0075366_100186393 166
494 3300006195 Ga0075366_10021764 Ga0075366_100217642 166
495 3300006195 Ga0075366_10067537 Ga0075366_100675374 166
496 3300006195 Ga0075366_10103210 Ga0075366_101032102 166
497 3300006195 Ga0075366_10302664 Ga0075366_103026642 166
498 3300006195 Ga0075366_10519459 Ga0075366_105194592 166
499 3300006237 Ga0097621_100000465 Ga0097621_10000046510 166
500 3300006237 Ga0097621_100007122 Ga0097621_1000071225 166
501 3300006237 Ga0097621_100011137 Ga0097621_1000111376 166
502 3300006237 Ga0097621_100022862 Ga0097621_1000228625 166
503 3300006237 Ga0097621_100048247 Ga0097621_1000482475 166
504 3300006237 Ga0097621_100055128 Ga0097621_1000551282 166
505 3300006237 Ga0097621_100113847 Ga0097621_1001138472 166
506 3300006237 Ga0097621_100147290 Ga0097621_1001472902 166
507 3300006237 Ga0097621_100160720 Ga0097621_1001607202 166
508 3300006237 Ga0097621_100204450 Ga0097621_1002044503 166
509 3300006237 Ga0097621_100478577 Ga0097621_1004785772 166
510 3300006237 Ga0097621_100724406 Ga0097621_1007244062 166
511 3300006237 Ga0097621_101049945 Ga0097621_1010499452 166
512 3300006237 Ga0097621_101202598 Ga0097621_1012025982 166
513 3300006237 Ga0097621_101379502 Ga0097621_1013795021 166
514 3300006237 Ga0097621_101555984 Ga0097621_1015559841 166
515 3300006358 Ga0068871_100001644 Ga0068871_10000164410 166
516 3300006358 Ga0068871_100008210 Ga0068871_1000082102 166
517 3300006358 Ga0068871_100017469 Ga0068871_1000174696 166
518 3300006358 Ga0068871_100023517 Ga0068871_1000235175 166
519 3300006358 Ga0068871_100047473 Ga0068871_1000474734 166
520 3300006358 Ga0068871_100068734 Ga0068871_1000687343 166
521 3300006358 Ga0068871_100187840 Ga0068871_1001878402 166
522 3300006358 Ga0068871_100284107 Ga0068871_1002841072 166
523 3300006358 Ga0068871_100312350 Ga0068871_1003123501 166
524 3300006358 Ga0068871_100611021 Ga0068871_1006110212 166
525 3300006358 Ga0068871_100613802 Ga0068871_1006138022 166
526 3300006358 Ga0068871_100815909 Ga0068871_1008159092 166
527 3300006358 Ga0068871_100820835 Ga0068871_1008208352 166
528 3300006358 Ga0068871_101009170 Ga0068871_1010091701 166
529 3300006871 Ga0075434_100084958 Ga0075434_1000849583 166
530 3300006881 Ga0068865_100007033 Ga0068865_1000070335 166
531 3300006881 Ga0068865_100027470 Ga0068865_1000274705 166
532 3300006881 Ga0068865_100037175 Ga0068865_1000371754 166
533 3300006881 Ga0068865_100041865 Ga0068865_1000418653 166
534 3300006881 Ga0068865_100343549 Ga0068865_1003435492 166
535 3300006881 Ga0068865_100440478 Ga0068865_1004404782 166
536 3300006881 Ga0068865_100478164 Ga0068865_1004781641 166
537 3300006881 Ga0068865_100663977 Ga0068865_1006639771 166
538 3300006881 Ga0068865_100802134 Ga0068865_1008021341 166
539 3300006881 Ga0068865_100866263 Ga0068865_1008662631 166
540 3300006881 Ga0068865_100986991 Ga0068865_1009869912 166
541 3300006931 Ga0097620_100000025 Ga0097620_10000002595 166
542 3300006931 Ga0097620_100011247 Ga0097620_1000112472 166
543 3300006931 Ga0097620_100021012 Ga0097620_1000210127 166
544 3300006931 Ga0097620_100037181 Ga0097620_1000371814 166
545 3300006931 Ga0097620_100043054 Ga0097620_1000430545 166
546 3300006931 Ga0097620_100097715 Ga0097620_1000977152 166
547 3300006931 Ga0097620_100150911 Ga0097620_1001509113 166
548 3300006931 Ga0097620_100167075 Ga0097620_1001670753 166
549 3300006931 Ga0097620_100204141 Ga0097620_1002041412 166
550 3300006931 Ga0097620_100231415 Ga0097620_1002314151 166
551 3300006931 Ga0097620_100374422 Ga0097620_1003744223 166
552 3300006931 Ga0097620_100395586 Ga0097620_1003955862 166
553 3300006931 Ga0097620_100553401 Ga0097620_1005534012 166
554 3300006931 Ga0097620_100767715 Ga0097620_1007677151 166
555 3300006931 Ga0097620_101377436 Ga0097620_1013774361 166
556 3300006931 Ga0097620_102445847 Ga0097620_1024458471 166
557 3300007788 Ga0099795_10197078 Ga0099795_101970781 166
558 3300009011 Ga0105251_10121983 Ga0105251_101219831 166
559 3300009011 Ga0105251_10488448 Ga0105251_104884481 166
560 3300009093 Ga0105240_10000198 Ga0105240_1000019848 166
561 3300009093 Ga0105240_10015994 Ga0105240_100159948 166
562 3300009093 Ga0105240_10027122 Ga0105240_100271226 166
563 3300009093 Ga0105240_10034622 Ga0105240_100346225 166
564 3300009093 Ga0105240_10046395 Ga0105240_100463956 166
565 3300009093 Ga0105240_10049957 Ga0105240_100499574 166
566 3300009093 Ga0105240_10098017 Ga0105240_100980176 166
567 3300009093 Ga0105240_10114329 Ga0105240_101143294 166
568 3300009093 Ga0105240_10154049 Ga0105240_101540493 166
569 3300009093 Ga0105240_10344372 Ga0105240_103443722 166
570 3300009093 Ga0105240_10514428 Ga0105240_105144281 166
571 3300009094 Ga0111539_10001644 Ga0111539_100016449 166
572 3300009094 Ga0111539_10444323 Ga0111539_104443231 166
573 3300009094 Ga0111539_10824223 Ga0111539_108242231 166
574 3300009098 Ga0105245_10349519 Ga0105245_103495192 166
575 3300009101 Ga0105247_10002225 Ga0105247_100022259 166
576 3300009101 Ga0105247_10005450 Ga0105247_100054502 166
577 3300009101 Ga0105247_10050542 Ga0105247_100505423 166
578 3300009101 Ga0105247_10059813 Ga0105247_100598131 166
579 3300009101 Ga0105247_10290865 Ga0105247_102908653 166
580 3300009101 Ga0105247_10727643 Ga0105247_107276431 166
581 3300009147 Ga0114129_10072767 Ga0114129_100727676 166
582 3300009148 Ga0105243_10452829 Ga0105243_104528292 166
583 3300009148 Ga0105243_10667404 Ga0105243_106674041 166
584 3300009148 Ga0105243_11120059 Ga0105243_111200592 166
585 3300009174 Ga0105241_10002300 Ga0105241_1000230013 166
586 3300009174 Ga0105241_10006585 Ga0105241_100065852 166
587 3300009174 Ga0105241_10006947 Ga0105241_100069472 166
588 3300009174 Ga0105241_10083775 Ga0105241_100837753 166
589 3300009174 Ga0105241_10302383 Ga0105241_103023832 166
590 3300009174 Ga0105241_10427724 Ga0105241_104277241 166
591 3300009174 Ga0105241_10488066 Ga0105241_104880662 166
592 3300009174 Ga0105241_10731076 Ga0105241_107310762 166
593 3300009174 Ga0105241_11040507 Ga0105241_110405071 166
594 3300009174 Ga0105241_11413056 Ga0105241_114130561 166
595 3300009176 Ga0105242_10032792 Ga0105242_100327924 166
596 3300009176 Ga0105242_10082475 Ga0105242_100824754 166
597 3300009176 Ga0105242_10224094 Ga0105242_102240942 166
598 3300009176 Ga0105242_10503567 Ga0105242_105035672 166
599 3300009176 Ga0105242_10850890 Ga0105242_108508902 166
600 3300009176 Ga0105242_10883030 Ga0105242_108830301 166
601 3300009176 Ga0105242_11759863 Ga0105242_117598631 166
602 3300009177 Ga0105248_10027947 Ga0105248_100279474 166
603 3300009177 Ga0105248_10060553 Ga0105248_100605536 166
604 3300009177 Ga0105248_10591575 Ga0105248_105915752 166
605 3300009177 Ga0105248_10811422 Ga0105248_108114221 166
606 3300009177 Ga0105248_11124136 Ga0105248_111241361 166
607 3300009545 Ga0105237_10000409 Ga0105237_1000040936 166
608 3300009545 Ga0105237_10000577 Ga0105237_100005779 166
609 3300009545 Ga0105237_10005234 Ga0105237_100052342 166
610 3300009545 Ga0105237_10005617 Ga0105237_100056178 166
611 3300009545 Ga0105237_10006807 Ga0105237_100068077 166
612 3300009545 Ga0105237_10009021 Ga0105237_100090211 166
613 3300009545 Ga0105237_10010186 Ga0105237_100101868 166
614 3300009545 Ga0105237_10010415 Ga0105237_100104159 166
615 3300009545 Ga0105237_10120174 Ga0105237_101201742 166
616 3300009545 Ga0105237_10129325 Ga0105237_101293252 166
617 3300009545 Ga0105237_10483019 Ga0105237_104830193 166
618 3300009545 Ga0105237_10809517 Ga0105237_108095172 166
619 3300009545 Ga0105237_10969481 Ga0105237_109694811 166
620 3300009545 Ga0105237_11173636 Ga0105237_111736361 166
621 3300009545 Ga0105237_11818588 Ga0105237_118185881 166
622 3300009551 Ga0105238_10007301 Ga0105238_100073019 166
623 3300009551 Ga0105238_10084102 Ga0105238_100841023 166
624 3300009551 Ga0105238_10098761 Ga0105238_100987614 166
625 3300009551 Ga0105238_10170233 Ga0105238_101702333 166
626 3300009553 Ga0105249_10020448 Ga0105249_100204484 166
627 3300009553 Ga0105249_10021479 Ga0105249_100214794 166
628 3300009553 Ga0105249_10032930 Ga0105249_100329305 166
629 3300009553 Ga0105249_10049926 Ga0105249_100499262 166
630 3300009553 Ga0105249_10110043 Ga0105249_101100432 166
631 3300009553 Ga0105249_10112374 Ga0105249_101123743 166
632 3300009553 Ga0105249_10121976 Ga0105249_101219762 166
633 3300009553 Ga0105249_10169249 Ga0105249_101692492 166
634 3300009553 Ga0105249_10176424 Ga0105249_101764242 166
635 3300009553 Ga0105249_10181883 Ga0105249_101818832 166
636 3300009553 Ga0105249_10383106 Ga0105249_103831062 166
637 3300009553 Ga0105249_10608287 Ga0105249_106082872 166
638 3300009553 Ga0105249_11227097 Ga0105249_112270971 166
639 3300009553 Ga0105249_12666249 Ga0105249_126662491 166
640 3300010375 Ga0105239_10000019 Ga0105239_10000019209 166
641 3300010375 Ga0105239_10000343 Ga0105239_1000034362 166
642 3300010375 Ga0105239_10000659 Ga0105239_1000065943 166
643 3300010375 Ga0105239_10001227 Ga0105239_1000122729 166
644 3300010375 Ga0105239_10005439 Ga0105239_100054397 166
645 3300010375 Ga0105239_10014750 Ga0105239_100147506 166
646 3300010375 Ga0105239_10041485 Ga0105239_100414856 166
647 3300010375 Ga0105239_10053665 Ga0105239_100536653 166
648 3300010375 Ga0105239_10093829 Ga0105239_100938293 166
649 3300010375 Ga0105239_10120279 Ga0105239_101202792 166
650 3300010375 Ga0105239_10191856 Ga0105239_101918563 166
651 3300010375 Ga0105239_10253293 Ga0105239_102532932 166
652 3300010375 Ga0105239_10265527 Ga0105239_102655272 166
653 3300010375 Ga0105239_10560199 Ga0105239_105601992 166
654 3300010375 Ga0105239_10599380 Ga0105239_105993802 166
655 3300010375 Ga0105239_11129094 Ga0105239_111290941 166
656 3300011119 Ga0105246_10032151 Ga0105246_100321512 166
657 3300011119 Ga0105246_10084639 Ga0105246_100846392 166
658 3300011119 Ga0105246_10127719 Ga0105246_101277192 166
659 3300011119 Ga0105246_10130463 Ga0105246_101304632 166
660 3300011119 Ga0105246_10329089 Ga0105246_103290892 166
661 3300011119 Ga0105246_10512057 Ga0105246_105120571 166
662 3300013100 Ga0157373_10008801 Ga0157373_100088015 166
663 3300013100 Ga0157373_10011698 Ga0157373_100116983 166
664 3300013100 Ga0157373_10483018 Ga0157373_104830181 166
665 3300013102 Ga0157371_10029953 Ga0157371_100299532 166
666 3300013102 Ga0157371_10357213 Ga0157371_103572132 166
667 3300013104 Ga0157370_10002115 Ga0157370_100021157 166
668 3300013104 Ga0157370_10010926 Ga0157370_100109261 166
669 3300013104 Ga0157370_10012060 Ga0157370_100120603 166
670 3300013104 Ga0157370_10100635 Ga0157370_101006352 166
671 3300013104 Ga0157370_10307518 Ga0157370_103075182 166
672 3300013104 Ga0157370_10757721 Ga0157370_107577211 166
673 3300013104 Ga0157370_11023994 Ga0157370_110239942 166
674 3300013104 Ga0157370_11267000 Ga0157370_112670001 166
675 3300013105 Ga0157369_10008539 Ga0157369_100085399 166
676 3300013105 Ga0157369_10044786 Ga0157369_100447862 166
677 3300013105 Ga0157369_10311980 Ga0157369_103119802 166
678 3300013105 Ga0157369_10980657 Ga0157369_109806572 166
679 3300013105 Ga0157369_11156009 Ga0157369_111560092 166
680 3300013296 Ga0157374_10000011 Ga0157374_10000011168 166
681 3300013296 Ga0157374_10003749 Ga0157374_100037496 166
682 3300013296 Ga0157374_10004107 Ga0157374_100041077 166
683 3300013296 Ga0157374_10004768 Ga0157374_100047687 166
684 3300013296 Ga0157374_10012057 Ga0157374_100120572 166
685 3300013296 Ga0157374_10025377 Ga0157374_100253772 166
686 3300013296 Ga0157374_10028328 Ga0157374_100283282 166
687 3300013296 Ga0157374_10036793 Ga0157374_100367934 166
688 3300013296 Ga0157374_10080774 Ga0157374_100807742 166
689 3300013296 Ga0157374_10107499 Ga0157374_101074992 166
690 3300013296 Ga0157374_10169500 Ga0157374_101695003 166
691 3300013296 Ga0157374_10833283 Ga0157374_108332831 166
692 3300013296 Ga0157374_10929497 Ga0157374_109294972 166
693 3300013296 Ga0157374_10962872 Ga0157374_109628721 166
694 3300013296 Ga0157374_11113769 Ga0157374_111137692 166
695 3300013297 Ga0157378_10002905 Ga0157378_1000290514 166
696 3300013297 Ga0157378_10012666 Ga0157378_100126666 166
697 3300013297 Ga0157378_10035819 Ga0157378_100358194 166
698 3300013297 Ga0157378_10089113 Ga0157378_100891133 166
699 3300013297 Ga0157378_10095139 Ga0157378_100951393 166
700 3300013297 Ga0157378_10120123 Ga0157378_101201232 166
701 3300013297 Ga0157378_10139797 Ga0157378_101397972 166
702 3300013297 Ga0157378_10189621 Ga0157378_101896213 166
703 3300013297 Ga0157378_10209824 Ga0157378_102098243 166
704 3300013297 Ga0157378_10220287 Ga0157378_102202873 166
705 3300013297 Ga0157378_10223040 Ga0157378_102230401 166
706 3300013297 Ga0157378_10225657 Ga0157378_102256571 166
707 3300013297 Ga0157378_10275097 Ga0157378_102750972 166
708 3300013297 Ga0157378_10789674 Ga0157378_107896741 166
709 3300013306 Ga0163162_10000151 Ga0163162_1000015154 166
710 3300013306 Ga0163162_10000344 Ga0163162_100003449 166
711 3300013306 Ga0163162_10000782 Ga0163162_1000078210 166
712 3300013306 Ga0163162_10000827 Ga0163162_100008275 166
713 3300013306 Ga0163162_10002957 Ga0163162_1000295710 166
714 3300013306 Ga0163162_10010911 Ga0163162_100109117 166
715 3300013306 Ga0163162_10014906 Ga0163162_100149062 166
716 3300013306 Ga0163162_10021159 Ga0163162_100211595 166
717 3300013306 Ga0163162_10068998 Ga0163162_100689983 166
718 3300013306 Ga0163162_10089929 Ga0163162_100899294 166
719 3300013306 Ga0163162_10136540 Ga0163162_101365404 166
720 3300013306 Ga0163162_10251118 Ga0163162_102511183 166
721 3300013306 Ga0163162_10263138 Ga0163162_102631381 166
722 3300013306 Ga0163162_10575924 Ga0163162_105759242 166
723 3300013306 Ga0163162_10796723 Ga0163162_107967231 166
724 3300013306 Ga0163162_10852866 Ga0163162_108528662 166
725 3300013306 Ga0163162_11086642 Ga0163162_110866422 166
726 3300013306 Ga0163162_11122652 Ga0163162_111226522 166
727 3300013306 Ga0163162_11122755 Ga0163162_111227551 166
728 3300013306 Ga0163162_11584769 Ga0163162_115847691 166
729 3300013306 Ga0163162_11584770 Ga0163162_115847702 166
730 3300013306 Ga0163162_12417306 Ga0163162_124173061 166
731 3300013307 Ga0157372_10003342 Ga0157372_100033426 166
732 3300013307 Ga0157372_10050769 Ga0157372_100507692 166
733 3300013307 Ga0157372_10056150 Ga0157372_100561503 166
734 3300013307 Ga0157372_10098575 Ga0157372_100985754 166
735 3300013307 Ga0157372_10127461 Ga0157372_101274613 166
736 3300013307 Ga0157372_10216330 Ga0157372_102163302 166
737 3300013307 Ga0157372_10715884 Ga0157372_107158842 166
738 3300013307 Ga0157372_10847590 Ga0157372_108475902 166
739 3300013307 Ga0157372_11669407 Ga0157372_116694072 166
740 3300013308 Ga0157375_10000911 Ga0157375_1000091110 166
741 3300013308 Ga0157375_10003934 Ga0157375_100039343 166
742 3300013308 Ga0157375_10052035 Ga0157375_100520352 166
743 3300013308 Ga0157375_10060880 Ga0157375_100608802 166
744 3300013308 Ga0157375_10103328 Ga0157375_101033282 166
745 3300013308 Ga0157375_10137861 Ga0157375_101378613 166
746 3300013308 Ga0157375_10202726 Ga0157375_102027262 166
747 3300013308 Ga0157375_10251467 Ga0157375_102514672 166
748 3300013308 Ga0157375_10257424 Ga0157375_102574243 166
749 3300013308 Ga0157375_10390622 Ga0157375_103906222 166
750 3300013308 Ga0157375_10875850 Ga0157375_108758502 166
751 3300013308 Ga0157375_11423458 Ga0157375_114234581 166
752 3300013308 Ga0157375_13006033 Ga0157375_130060331 166
753 3300014325 Ga0163163_10000215 Ga0163163_100002159 166
754 3300014325 Ga0163163_10007541 Ga0163163_100075415 166
755 3300014325 Ga0163163_10011287 Ga0163163_100112872 166
756 3300014325 Ga0163163_10147060 Ga0163163_101470601 166
757 3300014325 Ga0163163_10189538 Ga0163163_101895382 166
758 3300014325 Ga0163163_10226380 Ga0163163_102263803 166
759 3300014325 Ga0163163_10259849 Ga0163163_102598492 166
760 3300014325 Ga0163163_10314707 Ga0163163_103147072 166
761 3300014325 Ga0163163_10336472 Ga0163163_103364722 166
762 3300014325 Ga0163163_10809863 Ga0163163_108098631 166
763 3300014325 Ga0163163_10951994 Ga0163163_109519942 166
764 3300014325 Ga0163163_10955758 Ga0163163_109557582 166
765 3300014325 Ga0163163_11219158 Ga0163163_112191581 166
766 3300014326 Ga0157380_10015686 Ga0157380_100156862 166
767 3300014326 Ga0157380_10057056 Ga0157380_100570561 166
768 3300014326 Ga0157380_10253140 Ga0157380_102531402 166
769 3300014326 Ga0157380_10276805 Ga0157380_102768052 166
770 3300014326 Ga0157380_10296999 Ga0157380_102969992 166
771 3300014326 Ga0157380_10451809 Ga0157380_104518091 166
772 3300014326 Ga0157380_10863772 Ga0157380_108637721 166
773 3300014326 Ga0157380_11101733 Ga0157380_111017332 166
774 3300014326 Ga0157380_11466641 Ga0157380_114666411 166
775 3300014745 Ga0157377_10005894 Ga0157377_100058943 166
776 3300014745 Ga0157377_10091088 Ga0157377_100910881 166
777 3300014745 Ga0157377_10104700 Ga0157377_101047002 166
778 3300014745 Ga0157377_10261232 Ga0157377_102612322 166
779 3300014745 Ga0157377_10714477 Ga0157377_107144771 166
780 3300014968 Ga0157379_10001465 Ga0157379_1000146519 166
781 3300014968 Ga0157379_10025037 Ga0157379_100250372 166
782 3300014968 Ga0157379_10085296 Ga0157379_100852963 166
783 3300014968 Ga0157379_10132218 Ga0157379_101322182 166
784 3300014968 Ga0157379_10147775 Ga0157379_101477751 166
785 3300014968 Ga0157379_10154542 Ga0157379_101545422 166
786 3300014968 Ga0157379_10184606 Ga0157379_101846062 166
787 3300014968 Ga0157379_10226909 Ga0157379_102269092 166
788 3300014968 Ga0157379_10252836 Ga0157379_102528362 166
789 3300014968 Ga0157379_10380509 Ga0157379_103805091 166
790 3300014968 Ga0157379_10418814 Ga0157379_104188142 166
791 3300014968 Ga0157379_10814892 Ga0157379_108148922 166
792 3300014969 Ga0157376_10003091 Ga0157376_100030916 166
793 3300014969 Ga0157376_10003806 Ga0157376_1000380610 166
794 3300014969 Ga0157376_10009971 Ga0157376_100099714 166
795 3300014969 Ga0157376_10033522 Ga0157376_100335223 166
796 3300014969 Ga0157376_10037872 Ga0157376_100378723 166
797 3300014969 Ga0157376_10103479 Ga0157376_101034792 166
798 3300014969 Ga0157376_10183788 Ga0157376_101837882 166
799 3300014969 Ga0157376_10211903 Ga0157376_102119032 166
800 3300014969 Ga0157376_10537169 Ga0157376_105371692 166
801 3300014969 Ga0157376_10676587 Ga0157376_106765872 166
802 3300014969 Ga0157376_11363165 Ga0157376_113631651 166
803 3300014969 Ga0157376_11844482 Ga0157376_118444821 166
804 3300017792 Ga0163161_10006068 Ga0163161_100060685 166
805 3300017792 Ga0163161_10015639 Ga0163161_100156394 166
806 3300017792 Ga0163161_10017879 Ga0163161_100178795 166
807 3300017792 Ga0163161_10022905 Ga0163161_100229053 166
808 3300017792 Ga0163161_10063649 Ga0163161_100636493 166
809 3300017792 Ga0163161_10190044 Ga0163161_101900442 166
810 3300017792 Ga0163161_10192794 Ga0163161_101927941 166
811 3300017792 Ga0163161_10227210 Ga0163161_102272102 166
812 3300017792 Ga0163161_10386491 Ga0163161_103864912 166
813 3300017792 Ga0163161_10487437 Ga0163161_104874371 166
814 3300017792 Ga0163161_10605179 Ga0163161_106051792 166
815 3300020069 Ga0197907_10995076 Ga0197907_109950761 166
816 3300020069 Ga0197907_11045296 Ga0197907_110452961 166
817 3300020069 Ga0197907_11115152 Ga0197907_111151523 166
818 3300020070 Ga0206356_10869258 Ga0206356_108692583 166
819 3300020070 Ga0206356_11038156 Ga0206356_110381561 166
820 3300020070 Ga0206356_11208083 Ga0206356_112080831 166
821 3300020070 Ga0206356_11287791 Ga0206356_112877912 166
822 3300020070 Ga0206356_11576714 Ga0206356_115767141 166
823 3300020070 Ga0206356_11620720 Ga0206356_116207202 166
824 3300020075 Ga0206349_1234662 Ga0206349_12346621 166
825 3300020075 Ga0206349_1272832 Ga0206349_12728322 166
826 3300020075 Ga0206349_1793318 Ga0206349_17933181 166
827 3300020076 Ga0206355_1288808 Ga0206355_12888081 166
828 3300020076 Ga0206355_1701830 Ga0206355_17018301 166
829 3300020077 Ga0206351_10840370 Ga0206351_108403701 166
830 3300020077 Ga0206351_10857268 Ga0206351_108572682 166
831 3300020078 Ga0206352_10259686 Ga0206352_102596861 166
832 3300020078 Ga0206352_10359923 Ga0206352_103599232 166
833 3300020078 Ga0206352_10615519 Ga0206352_106155191 166
834 3300020078 Ga0206352_10977901 Ga0206352_109779012 166
835 3300020078 Ga0206352_11013407 Ga0206352_110134071 166
836 3300020078 Ga0206352_11155741 Ga0206352_111557412 166
837 3300020080 Ga0206350_10482065 Ga0206350_104820651 166
838 3300020080 Ga0206350_10497323 Ga0206350_104973232 166
839 3300020080 Ga0206350_10802927 Ga0206350_108029271 166
840 3300020080 Ga0206350_11247711 Ga0206350_112477113 166
841 3300020080 Ga0206350_11629336 Ga0206350_116293361 166
842 3300020081 Ga0206354_10457372 Ga0206354_104573721 166
843 3300020081 Ga0206354_10909307 Ga0206354_109093071 166
844 3300020081 Ga0206354_11042613 Ga0206354_110426131 166
845 3300020082 Ga0206353_11122960 Ga0206353_111229601 166
846 3300020082 Ga0206353_12050348 Ga0206353_120503481 166
847 3300020610 Ga0154015_1552988 Ga0154015_15529882 166
848 3300021384 Ga0213876_10005782 Ga0213876_100057822 166
849 3300022467 Ga0224712_10040477 Ga0224712_100404772 166
850 3300022467 Ga0224712_10117179 Ga0224712_101171792 166
851 3300025246 Ga0209646_1002933 Ga0209646_10029332 166
852 3300025290 Ga0207673_1038215 Ga0207673_10382152 166
853 3300025315 Ga0207697_10105069 Ga0207697_101050692 166
854 3300025321 Ga0207656_10012744 Ga0207656_100127443 166
855 3300025321 Ga0207656_10130031 Ga0207656_101300311 166
856 3300025321 Ga0207656_10144775 Ga0207656_101447752 166
857 3300025735 Ga0207713_1098921 Ga0207713_10989212 166
858 3300025893 Ga0207682_10057890 Ga0207682_100578902 166
859 3300025893 Ga0207682_10062397 Ga0207682_100623972 166
860 3300025893 Ga0207682_10078561 Ga0207682_100785611 166
861 3300025899 Ga0207642_10093236 Ga0207642_100932362 166
862 3300025899 Ga0207642_10321094 Ga0207642_103210942 166
863 3300025899 Ga0207642_10391464 Ga0207642_103914641 166
864 3300025899 Ga0207642_10730793 Ga0207642_107307931 166
865 3300025900 Ga0207710_10010275 Ga0207710_100102755 166
866 3300025900 Ga0207710_10204929 Ga0207710_102049292 166
867 3300025901 Ga0207688_10052388 Ga0207688_100523882 166
868 3300025903 Ga0207680_10000032 Ga0207680_1000003271 166
869 3300025903 Ga0207680_10001858 Ga0207680_100018587 166
870 3300025903 Ga0207680_10065662 Ga0207680_100656622 166
871 3300025903 Ga0207680_10173601 Ga0207680_101736011 166
872 3300025903 Ga0207680_10270317 Ga0207680_102703172 166
873 3300025903 Ga0207680_10695424 Ga0207680_106954242 166
874 3300025903 Ga0207680_10770023 Ga0207680_107700232 166
875 3300025904 Ga0207647_10008403 Ga0207647_100084034 166
876 3300025904 Ga0207647_10015067 Ga0207647_100150672 166
877 3300025904 Ga0207647_10020104 Ga0207647_100201043 166
878 3300025904 Ga0207647_10499755 Ga0207647_104997551 166
879 3300025907 Ga0207645_10001037 Ga0207645_100010379 166
880 3300025907 Ga0207645_10015523 Ga0207645_100155236 166
881 3300025907 Ga0207645_10017482 Ga0207645_100174824 166
882 3300025907 Ga0207645_10020806 Ga0207645_100208064 166
883 3300025907 Ga0207645_10047256 Ga0207645_100472563 166
884 3300025907 Ga0207645_10051420 Ga0207645_100514202 166
885 3300025907 Ga0207645_10136914 Ga0207645_101369141 166
886 3300025908 Ga0207643_10032899 Ga0207643_100328995 166
887 3300025908 Ga0207643_10037977 Ga0207643_100379772 166
888 3300025908 Ga0207643_10061490 Ga0207643_100614903 166
889 3300025908 Ga0207643_10241248 Ga0207643_102412481 166
890 3300025909 Ga0207705_10018695 Ga0207705_100186957 166
891 3300025909 Ga0207705_10081762 Ga0207705_100817623 166
892 3300025909 Ga0207705_10084378 Ga0207705_100843781 166
893 3300025911 Ga0207654_10003193 Ga0207654_100031932 166
894 3300025911 Ga0207654_10011353 Ga0207654_100113534 166
895 3300025911 Ga0207654_10051196 Ga0207654_100511962 166
896 3300025911 Ga0207654_10298556 Ga0207654_102985561 166
897 3300025911 Ga0207654_10339453 Ga0207654_103394531 166
898 3300025912 Ga0207707_10012036 Ga0207707_100120364 166
899 3300025912 Ga0207707_10049929 Ga0207707_100499292 166
900 3300025913 Ga0207695_10000212 Ga0207695_1000021283 166
901 3300025913 Ga0207695_10000346 Ga0207695_1000034646 166
902 3300025913 Ga0207695_10001638 Ga0207695_100016382 166
903 3300025913 Ga0207695_10050880 Ga0207695_100508803 166
904 3300025913 Ga0207695_10054308 Ga0207695_100543083 166
905 3300025913 Ga0207695_10062575 Ga0207695_100625753 166
906 3300025913 Ga0207695_10079628 Ga0207695_100796283 166
907 3300025913 Ga0207695_10996822 Ga0207695_109968221 166
908 3300025914 Ga0207671_10000402 Ga0207671_1000040226 166
909 3300025914 Ga0207671_10001317 Ga0207671_1000131728 166
910 3300025914 Ga0207671_10002977 Ga0207671_1000297711 166
911 3300025914 Ga0207671_10013351 Ga0207671_100133516 166
912 3300025914 Ga0207671_10013961 Ga0207671_100139613 166
913 3300025914 Ga0207671_10071447 Ga0207671_100714472 166
914 3300025914 Ga0207671_10093965 Ga0207671_100939651 166
915 3300025914 Ga0207671_10115538 Ga0207671_101155382 166
916 3300025914 Ga0207671_10226165 Ga0207671_102261652 166
917 3300025914 Ga0207671_10713587 Ga0207671_107135871 166
918 3300025914 Ga0207671_10896111 Ga0207671_108961112 166
919 3300025917 Ga0207660_10084322 Ga0207660_100843222 166
920 3300025917 Ga0207660_10129589 Ga0207660_101295892 166
921 3300025918 Ga0207662_10107448 Ga0207662_101074481 166
922 3300025918 Ga0207662_10143487 Ga0207662_101434872 166
923 3300025918 Ga0207662_10252308 Ga0207662_102523082 166
924 3300025919 Ga0207657_10353903 Ga0207657_103539031 166
925 3300025919 Ga0207657_10363098 Ga0207657_103630982 166
926 3300025920 Ga0207649_10001499 Ga0207649_100014999 166
927 3300025920 Ga0207649_10112777 Ga0207649_101127773 166
928 3300025920 Ga0207649_10524291 Ga0207649_105242911 166
929 3300025920 Ga0207649_10810143 Ga0207649_108101431 166
930 3300025920 Ga0207649_11281419 Ga0207649_112814191 166
931 3300025921 Ga0207652_10292723 Ga0207652_102927232 166
932 3300025923 Ga0207681_10069963 Ga0207681_100699632 166
933 3300025923 Ga0207681_10090697 Ga0207681_100906971 166
934 3300025923 Ga0207681_10248616 Ga0207681_102486162 166
935 3300025923 Ga0207681_10299388 Ga0207681_102993882 166
936 3300025923 Ga0207681_10804460 Ga0207681_108044601 166
937 3300025923 Ga0207681_11121260 Ga0207681_111212601 166
938 3300025924 Ga0207694_10006626 Ga0207694_100066262 166
939 3300025924 Ga0207694_10180164 Ga0207694_101801643 166
940 3300025924 Ga0207694_10307992 Ga0207694_103079922 166
941 3300025924 Ga0207694_10517761 Ga0207694_105177611 166
942 3300025925 Ga0207650_10018439 Ga0207650_100184394 166
943 3300025925 Ga0207650_10064928 Ga0207650_100649282 166
944 3300025925 Ga0207650_10088885 Ga0207650_100888853 166
945 3300025925 Ga0207650_10136667 Ga0207650_101366673 166
946 3300025925 Ga0207650_10182983 Ga0207650_101829832 166
947 3300025925 Ga0207650_10193656 Ga0207650_101936562 166
948 3300025925 Ga0207650_10212060 Ga0207650_102120602 166
949 3300025925 Ga0207650_10247907 Ga0207650_102479072 166
950 3300025925 Ga0207650_10314320 Ga0207650_103143202 166
951 3300025925 Ga0207650_10621260 Ga0207650_106212602 166
952 3300025925 Ga0207650_11455151 Ga0207650_114551511 166
953 3300025926 Ga0207659_10005427 Ga0207659_100054274 166
954 3300025926 Ga0207659_10022872 Ga0207659_100228724 166
955 3300025926 Ga0207659_10131521 Ga0207659_101315212 166
956 3300025926 Ga0207659_10141105 Ga0207659_101411052 166
957 3300025926 Ga0207659_10633080 Ga0207659_106330801 166
958 3300025926 Ga0207659_10750568 Ga0207659_107505682 166
959 3300025926 Ga0207659_10986683 Ga0207659_109866831 166
960 3300025931 Ga0207644_10011068 Ga0207644_100110683 166
961 3300025931 Ga0207644_10049616 Ga0207644_100496161 166
962 3300025931 Ga0207644_10056362 Ga0207644_100563622 166
963 3300025931 Ga0207644_10253986 Ga0207644_102539862 166
964 3300025931 Ga0207644_10413004 Ga0207644_104130042 166
965 3300025932 Ga0207690_10359899 Ga0207690_103598992 166
966 3300025933 Ga0207706_10019629 Ga0207706_100196294 166
967 3300025933 Ga0207706_10024662 Ga0207706_100246622 166
968 3300025933 Ga0207706_10032960 Ga0207706_100329603 166
969 3300025933 Ga0207706_10051313 Ga0207706_100513136 166
970 3300025933 Ga0207706_10052481 Ga0207706_100524813 166
971 3300025933 Ga0207706_10058898 Ga0207706_100588984 166
972 3300025934 Ga0207686_10047655 Ga0207686_100476553 166
973 3300025934 Ga0207686_10110306 Ga0207686_101103062 166
974 3300025934 Ga0207686_10247829 Ga0207686_102478292 166
975 3300025934 Ga0207686_10976831 Ga0207686_109768311 166
976 3300025935 Ga0207709_10404473 Ga0207709_104044732 166
977 3300025936 Ga0207670_10002959 Ga0207670_100029596 166
978 3300025936 Ga0207670_10060183 Ga0207670_100601832 166
979 3300025936 Ga0207670_10344085 Ga0207670_103440852 166
980 3300025937 Ga0207669_10100583 Ga0207669_101005832 166
981 3300025937 Ga0207669_10204591 Ga0207669_102045912 166
982 3300025937 Ga0207669_10366340 Ga0207669_103663401 166
983 3300025937 Ga0207669_10477447 Ga0207669_104774472 166
984 3300025938 Ga0207704_10017234 Ga0207704_100172344 166
985 3300025938 Ga0207704_10052814 Ga0207704_100528143 166
986 3300025938 Ga0207704_10104999 Ga0207704_101049991 166
987 3300025938 Ga0207704_10105173 Ga0207704_101051732 166
988 3300025938 Ga0207704_10163266 Ga0207704_101632662 166
989 3300025938 Ga0207704_10329125 Ga0207704_103291252 166
990 3300025938 Ga0207704_10354290 Ga0207704_103542901 166
991 3300025938 Ga0207704_10374328 Ga0207704_103743281 166
992 3300025938 Ga0207704_10834726 Ga0207704_108347261 166
993 3300025940 Ga0207691_10000076 Ga0207691_1000007673 166
994 3300025940 Ga0207691_10050794 Ga0207691_100507942 166
995 3300025940 Ga0207691_10054463 Ga0207691_100544635 166
996 3300025940 Ga0207691_10058866 Ga0207691_100588664 166
997 3300025940 Ga0207691_10065911 Ga0207691_100659111 166
998 3300025940 Ga0207691_10083028 Ga0207691_100830282 166
999 3300025940 Ga0207691_10233946 Ga0207691_102339462 166
1000 3300025940 Ga0207691_10282896 Ga0207691_102828962 166
1001 3300025940 Ga0207691_10392539 Ga0207691_103925391 166
1002 3300025940 Ga0207691_10593283 Ga0207691_105932832 166
1003 3300025941 Ga0207711_10047631 Ga0207711_100476312 166
1004 3300025941 Ga0207711_10335400 Ga0207711_103354001 166
1005 3300025941 Ga0207711_10649584 Ga0207711_106495841 166
1006 3300025941 Ga0207711_11107212 Ga0207711_111072121 166
1007 3300025942 Ga0207689_10001853 Ga0207689_1000185318 166
1008 3300025942 Ga0207689_10002225 Ga0207689_1000222511 166
1009 3300025942 Ga0207689_10003970 Ga0207689_100039704 166
1010 3300025942 Ga0207689_10009828 Ga0207689_100098286 166
1011 3300025942 Ga0207689_10013487 Ga0207689_100134876 166
1012 3300025942 Ga0207689_10016179 Ga0207689_100161795 166
1013 3300025942 Ga0207689_10030548 Ga0207689_100305482 166
1014 3300025942 Ga0207689_10065690 Ga0207689_100656904 166
1015 3300025942 Ga0207689_10082022 Ga0207689_100820224 166
1016 3300025942 Ga0207689_10083732 Ga0207689_100837322 166
1017 3300025942 Ga0207689_10092853 Ga0207689_100928534 166
1018 3300025942 Ga0207689_10095473 Ga0207689_100954733 166
1019 3300025942 Ga0207689_10114825 Ga0207689_101148253 166
1020 3300025942 Ga0207689_10318562 Ga0207689_103185622 166
1021 3300025944 Ga0207661_10007676 Ga0207661_100076763 166
1022 3300025944 Ga0207661_10074126 Ga0207661_100741262 166
1023 3300025944 Ga0207661_10204533 Ga0207661_102045333 166
1024 3300025944 Ga0207661_10435425 Ga0207661_104354252 166
1025 3300025945 Ga0207679_10000159 Ga0207679_1000015941 166
1026 3300025945 Ga0207679_10011961 Ga0207679_100119612 166
1027 3300025945 Ga0207679_10439790 Ga0207679_104397902 166
1028 3300025945 Ga0207679_10488798 Ga0207679_104887982 166
1029 3300025945 Ga0207679_10775443 Ga0207679_107754431 166
1030 3300025945 Ga0207679_11071114 Ga0207679_110711141 166
1031 3300025949 Ga0207667_10000414 Ga0207667_1000041410 166
1032 3300025949 Ga0207667_10006159 Ga0207667_100061592 166
1033 3300025949 Ga0207667_10006640 Ga0207667_100066406 166
1034 3300025949 Ga0207667_10018745 Ga0207667_100187452 166
1035 3300025949 Ga0207667_10179079 Ga0207667_101790793 166
1036 3300025949 Ga0207667_10456143 Ga0207667_104561432 166
1037 3300025949 Ga0207667_10953695 Ga0207667_109536952 166
1038 3300025960 Ga0207651_10006374 Ga0207651_100063747 166
1039 3300025960 Ga0207651_10067155 Ga0207651_100671552 166
1040 3300025960 Ga0207651_10084255 Ga0207651_100842552 166
1041 3300025960 Ga0207651_10084359 Ga0207651_100843592 166
1042 3300025960 Ga0207651_10155585 Ga0207651_101555853 166
1043 3300025960 Ga0207651_10245204 Ga0207651_102452042 166
1044 3300025960 Ga0207651_10323206 Ga0207651_103232062 166
1045 3300025960 Ga0207651_10473966 Ga0207651_104739662 166
1046 3300025960 Ga0207651_11013462 Ga0207651_110134621 166
1047 3300025961 Ga0207712_10010020 Ga0207712_100100203 166
1048 3300025961 Ga0207712_10066018 Ga0207712_100660182 166
1049 3300025961 Ga0207712_10080961 Ga0207712_100809612 166
1050 3300025961 Ga0207712_10119385 Ga0207712_101193852 166
1051 3300025961 Ga0207712_10169635 Ga0207712_101696352 166
1052 3300025961 Ga0207712_10172080 Ga0207712_101720802 166
1053 3300025961 Ga0207712_10188807 Ga0207712_101888073 166
1054 3300025961 Ga0207712_10204977 Ga0207712_102049771 166
1055 3300025961 Ga0207712_10232661 Ga0207712_102326612 166
1056 3300025961 Ga0207712_10372763 Ga0207712_103727631 166
1057 3300025972 Ga0207668_10044565 Ga0207668_100445653 166
1058 3300025972 Ga0207668_10109202 Ga0207668_101092021 166
1059 3300025972 Ga0207668_10121465 Ga0207668_101214652 166
1060 3300025972 Ga0207668_10166582 Ga0207668_101665822 166
1061 3300025972 Ga0207668_10310758 Ga0207668_103107581 166
1062 3300025972 Ga0207668_10364071 Ga0207668_103640713 166
1063 3300025972 Ga0207668_10455724 Ga0207668_104557241 166
1064 3300025972 Ga0207668_11216751 Ga0207668_112167512 166
1065 3300025981 Ga0207640_10010753 Ga0207640_100107534 166
1066 3300025981 Ga0207640_10099604 Ga0207640_100996042 166
1067 3300025981 Ga0207640_10160459 Ga0207640_101604593 166
1068 3300025981 Ga0207640_10184971 Ga0207640_101849712 166
1069 3300025981 Ga0207640_10389178 Ga0207640_103891782 166
1070 3300025981 Ga0207640_10567969 Ga0207640_105679692 166
1071 3300025981 Ga0207640_10967919 Ga0207640_109679191 166
1072 3300025981 Ga0207640_11076881 Ga0207640_110768811 166
1073 3300025986 Ga0207658_10008424 Ga0207658_100084242 166
1074 3300025986 Ga0207658_10066629 Ga0207658_100666292 166
1075 3300025986 Ga0207658_10120749 Ga0207658_101207492 166
1076 3300025986 Ga0207658_10286395 Ga0207658_102863952 166
1077 3300025986 Ga0207658_10293237 Ga0207658_102932372 166
1078 3300025986 Ga0207658_10306699 Ga0207658_103066992 166
1079 3300025986 Ga0207658_10309279 Ga0207658_103092792 166
1080 3300025986 Ga0207658_10337813 Ga0207658_103378132 166
1081 3300025986 Ga0207658_10411796 Ga0207658_104117962 166
1082 3300025986 Ga0207658_10678139 Ga0207658_106781391 166
1083 3300025986 Ga0207658_10810434 Ga0207658_108104341 166
1084 3300025986 Ga0207658_10840490 Ga0207658_108404902 166
1085 3300025986 Ga0207658_11078671 Ga0207658_110786712 166
1086 3300026023 Ga0207677_10003307 Ga0207677_100033074 166
1087 3300026023 Ga0207677_10043994 Ga0207677_100439945 166
1088 3300026023 Ga0207677_10054520 Ga0207677_100545202 166
1089 3300026023 Ga0207677_10062680 Ga0207677_100626803 166
1090 3300026023 Ga0207677_10074356 Ga0207677_100743561 166
1091 3300026023 Ga0207677_10183855 Ga0207677_101838552 166
1092 3300026023 Ga0207677_11051138 Ga0207677_110511381 166
1093 3300026023 Ga0207677_11261764 Ga0207677_112617641 166
1094 3300026035 Ga0207703_10051094 Ga0207703_100510942 166
1095 3300026035 Ga0207703_10144851 Ga0207703_101448511 166
1096 3300026035 Ga0207703_10172139 Ga0207703_101721391 166
1097 3300026035 Ga0207703_10255085 Ga0207703_102550852 166
1098 3300026035 Ga0207703_10314055 Ga0207703_103140551 166
1099 3300026035 Ga0207703_10400728 Ga0207703_104007282 166
1100 3300026035 Ga0207703_10612624 Ga0207703_106126241 166
1101 3300026035 Ga0207703_10657660 Ga0207703_106576602 166
1102 3300026035 Ga0207703_11058663 Ga0207703_110586631 166
1103 3300026041 Ga0207639_10003794 Ga0207639_100037945 166
1104 3300026041 Ga0207639_10067276 Ga0207639_100672762 166
1105 3300026041 Ga0207639_10083233 Ga0207639_100832332 166
1106 3300026041 Ga0207639_10167410 Ga0207639_101674101 166
1107 3300026041 Ga0207639_10211589 Ga0207639_102115891 166
1108 3300026041 Ga0207639_10229390 Ga0207639_102293902 166
1109 3300026041 Ga0207639_10242431 Ga0207639_102424312 166
1110 3300026041 Ga0207639_10244092 Ga0207639_102440922 166
1111 3300026041 Ga0207639_10338536 Ga0207639_103385362 166
1112 3300026041 Ga0207639_10536705 Ga0207639_105367051 166
1113 3300026067 Ga0207678_10271375 Ga0207678_102713752 166
1114 3300026067 Ga0207678_10514694 Ga0207678_105146942 166
1115 3300026067 Ga0207678_10979479 Ga0207678_109794792 166
1116 3300026075 Ga0207708_10597580 Ga0207708_105975801 166
1117 3300026078 Ga0207702_10020850 Ga0207702_100208502 166
1118 3300026078 Ga0207702_10080465 Ga0207702_100804653 166
1119 3300026078 Ga0207702_10759369 Ga0207702_107593692 166
1120 3300026088 Ga0207641_10000111 Ga0207641_1000011127 166
1121 3300026088 Ga0207641_10000661 Ga0207641_1000066136 166
1122 3300026088 Ga0207641_10033650 Ga0207641_100336502 166
1123 3300026088 Ga0207641_10138975 Ga0207641_101389753 166
1124 3300026088 Ga0207641_10240177 Ga0207641_102401772 166
1125 3300026088 Ga0207641_10335249 Ga0207641_103352492 166
1126 3300026088 Ga0207641_10363845 Ga0207641_103638452 166
1127 3300026088 Ga0207641_10439788 Ga0207641_104397882 166
1128 3300026088 Ga0207641_10468528 Ga0207641_104685283 166
1129 3300026088 Ga0207641_10767568 Ga0207641_107675681 166
1130 3300026088 Ga0207641_10886595 Ga0207641_108865952 166
1131 3300026089 Ga0207648_10001550 Ga0207648_100015508 166
1132 3300026089 Ga0207648_10002106 Ga0207648_100021063 166
1133 3300026089 Ga0207648_10002777 Ga0207648_100027778 166
1134 3300026089 Ga0207648_10021535 Ga0207648_100215355 166
1135 3300026089 Ga0207648_10082006 Ga0207648_100820063 166
1136 3300026089 Ga0207648_10118716 Ga0207648_101187162 166
1137 3300026089 Ga0207648_10188889 Ga0207648_101888892 166
1138 3300026089 Ga0207648_10533323 Ga0207648_105333232 166
1139 3300026089 Ga0207648_10537286 Ga0207648_105372861 166
1140 3300026089 Ga0207648_10618409 Ga0207648_106184092 166
1141 3300026089 Ga0207648_10641433 Ga0207648_106414331 166
1142 3300026089 Ga0207648_10837418 Ga0207648_108374181 166
1143 3300026095 Ga0207676_10050667 Ga0207676_100506673 166
1144 3300026095 Ga0207676_10053119 Ga0207676_100531192 166
1145 3300026095 Ga0207676_10065397 Ga0207676_100653972 166
1146 3300026095 Ga0207676_10093940 Ga0207676_100939403 166
1147 3300026095 Ga0207676_10511272 Ga0207676_105112721 166
1148 3300026095 Ga0207676_10521235 Ga0207676_105212352 166
1149 3300026095 Ga0207676_10606465 Ga0207676_106064651 166
1150 3300026095 Ga0207676_10650081 Ga0207676_106500812 166
1151 3300026095 Ga0207676_10718557 Ga0207676_107185572 166
1152 3300026116 Ga0207674_10003288 Ga0207674_1000328816 166
1153 3300026116 Ga0207674_10003475 Ga0207674_100034755 166
1154 3300026116 Ga0207674_10048957 Ga0207674_100489571 166
1155 3300026116 Ga0207674_10083735 Ga0207674_100837355 166
1156 3300026116 Ga0207674_10107427 Ga0207674_101074272 166
1157 3300026116 Ga0207674_10147535 Ga0207674_101475353 166
1158 3300026116 Ga0207674_10230182 Ga0207674_102301822 166
1159 3300026116 Ga0207674_10682528 Ga0207674_106825281 166
1160 3300026118 Ga0207675_100001864 Ga0207675_10000186411 166
1161 3300026118 Ga0207675_100009737 Ga0207675_1000097376 166
1162 3300026118 Ga0207675_100015472 Ga0207675_1000154724 166
1163 3300026118 Ga0207675_100068468 Ga0207675_1000684683 166
1164 3300026118 Ga0207675_100192217 Ga0207675_1001922172 166
1165 3300026118 Ga0207675_100229178 Ga0207675_1002291782 166
1166 3300026118 Ga0207675_100531824 Ga0207675_1005318241 166
1167 3300026118 Ga0207675_100839473 Ga0207675_1008394732 166
1168 3300026118 Ga0207675_101028849 Ga0207675_1010288491 166
1169 3300026118 Ga0207675_101044009 Ga0207675_1010440091 166
1170 3300026118 Ga0207675_101077052 Ga0207675_1010770521 166
1171 3300026118 Ga0207675_101177511 Ga0207675_1011775111 166
1172 3300026118 Ga0207675_102263589 Ga0207675_1022635891 166
1173 3300026121 Ga0207683_10003417 Ga0207683_100034176 166
1174 3300026121 Ga0207683_10010127 Ga0207683_100101275 166
1175 3300026121 Ga0207683_10054465 Ga0207683_100544652 166
1176 3300026121 Ga0207683_10068803 Ga0207683_100688032 166
1177 3300026121 Ga0207683_10112602 Ga0207683_101126022 166
1178 3300026121 Ga0207683_10559009 Ga0207683_105590092 166
1179 3300026121 Ga0207683_10581102 Ga0207683_105811021 166
1180 3300026121 Ga0207683_10700970 Ga0207683_107009701 166
1181 3300026121 Ga0207683_11810061 Ga0207683_118100611 166
1182 3300026142 Ga0207698_10003425 Ga0207698_100034257 166
1183 3300026142 Ga0207698_10009487 Ga0207698_100094875 166
1184 3300026142 Ga0207698_10021613 Ga0207698_100216132 166
1185 3300026142 Ga0207698_10046965 Ga0207698_100469654 166
1186 3300026142 Ga0207698_10081677 Ga0207698_100816772 166
1187 3300026142 Ga0207698_10182854 Ga0207698_101828541 166
1188 3300026142 Ga0207698_10250726 Ga0207698_102507262 166
1189 3300026142 Ga0207698_10278190 Ga0207698_102781903 166
1190 3300026142 Ga0207698_10320148 Ga0207698_103201481 166
1191 3300026142 Ga0207698_10419572 Ga0207698_104195721 166
1192 3300026142 Ga0207698_10517869 Ga0207698_105178692 166
1193 3300026142 Ga0207698_10607661 Ga0207698_106076612 166
1194 3300026142 Ga0207698_10971626 Ga0207698_109716261 166
1195 3300026142 Ga0207698_10998083 Ga0207698_109980832 166
1196 3300027395 Ga0209996_1048052 Ga0209996_10480521 166
1197 3300027907 Ga0207428_10009365 Ga0207428_100093657 166
1198 3300028379 Ga0268266_10000068 Ga0268266_1000006871 166
1199 3300028379 Ga0268266_10024264 Ga0268266_100242642 166
1200 3300028379 Ga0268266_10113619 Ga0268266_101136194 166
1201 3300028379 Ga0268266_10365168 Ga0268266_103651682 166
1202 3300028379 Ga0268266_10403331 Ga0268266_104033312 166
1203 3300028379 Ga0268266_10591881 Ga0268266_105918811 166
1204 3300028379 Ga0268266_11890212 Ga0268266_118902121 166
1205 3300028380 Ga0268265_10006095 Ga0268265_100060959 166
1206 3300028380 Ga0268265_10099857 Ga0268265_100998572 166
1207 3300028380 Ga0268265_10334141 Ga0268265_103341413 166
1208 3300028380 Ga0268265_10341654 Ga0268265_103416541 166
1209 3300028380 Ga0268265_10362237 Ga0268265_103622372 166
1210 3300028380 Ga0268265_10616475 Ga0268265_106164752 166
1211 3300028380 Ga0268265_11817972 Ga0268265_118179721 166
1212 3300028381 Ga0268264_10000079 Ga0268264_1000007925 166
1213 3300028381 Ga0268264_10002203 Ga0268264_1000220312 166
1214 3300028381 Ga0268264_10004438 Ga0268264_100044383 166
1215 3300028381 Ga0268264_10008001 Ga0268264_100080016 166
1216 3300028381 Ga0268264_10019796 Ga0268264_100197966 166
1217 3300028381 Ga0268264_10078043 Ga0268264_100780432 166
1218 3300028381 Ga0268264_10113975 Ga0268264_101139753 166
1219 3300028381 Ga0268264_10133846 Ga0268264_101338462 166
1220 3300028381 Ga0268264_10144967 Ga0268264_101449672 166
1221 3300028381 Ga0268264_10230957 Ga0268264_102309572 166
1222 3300028381 Ga0268264_10286460 Ga0268264_102864602 166
1223 3300028381 Ga0268264_10303017 Ga0268264_103030171 166
1224 3300028381 Ga0268264_10310894 Ga0268264_103108942 166
1225 3300028381 Ga0268264_10797505 Ga0268264_107975052 166
1226 3300028381 Ga0268264_10880282 Ga0268264_108802822 166
1227 3300028381 Ga0268264_11324138 Ga0268264_113241381 166
1228 3300028786 Ga0307517_10002947 Ga0307517_1000294713 166
1229 3300028786 Ga0307517_10063397 Ga0307517_100633971 166
1230 3300028794 Ga0307515_10000162 Ga0307515_1000016298 166
1231 3300028800 Ga0265338_10085655 Ga0265338_100856552 166
1232 3300030521 Ga0307511_10002426 Ga0307511_100024265 166
1233 3300030522 Ga0307512_10242718 Ga0307512_102427181 166
1234 3300030760 Ga0265762_1028110 Ga0265762_10281101 166
1235 3300031251 Ga0265327_10000211 Ga0265327_1000021149 166
1236 3300031251 Ga0265327_10056221 Ga0265327_100562212 166
1237 3300031251 Ga0265327_10164882 Ga0265327_101648821 166
1238 3300031456 Ga0307513_10011825 Ga0307513_1001182510 166
1239 3300031456 Ga0307513_10030364 Ga0307513_100303647 166
1240 3300031456 Ga0307513_10424886 Ga0307513_104248862 166
1241 3300031456 Ga0307513_10440001 Ga0307513_104400012 166
1242 3300031456 Ga0307513_10470463 Ga0307513_104704632 166
1243 3300031507 Ga0307509_10025814 Ga0307509_100258143 166
1244 3300031507 Ga0307509_10068967 Ga0307509_100689671 166
1245 3300031507 Ga0307509_10073437 Ga0307509_100734372 166
1246 3300031595 Ga0265313_10009958 Ga0265313_100099581 166
1247 3300031616 Ga0307508_10000686 Ga0307508_1000068613 166
1248 3300031730 Ga0307516_10003590 Ga0307516_1000359019 166
1249 3300031730 Ga0307516_10109739 Ga0307516_101097392 166
1250 3300031814 Ga0247548_103414 Ga0247548_1034142 166
1251 3300031824 Ga0307413_10437849 Ga0307413_104378492 166
1252 3300031852 Ga0307410_10032504 Ga0307410_100325043 166
1253 3300031852 Ga0307410_10542314 Ga0307410_105423142 166
1254 3300031903 Ga0307407_10346717 Ga0307407_103467172 166
1255 3300032002 Ga0307416_101792331 Ga0307416_1017923311 166
1256 3300032005 Ga0307411_11041394 Ga0307411_110413942 166
1257 3300032120 Ga0316053_106418 Ga0316053_1064182 166
1258 3300033180 Ga0307510_10009449 Ga0307510_100094493 166
1259 3300035086 Ga0373934_0024384 Ga0373934_0024384_1792_2292 166
1260 3300035117 Ga0373953_0062896 Ga0373953_0062896_599_1099 166
1261 3300035119 Ga0373956_0014883 Ga0373956_0014883_1055_1555 166
1262 3300035170 Ga0373943_0200393 Ga0373943_0200393_426_926 166
1263 3300035172 Ga0373955_0362955 Ga0373955_0362955_64_567 166
1264 3300035410 Ga0373924_0047247 Ga0373924_0047247_338_841 166
1265 3300035691 Ga0373931_0200936 Ga0373931_0200936_286_786 166
1266 3300035692 Ga0373935_0188483 Ga0373935_0188483_59_559 166
1267 3300035695 Ga0373927_0421245 Ga0373927_0421245_17_517 166
1268 3300035725 Ga0373947_0417939 Ga0373947_0417939_61_561 166
1269 3300036401 Ga0373937_1165108 Ga0373937_1165108_17_547 166
1270 3300036457 Ga0265778_009790 Ga0265778_009790_519_1019 166
1271 3300037312 Ga0395899_0302972 Ga0395899_0302972_333_833 166
1272 3300037418 Ga0395900_0860640 Ga0395900_0860640_240_740 166
1273 3300038443 Ga0395901_0264140 Ga0395901_0264140_1173_1673 166
1274 3300039437 Ga0436365_1006175 Ga0436365_1006175_368_868 166
1275 3300041404 Ga0439436_0001808 Ga0439436_0001808_4855_5355 166
1276 3300041404 Ga0439436_0068781 Ga0439436_0068781_170_709 166
1277 3300041406 Ga0439439_0073858 Ga0439439_0073858_61_561 166
1278 3300041451 Ga0451791_0561649 Ga0451791_0561649_33_533 166
1279 3300041451 Ga0451791_0610277 Ga0451791_0610277_385_885 166
1280 3300041453 Ga0451797_1589118 Ga0451797_1589118_60_560 166
1281 3300041456 Ga0451795_0658710 Ga0451795_0658710_12_512 166
1282 3300041459 Ga0451800_0870425 Ga0451800_0870425_83_583 166
1283 3300041463 Ga0451804_1163584 Ga0451804_1163584_1397_1897 166
1284 3300041486 Ga0451807_2034630 Ga0451807_2034630_35_535 166
1285 3300041486 Ga0451807_2520669 Ga0451807_2520669_141_641 166
1286 3300041492 Ga0451835_0796468 Ga0451835_0796468_127_627 166
1287 3300041494 Ga0451837_0151272 Ga0451837_0151272_77_577 166
1288 3300041496 Ga0451839_0417715 Ga0451839_0417715_177_677 166
1289 3300041507 Ga0451851_1315133 Ga0451851_1315133_193_693 166
1290 3300041509 Ga0451843_0280491 Ga0451843_0280491_467_967 166
1291 3300041512 Ga0451853_2369279 Ga0451853_2369279_217_717 166
1292 3300041512 Ga0451853_3113474 Ga0451853_3113474_271_771 166
1293 3300041916 Ga0452271_00284 Ga0452271_00284_161_661 166
1294 3300042007 Ga0439449_0017943 Ga0439449_0017943_1157_1657 166
1295 3300042011 Ga0439454_022306 Ga0439454_022306_90_596 166
1296 3300042012 Ga0439455_0093612 Ga0439455_0093612_175_675 166
1297 3300042014 Ga0439457_007741 Ga0439457_007741_1236_1736 166
1298 3300042015 Ga0439462_0000316 Ga0439462_0000316_6164_6664 166
1299 3300042015 Ga0439462_0016281 Ga0439462_0016281_776_1276 166
1300 3300042131 Ga0450894_003510 Ga0450894_003510_1311_1817 166
1301 3300042435 Ga0439434_0031310 Ga0439434_0031310_367_867 166
1302 3300042532 Ga0450893_0034783 Ga0450893_0034783_65_571 166
1303 3300042876 Ga0451577_0010418 Ga0451577_0010418_5497_5997 166
1304 3300042876 Ga0451577_0077486 Ga0451577_0077486_710_1210 166
1305 3300042876 Ga0451577_0115853 Ga0451577_0115853_1544_2044 166
1306 3300044656 Ga0466969_0001839 Ga0466969_0001839_739_1239 166
1307 3300044658 Ga0466972_0000047 Ga0466972_0000047_69882_70382 166
1308 3300044658 Ga0466972_0016295 Ga0466972_0016295_162_662 166
1309 3300044658 Ga0466972_0020214 Ga0466972_0020214_2226_2726 166
1310 3300044658 Ga0466972_0245505 Ga0466972_0245505_246_746 166
1311 3300044673 Ga0453683_0512605 Ga0453683_0512605_40_540 166
1312 3300044683 Ga0466965_0041591 Ga0466965_0041591_1188_1688 166
1313 3300044684 Ga0466966_0000047 Ga0466966_0000047_60267_60767 166
1314 3300044693 Ga0466961_0143690 Ga0466961_0143690_99_599 166
1315 3300044693 Ga0466961_0233268 Ga0466961_0233268_301_801 166
1316 3300044706 Ga0466964_0064418 Ga0466964_0064418_213_713 166
1317 3300044712 Ga0453684_0457166 Ga0453684_0457166_282_782 166
1318 3300044712 Ga0453684_0906061 Ga0453684_0906061_68_568 166
1319 3300044719 Ga0466971_0473029 Ga0466971_0473029_83_583 166
1320 3300044735 Ga0466968_0269485 Ga0466968_0269485_273_773 166
1321 3300044765 Ga0466970_0290958 Ga0466970_0290958_339_839 166
1322 3300044842 Ga0466957_0000937 Ga0466957_0000937_4123_4623 166
1323 3300044842 Ga0466957_0023370 Ga0466957_0023370_1104_1604 166
1324 3300044842 Ga0466957_0690407 Ga0466957_0690407_13_513 166
1325 3300045049 Ga0466959_0000065 Ga0466959_0000065_51343_51843 166
1326 3300046454 Ga0495592_0143158 Ga0495592_0143158_838_1338 166
1327 3300046454 Ga0495592_0551554 Ga0495592_0551554_192_695 166
1328 3300046460 Ga0495638_0087756 Ga0495638_0087756_1318_1818 166
1329 3300046460 Ga0495638_0147545 Ga0495638_0147545_833_1333 166
1330 3300046460 Ga0495638_0437710 Ga0495638_0437710_37_537 166
1331 3300046463 Ga0495653_0072165 Ga0495653_0072165_956_1456 166
1332 3300046471 Ga0495650_0014356 Ga0495650_0014356_180_680 166
1333 3300046472 Ga0495580_0160391 Ga0495580_0160391_940_1440 166
1334 3300046473 Ga0495582_0279297 Ga0495582_0279297_152_655 166
1335 3300046499 Ga0495594_0474533 Ga0495594_0474533_179_679 166
1336 3300046511 Ga0495608_0142584 Ga0495608_0142584_884_1384 166
1337 3300046514 Ga0495618_0179402 Ga0495618_0179402_633_1133 166
1338 3300046516 Ga0495628_0046468 Ga0495628_0046468_2063_2563 166
1339 3300046517 Ga0495630_0043935 Ga0495630_0043935_2269_2769 166
1340 3300046517 Ga0495630_0273931 Ga0495630_0273931_695_1198 166
1341 3300046519 Ga0495632_0273517 Ga0495632_0273517_129_629 166
1342 3300046522 Ga0495643_0107254 Ga0495643_0107254_468_974 166
1343 3300046524 Ga0495648_0003925 Ga0495648_0003925_7980_8480 166
1344 3300046529 Ga0495652_0654985 Ga0495652_0654985_121_624 166
1345 3300046533 Ga0495640_0527989 Ga0495640_0527989_162_665 166
1346 3300046536 Ga0495587_0077150 Ga0495587_0077150_1010_1510 166
1347 3300046538 Ga0495609_0233480 Ga0495609_0233480_194_694 166
1348 3300046558 Ga0495633_0166331 Ga0495633_0166331_451_954 166
1349 3300046616 Ga0495668_0001854 Ga0495668_0001854_16680_17180 166
1350 3300046642 Ga0495634_0099901 Ga0495634_0099901_966_1466 166
1351 3300046648 Ga0495611_0000435 Ga0495611_0000435_16740_17240 166
1352 3300046648 Ga0495611_0054059 Ga0495611_0054059_650_1150 166
1353 3300046648 Ga0495611_0172206 Ga0495611_0172206_59_559 166
1354 3300046660 Ga0495625_0171459 Ga0495625_0171459_155_655 166
1355 3300046660 Ga0495625_0235621 Ga0495625_0235621_251_751 166
1356 3300046680 Ga0495646_0185718 Ga0495646_0185718_290_790 166
1357 3300046681 Ga0495647_0183159 Ga0495647_0183159_195_698 166
1358 3300046683 Ga0495658_0577004 Ga0495658_0577004_13_513 166
1359 3300046683 Ga0495658_0605059 Ga0495658_0605059_46_549 166
1360 3300046689 Ga0495613_0241201 Ga0495613_0241201_257_757 166
1361 3300046694 Ga0495649_0020964 Ga0495649_0020964_2064_2564 166
1362 3300046694 Ga0495649_0165133 Ga0495649_0165133_359_859 166
1363 3300046694 Ga0495649_0359783 Ga0495649_0359783_188_688 166
1364 3300046809 Ga0495600_0210469 Ga0495600_0210469_373_873 166
1365 3300047319 Ga0495674_0516196 Ga0495674_0516196_106_609 166
1366 3300047320 Ga0495672_0032233 Ga0495672_0032233_1535_2035 166
1367 3300047320 Ga0495672_0045647 Ga0495672_0045647_1250_1750 166
1368 3300047443 Ga0495687_000058 Ga0495687_000058_2391_2891 166
1369 3300047444 Ga0495675_0164974 Ga0495675_0164974_548_1048 166
1370 3300047472 Ga0495686_0000005 Ga0495686_0000005_373389_373889 166
1371 3300047472 Ga0495686_0314362 Ga0495686_0314362_118_618 166
1372 3300047673 Ga0495593_0465706 Ga0495593_0465706_31_534 166
1373 3300048903 Ga0496100_0022116 Ga0496100_0022116_3228_3728 166
1374 3300048903 Ga0496100_1071295 Ga0496100_1071295_19_519 166
1375 3300048904 Ga0496101_0078704 Ga0496101_0078704_1789_2289 166
1376 3300048905 Ga0496102_0431248 Ga0496102_0431248_623_1126 166
1377 3300048905 Ga0496102_0785145 Ga0496102_0785145_95_595 166
1378 3300048907 Ga0496104_0102316 Ga0496104_0102316_1627_2127 166
1379 3300048907 Ga0496104_0294681 Ga0496104_0294681_13_513 166
1380 3300048907 Ga0496104_0562736 Ga0496104_0562736_429_932 166
1381 3300048907 Ga0496104_0690172 Ga0496104_0690172_336_836 166
1382 3300048908 Ga0496105_0104890 Ga0496105_0104890_1614_2114 166
1383 3300048913 Ga0496110_0009120 Ga0496110_0009120_7258_7758 166
1384 3300048913 Ga0496110_0583184 Ga0496110_0583184_332_832 166
1385 3300048914 Ga0496111_0888989 Ga0496111_0888989_88_588 166
1386 3300048917 Ga0496114_0060428 Ga0496114_0060428_909_1409 166
1387 3300048917 Ga0496114_0542910 Ga0496114_0542910_151_651 166
1388 3300048918 Ga0496115_0311462 Ga0496115_0311462_688_1191 166
1389 3300048927 Ga0496124_0025722 Ga0496124_0025722_2273_2773 166
1390 3300049127 Ga0501306_020602 Ga0501306_020602_28_528 166
1391 3300049127 Ga0501306_023486 Ga0501306_023486_314_814 166
1392 3300049127 Ga0501306_029430 Ga0501306_029430_257_757 166
1393 3300049127 Ga0501306_029588 Ga0501306_029588_267_767 166
1394 3300049127 Ga0501306_073237 Ga0501306_073237_47_547 166
1395 3300049128 Ga0501308_015523 Ga0501308_015523_225_725 166
1396 3300049128 Ga0501308_019267 Ga0501308_019267_127_627 166
1397 3300049128 Ga0501308_044528 Ga0501308_044528_104_604 166
1398 3300049128 Ga0501308_048431 Ga0501308_048431_78_578 166
1399 3300049129 Ga0501309_026316 Ga0501309_026316_310_810 166
1400 3300049129 Ga0501309_045566 Ga0501309_045566_114_614 166
1401 3300049130 Ga0501310_035532 Ga0501310_035532_72_572 166
1402 3300049130 Ga0501310_038151 Ga0501310_038151_134_634 166
1403 3300049132 Ga0501343_014432 Ga0501343_014432_121_621 166
1404 3300049133 Ga0501344_06775 Ga0501344_06775_48_548 166
1405 3300049160 Ga0501304_009793 Ga0501304_009793_237_737 166
1406 3300049160 Ga0501304_030658 Ga0501304_030658_14_514 166
1407 3300049161 Ga0501305_011364 Ga0501305_011364_10_510 166
1408 3300049161 Ga0501305_023982 Ga0501305_023982_316_816 166
1409 3300049162 Ga0501307_015588 Ga0501307_015588_106_606 166
1410 3300049162 Ga0501307_071311 Ga0501307_071311_37_537 166
1411 3300049527 Ga0501311_039794 Ga0501311_039794_198_698 166
1412 3300049527 Ga0501311_051601 Ga0501311_051601_132_632 166
1413 3300049528 Ga0501312_020191 Ga0501312_020191_235_735 166
1414 3300049528 Ga0501312_036407 Ga0501312_036407_226_726 166
1415 3300049528 Ga0501312_057184 Ga0501312_057184_157_657 166
1416 3300049529 Ga0501313_020182 Ga0501313_020182_149_649 166
1417 3300049530 Ga0501314_019372 Ga0501314_019372_60_560 166
1418 3300049531 Ga0501315_006608 Ga0501315_006608_608_1108 166
1419 3300049531 Ga0501315_029210 Ga0501315_029210_74_574 166
1420 3300049531 Ga0501315_034424 Ga0501315_034424_148_648 166
1421 3300049531 Ga0501315_038411 Ga0501315_038411_58_558 166
1422 3300049532 Ga0501316_038392 Ga0501316_038392_71_571 166
1423 3300049533 Ga0501317_023266 Ga0501317_023266_185_685 166
1424 3300049533 Ga0501317_073580 Ga0501317_073580_27_527 166
1425 3300049535 Ga0501319_013389 Ga0501319_013389_134_634 166
1426 3300049537 Ga0501321_032085 Ga0501321_032085_131_631 166
1427 3300049539 Ga0501323_068822 Ga0501323_068822_54_554 166
1428 3300049540 Ga0501324_018982 Ga0501324_018982_40_540 166
1429 3300049550 Ga0501334_08988 Ga0501334_08988_100_600 166
1430 3300049552 Ga0501336_013424 Ga0501336_013424_44_544 166
1431 3300049552 Ga0501336_024268 Ga0501336_024268_22_522 166
1432 3300049556 Ga0501340_011543 Ga0501340_011543_86_586 166
1433 3300049568 Ga0501031_0011346 Ga0501031_0011346_3948_4448 166
1434 3300049569 Ga0501032_0016212 Ga0501032_0016212_3258_3758 166
1435 3300049570 Ga0501033_0148587 Ga0501033_0148587_997_1497 166
1436 3300049571 Ga0501034_0000004 Ga0501034_0000004_208950_209450 166
1437 3300049571 Ga0501034_0038295 Ga0501034_0038295_2412_2936 166
1438 3300049571 Ga0501034_0156703 Ga0501034_0156703_289_789 166
1439 3300049571 Ga0501034_0221323 Ga0501034_0221323_544_1047 166
1440 3300049572 Ga0501036_0064864 Ga0501036_0064864_1459_1959 166
1441 3300049573 Ga0501037_0073362 Ga0501037_0073362_878_1378 166
1442 3300049573 Ga0501037_0094630 Ga0501037_0094630_789_1313 166
1443 3300049574 Ga0501038_0031875 Ga0501038_0031875_2794_3294 166
1444 3300049574 Ga0501038_0160713 Ga0501038_0160713_1027_1551 166
1445 3300049574 Ga0501038_0341423 Ga0501038_0341423_91_591 166
1446 3300049575 Ga0501039_0069150 Ga0501039_0069150_1552_2076 166
1447 3300049575 Ga0501039_0440216 Ga0501039_0440216_235_735 166
1448 3300049578 Ga0501042_0667506 Ga0501042_0667506_49_573 166
1449 3300049579 Ga0501043_0182147 Ga0501043_0182147_449_949 166
1450 3300049579 Ga0501043_0696340 Ga0501043_0696340_95_619 166
1451 3300049580 Ga0501046_0059769 Ga0501046_0059769_1287_1787 166
1452 3300049580 Ga0501046_0070301 Ga0501046_0070301_1273_1797 166
1453 3300049581 Ga0501047_0104968 Ga0501047_0104968_1912_2412 166
1454 3300049581 Ga0501047_0324513 Ga0501047_0324513_377_877 166
1455 3300049581 Ga0501047_0684518 Ga0501047_0684518_40_540 166
1456 3300049582 Ga0501048_0052768 Ga0501048_0052768_1232_1756 166
1457 3300049582 Ga0501048_0166124 Ga0501048_0166124_364_867 166
1458 3300049583 Ga0501067_0078807 Ga0501067_0078807_1104_1628 166
1459 3300049583 Ga0501067_0178652 Ga0501067_0178652_106_609 166
1460 3300049583 Ga0501067_0605946 Ga0501067_0605946_46_546 166
1461 3300049584 Ga0501068_0116026 Ga0501068_0116026_636_1139 166
1462 3300049585 Ga0501069_0265062 Ga0501069_0265062_270_773 166
1463 3300049587 Ga0501071_0079981 Ga0501071_0079981_731_1234 166
1464 3300049588 Ga0501072_0378227 Ga0501072_0378227_609_1109 166
1465 3300049588 Ga0501072_0839155 Ga0501072_0839155_163_687 166
1466 3300049589 Ga0501073_0136283 Ga0501073_0136283_615_1139 166
1467 3300049590 Ga0501074_0016995 Ga0501074_0016995_1493_2017 166
1468 3300049705 Ga0501225_0004193 Ga0501225_0004193_3372_3872 166
1469 3300049742 Ga0501080_0241525 Ga0501080_0241525_357_860 166
1470 3300049742 Ga0501080_0665087 Ga0501080_0665087_112_612 166
1471 3300049742 Ga0501080_0697459 Ga0501080_0697459_292_795 166
1472 3300049744 Ga0501083_0038490 Ga0501083_0038490_1798_2322 166
1473 3300049744 Ga0501083_0066762 Ga0501083_0066762_266_766 166
1474 3300049744 Ga0501083_0075836 Ga0501083_0075836_101_604 166
1475 3300049822 Ga0501035_0082386 Ga0501035_0082386_1924_2448 166
1476 3300049822 Ga0501035_0216770 Ga0501035_0216770_881_1381 166
1477 3300049822 Ga0501035_0326710 Ga0501035_0326710_472_972 166
1478 3300049822 Ga0501035_0486912 Ga0501035_0486912_144_647 166
1479 3300049822 Ga0501035_0488862 Ga0501035_0488862_469_969 166
1480 3300049823 Ga0501044_0092260 Ga0501044_0092260_1811_2311 166
1481 3300049823 Ga0501044_0209997 Ga0501044_0209997_789_1289 166
1482 3300049823 Ga0501044_0709142 Ga0501044_0709142_253_753 166
1483 3300049823 Ga0501044_0846074 Ga0501044_0846074_270_770 166
1484 3300050491 nmdc:mga00v17_468702_c1 nmdc:mga00v17_468702_c1_153_653 166
1485 3300050493 nmdc:mga0k408_15433_c1 nmdc:mga0k408_15433_c1_2683_3183 166
1486 3300050493 nmdc:mga0k408_173576_c1 nmdc:mga0k408_173576_c1_136_636 166
1487 3300050493 nmdc:mga0k408_210511_c1 nmdc:mga0k408_210511_c1_192_692 166
1488 3300050493 nmdc:mga0k408_57726_c1 nmdc:mga0k408_57726_c1_938_1438 166
1489 3300050493 nmdc:mga0k408_60000_c1 nmdc:mga0k408_60000_c1_1440_1940 166
1490 3300050493 nmdc:mga0k408_71296_c1 nmdc:mga0k408_71296_c1_130_630 166
1491 3300050493 nmdc:mga0k408_88131_c1 nmdc:mga0k408_88131_c1_1015_1515 166
1492 3300050496 nmdc:mga07m45_285829_c1 nmdc:mga07m45_285829_c1_62_562 166
1493 3300050496 nmdc:mga07m45_424286_c1 nmdc:mga07m45_424286_c1_230_730 166
1494 3300050507 nmdc:mga05p37_450122_c1 nmdc:mga05p37_450122_c1_231_731 166
1495 3300050511 nmdc:mga08y16_13908_c1 nmdc:mga08y16_13908_c1_2739_3239 166
1496 3300050511 nmdc:mga08y16_181367_c1 nmdc:mga08y16_181367_c1_1647_2150 166
1497 3300050512 nmdc:mga0n895_26949_c1 nmdc:mga0n895_26949_c1_4206_4706 166
1498 3300050513 nmdc:mga0rr50_521263_c1 nmdc:mga0rr50_521263_c1_286_786 166
1499 3300053086 Ga0500578_0000765 Ga0500578_0000765_19248_19748 166
1500 3300053086 Ga0500578_0071393 Ga0500578_0071393_46_546 166
1501 3300053086 Ga0500578_0461766 Ga0500578_0461766_179_679 166
1502 3300053087 Ga0500643_166056 Ga0500643_166056_57_557 166
1503 3300053090 Ga0500646_0005187 Ga0500646_0005187_408_908 166
1504 3300053090 Ga0500646_0023739 Ga0500646_0023739_663_1163 166
1505 3300053090 Ga0500646_0111081 Ga0500646_0111081_352_852 166
1506 3300053092 Ga0500583_0000003 Ga0500583_0000003_72216_72716 166
1507 3300053092 Ga0500583_0008462 Ga0500583_0008462_1175_1675 166
1508 3300053096 Ga0500641_0008479 Ga0500641_0008479_1693_2193 166
1509 3300053096 Ga0500641_0292843 Ga0500641_0292843_151_651 166
1510 3300053098 Ga0500650_0011604 Ga0500650_0011604_3022_3522 166
1511 3300053099 Ga0500654_199620 Ga0500654_199620_95_595 166
1512 3300053103 Ga0500555_002160 Ga0500555_002160_2285_2785 166
1513 3300053104 Ga0500556_0016645 Ga0500556_0016645_1453_1953 166
1514 3300053108 Ga0500562_032145 Ga0500562_032145_499_999 166
1515 3300053118 Ga0500594_0166233 Ga0500594_0166233_51_551 166
1516 3300053126 Ga0500621_129805 Ga0500621_129805_310_810 166
1517 3300053130 Ga0500642_0006418 Ga0500642_0006418_2741_3241 166
1518 3300053130 Ga0500642_0008766 Ga0500642_0008766_676_1176 166
1519 3300053130 Ga0500642_0176466 Ga0500642_0176466_156_656 166
1520 3300053130 Ga0500642_0291480 Ga0500642_0291480_197_697 166
1521 3300053131 Ga0500652_089437 Ga0500652_089437_36_536 166
1522 3300053131 Ga0500652_126792 Ga0500652_126792_298_798 166
1523 3300053133 Ga0500655_004076 Ga0500655_004076_1462_1962 166
1524 3300053133 Ga0500655_016378 Ga0500655_016378_144_644 166
1525 3300053134 Ga0500658_0092683 Ga0500658_0092683_695_1195 166
1526 3300053136 Ga0500559_0096701 Ga0500559_0096701_509_1009 166
1527 3300053139 Ga0500568_0033671 Ga0500568_0033671_1140_1640 166
1528 3300053139 Ga0500568_0136927 Ga0500568_0136927_273_773 166
1529 3300053140 Ga0500573_0318135 Ga0500573_0318135_11_511 166
1530 3300053146 Ga0500588_0000576 Ga0500588_0000576_264_764 166
1531 3300053146 Ga0500588_0011679 Ga0500588_0011679_810_1310 166
1532 3300053147 Ga0500589_051369 Ga0500589_051369_1003_1503 166
1533 3300053147 Ga0500589_149284 Ga0500589_149284_207_707 166
1534 3300053151 Ga0500604_0004024 Ga0500604_0004024_2449_2949 166
1535 3300053151 Ga0500604_0065920 Ga0500604_0065920_492_992 166
1536 3300053151 Ga0500604_0066789 Ga0500604_0066789_592_1092 166
1537 3300053153 Ga0500616_0003349 Ga0500616_0003349_7466_7966 166
1538 3300053153 Ga0500616_0187851 Ga0500616_0187851_218_718 166
1539 3300053156 Ga0500622_0020789 Ga0500622_0020789_1857_2357 166
1540 3300053156 Ga0500622_0046969 Ga0500622_0046969_1416_1916 166
1541 3300053160 Ga0500633_0240254 Ga0500633_0240254_164_664 166
1542 3300053163 Ga0500639_102242 Ga0500639_102242_795_1295 166
1543 3300053178 Ga0500637_0042051 Ga0500637_0042051_1351_1851 166
1544 3300053178 Ga0500637_0042775 Ga0500637_0042775_797_1297 166
1545 3300053178 Ga0500637_0199242 Ga0500637_0199242_29_529 166
1546 3300053727 Ga0500611_000155 Ga0500611_000155_3847_4347 166
1547 3300054114 Ga0501084_0456261 Ga0501084_0456261_308_811 166
1548 3300059477 Ga0587084_018264 Ga0587084_018264_413_913 166
1549 3300059492 Ga0587073_0065816 Ga0587073_0065816_137_637 166
1550 3300059493 Ga0587077_026657 Ga0587077_026657_111_611 166
1551 3300059503 Ga0587080_052881 Ga0587080_052881_185_685 166
1552 3300059503 Ga0587080_058819 Ga0587080_058819_186_686 166
1553 3300059504 Ga0587082_067543 Ga0587082_067543_128_628 166
1554 3300059505 Ga0587083_0035801 Ga0587083_0035801_388_888 166
1555 3300059506 Ga0587085_033012 Ga0587085_033012_133_633 166
1556 3300059507 Ga0587086_033745 Ga0587086_033745_145_645 166
1557 3300059508 Ga0587088_014397 Ga0587088_014397_127_627 166
1558 3300059508 Ga0587088_058532 Ga0587088_058532_99_599 166
1559 3300059508 Ga0587088_059318 Ga0587088_059318_80_580 166
1560 3300059509 Ga0587089_072571 Ga0587089_072571_57_557 166
1561 3300059510 Ga0587090_018239 Ga0587090_018239_508_1008 166
1562 3300059510 Ga0587090_105753 Ga0587090_105753_45_545 166
1563 3300059604 Ga0587098_045543 Ga0587098_045543_71_571 166
1564 3300059605 Ga0587106_081430 Ga0587106_081430_13_513 166
1565 3300059622 Ga0587099_027090 Ga0587099_027090_89_589 166
1566 3300059623 Ga0587101_009100 Ga0587101_009100_54_554 166
1567 3300059624 Ga0587109_048730 Ga0587109_048730_142_642 166
1568 3300059625 Ga0587113_034899 Ga0587113_034899_73_573 166
1569 3300059630 Ga0587128_049683 Ga0587128_049683_99_599 166
1570 3300059631 Ga0587130_015633 Ga0587130_015633_157_657 166
1571 3300059639 Ga0587062_008766 Ga0587062_008766_662_1162 166
1572 3300059640 Ga0587067_029795 Ga0587067_029795_295_795 166
1573 3300059640 Ga0587067_081838 Ga0587067_081838_168_668 166
1574 3300059645 Ga0587076_010100 Ga0587076_010100_133_633 166
1575 3300059648 Ga0587100_020743 Ga0587100_020743_61_561 166
1576 3300059652 Ga0587107_021210 Ga0587107_021210_129_629 166
1577 3300059652 Ga0587107_083939 Ga0587107_083939_62_562 166
1578 3300059653 Ga0587108_009588 Ga0587108_009588_54_554 166
1579 3300059655 Ga0587114_088944 Ga0587114_088944_15_515 166
1580 3300059660 Ga0587124_023954 Ga0587124_023954_41_541 166
1581 3300060346 Ga0587111_0050904 Ga0587111_0050904_363_863 166
1582 3300060353 Ga0501082_0531371 Ga0501082_0531371_220_723 166

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF08281

Sigma70_r4_2

Sigma-70, region 4

138

190

0.95

PF22029

PhyR_sigma2

Sigma2 domain of PhyR

41

94

0.94

PF04542

Sigma70_r2

Sigma-70 region 2

39

107

0.93

PF07638

Sigma70_ECF

ECF sigma factor

50

196

0.81

Feature Viewer

pLDDT pTM Quality
83.19 0.48 Low
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map