F494869

General Info

Members Datasets Scaffolds Average Seq Length
1576 392 1575 324

Family's Representative Sequence

Representative Sequence 3300050512|nmdc:mga0n895_107425_c1|nmdc:mga0n895_107425_c1_599_1750
Length 375
Sequence MSLVLDRYGILDKSRSRLRRAEVPGIGHAMGSTGAIGERPTFNAHWEENMLKLPRRRFLHLAAGAAALPVVPRIAMAQAFPTRPVRIVVPFAAGGATDIIARLIGQWLSERLGQQFVIENRPGAGSNIGTEMVVNAPPDGYTLLQVGASSAINATLYEKLSFNFLRDIAPVSGIISIPFIMAVNPSFPAKTVSEFIAYARANPGKVNMASGGNGTAGHLSGELFKMMAGINMVHVPYRGEGPALTDMLGGQVQAMFGTMPASIEYVRAGKLRPLAVTSARRSELLPDLPTVGDFVPGYETSAWQGIGAPKNTPAEIINKFNKEINAGLADPKIKTRVADMGGTVLAGSPADFDKLIADETEKWGQVVKFSGAKPD

Samples

Sample ID Description Type Environment
1 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
2 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
3 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
15 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
16 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
17 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
18 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
19 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
20 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
21 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
22 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
23 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
24 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
25 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
26 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
27 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
28 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
29 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
30 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
31 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
32 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
33 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
48 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
49 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
50 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
51 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
52 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
53 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
54 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
55 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
56 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
62 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
63 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
64 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
65 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
66 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
67 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
68 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
69 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
70 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
71 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
72 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
73 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
74 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
75 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
76 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
79 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
80 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
81 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
82 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
83 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
87 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
88 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
89 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
90 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
91 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
92 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
95 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
96 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
97 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
98 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
106 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
107 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
108 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
109 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
110 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
115 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
116 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
117 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
118 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
119 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
120 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
121 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
122 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
123 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
124 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
125 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
126 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
127 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
128 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
129 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
130 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
131 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
196 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
197 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
198 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
202 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
203 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
204 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
205 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
206 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
209 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
210 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
211 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
212 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
213 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
214 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
215 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
216 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
217 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
218 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
219 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
220 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
221 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
222 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
223 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
224 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
225 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
226 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
227 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
231 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
232 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
233 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
234 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
235 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
236 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
237 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
238 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
239 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
240 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
241 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
242 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
243 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
244 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
245 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
246 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
247 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
248 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
249 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
250 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
251 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
252 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
253 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
254 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
255 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
256 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
257 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
258 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
259 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
260 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
261 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
262 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
263 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
264 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
265 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
266 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
267 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
268 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
269 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
270 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
271 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
272 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
273 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
274 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
275 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
276 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
277 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
278 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
279 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
280 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
281 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
282 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
283 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
286 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
287 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
288 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
289 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
290 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
291 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
292 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
293 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
294 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
295 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
296 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
297 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
298 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
299 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
302 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
303 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
304 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
305 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
306 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
307 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
308 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
309 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
310 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
313 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
314 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
315 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
316 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
317 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
318 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
319 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
320 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
321 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
322 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
323 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
324 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
325 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
326 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
327 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
338 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
339 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
349 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
350 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
351 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
357 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
358 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
359 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
360 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
361 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
362 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
363 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
364 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
365 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
366 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
367 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
368 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
371 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
372 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
373 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
374 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
375 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
376 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
377 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
378 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
379 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
380 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
381 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
382 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
383 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
384 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
387 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
388 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
391 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
392 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.62
Metatranscriptomes 0.38
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.17
Nodule 0
Rhizoplane 13.45
Rhizosphere 82.68
Stem 0
Stem Tuber 0
Unclassified 0.7

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24743J22301_10006362 3300001991 Bacteria 2010
2 JGI24748J21848_1006701 3300002074 Bacteria 1343
3 JGI24034J26672_10010156 3300002239 Bacteria 1395
4 JGI24742J22300_10015628 3300002244 Bacteria 1277
5 JGI24751J29686_10020555 3300002459 Bacteria 1367
6 JGI25405J52794_10015483 3300003911 Bacteria 1499
7 Ga0070683_100031717 3300005329 Bacteria 4808
8 Ga0070683_100220252 3300005329 Bacteria 1804
9 Ga0070690_100046048 3300005330 Bacteria 2773
10 Ga0070670_100018569 3300005331 Bacteria 5961
11 Ga0070670_100068665 3300005331 Bacteria 3042
12 Ga0070670_100101432 3300005331 Bacteria 2478
13 Ga0070670_100148859 3300005331 Bacteria 2026
14 Ga0070670_100159589 3300005331 Bacteria 1954
15 Ga0070670_100192988 3300005331 Bacteria 1769
16 Ga0068869_100120806 3300005334 Bacteria 2003
17 Ga0070666_10146934 3300005335 Bacteria 1643
18 Ga0070666_10153657 3300005335 Bacteria 1606
19 Ga0068868_100066964 3300005338 Bacteria 2857
20 Ga0068868_100260967 3300005338 Bacteria 1461
21 Ga0070660_100193698 3300005339 Bacteria 1647
22 Ga0070660_100200412 3300005339 Unclassified 1619
23 Ga0070689_100008616 3300005340 Bacteria 7192
24 Ga0070689_100009023 3300005340 Bacteria 7060
25 Ga0070689_100070241 3300005340 Bacteria 2734
26 Ga0070689_100308516 3300005340 Bacteria 1319
27 Ga0070691_10036528 3300005341 Bacteria 2316
28 Ga0070687_100055723 3300005343 Bacteria 2066
29 Ga0070687_100098840 3300005343 Bacteria 1630
30 Ga0070661_100142219 3300005344 Bacteria 1809
31 Ga0070668_100142683 3300005347 Bacteria 1931
32 Ga0070668_100308306 3300005347 Bacteria 1329
33 Ga0070669_100027048 3300005353 Bacteria 4128
34 Ga0070669_100041467 3300005353 Bacteria 3347
35 Ga0070675_100011458 3300005354 Bacteria 6942
36 Ga0070675_100132780 3300005354 Bacteria 2123
37 Ga0070675_100236301 3300005354 Bacteria 1596
38 Ga0070675_100319469 3300005354 Bacteria 1371
39 Ga0070671_100020244 3300005355 Bacteria 5424
40 Ga0070671_100079554 3300005355 Bacteria 2740
41 Ga0070671_100091945 3300005355 Bacteria 2542
42 Ga0070671_100241595 3300005355 Bacteria 1533
43 Ga0070674_100004853 3300005356 Bacteria 7709
44 Ga0070674_100026512 3300005356 Bacteria 3787
45 Ga0070674_100060639 3300005356 Bacteria 2637
46 Ga0070674_100065363 3300005356 Bacteria 2553
47 Ga0070674_100120073 3300005356 Bacteria 1945
48 Ga0070674_100156028 3300005356 Bacteria 1727
49 Ga0070673_100032355 3300005364 Bacteria 3937
50 Ga0070673_100064182 3300005364 Bacteria 2925
51 Ga0070673_100076996 3300005364 Bacteria 2695
52 Ga0070673_100078862 3300005364 Bacteria 2665
53 Ga0070673_100403541 3300005364 Bacteria 1223
54 Ga0070688_100010373 3300005365 Bacteria 5135
55 Ga0070688_100017289 3300005365 Bacteria 4137
56 Ga0070688_100072025 3300005365 Bacteria 2213
57 Ga0070688_100125001 3300005365 Bacteria 1728
58 Ga0070688_100201012 3300005365 Bacteria 1394
59 Ga0070667_100141157 3300005367 Bacteria 2110
60 Ga0070667_100379159 3300005367 Bacteria 1284
61 Ga0070709_10030645 3300005434 Bacteria 3229
62 Ga0070709_10047082 3300005434 Bacteria 2685
63 Ga0070709_10078278 3300005434 Bacteria 2151
64 Ga0070714_100031518 3300005435 Bacteria 4424
65 Ga0070714_100071750 3300005435 Bacteria 2995
66 Ga0070714_100076959 3300005435 Bacteria 2897
67 Ga0070714_100104574 3300005435 Bacteria 2499
68 Ga0070714_100172592 3300005435 Bacteria 1963
69 Ga0070714_100215580 3300005435 Bacteria 1762
70 Ga0070713_100004119 3300005436 Bacteria 9691
71 Ga0070713_100008359 3300005436 Bacteria 7339
72 Ga0070713_100012035 3300005436 Bacteria 6334
73 Ga0070713_100039350 3300005436 Bacteria 3837
74 Ga0070713_100066292 3300005436 Bacteria 3036
75 Ga0070713_100116622 3300005436 Bacteria 2335
76 Ga0070713_100145019 3300005436 Bacteria 2106
77 Ga0070713_100347667 3300005436 Bacteria 1375
78 Ga0070713_100390687 3300005436 Bacteria 1298
79 Ga0070713_100415813 3300005436 Bacteria 1258
80 Ga0070713_100511909 3300005436 Bacteria 1133
81 Ga0070710_10004450 3300005437 Bacteria 6632
82 Ga0070710_10005028 3300005437 Bacteria 6257
83 Ga0070710_10011019 3300005437 Bacteria 4456
84 Ga0070710_10014050 3300005437 Bacteria 4022
85 Ga0070710_10031214 3300005437 Bacteria 2874
86 Ga0070710_10044571 3300005437 Bacteria 2461
87 Ga0070710_10057405 3300005437 Bacteria 2206
88 Ga0070710_10077079 3300005437 Bacteria 1936
89 Ga0070710_10286230 3300005437 Bacteria 1071
90 Ga0070711_100016408 3300005439 Bacteria 4704
91 Ga0070711_100040083 3300005439 Bacteria 3157
92 Ga0070711_100077461 3300005439 Bacteria 2360
93 Ga0070711_100174991 3300005439 Bacteria 1639
94 Ga0070711_100230686 3300005439 Unclassified 1443
95 Ga0070711_100261603 3300005439 Bacteria 1361
96 Ga0070705_100037053 3300005440 Bacteria 2748
97 Ga0070705_100092705 3300005440 Bacteria 1886
98 Ga0070700_100059883 3300005441 Bacteria 2398
99 Ga0070700_100134053 3300005441 Unclassified 1675
100 Ga0070700_100218670 3300005441 Bacteria 1348
101 Ga0070708_100036937 3300005445 Bacteria 4260
102 Ga0070708_100044846 3300005445 Bacteria 3891
103 Ga0070708_100046364 3300005445 Bacteria 3835
104 Ga0070708_100091441 3300005445 Bacteria 2771
105 Ga0070708_100149223 3300005445 Bacteria 2173
106 Ga0070708_100209938 3300005445 Bacteria 1824
107 Ga0070708_100323604 3300005445 Bacteria 1452
108 Ga0070708_100429756 3300005445 Bacteria 1245
109 Ga0070708_100573215 3300005445 Unclassified 1064
110 Ga0070663_100096720 3300005455 Bacteria 2196
111 Ga0070663_100191583 3300005455 Bacteria 1591
112 Ga0070678_100011939 3300005456 Bacteria 5379
113 Ga0070678_100014681 3300005456 Bacteria 4952
114 Ga0070678_100046086 3300005456 Bacteria 3124
115 Ga0070678_100128195 3300005456 Bacteria 2012
116 Ga0070678_100165995 3300005456 Bacteria 1793
117 Ga0070678_100478252 3300005456 Unclassified 1096
118 Ga0070662_100021738 3300005457 Bacteria 4383
119 Ga0070662_100070425 3300005457 Bacteria 2577
120 Ga0070662_100171871 3300005457 Bacteria 1702
121 Ga0070681_10001525 3300005458 Bacteria 20520
122 Ga0070681_10008975 3300005458 Bacteria 9830
123 Ga0068867_100076646 3300005459 Bacteria 2511
124 Ga0068867_100206310 3300005459 Bacteria 1576
125 Ga0070685_10028916 3300005466 Bacteria 3076
126 Ga0070706_100011112 3300005467 Bacteria 8360
127 Ga0070706_100024329 3300005467 Bacteria 5575
128 Ga0070706_100026569 3300005467 Bacteria 5326
129 Ga0070706_100081067 3300005467 Bacteria 3005
130 Ga0070706_100122999 3300005467 Bacteria 2419
131 Ga0070706_100131942 3300005467 Bacteria 2331
132 Ga0070706_100238360 3300005467 Bacteria 1698
133 Ga0070706_100257426 3300005467 Bacteria 1629
134 Ga0070706_100360706 3300005467 Bacteria 1354
135 Ga0070706_100446342 3300005467 Bacteria 1204
136 Ga0070707_100026725 3300005468 Bacteria 5483
137 Ga0070707_100057710 3300005468 Bacteria 3724
138 Ga0070707_100067635 3300005468 Bacteria 3437
139 Ga0070707_100167949 3300005468 Bacteria 2138
140 Ga0070707_100180883 3300005468 Bacteria 2055
141 Ga0070707_100342196 3300005468 Bacteria 1453
142 Ga0070707_100355040 3300005468 Bacteria 1424
143 Ga0070707_100379341 3300005468 Bacteria 1374
144 Ga0070698_100011071 3300005471 Bacteria 9584
145 Ga0070698_100040443 3300005471 Bacteria 4791
146 Ga0070698_100093887 3300005471 Bacteria 2979
147 Ga0070698_100098692 3300005471 Bacteria 2894
148 Ga0070698_100122215 3300005471 Bacteria 2563
149 Ga0070698_100127613 3300005471 Bacteria 2500
150 Ga0070698_100232471 3300005471 Bacteria 1777
151 Ga0070698_100271459 3300005471 Bacteria 1628
152 Ga0070698_100311683 3300005471 Bacteria 1504
153 Ga0070698_100337524 3300005471 Bacteria 1438
154 Ga0070698_100358713 3300005471 Bacteria 1389
155 Ga0070698_100371901 3300005471 Bacteria 1361
156 Ga0070698_100618614 3300005471 Bacteria 1024
157 Ga0070699_100018717 3300005518 Bacteria 5946
158 Ga0070699_100022076 3300005518 Bacteria 5482
159 Ga0070699_100023093 3300005518 Bacteria 5359
160 Ga0070699_100045971 3300005518 Bacteria 3778
161 Ga0070699_100130995 3300005518 Bacteria 2210
162 Ga0070699_100178923 3300005518 Bacteria 1881
163 Ga0070699_100184997 3300005518 Bacteria 1850
164 Ga0070699_100257401 3300005518 Bacteria 1560
165 Ga0070699_100408219 3300005518 Bacteria 1229
166 Ga0070679_100010022 3300005530 Bacteria 8973
167 Ga0070679_100018585 3300005530 Bacteria 6747
168 Ga0070679_100033132 3300005530 Bacteria 5115
169 Ga0070679_100494449 3300005530 Unclassified 1167
170 Ga0070684_100093165 3300005535 Bacteria 2681
171 Ga0070684_100479601 3300005535 Bacteria 1151
172 Ga0070697_100014128 3300005536 Bacteria 6272
173 Ga0070697_100051701 3300005536 Bacteria 3339
174 Ga0070697_100074530 3300005536 Bacteria 2788
175 Ga0070697_100177760 3300005536 Unclassified 1803
176 Ga0070697_100237356 3300005536 Bacteria 1556
177 Ga0070697_100297350 3300005536 Bacteria 1387
178 Ga0070697_100349192 3300005536 Bacteria 1277
179 Ga0070697_100413507 3300005536 Bacteria 1171
180 Ga0070672_100083799 3300005543 Bacteria 2559
181 Ga0070672_100207515 3300005543 Bacteria 1640
182 Ga0070672_100213277 3300005543 Bacteria 1617
183 Ga0070672_100371054 3300005543 Bacteria 1223
184 Ga0070686_100042774 3300005544 Bacteria 2839
185 Ga0070686_100118475 3300005544 Bacteria 1815
186 Ga0070693_100131506 3300005547 Bacteria 1565
187 Ga0070665_100077979 3300005548 Bacteria 3319
188 Ga0070665_100087082 3300005548 Unclassified 3129
189 Ga0070665_100094212 3300005548 Bacteria 3000
190 Ga0070665_100152431 3300005548 Bacteria 2314
191 Ga0070665_100515917 3300005548 Bacteria 1207
192 Ga0070704_100112963 3300005549 Bacteria 2071
193 Ga0068855_100394387 3300005563 Bacteria 1518
194 Ga0070664_100037165 3300005564 Bacteria 4092
195 Ga0070664_100037512 3300005564 Bacteria 4075
196 Ga0070664_100108589 3300005564 Bacteria 2420
197 Ga0068857_100113920 3300005577 Bacteria 2432
198 Ga0068854_100088541 3300005578 Bacteria 2299
199 Ga0068854_100148531 3300005578 Bacteria 1805
200 Ga0068854_100157066 3300005578 Bacteria 1758
201 Ga0068856_100008281 3300005614 Bacteria 10134
202 Ga0070702_100013753 3300005615 Bacteria 4093
203 Ga0070702_100085925 3300005615 Bacteria 1896
204 Ga0068852_100203923 3300005616 Bacteria 1872
205 Ga0068852_100235177 3300005616 Bacteria 1748
206 Ga0068859_100170534 3300005617 Bacteria 2257
207 Ga0068864_100010129 3300005618 Bacteria 7784
208 Ga0068864_100011114 3300005618 Bacteria 7441
209 Ga0068864_100012057 3300005618 Bacteria 7139
210 Ga0068864_100082089 3300005618 Bacteria 2828
211 Ga0068864_100096904 3300005618 Bacteria 2611
212 Ga0068861_100309991 3300005719 Bacteria 1370
213 Ga0068851_10040560 3300005834 Bacteria 2340
214 Ga0068870_10056343 3300005840 Bacteria 2097
215 Ga0068863_100050391 3300005841 Bacteria 3947
216 Ga0068863_100122471 3300005841 Bacteria 2481
217 Ga0068858_100164298 3300005842 Bacteria 2091
218 Ga0068858_100185999 3300005842 Bacteria 1962
219 Ga0068858_100375638 3300005842 Bacteria 1364
220 Ga0068860_100034202 3300005843 Bacteria 4874
221 Ga0068860_100122235 3300005843 Bacteria 2494
222 Ga0068862_100075552 3300005844 Bacteria 2914
223 Ga0068862_100218228 3300005844 Bacteria 1726
224 Ga0081455_10004238 3300005937 Bacteria 16172
225 Ga0081455_10005779 3300005937 Bacteria 13484
226 Ga0081455_10007104 3300005937 Bacteria 11858
227 Ga0081455_10007366 3300005937 Bacteria 11600
228 Ga0081455_10008338 3300005937 Bacteria 10792
229 Ga0081455_10009638 3300005937 Bacteria 9913
230 Ga0081455_10025133 3300005937 Bacteria 5502
231 Ga0081455_10032092 3300005937 Bacteria 4739
232 Ga0081455_10032158 3300005937 Bacteria 4732
233 Ga0081455_10034630 3300005937 Bacteria 4523
234 Ga0081455_10040625 3300005937 Bacteria 4100
235 Ga0081455_10045542 3300005937 Bacteria 3816
236 Ga0081455_10052752 3300005937 Bacteria 3479
237 Ga0081455_10061147 3300005937 Bacteria 3171
238 Ga0081455_10062658 3300005937 Bacteria 3125
239 Ga0081455_10068729 3300005937 Bacteria 2948
240 Ga0081455_10069112 3300005937 Bacteria 2938
241 Ga0081455_10093413 3300005937 Bacteria 2432
242 Ga0081455_10103415 3300005937 Bacteria 2281
243 Ga0081455_10105270 3300005937 Bacteria 2255
244 Ga0081455_10112256 3300005937 Bacteria 2164
245 Ga0081455_10113490 3300005937 Bacteria 2149
246 Ga0081455_10181971 3300005937 Bacteria 1590
247 Ga0081455_10202923 3300005937 Bacteria 1483
248 Ga0081455_10240177 3300005937 Bacteria 1332
249 Ga0081455_10241328 3300005937 Bacteria 1328
250 Ga0081538_10061696 3300005981 Bacteria 2144
251 Ga0081538_10079435 3300005981 Bacteria 1755
252 Ga0081540_1000005 3300005983 Bacteria 227052
253 Ga0081540_1002105 3300005983 Bacteria 16574
254 Ga0081540_1015575 3300005983 Bacteria 4808
255 Ga0081540_1044164 3300005983 Bacteria 2278
256 Ga0081540_1088417 3300005983 Bacteria 1370
257 Ga0081540_1109128 3300005983 Unclassified 1174
258 Ga0081540_1123633 3300005983 Bacteria 1069
259 Ga0081539_10000008 3300005985 Bacteria 525071
260 Ga0070717_10002307 3300006028 Bacteria 13393
261 Ga0070717_10006917 3300006028 Bacteria 8377
262 Ga0070717_10013103 3300006028 Bacteria 6337
263 Ga0070717_10017464 3300006028 Bacteria 5583
264 Ga0070717_10037566 3300006028 Bacteria 3933
265 Ga0070717_10046690 3300006028 Bacteria 3545
266 Ga0070717_10048886 3300006028 Bacteria 3470
267 Ga0070717_10054878 3300006028 Bacteria 3287
268 Ga0070717_10056592 3300006028 Bacteria 3240
269 Ga0070717_10058415 3300006028 Bacteria 3190
270 Ga0070717_10068282 3300006028 Bacteria 2959
271 Ga0070717_10136792 3300006028 Bacteria 2111
272 Ga0070717_10176640 3300006028 Bacteria 1859
273 Ga0070717_10196387 3300006028 Bacteria 1765
274 Ga0070717_10227872 3300006028 Bacteria 1640
275 Ga0070717_10228853 3300006028 Bacteria 1636
276 Ga0070717_10265500 3300006028 Bacteria 1519
277 Ga0070717_10278760 3300006028 Bacteria 1482
278 Ga0070717_10338860 3300006028 Bacteria 1342
279 Ga0070717_10363678 3300006028 Bacteria 1295
280 Ga0070717_10380193 3300006028 Bacteria 1266
281 Ga0075365_10003327 3300006038 Bacteria 8259
282 Ga0075365_10004320 3300006038 Bacteria 7503
283 Ga0075365_10065284 3300006038 Bacteria 2439
284 Ga0075365_10100653 3300006038 Bacteria 1978
285 Ga0075365_10175617 3300006038 Bacteria 1496
286 Ga0075365_10267302 3300006038 Bacteria 1203
287 Ga0075365_10277661 3300006038 Unclassified 1178
288 Ga0075363_100026119 3300006048 Bacteria 2985
289 Ga0075363_100101995 3300006048 Bacteria 1588
290 Ga0075364_10038512 3300006051 Bacteria 3097
291 Ga0075364_10047602 3300006051 Bacteria 2794
292 Ga0070715_10001543 3300006163 Bacteria 6742
293 Ga0070716_100026846 3300006173 Bacteria 3087
294 Ga0070716_100176522 3300006173 Bacteria 1399
295 Ga0070712_100000699 3300006175 Bacteria 19787
296 Ga0070712_100002543 3300006175 Bacteria 11265
297 Ga0070712_100004977 3300006175 Bacteria 8222
298 Ga0070712_100009031 3300006175 Bacteria 6278
299 Ga0070712_100012289 3300006175 Bacteria 5442
300 Ga0070712_100013407 3300006175 Bacteria 5239
301 Ga0070712_100015083 3300006175 Bacteria 4969
302 Ga0070712_100037903 3300006175 Bacteria 3289
303 Ga0070712_100074349 3300006175 Bacteria 2441
304 Ga0070712_100091782 3300006175 Bacteria 2226
305 Ga0070712_100102503 3300006175 Bacteria 2119
306 Ga0070712_100123319 3300006175 Bacteria 1953
307 Ga0070712_100170666 3300006175 Bacteria 1687
308 Ga0070712_100211885 3300006175 Bacteria 1528
309 Ga0070712_100225363 3300006175 Bacteria 1486
310 Ga0070712_100258721 3300006175 Bacteria 1394
311 Ga0070712_100392108 3300006175 Bacteria 1145
312 Ga0070712_100420357 3300006175 Bacteria 1108
313 Ga0075362_10006825 3300006177 Bacteria 4273
314 Ga0075367_10010517 3300006178 Unclassified 4862
315 Ga0075367_10036980 3300006178 Bacteria 2834
316 Ga0075367_10069218 3300006178 Bacteria 2118
317 Ga0075367_10126495 3300006178 Bacteria 1577
318 Ga0075366_10009871 3300006195 Bacteria 5341
319 Ga0075366_10015058 3300006195 Bacteria 4424
320 Ga0075366_10017399 3300006195 Bacteria 4137
321 Ga0075366_10033495 3300006195 Bacteria 3026
322 Ga0075366_10146137 3300006195 Bacteria 1431
323 Ga0097621_100278075 3300006237 Bacteria 1473
324 Ga0075370_10003227 3300006353 Bacteria 7718
325 Ga0075370_10107044 3300006353 Bacteria 1621
326 Ga0075370_10243608 3300006353 Bacteria 1065
327 Ga0068871_100325781 3300006358 Bacteria 1354
328 Ga0075428_100010595 3300006844 Bacteria 10246
329 Ga0075428_100014005 3300006844 Bacteria 8927
330 Ga0075428_100026075 3300006844 Bacteria 6472
331 Ga0075428_100027123 3300006844 Bacteria 6341
332 Ga0075428_100108686 3300006844 Bacteria 3022
333 Ga0075428_100116533 3300006844 Bacteria 2910
334 Ga0075428_100157334 3300006844 Bacteria 2468
335 Ga0075428_100163984 3300006844 Bacteria 2411
336 Ga0075428_100273466 3300006844 Bacteria 1817
337 Ga0075428_100346782 3300006844 Bacteria 1594
338 Ga0075428_100383614 3300006844 Bacteria 1506
339 Ga0075428_100619970 3300006844 Bacteria 1155
340 Ga0075430_100010004 3300006846 Bacteria 8026
341 Ga0075430_100019458 3300006846 Bacteria 5774
342 Ga0075430_100036853 3300006846 Bacteria 4145
343 Ga0075430_100431430 3300006846 Unclassified 1088
344 Ga0075431_100015344 3300006847 Bacteria 7762
345 Ga0075431_100070861 3300006847 Bacteria 3596
346 Ga0075431_100072930 3300006847 Bacteria 3542
347 Ga0075431_100232961 3300006847 Bacteria 1876
348 Ga0075431_100269390 3300006847 Bacteria 1726
349 Ga0075431_100353182 3300006847 Bacteria 1478
350 Ga0075431_100416867 3300006847 Bacteria 1342
351 Ga0075433_10006873 3300006852 Bacteria 9017
352 Ga0075433_10221933 3300006852 Bacteria 1679
353 Ga0075433_10397058 3300006852 Bacteria 1217
354 Ga0075434_100016953 3300006871 Bacteria 7009
355 Ga0075434_100033546 3300006871 Bacteria 5067
356 Ga0075434_100034044 3300006871 Bacteria 5029
357 Ga0075434_100040222 3300006871 Bacteria 4631
358 Ga0075434_100045047 3300006871 Bacteria 4376
359 Ga0075434_100056864 3300006871 Bacteria 3888
360 Ga0075434_100073818 3300006871 Bacteria 3404
361 Ga0075434_100269313 3300006871 Bacteria 1723
362 Ga0075434_100294932 3300006871 Bacteria 1641
363 Ga0075434_100355857 3300006871 Bacteria 1485
364 Ga0075434_100414619 3300006871 Bacteria 1368
365 Ga0075434_100420986 3300006871 Bacteria 1357
366 Ga0075429_100000335 3300006880 Bacteria 34163
367 Ga0075429_100003214 3300006880 Bacteria 13903
368 Ga0075429_100024339 3300006880 Bacteria 5253
369 Ga0075429_100024840 3300006880 Bacteria 5200
370 Ga0075429_100054506 3300006880 Bacteria 3478
371 Ga0075429_100235110 3300006880 Bacteria 1605
372 Ga0068865_100054285 3300006881 Bacteria 2783
373 Ga0068865_100119786 3300006881 Bacteria 1955
374 Ga0068865_100269193 3300006881 Bacteria 1352
375 Ga0075436_100057676 3300006914 Bacteria 2681
376 Ga0075436_100193009 3300006914 Unclassified 1441
377 Ga0097620_100170536 3300006931 Bacteria 2257
378 Ga0075435_100041238 3300007076 Bacteria 3689
379 Ga0075435_100092053 3300007076 Bacteria 2503
380 Ga0075435_100176243 3300007076 Bacteria 1805
381 Ga0075435_100257752 3300007076 Unclassified 1485
382 Ga0075435_100293150 3300007076 Bacteria 1390
383 Ga0075435_100346791 3300007076 Bacteria 1272
384 Ga0075435_100409636 3300007076 Bacteria 1167
385 Ga0099794_10000511 3300007265 Bacteria 13018
386 Ga0099794_10001409 3300007265 Bacteria 8399
387 Ga0099794_10003050 3300007265 Bacteria 6326
388 Ga0099794_10035288 3300007265 Bacteria 2360
389 Ga0099794_10074272 3300007265 Bacteria 1670
390 Ga0099794_10102192 3300007265 Bacteria 1431
391 Ga0099795_10000636 3300007788 Bacteria 6726
392 Ga0099795_10000907 3300007788 Bacteria 5971
393 Ga0099795_10001010 3300007788 Bacteria 5783
394 Ga0099795_10001128 3300007788 Bacteria 5569
395 Ga0099795_10002700 3300007788 Bacteria 4240
396 Ga0099795_10006163 3300007788 Bacteria 3251
397 Ga0099795_10012339 3300007788 Bacteria 2588
398 Ga0099795_10014518 3300007788 Bacteria 2445
399 Ga0099795_10017981 3300007788 Bacteria 2263
400 Ga0099795_10024295 3300007788 Bacteria 2020
401 Ga0099795_10033966 3300007788 Bacteria 1774
402 Ga0099795_10059410 3300007788 Bacteria 1414
403 Ga0099795_10062717 3300007788 Bacteria 1383
404 Ga0099795_10115387 3300007788 Bacteria 1069
405 Ga0105244_10203139 3300009036 Bacteria 934
406 Ga0105250_10066235 3300009092 Bacteria 1456
407 Ga0105240_10071834 3300009093 Bacteria 4279
408 Ga0111539_10000460 3300009094 Bacteria 51154
409 Ga0111539_10007590 3300009094 Bacteria 13859
410 Ga0111539_10011255 3300009094 Bacteria 11241
411 Ga0111539_10029907 3300009094 Bacteria 6626
412 Ga0111539_10054718 3300009094 Bacteria 4747
413 Ga0111539_10067349 3300009094 Bacteria 4228
414 Ga0111539_10080355 3300009094 Bacteria 3835
415 Ga0111539_10108704 3300009094 Bacteria 3255
416 Ga0111539_10111949 3300009094 Bacteria 3202
417 Ga0111539_10265095 3300009094 Bacteria 2000
418 Ga0111539_10466257 3300009094 Bacteria 1471
419 Ga0105245_10025645 3300009098 Bacteria 5183
420 Ga0105245_10175251 3300009098 Bacteria 2045
421 Ga0105245_10179462 3300009098 Unclassified 2022
422 Ga0105245_10391778 3300009098 Bacteria 1386
423 Ga0105247_10012908 3300009101 Bacteria 5011
424 Ga0105247_10030298 3300009101 Bacteria 3279
425 Ga0105247_10067289 3300009101 Bacteria 2231
426 Ga0105247_10098504 3300009101 Bacteria 1866
427 Ga0105247_10170114 3300009101 Bacteria 1448
428 Ga0105247_10298740 3300009101 Bacteria 1116
429 Ga0105247_10342539 3300009101 Bacteria 1049
430 Ga0114129_10004508 3300009147 Bacteria 19647
431 Ga0114129_10016541 3300009147 Bacteria 10503
432 Ga0114129_10031478 3300009147 Bacteria 7498
433 Ga0114129_10032128 3300009147 Bacteria 7420
434 Ga0114129_10163248 3300009147 Bacteria 3041
435 Ga0114129_10194385 3300009147 Bacteria 2752
436 Ga0114129_10197123 3300009147 Bacteria 2730
437 Ga0114129_10254235 3300009147 Bacteria 2357
438 Ga0114129_10269567 3300009147 Unclassified 2278
439 Ga0114129_10349352 3300009147 Bacteria 1960
440 Ga0114129_10441005 3300009147 Bacteria 1709
441 Ga0114129_10569262 3300009147 Bacteria 1471
442 Ga0114129_10806875 3300009147 Bacteria 1197
443 Ga0114129_10838853 3300009147 Unclassified 1169
444 Ga0105243_10126095 3300009148 Bacteria 2166
445 Ga0105243_10178425 3300009148 Bacteria 1845
446 Ga0105243_10213976 3300009148 Bacteria 1699
447 Ga0105242_10021354 3300009176 Bacteria 5081
448 Ga0105242_10033095 3300009176 Bacteria 4138
449 Ga0105242_10038691 3300009176 Bacteria 3837
450 Ga0105242_10077711 3300009176 Bacteria 2769
451 Ga0105242_10320870 3300009176 Bacteria 1420
452 Ga0105248_10011975 3300009177 Bacteria 9566
453 Ga0105248_10124787 3300009177 Bacteria 2904
454 Ga0105248_10172326 3300009177 Bacteria 2439
455 Ga0105248_10244766 3300009177 Bacteria 2019
456 Ga0105237_10092733 3300009545 Bacteria 3010
457 Ga0105238_10041647 3300009551 Bacteria 4651
458 Ga0105238_10171169 3300009551 Bacteria 2148
459 Ga0105249_10105632 3300009553 Bacteria 2655
460 Ga0105249_10128069 3300009553 Bacteria 2420
461 Ga0105249_10189922 3300009553 Bacteria 2004
462 Ga0105249_10468784 3300009553 Bacteria 1300
463 Ga0099796_10000392 3300010159 Bacteria 7179
464 Ga0099796_10003060 3300010159 Bacteria 3805
465 Ga0099796_10005609 3300010159 Bacteria 3141
466 Ga0099796_10007189 3300010159 Bacteria 2898
467 Ga0099796_10008474 3300010159 Bacteria 2743
468 Ga0099796_10015304 3300010159 Bacteria 2239
469 Ga0099796_10017185 3300010159 Bacteria 2149
470 Ga0099796_10017260 3300010159 Bacteria 2145
471 Ga0099796_10031731 3300010159 Bacteria 1726
472 Ga0099796_10059150 3300010159 Bacteria 1353
473 Ga0099796_10090650 3300010159 Bacteria 1136
474 Ga0105239_10014862 3300010375 Bacteria 8630
475 Ga0105239_10089195 3300010375 Bacteria 3400
476 Ga0105239_10351224 3300010375 Bacteria 1665
477 Ga0105239_10401504 3300010375 Bacteria 1551
478 Ga0105239_10682353 3300010375 Bacteria 1174
479 Ga0105246_10019249 3300011119 Bacteria 4359
480 Ga0105246_10050531 3300011119 Bacteria 2852
481 Ga0105246_10087017 3300011119 Bacteria 2241
482 Ga0105246_10156295 3300011119 Bacteria 1732
483 Ga0105246_10228891 3300011119 Bacteria 1462
484 Ga0105246_10330788 3300011119 Unclassified 1242
485 Ga0157371_10028416 3300013102 Bacteria 4050
486 Ga0157371_10302455 3300013102 Bacteria 1158
487 Ga0157374_10041727 3300013296 Bacteria 4230
488 Ga0157374_10065302 3300013296 Bacteria 3417
489 Ga0157378_10133541 3300013297 Bacteria 2300
490 Ga0157378_10422641 3300013297 Bacteria 1317
491 Ga0163162_10026037 3300013306 Bacteria 5780
492 Ga0163162_10344151 3300013306 Bacteria 1624
493 Ga0163162_10370676 3300013306 Unclassified 1565
494 Ga0163162_10547752 3300013306 Bacteria 1285
495 Ga0163162_10689752 3300013306 Bacteria 1143
496 Ga0157372_10251778 3300013307 Bacteria 2050
497 Ga0157375_10013199 3300013308 Bacteria 7346
498 Ga0157375_10087694 3300013308 Bacteria 3164
499 Ga0157375_10102540 3300013308 Bacteria 2946
500 Ga0157375_10148637 3300013308 Bacteria 2476
501 Ga0157375_10178636 3300013308 Bacteria 2274
502 Ga0157375_10179167 3300013308 Bacteria 2270
503 Ga0157375_10188064 3300013308 Bacteria 2219
504 Ga0157375_10252568 3300013308 Bacteria 1924
505 Ga0157375_10724216 3300013308 Bacteria 1147
506 Ga0163163_10027007 3300014325 Bacteria 5493
507 Ga0163163_10028539 3300014325 Bacteria 5360
508 Ga0163163_10052450 3300014325 Bacteria 4023
509 Ga0163163_10077956 3300014325 Bacteria 3309
510 Ga0163163_10082653 3300014325 Bacteria 3216
511 Ga0163163_10095995 3300014325 Bacteria 2985
512 Ga0163163_10112113 3300014325 Bacteria 2757
513 Ga0163163_10128928 3300014325 Bacteria 2569
514 Ga0163163_10131371 3300014325 Bacteria 2544
515 Ga0163163_10164629 3300014325 Bacteria 2263
516 Ga0163163_10322030 3300014325 Bacteria 1600
517 Ga0163163_10533702 3300014325 Bacteria 1236
518 Ga0157380_10165772 3300014326 Bacteria 1925
519 Ga0157380_10208959 3300014326 Bacteria 1738
520 Ga0157380_10335691 3300014326 Bacteria 1407
521 Ga0157380_10441883 3300014326 Bacteria 1247
522 Ga0157377_10003368 3300014745 Bacteria 7229
523 Ga0157377_10008667 3300014745 Bacteria 4966
524 Ga0157377_10252057 3300014745 Bacteria 1145
525 Ga0157379_10249399 3300014968 Bacteria 1611
526 Ga0157379_10323234 3300014968 Bacteria 1409
527 Ga0157379_10338700 3300014968 Bacteria 1375
528 Ga0157379_10354446 3300014968 Bacteria 1344
529 Ga0157376_10468574 3300014969 Bacteria 1232
530 Ga0163161_10027408 3300017792 Bacteria 4041
531 Ga0163161_10048558 3300017792 Bacteria 3065
532 Ga0163161_10059104 3300017792 Bacteria 2787
533 Ga0163161_10071538 3300017792 Bacteria 2538
534 Ga0163161_10077919 3300017792 Unclassified 2435
535 Ga0213872_10031448 3300021361 Bacteria 2433
536 Ga0213872_10069915 3300021361 Unclassified 1583
537 Ga0213874_10047992 3300021377 Bacteria 1301
538 Ga0213876_10029719 3300021384 Bacteria 2879
539 Ga0213871_10006157 3300021441 Bacteria 2525
540 Ga0224572_1005521 3300024225 Bacteria 2258
541 Ga0209758_1000241 3300025297 Bacteria 113998
542 Ga0207697_10058344 3300025315 Bacteria 1603
543 Ga0207656_10027635 3300025321 Bacteria 2322
544 Ga0207653_10007535 3300025885 Bacteria 3393
545 Ga0207682_10040908 3300025893 Bacteria 1890
546 Ga0207692_10005911 3300025898 Bacteria 4936
547 Ga0207692_10024236 3300025898 Bacteria 2818
548 Ga0207692_10051611 3300025898 Bacteria 2086
549 Ga0207692_10054763 3300025898 Bacteria 2039
550 Ga0207692_10164802 3300025898 Bacteria 1280
551 Ga0207642_10159539 3300025899 Bacteria 1209
552 Ga0207710_10120223 3300025900 Bacteria 1254
553 Ga0207688_10003081 3300025901 Bacteria 9097
554 Ga0207688_10014518 3300025901 Plasmid 4281
555 Ga0207688_10040700 3300025901 Bacteria 2583
556 Ga0207688_10148391 3300025901 Bacteria 1384
557 Ga0207680_10112030 3300025903 Bacteria 1771
558 Ga0207680_10114764 3300025903 Bacteria 1753
559 Ga0207647_10020750 3300025904 Bacteria 4401
560 Ga0207685_10002127 3300025905 Bacteria 4444
561 Ga0207685_10029993 3300025905 Bacteria 1932
562 Ga0207685_10106351 3300025905 Bacteria 1209
563 Ga0207699_10050854 3300025906 Bacteria 2446
564 Ga0207699_10088241 3300025906 Bacteria 1941
565 Ga0207699_10255254 3300025906 Bacteria 1210
566 Ga0207645_10022958 3300025907 Bacteria 4054
567 Ga0207645_10032983 3300025907 Bacteria 3329
568 Ga0207643_10003291 3300025908 Bacteria 8724
569 Ga0207684_10021505 3300025910 Bacteria 5508
570 Ga0207684_10025479 3300025910 Bacteria 5040
571 Ga0207684_10032236 3300025910 Bacteria 4456
572 Ga0207684_10038693 3300025910 Bacteria 4048
573 Ga0207684_10042334 3300025910 Bacteria 3860
574 Ga0207684_10050122 3300025910 Bacteria 3542
575 Ga0207684_10059011 3300025910 Bacteria 3257
576 Ga0207684_10062499 3300025910 Bacteria 3162
577 Ga0207684_10122888 3300025910 Bacteria 2226
578 Ga0207684_10123852 3300025910 Bacteria 2217
579 Ga0207684_10141993 3300025910 Bacteria 2064
580 Ga0207684_10167028 3300025910 Bacteria 1896
581 Ga0207684_10194560 3300025910 Bacteria 1749
582 Ga0207684_10365999 3300025910 Bacteria 1241
583 Ga0207707_10150023 3300025912 Bacteria 2038
584 Ga0207695_10199856 3300025913 Bacteria 1913
585 Ga0207671_10107589 3300025914 Bacteria 2118
586 Ga0207693_10002435 3300025915 Bacteria 16162
587 Ga0207693_10004770 3300025915 Bacteria 11399
588 Ga0207693_10014478 3300025915 Bacteria 6339
589 Ga0207693_10014604 3300025915 Bacteria 6311
590 Ga0207693_10018937 3300025915 Bacteria 5480
591 Ga0207693_10020263 3300025915 Bacteria 5290
592 Ga0207693_10026624 3300025915 Bacteria 4575
593 Ga0207693_10029804 3300025915 Bacteria 4307
594 Ga0207693_10043187 3300025915 Bacteria 3548
595 Ga0207693_10071374 3300025915 Bacteria 2718
596 Ga0207693_10075641 3300025915 Bacteria 2637
597 Ga0207693_10097988 3300025915 Bacteria 2299
598 Ga0207693_10098829 3300025915 Bacteria 2288
599 Ga0207693_10108576 3300025915 Bacteria 2177
600 Ga0207693_10109904 3300025915 Bacteria 2162
601 Ga0207693_10155775 3300025915 Bacteria 1797
602 Ga0207693_10161301 3300025915 Bacteria 1764
603 Ga0207693_10168210 3300025915 Bacteria 1726
604 Ga0207693_10209744 3300025915 Bacteria 1531
605 Ga0207693_10210096 3300025915 Bacteria 1530
606 Ga0207693_10249755 3300025915 Bacteria 1392
607 Ga0207693_10268525 3300025915 Bacteria 1337
608 Ga0207693_10308538 3300025915 Bacteria 1239
609 Ga0207693_10325409 3300025915 Bacteria 1203
610 Ga0207693_10375435 3300025915 Bacteria 1112
611 Ga0207693_10414619 3300025915 Bacteria 1053
612 Ga0207663_10008274 3300025916 Bacteria 5431
613 Ga0207663_10011889 3300025916 Bacteria 4688
614 Ga0207663_10069792 3300025916 Bacteria 2262
615 Ga0207663_10126035 3300025916 Bacteria 1761
616 Ga0207663_10135955 3300025916 Bacteria 1706
617 Ga0207663_10163780 3300025916 Bacteria 1573
618 Ga0207663_10173082 3300025916 Bacteria 1535
619 Ga0207663_10186294 3300025916 Bacteria 1486
620 Ga0207663_10229378 3300025916 Bacteria 1356
621 Ga0207663_10271537 3300025916 Bacteria 1256
622 Ga0207662_10006695 3300025918 Bacteria 6229
623 Ga0207662_10009387 3300025918 Bacteria 5379
624 Ga0207657_10044026 3300025919 Bacteria 3927
625 Ga0207649_10204992 3300025920 Bacteria 1395
626 Ga0207652_10441019 3300025921 Unclassified 1174
627 Ga0207646_10050419 3300025922 Bacteria 3725
628 Ga0207646_10145651 3300025922 Bacteria 2134
629 Ga0207646_10198425 3300025922 Bacteria 1812
630 Ga0207646_10301959 3300025922 Bacteria 1446
631 Ga0207646_10309165 3300025922 Bacteria 1428
632 Ga0207646_10399499 3300025922 Bacteria 1241
633 Ga0207681_10098254 3300025923 Bacteria 2106
634 Ga0207681_10161094 3300025923 Bacteria 1691
635 Ga0207681_10405173 3300025923 Bacteria 1102
636 Ga0207650_10004422 3300025925 Bacteria 9602
637 Ga0207650_10009756 3300025925 Bacteria 6566
638 Ga0207650_10059644 3300025925 Bacteria 2845
639 Ga0207650_10081554 3300025925 Bacteria 2454
640 Ga0207650_10145623 3300025925 Bacteria 1865
641 Ga0207659_10034418 3300025926 Bacteria 3493
642 Ga0207659_10038139 3300025926 Bacteria 3340
643 Ga0207659_10062519 3300025926 Bacteria 2687
644 Ga0207659_10092967 3300025926 Bacteria 2256
645 Ga0207659_10221709 3300025926 Bacteria 1521
646 Ga0207700_10008546 3300025928 Bacteria 6351
647 Ga0207700_10054981 3300025928 Bacteria 2990
648 Ga0207700_10057164 3300025928 Bacteria 2940
649 Ga0207700_10070744 3300025928 Bacteria 2683
650 Ga0207700_10082750 3300025928 Bacteria 2510
651 Ga0207700_10090680 3300025928 Bacteria 2413
652 Ga0207700_10141734 3300025928 Bacteria 1976
653 Ga0207700_10185847 3300025928 Bacteria 1743
654 Ga0207700_10283406 3300025928 Bacteria 1426
655 Ga0207700_10359902 3300025928 Bacteria 1268
656 Ga0207700_10392238 3300025928 Bacteria 1215
657 Ga0207700_10401039 3300025928 Bacteria 1202
658 Ga0207664_10031939 3300025929 Bacteria 4032
659 Ga0207664_10169127 3300025929 Bacteria 1869
660 Ga0207664_10187373 3300025929 Bacteria 1779
661 Ga0207664_10234546 3300025929 Bacteria 1596
662 Ga0207644_10185763 3300025931 Bacteria 1632
663 Ga0207644_10207109 3300025931 Bacteria 1549
664 Ga0207644_10252534 3300025931 Bacteria 1407
665 Ga0207690_10018264 3300025932 Bacteria 4300
666 Ga0207690_10049046 3300025932 Bacteria 2812
667 Ga0207690_10351544 3300025932 Bacteria 1165
668 Ga0207706_10009602 3300025933 Bacteria 8881
669 Ga0207706_10032201 3300025933 Bacteria 4669
670 Ga0207706_10032292 3300025933 Bacteria 4662
671 Ga0207706_10147285 3300025933 Bacteria 2071
672 Ga0207706_10163309 3300025933 Bacteria 1958
673 Ga0207686_10024773 3300025934 Bacteria 3482
674 Ga0207686_10078208 3300025934 Bacteria 2150
675 Ga0207686_10269729 3300025934 Bacteria 1251
676 Ga0207709_10044164 3300025935 Bacteria 2691
677 Ga0207709_10144785 3300025935 Bacteria 1638
678 Ga0207709_10148832 3300025935 Bacteria 1619
679 Ga0207709_10158719 3300025935 Bacteria 1575
680 Ga0207709_10160294 3300025935 Bacteria 1568
681 Ga0207670_10003864 3300025936 Bacteria 7986
682 Ga0207670_10028557 3300025936 Bacteria 3543
683 Ga0207670_10140000 3300025936 Bacteria 1783
684 Ga0207669_10002290 3300025937 Bacteria 8153
685 Ga0207669_10030799 3300025937 Bacteria 2987
686 Ga0207669_10242322 3300025937 Bacteria 1337
687 Ga0207704_10120318 3300025938 Bacteria 1795
688 Ga0207704_10126032 3300025938 Bacteria 1763
689 Ga0207665_10025127 3300025939 Bacteria 3929
690 Ga0207665_10128479 3300025939 Bacteria 1797
691 Ga0207665_10138249 3300025939 Bacteria 1735
692 Ga0207665_10230089 3300025939 Bacteria 1362
693 Ga0207691_10003300 3300025940 Bacteria 15729
694 Ga0207691_10015271 3300025940 Bacteria 7307
695 Ga0207691_10163302 3300025940 Bacteria 1953
696 Ga0207691_10428424 3300025940 Bacteria 1127
697 Ga0207691_10477504 3300025940 Bacteria 1060
698 Ga0207711_10086829 3300025941 Bacteria 2744
699 Ga0207711_10130411 3300025941 Bacteria 2253
700 Ga0207689_10009584 3300025942 Bacteria 8352
701 Ga0207689_10024157 3300025942 Bacteria 5099
702 Ga0207661_10274124 3300025944 Bacteria 1506
703 Ga0207679_10085498 3300025945 Unclassified 2423
704 Ga0207679_10089171 3300025945 Bacteria 2380
705 Ga0207667_10179043 3300025949 Bacteria 2178
706 Ga0207651_10012695 3300025960 Bacteria 4780
707 Ga0207651_10056398 3300025960 Bacteria 2704
708 Ga0207651_10071788 3300025960 Bacteria 2456
709 Ga0207651_10339119 3300025960 Bacteria 1262
710 Ga0207651_10450990 3300025960 Bacteria 1104
711 Ga0207712_10066196 3300025961 Bacteria 2582
712 Ga0207668_10024223 3300025972 Bacteria 3914
713 Ga0207668_10082393 3300025972 Bacteria 2337
714 Ga0207668_10098905 3300025972 Bacteria 2163
715 Ga0207668_10170902 3300025972 Bacteria 1704
716 Ga0207668_10317326 3300025972 Bacteria 1292
717 Ga0207640_10079717 3300025981 Bacteria 2233
718 Ga0207640_10109824 3300025981 Bacteria 1952
719 Ga0207640_10137644 3300025981 Bacteria 1775
720 Ga0207658_10336107 3300025986 Bacteria 1312
721 Ga0207677_10155367 3300026023 Bacteria 1771
722 Ga0207677_10317076 3300026023 Bacteria 1294
723 Ga0207703_10297754 3300026035 Bacteria 1470
724 Ga0207639_10309152 3300026041 Bacteria 1400
725 Ga0207678_10007441 3300026067 Bacteria 9696
726 Ga0207678_10129323 3300026067 Bacteria 2154
727 Ga0207708_10005502 3300026075 Bacteria 9352
728 Ga0207708_10064909 3300026075 Bacteria 2790
729 Ga0207708_10352829 3300026075 Bacteria 1207
730 Ga0207708_10385111 3300026075 Bacteria 1157
731 Ga0207702_10060026 3300026078 Bacteria 3241
732 Ga0207641_10038792 3300026088 Bacteria 3983
733 Ga0207641_10062646 3300026088 Bacteria 3175
734 Ga0207648_10006546 3300026089 Bacteria 11566
735 Ga0207648_10067325 3300026089 Bacteria 3122
736 Ga0207648_10117331 3300026089 Bacteria 2339
737 Ga0207648_10163211 3300026089 Bacteria 1968
738 Ga0207648_10168858 3300026089 Bacteria 1933
739 Ga0207648_10231682 3300026089 Bacteria 1643
740 Ga0207676_10020274 3300026095 Bacteria 4862
741 Ga0207676_10058061 3300026095 Bacteria 3050
742 Ga0207674_10049046 3300026116 Bacteria 4320
743 Ga0207674_10151577 3300026116 Bacteria 2275
744 Ga0207675_100093444 3300026118 Bacteria 2829
745 Ga0207675_100172498 3300026118 Bacteria 2068
746 Ga0207675_100352628 3300026118 Bacteria 1442
747 Ga0207683_10001645 3300026121 Bacteria 20016
748 Ga0207683_10010160 3300026121 Bacteria 8032
749 Ga0207683_10012488 3300026121 Bacteria 7247
750 Ga0207683_10052653 3300026121 Bacteria 3567
751 Ga0207683_10091444 3300026121 Plasmid 2711
752 Ga0207683_10639817 3300026121 Bacteria 985
753 Ga0209179_1002418 3300027512 Bacteria 2521
754 Ga0209179_1006150 3300027512 Bacteria 1918
755 Ga0209179_1017013 3300027512 Bacteria 1372
756 Ga0209179_1029630 3300027512 Bacteria 1115
757 Ga0209588_1001180 3300027671 Bacteria 6740
758 Ga0209588_1006825 3300027671 Bacteria 3337
759 Ga0209588_1013010 3300027671 Bacteria 2533
760 Ga0209588_1018279 3300027671 Bacteria 2181
761 Ga0209588_1028376 3300027671 Bacteria 1781
762 Ga0209813_10036716 3300027866 Bacteria 1473
763 Ga0207428_10001335 3300027907 Bacteria 26224
764 Ga0207428_10015228 3300027907 Bacteria 6654
765 Ga0207428_10022443 3300027907 Bacteria 5326
766 Ga0207428_10049968 3300027907 Bacteria 3347
767 Ga0207428_10117219 3300027907 Unclassified 2044
768 Ga0207428_10126322 3300027907 Bacteria 1958
769 Ga0207428_10196070 3300027907 Bacteria 1521
770 Ga0207428_10274595 3300027907 Bacteria 1252
771 Ga0265357_1006184 3300028023 Bacteria 1127
772 Ga0268266_10014049 3300028379 Bacteria 6893
773 Ga0268266_10121848 3300028379 Bacteria 2321
774 Ga0268266_10363577 3300028379 Bacteria 1362
775 Ga0268265_10168941 3300028380 Bacteria 1867
776 Ga0268265_10451565 3300028380 Bacteria 1201
777 Ga0268264_10180608 3300028381 Bacteria 1916
778 Ga0268264_10188906 3300028381 Bacteria 1876
779 Ga0268264_10414916 3300028381 Unclassified 1297
780 Ga0265337_1010592 3300028556 Bacteria 3221
781 Ga0265318_10089770 3300028577 Bacteria 1132
782 Ga0307515_10016334 3300028794 Bacteria 13601
783 Ga0265338_10044886 3300028800 Bacteria 4071
784 Ga0265338_10103678 3300028800 Bacteria 2309
785 Ga0265763_1000647 3300030763 Bacteria 2212
786 Ga0265763_1001801 3300030763 Bacteria 1580
787 Ga0265760_10000755 3300031090 Bacteria 9281
788 Ga0265760_10002462 3300031090 Bacteria 5405
789 Ga0265760_10008390 3300031090 Bacteria 2955
790 Ga0265760_10063403 3300031090 Bacteria 1126
791 Ga0265332_10100268 3300031238 Bacteria 1222
792 Ga0265320_10012936 3300031240 Bacteria 4823
793 Ga0265325_10000026 3300031241 Bacteria 109937
794 Ga0265325_10066308 3300031241 Bacteria 1820
795 Ga0265340_10018331 3300031247 Bacteria 3611
796 Ga0265340_10030638 3300031247 Bacteria 2696
797 Ga0265340_10043812 3300031247 Bacteria 2192
798 Ga0265340_10068000 3300031247 Bacteria 1692
799 Ga0265339_10000038 3300031249 Bacteria 121961
800 Ga0265339_10000109 3300031249 Bacteria 66969
801 Ga0265339_10000511 3300031249 Bacteria 30223
802 Ga0265313_10000257 3300031595 Bacteria 57767
803 Ga0265313_10004634 3300031595 Bacteria 10417
804 Ga0265342_10018056 3300031712 Bacteria 4577
805 Ga0265342_10040186 3300031712 Bacteria 2838
806 Ga0307416_100117916 3300032002 Bacteria 2358
807 Ga0307510_10063779 3300033180 Bacteria 3748
808 Ga0373926_0004849 3300035083 Bacteria 4424
809 Ga0373944_0010852 3300035089 Bacteria 2489
810 Ga0373951_0020164 3300035091 Bacteria 1525
811 Ga0373923_0008195 3300035111 Bacteria 3713
812 Ga0373923_0134337 3300035111 Bacteria 1114
813 Ga0373936_0000132 3300035113 Bacteria 25845
814 Ga0373936_0001937 3300035113 Bacteria 7654
815 Ga0373936_0036167 3300035113 Bacteria 1968
816 Ga0373936_0040018 3300035113 Bacteria 1877
817 Ga0373939_0029775 3300035114 Bacteria 1565
818 Ga0373939_0056225 3300035114 Bacteria 1238
819 Ga0373941_0052341 3300035115 Bacteria 1302
820 Ga0373945_0001585 3300035116 Bacteria 6968
821 Ga0373945_0007553 3300035116 Bacteria 3526
822 Ga0373945_0007645 3300035116 Bacteria 3504
823 Ga0373945_0028448 3300035116 Bacteria 1958
824 Ga0373945_0036969 3300035116 Bacteria 1751
825 Ga0373953_0000825 3300035117 Bacteria 8661
826 Ga0373953_0021424 3300035117 Bacteria 2425
827 Ga0373953_0039319 3300035117 Bacteria 1874
828 Ga0373954_0002809 3300035118 Bacteria 7327
829 Ga0373954_0030549 3300035118 Bacteria 2484
830 Ga0373954_0048002 3300035118 Bacteria 2000
831 Ga0373954_0091647 3300035118 Bacteria 1460
832 Ga0373954_0215620 3300035118 Bacteria 944
833 Ga0373956_0004575 3300035119 Bacteria 5525
834 Ga0373956_0042805 3300035119 Bacteria 2015
835 Ga0373957_0005849 3300035120 Bacteria 3840
836 Ga0373957_0008078 3300035120 Bacteria 3396
837 Ga0373957_0052022 3300035120 Bacteria 1568
838 Ga0373957_0080745 3300035120 Bacteria 1283
839 Ga0373943_0006948 3300035170 Bacteria 5077
840 Ga0373943_0043569 3300035170 Bacteria 2180
841 Ga0373943_0057594 3300035170 Bacteria 1931
842 Ga0373943_0093989 3300035170 Bacteria 1557
843 Ga0373943_0132238 3300035170 Bacteria 1336
844 Ga0373943_0133451 3300035170 Bacteria 1331
845 Ga0373946_0004139 3300035171 Bacteria 5165
846 Ga0373946_0008578 3300035171 Bacteria 3751
847 Ga0373946_0065703 3300035171 Bacteria 1554
848 Ga0373955_0000213 3300035172 Bacteria 24300
849 Ga0373955_0000740 3300035172 Bacteria 14029
850 Ga0373955_0001043 3300035172 Bacteria 11778
851 Ga0373955_0062738 3300035172 Bacteria 2056
852 Ga0373955_0075487 3300035172 Bacteria 1894
853 Ga0373955_0102118 3300035172 Bacteria 1648
854 Ga0373955_0127352 3300035172 Bacteria 1484
855 Ga0373942_0015978 3300035207 Bacteria 1836
856 Ga0373961_0017896 3300035241 Bacteria 1844
857 Ga0373962_0029351 3300035242 Bacteria 1498
858 Ga0373924_0000481 3300035410 Bacteria 12193
859 Ga0373924_0007873 3300035410 Bacteria 3855
860 Ga0373924_0021583 3300035410 Bacteria 2512
861 Ga0373924_0063134 3300035410 Bacteria 1553
862 Ga0373924_0082033 3300035410 Bacteria 1372
863 Ga0373924_0094898 3300035410 Bacteria 1279
864 Ga0373924_0104098 3300035410 Bacteria 1223
865 Ga0373931_0002198 3300035691 Bacteria 8618
866 Ga0373931_0002781 3300035691 Bacteria 7787
867 Ga0373931_0004798 3300035691 Bacteria 6206
868 Ga0373931_0012398 3300035691 Bacteria 4129
869 Ga0373931_0073255 3300035691 Bacteria 1874
870 Ga0373931_0074715 3300035691 Bacteria 1857
871 Ga0373935_0000131 3300035692 Bacteria 34019
872 Ga0373935_0000179 3300035692 Bacteria 29705
873 Ga0373935_0052937 3300035692 Bacteria 2582
874 Ga0373935_0054554 3300035692 Bacteria 2545
875 Ga0373935_0089022 3300035692 Bacteria 2018
876 Ga0373935_0123861 3300035692 Bacteria 1730
877 Ga0373935_0176494 3300035692 Bacteria 1464
878 Ga0373935_0218132 3300035692 Unclassified 1324
879 Ga0373927_0003776 3300035695 Bacteria 10748
880 Ga0373927_0004787 3300035695 Bacteria 9423
881 Ga0373927_0006518 3300035695 Bacteria 7950
882 Ga0373927_0019879 3300035695 Bacteria 4403
883 Ga0373927_0025742 3300035695 Bacteria 3846
884 Ga0373927_0026311 3300035695 Bacteria 3802
885 Ga0373927_0038695 3300035695 Bacteria 3096
886 Ga0373927_0043982 3300035695 Bacteria 2890
887 Ga0373927_0044431 3300035695 Bacteria 2875
888 Ga0373927_0056338 3300035695 Bacteria 2541
889 Ga0373927_0089441 3300035695 Bacteria 1999
890 Ga0373927_0094751 3300035695 Bacteria 1940
891 Ga0373927_0119672 3300035695 Bacteria 1718
892 Ga0373927_0162038 3300035695 Bacteria 1465
893 Ga0373927_0219489 3300035695 Bacteria 1249
894 Ga0373933_0010880 3300035724 Bacteria 4995
895 Ga0373933_0027856 3300035724 Bacteria 3257
896 Ga0373933_0028765 3300035724 Bacteria 3208
897 Ga0373933_0333321 3300035724 Bacteria 984
898 Ga0373947_0000414 3300035725 Bacteria 24229
899 Ga0373947_0006445 3300035725 Bacteria 6816
900 Ga0373947_0015493 3300035725 Bacteria 4378
901 Ga0373947_0015898 3300035725 Bacteria 4322
902 Ga0373947_0018204 3300035725 Bacteria 4042
903 Ga0373947_0038111 3300035725 Bacteria 2854
904 Ga0373947_0091371 3300035725 Bacteria 1899
905 Ga0373947_0136598 3300035725 Bacteria 1569
906 Ga0373947_0202396 3300035725 Bacteria 1299
907 Ga0373947_0209132 3300035725 Bacteria 1279
908 Ga0373947_0219925 3300035725 Bacteria 1248
909 Ga0373947_0271560 3300035725 Bacteria 1126
910 Ga0373937_0000293 3300036401 Bacteria 47507
911 Ga0373937_0000514 3300036401 Bacteria 34949
912 Ga0373937_0000516 3300036401 Bacteria 34938
913 Ga0373937_0000691 3300036401 Bacteria 29384
914 Ga0373937_0003652 3300036401 Bacteria 12984
915 Ga0373937_0006471 3300036401 Bacteria 10108
916 Ga0373937_0015436 3300036401 Bacteria 6752
917 Ga0373937_0018126 3300036401 Bacteria 6281
918 Ga0373937_0038834 3300036401 Bacteria 4338
919 Ga0373937_0039364 3300036401 Bacteria 4308
920 Ga0373937_0083475 3300036401 Bacteria 2955
921 Ga0373937_0320029 3300036401 Bacteria 1468
922 Ga0373937_0469211 3300036401 Bacteria 1195
923 Ga0373925_0000087 3300037068 Bacteria 99043
924 Ga0373925_0000639 3300037068 Bacteria 32946
925 Ga0373925_0006073 3300037068 Bacteria 8936
926 Ga0373925_0019670 3300037068 Bacteria 4913
927 Ga0373925_0046777 3300037068 Bacteria 3218
928 Ga0373925_0049591 3300037068 Bacteria 3130
929 Ga0373925_0078691 3300037068 Bacteria 2504
930 Ga0373925_0102587 3300037068 Bacteria 2201
931 Ga0373925_0109214 3300037068 Bacteria 2135
932 Ga0373925_0129568 3300037068 Bacteria 1966
933 Ga0373925_0146699 3300037068 Bacteria 1850
934 Ga0373925_0194456 3300037068 Bacteria 1611
935 Ga0373925_0196387 3300037068 Bacteria 1603
936 Ga0373925_0243319 3300037068 Bacteria 1441
937 Ga0373925_0250051 3300037068 Bacteria 1421
938 Ga0395899_0033015 3300037312 Bacteria 3889
939 Ga0395900_0002052 3300037418 Bacteria 22610
940 Ga0395898_0116467 3300037466 Bacteria 2560
941 Ga0395898_0172878 3300037466 Bacteria 2065
942 Ga0395898_0341990 3300037466 Bacteria 1427
943 Ga0395901_0101347 3300038443 Bacteria 3021
944 Ga0395901_0271729 3300038443 Bacteria 1763
945 Ga0395901_0480438 3300038443 Bacteria 1267
946 Ga0242420_019451 3300038996 Bacteria 1203
947 Ga0436365_0161226 3300039437 Bacteria 7955
948 Ga0436365_0566541 3300039437 Bacteria 1947
949 Ga0436365_1323468 3300039437 Bacteria 1296
950 Ga0436365_1680786 3300039437 Unclassified 1056
951 Ga0436360_0558472 3300039438 Bacteria 1678
952 Ga0436360_0769332 3300039438 Bacteria 15964
953 Ga0436361_0099439 3300039447 Bacteria 10606
954 Ga0436361_0353650 3300039447 Bacteria 5572
955 Ga0436361_0436199 3300039447 Bacteria 3843
956 Ga0436361_0480515 3300039447 Bacteria 4662
957 Ga0436361_0674185 3300039447 Bacteria 1587
958 Ga0436361_1050847 3300039447 Bacteria 1692
959 Ga0436363_0805331 3300039450 Bacteria 1385
960 Ga0451853_3783103 3300041512 Bacteria 2373
961 Ga0439448_0028592 3300042005 Bacteria 1762
962 Ga0450923_003138 3300042125 Bacteria 2457
963 Ga0466958_0011478 3300045836 Bacteria 4989
964 Ga0466967_0166292 3300045976 Bacteria 2073
965 Ga0466967_0442001 3300045976 Bacteria 1270
966 Ga0495617_020353 3300046452 Bacteria 2243
967 Ga0495592_0000001 3300046454 Bacteria 305819
968 Ga0495592_0000348 3300046454 Bacteria 37669
969 Ga0495592_0031156 3300046454 Bacteria 4032
970 Ga0495592_0108456 3300046454 Bacteria 1968
971 Ga0495592_0270605 3300046454 Bacteria 1115
972 Ga0495603_0024043 3300046455 Bacteria 3685
973 Ga0495603_0063470 3300046455 Bacteria 2179
974 Ga0495603_0151420 3300046455 Bacteria 1347
975 Ga0495603_0189004 3300046455 Bacteria 1191
976 Ga0495603_0213423 3300046455 Bacteria 1114
977 Ga0495590_0018924 3300046457 Bacteria 2459
978 Ga0495629_0057835 3300046459 Bacteria 2711
979 Ga0495629_0071151 3300046459 Bacteria 2427
980 Ga0495629_0091368 3300046459 Bacteria 2125
981 Ga0495629_0136193 3300046459 Bacteria 1710
982 Ga0495629_0139301 3300046459 Bacteria 1688
983 Ga0495629_0220455 3300046459 Bacteria 1308
984 Ga0495638_0022443 3300046460 Bacteria 4144
985 Ga0495638_0093554 3300046460 Bacteria 1807
986 Ga0495641_0076369 3300046461 Bacteria 1502
987 Ga0495651_0000781 3300046462 Bacteria 24676
988 Ga0495651_0001675 3300046462 Bacteria 17143
989 Ga0495651_0182501 3300046462 Bacteria 1484
990 Ga0495653_0000015 3300046463 Bacteria 213697
991 Ga0495653_0000030 3300046463 Bacteria 142668
992 Ga0495653_0239866 3300046463 Bacteria 1209
993 Ga0495580_0011401 3300046472 Bacteria 6878
994 Ga0495580_0029339 3300046472 Bacteria 3993
995 Ga0495580_0048052 3300046472 Bacteria 3024
996 Ga0495580_0143302 3300046472 Bacteria 1656
997 Ga0495582_0127912 3300046473 Bacteria 1434
998 Ga0495582_0151994 3300046473 Bacteria 1314
999 Ga0495582_0169548 3300046473 Bacteria 1242
1000 Ga0495639_0034919 3300046475 Bacteria 2249
1001 Ga0495639_0088824 3300046475 Bacteria 1447
1002 Ga0495639_0091247 3300046475 Bacteria 1430
1003 Ga0495639_0097612 3300046475 Bacteria 1384
1004 Ga0495662_0000957 3300046476 Bacteria 14125
1005 Ga0495662_0010230 3300046476 Bacteria 4597
1006 Ga0495662_0065174 3300046476 Bacteria 1761
1007 Ga0495662_0097610 3300046476 Bacteria 1436
1008 Ga0495664_0000001 3300046477 Bacteria 757730
1009 Ga0495664_0000003 3300046477 Bacteria 551602
1010 Ga0495664_0026096 3300046477 Bacteria 3402
1011 Ga0495664_0216966 3300046477 Bacteria 1158
1012 Ga0495584_0006062 3300046491 Bacteria 6364
1013 Ga0495584_0033614 3300046491 Bacteria 2595
1014 Ga0495584_0035668 3300046491 Bacteria 2513
1015 Ga0495585_0035283 3300046492 Bacteria 2827
1016 Ga0495585_0051896 3300046492 Bacteria 2271
1017 Ga0495585_0114986 3300046492 Bacteria 1428
1018 Ga0495585_0160056 3300046492 Bacteria 1169
1019 Ga0495585_0190690 3300046492 Bacteria 1049
1020 Ga0495594_0136573 3300046499 Bacteria 1390
1021 Ga0495594_0217053 3300046499 Bacteria 1091
1022 Ga0495596_0029393 3300046500 Bacteria 2203
1023 Ga0495607_0145876 3300046501 Bacteria 1216
1024 Ga0495607_0173042 3300046501 Bacteria 1089
1025 Ga0495608_0000011 3300046511 Bacteria 248514
1026 Ga0495608_0000066 3300046511 Bacteria 81664
1027 Ga0495608_0048188 3300046511 Bacteria 2832
1028 Ga0495608_0165605 3300046511 Bacteria 1404
1029 Ga0495618_0000021 3300046514 Bacteria 129750
1030 Ga0495618_0000025 3300046514 Bacteria 116027
1031 Ga0495618_0014700 3300046514 Bacteria 4773
1032 Ga0495618_0014992 3300046514 Bacteria 4727
1033 Ga0495618_0015167 3300046514 Bacteria 4701
1034 Ga0495618_0039444 3300046514 Bacteria 2968
1035 Ga0495618_0064197 3300046514 Bacteria 2333
1036 Ga0495618_0100863 3300046514 Bacteria 1848
1037 Ga0495618_0159573 3300046514 Bacteria 1438
1038 Ga0495628_0000001 3300046516 Bacteria 917742
1039 Ga0495628_0000005 3300046516 Bacteria 420969
1040 Ga0495630_0000254 3300046517 Bacteria 43049
1041 Ga0495630_0004861 3300046517 Bacteria 9435
1042 Ga0495630_0006811 3300046517 Bacteria 8147
1043 Ga0495630_0075614 3300046517 Bacteria 2537
1044 Ga0495630_0095721 3300046517 Bacteria 2245
1045 Ga0495630_0104617 3300046517 Bacteria 2142
1046 Ga0495630_0172291 3300046517 Bacteria 1649
1047 Ga0495630_0254044 3300046517 Bacteria 1343
1048 Ga0495630_0323363 3300046517 Bacteria 1179
1049 Ga0495630_0326212 3300046517 Bacteria 1174
1050 Ga0495630_0343815 3300046517 Bacteria 1142
1051 Ga0495631_0108418 3300046518 Bacteria 1194
1052 Ga0495632_0006407 3300046519 Bacteria 7574
1053 Ga0495637_0032095 3300046520 Bacteria 2316
1054 Ga0495644_0051792 3300046523 Bacteria 1541
1055 Ga0495663_0058868 3300046525 Bacteria 1205
1056 Ga0495666_0042521 3300046526 Bacteria 2197
1057 Ga0495666_0048508 3300046526 Bacteria 2045
1058 Ga0495666_0070493 3300046526 Bacteria 1662
1059 Ga0495666_0109502 3300046526 Bacteria 1298
1060 Ga0495666_0157016 3300046526 Bacteria 1056
1061 Ga0495666_0163392 3300046526 Bacteria 1032
1062 Ga0495652_0000001 3300046529 Bacteria 1045081
1063 Ga0495652_0000002 3300046529 Bacteria 946606
1064 Ga0495652_0050303 3300046529 Bacteria 3563
1065 Ga0495652_0078348 3300046529 Bacteria 2736
1066 Ga0495652_0260966 3300046529 Bacteria 1279
1067 Ga0495665_0010438 3300046531 Bacteria 5026
1068 Ga0495665_0033332 3300046531 Bacteria 2755
1069 Ga0495665_0036545 3300046531 Bacteria 2622
1070 Ga0495665_0049787 3300046531 Bacteria 2221
1071 Ga0495665_0065396 3300046531 Bacteria 1919
1072 Ga0495665_0170593 3300046531 Bacteria 1133
1073 Ga0495640_0000002 3300046533 Bacteria 646434
1074 Ga0495640_0000006 3300046533 Bacteria 285419
1075 Ga0495640_0004669 3300046533 Bacteria 10925
1076 Ga0495640_0011330 3300046533 Bacteria 6865
1077 Ga0495640_0016212 3300046533 Bacteria 5578
1078 Ga0495640_0042579 3300046533 Bacteria 3166
1079 Ga0495640_0061377 3300046533 Bacteria 2554
1080 Ga0495640_0100050 3300046533 Bacteria 1904
1081 Ga0495640_0114986 3300046533 Bacteria 1754
1082 Ga0495640_0157875 3300046533 Bacteria 1455
1083 Ga0495640_0170265 3300046533 Bacteria 1392
1084 Ga0495640_0185473 3300046533 Bacteria 1324
1085 Ga0495640_0202787 3300046533 Bacteria 1256
1086 Ga0495586_0048453 3300046535 Bacteria 2296
1087 Ga0495587_0000001 3300046536 Bacteria 724132
1088 Ga0495587_0000012 3300046536 Bacteria 197088
1089 Ga0495587_0019961 3300046536 Bacteria 4142
1090 Ga0495598_0008201 3300046537 Bacteria 2423
1091 Ga0495598_0054916 3300046537 Bacteria 1211
1092 Ga0495645_0000041 3300046543 Bacteria 92278
1093 Ga0495645_0000276 3300046543 Bacteria 37763
1094 Ga0495633_0034411 3300046558 Bacteria 2437
1095 Ga0495667_0000001 3300046559 Bacteria 834831
1096 Ga0495667_0000004 3300046559 Bacteria 295297
1097 Ga0495667_0056279 3300046559 Bacteria 2586
1098 Ga0495667_0189129 3300046559 Bacteria 1320
1099 Ga0495667_0217078 3300046559 Bacteria 1221
1100 Ga0495656_0118320 3300046615 Bacteria 1247
1101 Ga0495634_0000624 3300046642 Bacteria 34336
1102 Ga0495634_0001327 3300046642 Bacteria 22545
1103 Ga0495634_0008586 3300046642 Bacteria 7586
1104 Ga0495634_0013528 3300046642 Bacteria 5895
1105 Ga0495634_0026514 3300046642 Bacteria 4043
1106 Ga0495634_0064369 3300046642 Bacteria 2431
1107 Ga0495634_0071090 3300046642 Bacteria 2292
1108 Ga0495634_0100293 3300046642 Bacteria 1871
1109 Ga0495634_0102067 3300046642 Bacteria 1852
1110 Ga0495634_0160212 3300046642 Bacteria 1419
1111 Ga0495635_0000001 3300046663 Bacteria 704901
1112 Ga0495635_0000007 3300046663 Bacteria 278786
1113 Ga0495635_0000280 3300046663 Bacteria 32788
1114 Ga0495635_0019209 3300046663 Bacteria 4768
1115 Ga0495635_0039030 3300046663 Bacteria 3287
1116 Ga0495635_0076345 3300046663 Bacteria 2296
1117 Ga0495635_0115674 3300046663 Bacteria 1831
1118 Ga0495659_0035561 3300046664 Bacteria 1756
1119 Ga0495661_0149816 3300046665 Bacteria 1261
1120 Ga0495588_0015185 3300046674 Bacteria 3700
1121 Ga0495657_0000047 3300046675 Bacteria 104362
1122 Ga0495657_0000190 3300046675 Bacteria 55153
1123 Ga0495657_0002866 3300046675 Bacteria 14328
1124 Ga0495599_0000002 3300046678 Bacteria 348168
1125 Ga0495599_0000212 3300046678 Bacteria 37642
1126 Ga0495623_0000023 3300046679 Bacteria 96650
1127 Ga0495623_0000043 3300046679 Bacteria 77839
1128 Ga0495646_0000009 3300046680 Bacteria 200698
1129 Ga0495646_0000024 3300046680 Bacteria 107836
1130 Ga0495647_0020884 3300046681 Bacteria 2354
1131 Ga0495658_0013169 3300046683 Bacteria 4208
1132 Ga0495658_0020191 3300046683 Bacteria 3492
1133 Ga0495658_0095155 3300046683 Bacteria 1770
1134 Ga0495658_0161859 3300046683 Bacteria 1381
1135 Ga0495658_0169160 3300046683 Bacteria 1352
1136 Ga0495613_0004409 3300046689 Bacteria 10541
1137 Ga0495613_0022159 3300046689 Bacteria 4734
1138 Ga0495613_0033615 3300046689 Bacteria 3810
1139 Ga0495613_0069404 3300046689 Bacteria 2569
1140 Ga0495613_0074491 3300046689 Bacteria 2472
1141 Ga0495613_0079076 3300046689 Bacteria 2391
1142 Ga0495613_0106562 3300046689 Bacteria 2022
1143 Ga0495613_0160659 3300046689 Bacteria 1599
1144 Ga0495613_0172953 3300046689 Bacteria 1532
1145 Ga0495624_0011265 3300046690 Bacteria 6150
1146 Ga0495624_0014443 3300046690 Bacteria 5357
1147 Ga0495624_0016799 3300046690 Bacteria 4925
1148 Ga0495624_0022670 3300046690 Bacteria 4146
1149 Ga0495624_0037870 3300046690 Bacteria 3101
1150 Ga0495624_0065362 3300046690 Bacteria 2272
1151 Ga0495624_0083479 3300046690 Bacteria 1975
1152 Ga0495624_0141203 3300046690 Bacteria 1475
1153 Ga0495624_0224406 3300046690 Bacteria 1139
1154 Ga0495624_0291703 3300046690 Bacteria 984
1155 Ga0495670_0167128 3300046691 Bacteria 1158
1156 Ga0495670_0174245 3300046691 Bacteria 1134
1157 Ga0495600_0000013 3300046809 Bacteria 119404
1158 Ga0495600_0000017 3300046809 Bacteria 107635
1159 Ga0495660_0178755 3300046810 Bacteria 1028
1160 Ga0495581_0009849 3300047315 Bacteria 5530
1161 Ga0495581_0012248 3300047315 Bacteria 4967
1162 Ga0495604_0000007 3300047317 Bacteria 412174
1163 Ga0495604_0000008 3300047317 Bacteria 341160
1164 Ga0495604_0056160 3300047317 Bacteria 3032
1165 Ga0495604_0210474 3300047317 Bacteria 1344
1166 Ga0495674_0000001 3300047319 Bacteria 778665
1167 Ga0495674_0000016 3300047319 Bacteria 216763
1168 Ga0495674_0014327 3300047319 Bacteria 7426
1169 Ga0495674_0152748 3300047319 Bacteria 1935
1170 Ga0495674_0158720 3300047319 Bacteria 1893
1171 Ga0495674_0163190 3300047319 Bacteria 1863
1172 Ga0495674_0169816 3300047319 Bacteria 1821
1173 Ga0495672_0003778 3300047320 Bacteria 12755
1174 Ga0495672_0005349 3300047320 Bacteria 10213
1175 Ga0495672_0056375 3300047320 Bacteria 2287
1176 Ga0495676_0034135 3300047321 Bacteria 4272
1177 Ga0495676_0089487 3300047321 Bacteria 2306
1178 Ga0495676_0261625 3300047321 Bacteria 1177
1179 Ga0495680_0001034 3300047322 Bacteria 30822
1180 Ga0495680_0001437 3300047322 Bacteria 25662
1181 Ga0495680_0042100 3300047322 Bacteria 3627
1182 Ga0495680_0103910 3300047322 Bacteria 2114
1183 Ga0495680_0142114 3300047322 Bacteria 1755
1184 Ga0495675_0000014 3300047444 Bacteria 137646
1185 Ga0495675_0000502 3300047444 Bacteria 25367
1186 Ga0495675_0022442 3300047444 Bacteria 4023
1187 Ga0495679_033581 3300047446 Bacteria 1638
1188 Ga0495684_0000002 3300047471 Bacteria 341216
1189 Ga0495684_0000027 3300047471 Bacteria 124367
1190 Ga0495684_0008654 3300047471 Bacteria 7873
1191 Ga0495684_0011856 3300047471 Bacteria 6725
1192 Ga0495684_0016981 3300047471 Bacteria 5607
1193 Ga0495684_0072281 3300047471 Bacteria 2621
1194 Ga0495684_0181927 3300047471 Bacteria 1558
1195 Ga0495593_0000458 3300047673 Bacteria 22861
1196 Ga0495593_0013235 3300047673 Bacteria 4709
1197 Ga0495593_0040902 3300047673 Bacteria 2494
1198 Ga0495602_0000004 3300048088 Bacteria 326932
1199 Ga0495602_0000024 3300048088 Bacteria 151162
1200 Ga0495602_0346795 3300048088 Bacteria 1073
1201 Ga0495626_0115273 3300048091 Bacteria 1160
1202 Ga0496100_0013756 3300048903 Bacteria 4680
1203 Ga0496100_0025730 3300048903 Bacteria 3600
1204 Ga0496100_0050216 3300048903 Bacteria 2701
1205 Ga0496100_0055950 3300048903 Bacteria 2579
1206 Ga0496100_0157439 3300048903 Bacteria 1625
1207 Ga0496100_0271750 3300048903 Bacteria 1261
1208 Ga0496101_0013068 3300048904 Bacteria 5554
1209 Ga0496101_0020816 3300048904 Bacteria 4499
1210 Ga0496101_0022740 3300048904 Bacteria 4320
1211 Ga0496101_0024222 3300048904 Plasmid 4199
1212 Ga0496101_0037733 3300048904 Bacteria 3429
1213 Ga0496101_0044585 3300048904 Unclassified 3174
1214 Ga0496101_0096658 3300048904 Bacteria 2205
1215 Ga0496101_0220125 3300048904 Bacteria 1473
1216 Ga0496101_0251806 3300048904 Bacteria 1376
1217 Ga0496101_0301302 3300048904 Bacteria 1255
1218 Ga0496101_0411660 3300048904 Bacteria 1065
1219 Ga0496101_0418413 3300048904 Unclassified 1056
1220 Ga0496102_0021681 3300048905 Bacteria 5683
1221 Ga0496102_0022950 3300048905 Bacteria 5536
1222 Ga0496102_0024733 3300048905 Bacteria 5341
1223 Ga0496102_0032326 3300048905 Bacteria 4700
1224 Ga0496102_0036208 3300048905 Bacteria 4445
1225 Ga0496102_0079493 3300048905 Bacteria 3020
1226 Ga0496102_0088104 3300048905 Bacteria 2869
1227 Ga0496102_0144813 3300048905 Bacteria 2229
1228 Ga0496102_0156751 3300048905 Bacteria 2140
1229 Ga0496102_0179550 3300048905 Bacteria 1994
1230 Ga0496102_0195259 3300048905 Unclassified 1907
1231 Ga0496102_0299830 3300048905 Bacteria 1514
1232 Ga0496103_0004409 3300048906 Bacteria 8539
1233 Ga0496103_0018010 3300048906 Bacteria 4232
1234 Ga0496103_0027853 3300048906 Bacteria 3427
1235 Ga0496103_0095507 3300048906 Bacteria 1878
1236 Ga0496103_0247231 3300048906 Bacteria 1148
1237 Ga0496103_0247290 3300048906 Bacteria 1147
1238 Ga0496104_0000443 3300048907 Bacteria 36009
1239 Ga0496104_0000660 3300048907 Bacteria 29613
1240 Ga0496104_0000706 3300048907 Bacteria 28670
1241 Ga0496104_0000786 3300048907 Bacteria 27166
1242 Ga0496104_0002263 3300048907 Bacteria 16590
1243 Ga0496104_0005703 3300048907 Bacteria 10894
1244 Ga0496104_0006331 3300048907 Bacteria 10415
1245 Ga0496104_0006375 3300048907 Bacteria 10376
1246 Ga0496104_0006603 3300048907 Bacteria 10203
1247 Ga0496104_0007595 3300048907 Bacteria 9599
1248 Ga0496104_0009962 3300048907 Bacteria 8482
1249 Ga0496104_0010215 3300048907 Bacteria 8383
1250 Ga0496104_0010360 3300048907 Bacteria 8326
1251 Ga0496104_0013393 3300048907 Bacteria 7390
1252 Ga0496104_0014911 3300048907 Bacteria 7025
1253 Ga0496104_0014943 3300048907 Bacteria 7021
1254 Ga0496104_0017982 3300048907 Bacteria 6445
1255 Ga0496104_0018223 3300048907 Bacteria 6404
1256 Ga0496104_0028234 3300048907 Bacteria 5200
1257 Ga0496104_0030010 3300048907 Bacteria 5049
1258 Ga0496104_0064537 3300048907 Bacteria 3473
1259 Ga0496104_0133777 3300048907 Bacteria 2382
1260 Ga0496104_0145810 3300048907 Bacteria 2273
1261 Ga0496104_0164984 3300048907 Bacteria 2124
1262 Ga0496104_0201058 3300048907 Bacteria 1904
1263 Ga0496105_0001721 3300048908 Bacteria 15643
1264 Ga0496105_0006722 3300048908 Bacteria 8849
1265 Ga0496105_0027901 3300048908 Bacteria 4616
1266 Ga0496105_0037824 3300048908 Bacteria 3975
1267 Ga0496105_0040825 3300048908 Bacteria 3826
1268 Ga0496105_0052689 3300048908 Bacteria 3361
1269 Ga0496105_0060026 3300048908 Bacteria 3137
1270 Ga0496105_0068519 3300048908 Bacteria 2931
1271 Ga0496105_0074845 3300048908 Bacteria 2797
1272 Ga0496105_0089023 3300048908 Plasmid 2550
1273 Ga0496105_0091277 3300048908 Bacteria 2515
1274 Ga0496105_0129777 3300048908 Bacteria 2078
1275 Ga0496105_0149867 3300048908 Bacteria 1917
1276 Ga0496105_0179573 3300048908 Bacteria 1733
1277 Ga0496105_0253998 3300048908 Bacteria 1423
1278 Ga0496106_0031167 3300048909 Bacteria 3973
1279 Ga0496106_0033064 3300048909 Bacteria 3857
1280 Ga0496106_0035684 3300048909 Bacteria 3718
1281 Ga0496106_0039739 3300048909 Bacteria 3523
1282 Ga0496106_0054072 3300048909 Bacteria 3033
1283 Ga0496106_0059497 3300048909 Bacteria 2894
1284 Ga0496106_0102514 3300048909 Bacteria 2220
1285 Ga0496106_0122586 3300048909 Bacteria 2033
1286 Ga0496106_0199008 3300048909 Bacteria 1594
1287 Ga0496106_0277521 3300048909 Bacteria 1342
1288 Ga0496106_0372919 3300048909 Bacteria 1147
1289 Ga0496107_0002409 3300048910 Bacteria 12112
1290 Ga0496107_0014869 3300048910 Bacteria 5450
1291 Ga0496107_0036668 3300048910 Bacteria 3517
1292 Ga0496107_0044950 3300048910 Bacteria 3176
1293 Ga0496107_0062640 3300048910 Bacteria 2695
1294 Ga0496107_0166124 3300048910 Bacteria 1636
1295 Ga0496107_0168521 3300048910 Bacteria 1625
1296 Ga0496107_0170356 3300048910 Bacteria 1615
1297 Ga0496107_0242220 3300048910 Bacteria 1342
1298 Ga0496108_0002679 3300048911 Bacteria 14262
1299 Ga0496108_0003508 3300048911 Bacteria 12567
1300 Ga0496108_0004341 3300048911 Bacteria 11401
1301 Ga0496108_0004786 3300048911 Bacteria 10919
1302 Ga0496108_0005272 3300048911 Bacteria 10433
1303 Ga0496108_0008488 3300048911 Bacteria 8334
1304 Ga0496108_0015120 3300048911 Bacteria 6297
1305 Ga0496108_0018360 3300048911 Bacteria 5728
1306 Ga0496108_0032128 3300048911 Bacteria 4358
1307 Ga0496108_0050335 3300048911 Bacteria 3487
1308 Ga0496108_0072776 3300048911 Bacteria 2901
1309 Ga0496108_0164941 3300048911 Unclassified 1915
1310 Ga0496108_0204250 3300048911 Bacteria 1715
1311 Ga0496108_0383834 3300048911 Bacteria 1227
1312 Ga0496109_0003734 3300048912 Bacteria 12724
1313 Ga0496109_0004659 3300048912 Bacteria 11448
1314 Ga0496109_0005259 3300048912 Bacteria 10809
1315 Ga0496109_0009359 3300048912 Bacteria 8345
1316 Ga0496109_0013061 3300048912 Bacteria 7184
1317 Ga0496109_0015782 3300048912 Bacteria 6593
1318 Ga0496109_0027992 3300048912 Bacteria 5039
1319 Ga0496109_0033296 3300048912 Bacteria 4635
1320 Ga0496109_0048349 3300048912 Bacteria 3870
1321 Ga0496109_0055084 3300048912 Bacteria 3628
1322 Ga0496109_0060783 3300048912 Bacteria 3453
1323 Ga0496109_0067785 3300048912 Bacteria 3269
1324 Ga0496109_0082220 3300048912 Bacteria 2968
1325 Ga0496109_0111252 3300048912 Bacteria 2547
1326 Ga0496109_0155113 3300048912 Bacteria 2145
1327 Ga0496109_0253243 3300048912 Bacteria 1658
1328 Ga0496109_0262256 3300048912 Bacteria 1628
1329 Ga0496109_0331747 3300048912 Bacteria 1436
1330 Ga0496110_0003787 3300048913 Bacteria 11653
1331 Ga0496110_0003931 3300048913 Bacteria 11437
1332 Ga0496110_0010917 3300048913 Bacteria 7407
1333 Ga0496110_0014321 3300048913 Bacteria 6580
1334 Ga0496110_0018535 3300048913 Bacteria 5836
1335 Ga0496110_0026532 3300048913 Bacteria 4959
1336 Ga0496110_0030620 3300048913 Bacteria 4639
1337 Ga0496110_0045254 3300048913 Bacteria 3846
1338 Ga0496110_0060616 3300048913 Bacteria 3338
1339 Ga0496110_0064537 3300048913 Bacteria 3236
1340 Ga0496110_0065545 3300048913 Bacteria 3211
1341 Ga0496110_0083642 3300048913 Bacteria 2847
1342 Ga0496110_0086289 3300048913 Bacteria 2802
1343 Ga0496110_0165018 3300048913 Bacteria 2008
1344 Ga0496110_0165533 3300048913 Bacteria 2005
1345 Ga0496110_0188294 3300048913 Bacteria 1874
1346 Ga0496110_0196794 3300048913 Bacteria 1830
1347 Ga0496110_0262735 3300048913 Bacteria 1571
1348 Ga0496110_0384235 3300048913 Bacteria 1279
1349 Ga0496111_0001999 3300048914 Bacteria 12130
1350 Ga0496111_0004046 3300048914 Bacteria 9211
1351 Ga0496111_0012579 3300048914 Bacteria 5735
1352 Ga0496111_0012858 3300048914 Bacteria 5680
1353 Ga0496111_0024082 3300048914 Bacteria 4281
1354 Ga0496111_0035930 3300048914 Bacteria 3543
1355 Ga0496111_0041671 3300048914 Bacteria 3295
1356 Ga0496111_0089272 3300048914 Bacteria 2257
1357 Ga0496111_0104629 3300048914 Bacteria 2082
1358 Ga0496111_0124370 3300048914 Bacteria 1906
1359 Ga0496111_0137021 3300048914 Bacteria 1813
1360 Ga0496111_0150344 3300048914 Bacteria 1727
1361 Ga0496111_0158355 3300048914 Bacteria 1681
1362 Ga0496111_0288313 3300048914 Bacteria 1217
1363 Ga0496112_0003085 3300048915 Bacteria 13652
1364 Ga0496112_0008668 3300048915 Bacteria 9118
1365 Ga0496112_0008948 3300048915 Bacteria 8990
1366 Ga0496112_0028781 3300048915 Bacteria 5366
1367 Ga0496112_0029288 3300048915 Bacteria 5324
1368 Ga0496112_0087988 3300048915 Bacteria 3074
1369 Ga0496112_0088334 3300048915 Bacteria 3067
1370 Ga0496112_0123658 3300048915 Bacteria 2558
1371 Ga0496112_0131730 3300048915 Bacteria 2471
1372 Ga0496112_0157063 3300048915 Bacteria 2241
1373 Ga0496112_0163272 3300048915 Unclassified 2194
1374 Ga0496112_0183389 3300048915 Bacteria 2057
1375 Ga0496112_0188740 3300048915 Bacteria 2024
1376 Ga0496112_0319224 3300048915 Bacteria 1498
1377 Ga0496112_0327720 3300048915 Bacteria 1475
1378 Ga0496112_0339670 3300048915 Bacteria 1445
1379 Ga0496112_0372930 3300048915 Bacteria 1368
1380 Ga0496112_0529203 3300048915 Bacteria 1113
1381 Ga0496113_0004374 3300048916 Bacteria 8665
1382 Ga0496113_0004550 3300048916 Bacteria 8541
1383 Ga0496113_0017002 3300048916 Bacteria 5038
1384 Ga0496113_0017381 3300048916 Bacteria 4991
1385 Ga0496113_0030041 3300048916 Bacteria 3931
1386 Ga0496113_0035288 3300048916 Bacteria 3656
1387 Ga0496113_0062832 3300048916 Bacteria 2805
1388 Ga0496113_0071799 3300048916 Bacteria 2633
1389 Ga0496113_0090969 3300048916 Bacteria 2351
1390 Ga0496113_0113753 3300048916 Bacteria 2109
1391 Ga0496114_0002808 3300048917 Bacteria 13342
1392 Ga0496114_0007847 3300048917 Bacteria 8442
1393 Ga0496114_0023103 3300048917 Bacteria 5069
1394 Ga0496114_0045749 3300048917 Bacteria 3637
1395 Ga0496114_0061497 3300048917 Bacteria 3141
1396 Ga0496114_0107112 3300048917 Bacteria 2392
1397 Ga0496114_0180288 3300048917 Bacteria 1844
1398 Ga0496114_0213660 3300048917 Bacteria 1692
1399 Ga0496114_0277186 3300048917 Bacteria 1478
1400 Ga0496114_0282396 3300048917 Bacteria 1464
1401 Ga0496114_0295677 3300048917 Bacteria 1429
1402 Ga0496115_0003972 3300048918 Bacteria 10670
1403 Ga0496115_0008920 3300048918 Bacteria 7436
1404 Ga0496115_0011443 3300048918 Bacteria 6650
1405 Ga0496115_0019320 3300048918 Bacteria 5242
1406 Ga0496115_0024317 3300048918 Bacteria 4707
1407 Ga0496115_0028468 3300048918 Bacteria 4380
1408 Ga0496115_0094335 3300048918 Bacteria 2448
1409 Ga0496115_0094986 3300048918 Bacteria 2440
1410 Ga0496115_0120031 3300048918 Unclassified 2163
1411 Ga0496115_0207083 3300048918 Bacteria 1620
1412 Ga0496115_0239033 3300048918 Bacteria 1497
1413 Ga0496115_0252874 3300048918 Bacteria 1450
1414 Ga0496121_0005414 3300048924 Bacteria 16387
1415 Ga0501031_0031459 3300049568 Bacteria 3462
1416 Ga0501032_0155311 3300049569 Bacteria 1503
1417 Ga0501033_0192600 3300049570 Bacteria 1458
1418 Ga0501034_0235953 3300049571 Bacteria 1776
1419 Ga0501038_0037381 3300049574 Bacteria 4256
1420 Ga0501038_0074191 3300049574 Bacteria 2879
1421 Ga0501039_0032425 3300049575 Bacteria 4028
1422 Ga0501039_0175745 3300049575 Bacteria 1684
1423 Ga0501039_0325018 3300049575 Unclassified 1209
1424 Ga0501043_0141675 3300049579 Bacteria 1883
1425 Ga0501047_0008410 3300049581 Bacteria 9737
1426 Ga0501047_0041197 3300049581 Bacteria 4463
1427 Ga0501047_0212517 3300049581 Bacteria 1792
1428 Ga0501067_0016974 3300049583 Bacteria 4022
1429 Ga0501068_0002927 3300049584 Bacteria 9093
1430 Ga0501069_0008835 3300049585 Bacteria 5309
1431 Ga0501070_0031390 3300049586 Bacteria 4451
1432 Ga0501071_0040890 3300049587 Bacteria 3319
1433 Ga0501072_0081673 3300049588 Bacteria 2562
1434 Ga0501073_0029902 3300049589 Bacteria 3890
1435 Ga0501074_0121449 3300049590 Bacteria 1868
1436 Ga0501074_0369902 3300049590 Bacteria 1017
1437 Ga0501076_0055417 3300049592 Bacteria 3144
1438 Ga0501076_0260543 3300049592 Bacteria 1420
1439 Ga0501077_0124939 3300049593 Bacteria 1631
1440 Ga0501077_0155433 3300049593 Bacteria 1452
1441 Ga0501077_0222913 3300049593 Bacteria 1198
1442 Ga0501079_0171103 3300049741 Unclassified 1694
1443 Ga0501079_0472758 3300049741 Bacteria 985
1444 Ga0501081_0108680 3300049743 Bacteria 1967
1445 Ga0501035_0043117 3300049822 Bacteria 4066
1446 Ga0501044_0390020 3300049823 Bacteria 1306
1447 Ga0501045_0039418 3300049824 Bacteria 3438
1448 Ga0501045_0148684 3300049824 Bacteria 1742
1449 nmdc:mga03n38_33415_c1 3300050490 Bacteria 2188
1450 nmdc:mga03n38_50028_c1 3300050490 Bacteria 1861
1451 nmdc:mga00v17_33683_c1 3300050491 Bacteria 3036
1452 nmdc:mga00v17_36745_c1 3300050491 Bacteria 2921
1453 nmdc:mga00v17_79235_c1 3300050491 Bacteria 2048
1454 nmdc:mga0yw44_10202_c1 3300050492 Bacteria 4789
1455 nmdc:mga0yw44_140480_c1 3300050492 Bacteria 1569
1456 nmdc:mga0yw44_34353_c1 3300050492 Bacteria 2971
1457 nmdc:mga0yw44_40280_c1 3300050492 Bacteria 2775
1458 nmdc:mga0yw44_4841_c1 3300050492 Bacteria 6256
1459 nmdc:mga0yw44_9210_c1 3300050492 Bacteria 4971
1460 nmdc:mga0k408_15901_c1 3300050493 Bacteria 2937
1461 nmdc:mga0k408_55261_c1 3300050493 Bacteria 2302
1462 nmdc:mga0k408_8835_c1 3300050493 Bacteria 5421
1463 nmdc:mga06z11_86446_c1 3300050494 Unclassified 1694
1464 nmdc:mga07m45_48809_c1 3300050496 Bacteria 2381
1465 nmdc:mga05p37_109826_c1 3300050507 Bacteria 3392
1466 nmdc:mga05p37_145470_c1 3300050507 Bacteria 2903
1467 nmdc:mga05p37_158571_c1 3300050507 Bacteria 2764
1468 nmdc:mga05p37_204558_c1 3300050507 Bacteria 2389
1469 nmdc:mga05p37_214420_c1 3300050507 Bacteria 2326
1470 nmdc:mga05p37_24284_c1 3300050507 Bacteria 7366
1471 nmdc:mga05p37_32710_c1 3300050507 Bacteria 6363
1472 nmdc:mga05p37_38199_c1 3300050507 Bacteria 5888
1473 nmdc:mga05p37_82120_c1 3300050507 Bacteria 3971
1474 nmdc:mga05p37_92500_c1 3300050507 Bacteria 3164
1475 nmdc:mga09592_1301_c1 3300050508 Bacteria 20060
1476 nmdc:mga09592_27694_c1 3300050508 Bacteria 4705
1477 nmdc:mga09592_6746_c1 3300050508 Bacteria 9341
1478 nmdc:mga0qj67_135573_c1 3300050509 Bacteria 1995
1479 nmdc:mga0qj67_180696_c1 3300050509 Unclassified 1713
1480 nmdc:mga0qj67_32944_c1 3300050509 Bacteria 4042
1481 nmdc:mga0qj67_336304_c1 3300050509 Bacteria 1221
1482 nmdc:mga0qj67_45493_c1 3300050509 Bacteria 3464
1483 nmdc:mga0qj67_74831_c1 3300050509 Bacteria 2706
1484 nmdc:mga06r32_110199_c1 3300050510 Bacteria 2708
1485 nmdc:mga06r32_2045_c1 3300050510 Bacteria 18050
1486 nmdc:mga06r32_208668_c1 3300050510 Unclassified 1941
1487 nmdc:mga06r32_252271_c1 3300050510 Bacteria 1752
1488 nmdc:mga06r32_487691_c1 3300050510 Bacteria 1210
1489 nmdc:mga06r32_58247_c1 3300050510 Bacteria 3713
1490 nmdc:mga06r32_63759_c1 3300050510 Bacteria 3553
1491 nmdc:mga06r32_64655_c1 3300050510 Bacteria 3528
1492 nmdc:mga08y16_117534_c1 3300050511 Bacteria 2768
1493 nmdc:mga08y16_164510_c1 3300050511 Bacteria 2305
1494 nmdc:mga08y16_189386_c1 3300050511 Bacteria 2134
1495 nmdc:mga08y16_306040_c1 3300050511 Bacteria 1637
1496 nmdc:mga08y16_50543_c1 3300050511 Bacteria 4351
1497 nmdc:mga08y16_6978_c1 3300050511 Bacteria 11843
1498 nmdc:mga08y16_81222_c1 3300050511 Bacteria 3380
1499 nmdc:mga08y16_81_c1 3300050511 Bacteria 81573
1500 nmdc:mga08y16_9291_c1 3300050511 Bacteria 10313
1501 nmdc:mga0n895_107425_c1 3300050512 Bacteria 2804
1502 nmdc:mga0n895_11780_c1 3300050512 Bacteria 7819
1503 nmdc:mga0n895_155906_c1 3300050512 Bacteria 2314
1504 nmdc:mga0n895_212243_c1 3300050512 Bacteria 1966
1505 nmdc:mga0n895_477492_c1 3300050512 Bacteria 1257
1506 nmdc:mga0n895_49926_c1 3300050512 Bacteria 4101
1507 nmdc:mga0n895_51599_c1 3300050512 Bacteria 4035
1508 nmdc:mga0n895_68526_c1 3300050512 Bacteria 3515
1509 nmdc:mga0n895_764831_c1 3300050512 Bacteria 958
1510 nmdc:mga0n895_78393_c1 3300050512 Bacteria 3288
1511 nmdc:mga0rr50_130193_c1 3300050513 Bacteria 2014
1512 nmdc:mga0rr50_158640_c1 3300050513 Bacteria 1834
1513 nmdc:mga0rr50_172741_c1 3300050513 Bacteria 1762
1514 nmdc:mga0rr50_291980_c1 3300050513 Bacteria 1362
1515 nmdc:mga0rr50_309232_c1 3300050513 Bacteria 1323
1516 nmdc:mga08x19_212427_c1 3300050514 Bacteria 1328
1517 nmdc:mga08x19_282554_c1 3300050514 Bacteria 1150
1518 nmdc:mga0a205_189418_c1 3300050515 Bacteria 1950
1519 nmdc:mga0a205_203591_c1 3300050515 Bacteria 1869
1520 nmdc:mga0a205_404175_c1 3300050515 Bacteria 1229
1521 nmdc:mga0a205_511381_c1 3300050515 Bacteria 1058
1522 nmdc:mga0sz30_100804_c1 3300050516 Bacteria 1261
1523 Ga0495601_0000001 3300053077 Bacteria 549454
1524 Ga0495601_0000006 3300053077 Bacteria 373770
1525 Ga0495601_0026119 3300053077 Bacteria 3604
1526 Ga0495601_0033620 3300053077 Bacteria 3195
1527 Ga0495601_0058771 3300053077 Bacteria 2437
1528 Ga0495601_0065943 3300053077 Bacteria 2305
1529 Ga0495601_0068535 3300053077 Bacteria 2261
1530 Ga0495601_0093095 3300053077 Bacteria 1941
1531 Ga0495601_0127097 3300053077 Bacteria 1658
1532 Ga0495601_0129744 3300053077 Bacteria 1641
1533 Ga0495601_0133709 3300053077 Bacteria 1616
1534 Ga0495601_0151460 3300053077 Bacteria 1514
1535 Ga0495601_0213463 3300053077 Bacteria 1261
1536 Ga0495601_0266030 3300053077 Bacteria 1119
1537 Ga0495601_0291658 3300053077 Bacteria 1063
1538 Ga0495612_0000004 3300053078 Bacteria 286946
1539 Ga0495612_0000097 3300053078 Bacteria 37614
1540 Ga0495612_0006291 3300053078 Bacteria 4893
1541 Ga0495612_0009962 3300053078 Bacteria 3848
1542 Ga0495655_0006096 3300053083 Bacteria 2171
1543 Ga0495655_0028527 3300053083 Bacteria 1334
1544 Ga0495655_0035438 3300053083 Bacteria 1241
1545 Ga0495595_0000006 3300053084 Bacteria 231295
1546 Ga0495595_0001132 3300053084 Bacteria 10328
1547 Ga0495595_0005469 3300053084 Bacteria 5143
1548 Ga0495595_0015956 3300053084 Bacteria 3208
1549 Ga0495595_0029773 3300053084 Bacteria 2445
1550 Ga0495595_0036886 3300053084 Bacteria 2221
1551 Ga0495595_0108932 3300053084 Bacteria 1342
1552 Ga0495619_0000004 3300053085 Bacteria 500068
1553 Ga0495619_0000011 3300053085 Bacteria 287128
1554 Ga0495619_0010124 3300053085 Bacteria 5937
1555 Ga0495619_0012151 3300053085 Bacteria 5421
1556 Ga0495619_0016157 3300053085 Bacteria 4725
1557 Ga0495619_0054031 3300053085 Bacteria 2658
1558 Ga0495619_0087637 3300053085 Bacteria 2105
1559 Ga0495619_0087645 3300053085 Bacteria 2105
1560 Ga0495619_0091235 3300053085 Bacteria 2062
1561 Ga0495619_0101567 3300053085 Bacteria 1958
1562 Ga0495619_0126513 3300053085 Bacteria 1754
1563 Ga0495619_0137788 3300053085 Bacteria 1679
1564 Ga0495619_0258805 3300053085 Bacteria 1206
1565 Ga0500651_0045437 3300053093 Bacteria 2763
1566 Ga0500641_0008240 3300053096 Bacteria 3716
1567 Ga0500595_003885 3300053119 Bacteria 6859
1568 Ga0500652_056340 3300053131 Bacteria 1612
1569 Ga0500588_0073832 3300053146 Bacteria 1125
1570 Ga0500616_0000002 3300053153 Bacteria 1611257
1571 Ga0500616_0001749 3300053153 Bacteria 19909
1572 Ga0501084_0022304 3300054114 Bacteria 5285
1573 Ga0501084_0353999 3300054114 Bacteria 1240
1574 Ga0501082_0034728 3300060353 Bacteria 4347
1575 Ga0530510_0111572 3300061734 Bacteria 2003

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300046664 Ga0495659_0035561 Ga0495659_0035561_925_1737 262
2 3300046514 Ga0495618_0015167 Ga0495618_0015167_638_1444 265
3 3300046533 Ga0495640_0004669 Ga0495640_0004669_6094_6900 265
4 3300009092 Ga0105250_10066235 Ga0105250_100662351 267
5 3300026121 Ga0207683_10639817 Ga0207683_106398171 267
6 3300035111 Ga0373923_0134337 Ga0373923_0134337_274_1089 269
7 3300046675 Ga0495657_0002866 Ga0495657_0002866_13501_14316 269
8 3300009036 Ga0105244_10203139 Ga0105244_102031391 270
9 3300046517 Ga0495630_0095721 Ga0495630_0095721_1406_2230 272
10 3300005435 Ga0070714_100071750 Ga0070714_1000717502 284
11 3300006028 Ga0070717_10058415 Ga0070717_100584153 284
12 3300025906 Ga0207699_10255254 Ga0207699_102552541 284
13 3300035410 Ga0373924_0104098 Ga0373924_0104098_138_1007 287
14 3300035725 Ga0373947_0015898 Ga0373947_0015898_2939_3808 287
15 3300039438 Ga0436360_0769332 Ga0436360_0769332_10929_11843 287
16 3300039447 Ga0436361_0353650 Ga0436361_0353650_2196_3110 287
17 3300046454 Ga0495592_0270605 Ga0495592_0270605_223_1092 287
18 3300046472 Ga0495580_0029339 Ga0495580_0029339_1615_2484 287
19 3300046475 Ga0495639_0088824 Ga0495639_0088824_404_1273 287
20 3300050512 nmdc:mga0n895_764831_c1 nmdc:mga0n895_764831_c1_44_913 287
21 3300050512 nmdc:mga0n895_477492_c1 nmdc:mga0n895_477492_c1_10_888 289
22 3300046526 Ga0495666_0109502 Ga0495666_0109502_209_1156 290
23 3300045976 Ga0466967_0442001 Ga0466967_0442001_182_1078 296
24 3300037466 Ga0395898_0341990 Ga0395898_0341990_13_915 297
25 3300006038 Ga0075365_10175617 Ga0075365_101756171 298
26 3300026089 Ga0207648_10067325 Ga0207648_100673253 298
27 3300035118 Ga0373954_0215620 Ga0373954_0215620_30_932 298
28 3300005441 Ga0070700_100134053 Ga0070700_1001340532 299
29 3300007788 Ga0099795_10014518 Ga0099795_100145181 300
30 3300037068 Ga0373925_0049591 Ga0373925_0049591_790_1698 300
31 3300046463 Ga0495653_0239866 Ga0495653_0239866_263_1171 300
32 3300053119 Ga0500595_003885 Ga0500595_003885_5881_6789 300
33 3300006846 Ga0075430_100431430 Ga0075430_1004314301 301
34 3300009177 Ga0105248_10172326 Ga0105248_101723262 301
35 3300010375 Ga0105239_10089195 Ga0105239_100891953 301
36 3300025900 Ga0207710_10120223 Ga0207710_101202231 301
37 3300025941 Ga0207711_10130411 Ga0207711_101304111 301
38 3300031090 Ga0265760_10000755 Ga0265760_100007557 301
39 3300035170 Ga0373943_0133451 Ga0373943_0133451_51_1031 301
40 3300035725 Ga0373947_0271560 Ga0373947_0271560_33_1013 301
41 3300048908 Ga0496105_0149867 Ga0496105_0149867_118_1098 301
42 3300048910 Ga0496107_0014869 Ga0496107_0014869_329_1309 301
43 3300048912 Ga0496109_0155113 Ga0496109_0155113_587_1567 301
44 3300048915 Ga0496112_0319224 Ga0496112_0319224_236_1216 301
45 3300048918 Ga0496115_0252874 Ga0496115_0252874_108_1088 301
46 3300050509 nmdc:mga0qj67_180696_c1 nmdc:mga0qj67_180696_c1_182_1159 301
47 3300005981 Ga0081538_10079435 Ga0081538_100794351 302
48 3300007788 Ga0099795_10000636 Ga0099795_100006365 302
49 3300025915 Ga0207693_10026624 Ga0207693_100266244 302
50 3300035170 Ga0373943_0043569 Ga0373943_0043569_681_1595 302
51 3300035695 Ga0373927_0119672 Ga0373927_0119672_156_1070 302
52 3300035725 Ga0373947_0219925 Ga0373947_0219925_74_991 302
53 3300046457 Ga0495590_0018924 Ga0495590_0018924_263_1180 302
54 3300046517 Ga0495630_0343815 Ga0495630_0343815_37_951 302
55 3300046519 Ga0495632_0006407 Ga0495632_0006407_239_1156 302
56 3300046531 Ga0495665_0170593 Ga0495665_0170593_42_959 302
57 3300046690 Ga0495624_0291703 Ga0495624_0291703_29_946 302
58 3300049575 Ga0501039_0325018 Ga0501039_0325018_25_939 302
59 3300006175 Ga0070712_100012289 Ga0070712_1000122893 303
60 3300025898 Ga0207692_10051611 Ga0207692_100516111 303
61 3300025905 Ga0207685_10106351 Ga0207685_101063511 303
62 3300025910 Ga0207684_10365999 Ga0207684_103659991 303
63 3300035113 Ga0373936_0040018 Ga0373936_0040018_83_1027 303
64 3300035695 Ga0373927_0056338 Ga0373927_0056338_1518_2435 303
65 3300037068 Ga0373925_0078691 Ga0373925_0078691_1473_2390 303
66 3300045976 Ga0466967_0166292 Ga0466967_0166292_19_936 303
67 3300046499 Ga0495594_0217053 Ga0495594_0217053_121_1038 303
68 3300046514 Ga0495618_0064197 Ga0495618_0064197_1156_2073 303
69 3300046517 Ga0495630_0326212 Ga0495630_0326212_198_1115 303
70 3300046615 Ga0495656_0118320 Ga0495656_0118320_10_921 303
71 3300046683 Ga0495658_0169160 Ga0495658_0169160_321_1238 303
72 3300046810 Ga0495660_0178755 Ga0495660_0178755_99_1010 303
73 3300048917 Ga0496114_0180288 Ga0496114_0180288_903_1820 303
74 3300049741 Ga0501079_0472758 Ga0501079_0472758_17_934 303
75 3300053077 Ga0495601_0133709 Ga0495601_0133709_261_1178 303
76 3300053153 Ga0500616_0000002 Ga0500616_0000002_776943_777860 303
77 3300005435 Ga0070714_100215580 Ga0070714_1002155802 304
78 3300007788 Ga0099795_10012339 Ga0099795_100123392 304
79 3300025905 Ga0207685_10029993 Ga0207685_100299932 304
80 3300025915 Ga0207693_10414619 Ga0207693_104146191 304
81 3300035724 Ga0373933_0333321 Ga0373933_0333321_25_948 304
82 3300035725 Ga0373947_0136598 Ga0373947_0136598_11_931 304
83 3300046517 Ga0495630_0323363 Ga0495630_0323363_249_1169 304
84 3300046690 Ga0495624_0141203 Ga0495624_0141203_531_1451 304
85 3300047320 Ga0495672_0056375 Ga0495672_0056375_785_1762 304
86 3300048907 Ga0496104_0014943 Ga0496104_0014943_781_1701 304
87 3300048911 Ga0496108_0004341 Ga0496108_0004341_6259_7179 304
88 3300048912 Ga0496109_0004659 Ga0496109_0004659_5966_6886 304
89 3300048913 Ga0496110_0003931 Ga0496110_0003931_4700_5620 304
90 3300048913 Ga0496110_0188294 Ga0496110_0188294_459_1379 304
91 3300048914 Ga0496111_0089272 Ga0496111_0089272_816_1736 304
92 3300048915 Ga0496112_0123658 Ga0496112_0123658_1606_2526 304
93 3300050512 nmdc:mga0n895_68526_c1 nmdc:mga0n895_68526_c1_829_1749 304
94 3300005339 Ga0070660_100193698 Ga0070660_1001936982 305
95 3300005356 Ga0070674_100060639 Ga0070674_1000606391 305
96 3300005548 Ga0070665_100087082 Ga0070665_1000870822 305
97 3300005564 Ga0070664_100037512 Ga0070664_1000375124 305
98 3300006178 Ga0075367_10010517 Ga0075367_100105174 305
99 3300006195 Ga0075366_10017399 Ga0075366_100173993 305
100 3300009098 Ga0105245_10179462 Ga0105245_101794622 305
101 3300009553 Ga0105249_10189922 Ga0105249_101899222 305
102 3300011119 Ga0105246_10330788 Ga0105246_103307881 305
103 3300013297 Ga0157378_10133541 Ga0157378_101335412 305
104 3300013308 Ga0157375_10102540 Ga0157375_101025403 305
105 3300014325 Ga0163163_10131371 Ga0163163_101313711 305
106 3300017792 Ga0163161_10077919 Ga0163161_100779191 305
107 3300025932 Ga0207690_10049046 Ga0207690_100490462 305
108 3300025933 Ga0207706_10032292 Ga0207706_100322925 305
109 3300025934 Ga0207686_10024773 Ga0207686_100247733 305
110 3300025937 Ga0207669_10030799 Ga0207669_100307993 305
111 3300025945 Ga0207679_10085498 Ga0207679_100854981 305
112 3300025981 Ga0207640_10109824 Ga0207640_101098242 305
113 3300025986 Ga0207658_10336107 Ga0207658_103361071 305
114 3300026067 Ga0207678_10007441 Ga0207678_100074417 305
115 3300026121 Ga0207683_10091444 Ga0207683_100914443 305
116 3300028381 Ga0268264_10414916 Ga0268264_104149161 305
117 3300036401 Ga0373937_0320029 Ga0373937_0320029_12_935 305
118 3300048904 Ga0496101_0024222 Ga0496101_0024222_1731_2717 305
119 3300048905 Ga0496102_0144813 Ga0496102_0144813_25_1011 305
120 3300048910 Ga0496107_0062640 Ga0496107_0062640_565_1551 305
121 3300048913 Ga0496110_0165533 Ga0496110_0165533_508_1521 305
122 3300048915 Ga0496112_0163272 Ga0496112_0163272_1140_2153 305
123 3300048917 Ga0496114_0061497 Ga0496114_0061497_1032_2018 305
124 3300048918 Ga0496115_0120031 Ga0496115_0120031_359_1345 305
125 3300050493 nmdc:mga0k408_15901_c1 nmdc:mga0k408_15901_c1_1402_2415 305
126 3300050494 nmdc:mga06z11_86446_c1 nmdc:mga06z11_86446_c1_485_1498 305
127 3300053084 Ga0495595_0108932 Ga0495595_0108932_406_1329 305
128 3300005617 Ga0068859_100170534 Ga0068859_1001705343 306
129 3300005618 Ga0068864_100011114 Ga0068864_1000111147 306
130 3300005983 Ga0081540_1123633 Ga0081540_11236331 306
131 3300006881 Ga0068865_100269193 Ga0068865_1002691931 306
132 3300006931 Ga0097620_100170536 Ga0097620_1001705361 306
133 3300009176 Ga0105242_10033095 Ga0105242_100330953 306
134 3300010159 Ga0099796_10090650 Ga0099796_100906501 306
135 3300025315 Ga0207697_10058344 Ga0207697_100583442 306
136 3300025901 Ga0207688_10014518 Ga0207688_100145182 306
137 3300025935 Ga0207709_10148832 Ga0207709_101488322 306
138 3300025936 Ga0207670_10003864 Ga0207670_100038643 306
139 3300025972 Ga0207668_10082393 Ga0207668_100823931 306
140 3300026089 Ga0207648_10231682 Ga0207648_102316821 306
141 3300026121 Ga0207683_10052653 Ga0207683_100526532 306
142 3300028800 Ga0265338_10103678 Ga0265338_101036782 306
143 3300031249 Ga0265339_10000038 Ga0265339_1000003863 306
144 3300031595 Ga0265313_10004634 Ga0265313_100046347 306
145 3300031712 Ga0265342_10040186 Ga0265342_100401863 306
146 3300048917 Ga0496114_0107112 Ga0496114_0107112_1316_2320 306
147 3300048918 Ga0496115_0024317 Ga0496115_0024317_1818_2747 306
148 3300005549 Ga0070704_100112963 Ga0070704_1001129632 307
149 3300013102 Ga0157371_10028416 Ga0157371_100284162 307
150 3300025915 Ga0207693_10308538 Ga0207693_103085382 307
151 3300031247 Ga0265340_10018331 Ga0265340_100183312 307
152 3300046533 Ga0495640_0170265 Ga0495640_0170265_23_1000 307
153 3300048907 Ga0496104_0164984 Ga0496104_0164984_688_1665 307
154 3300050509 nmdc:mga0qj67_336304_c1 nmdc:mga0qj67_336304_c1_185_1177 307
155 3300005436 Ga0070713_100145019 Ga0070713_1001450192 308
156 3300021361 Ga0213872_10069915 Ga0213872_100699153 308
157 3300021441 Ga0213871_10006157 Ga0213871_100061572 308
158 3300046492 Ga0495585_0035283 Ga0495585_0035283_427_1404 308
159 3300005436 Ga0070713_100066292 Ga0070713_1000662922 309
160 3300038996 Ga0242420_019451 Ga0242420_019451_153_1088 309
161 3300050511 nmdc:mga08y16_306040_c1 nmdc:mga08y16_306040_c1_86_1027 310
162 3300006353 Ga0075370_10003227 Ga0075370_100032273 311
163 3300014325 Ga0163163_10128928 Ga0163163_101289283 311
164 3300035692 Ga0373935_0089022 Ga0373935_0089022_875_1945 311
165 3300048907 Ga0496104_0145810 Ga0496104_0145810_832_1782 311
166 3300048908 Ga0496105_0037824 Ga0496105_0037824_445_1395 311
167 3300048914 Ga0496111_0150344 Ga0496111_0150344_115_1065 311
168 3300053093 Ga0500651_0045437 Ga0500651_0045437_1643_2584 311
169 3300005435 Ga0070714_100172592 Ga0070714_1001725922 312
170 3300005445 Ga0070708_100209938 Ga0070708_1002099382 312
171 3300005467 Ga0070706_100024329 Ga0070706_1000243296 312
172 3300005536 Ga0070697_100237356 Ga0070697_1002373562 312
173 3300025885 Ga0207653_10007535 Ga0207653_100075352 312
174 3300025910 Ga0207684_10025479 Ga0207684_100254796 312
175 3300025928 Ga0207700_10185847 Ga0207700_101858472 312
176 3300028380 Ga0268265_10451565 Ga0268265_104515652 312
177 3300048907 Ga0496104_0000443 Ga0496104_0000443_4623_5594 312
178 3300048913 Ga0496110_0026532 Ga0496110_0026532_3074_4051 312
179 3300048916 Ga0496113_0090969 Ga0496113_0090969_1383_2327 312
180 3300006914 Ga0075436_100193009 Ga0075436_1001930093 313
181 3300025928 Ga0207700_10283406 Ga0207700_102834062 313
182 3300025935 Ga0207709_10144785 Ga0207709_101447852 313
183 3300027512 Ga0209179_1006150 Ga0209179_10061502 313
184 3300037466 Ga0395898_0172878 Ga0395898_0172878_925_1872 313
185 3300046501 Ga0495607_0173042 Ga0495607_0173042_15_956 313
186 3300046531 Ga0495665_0065396 Ga0495665_0065396_221_1168 313
187 3300048907 Ga0496104_0010215 Ga0496104_0010215_3831_4811 313
188 3300048917 Ga0496114_0277186 Ga0496114_0277186_266_1246 313
189 3300050510 nmdc:mga06r32_252271_c1 nmdc:mga06r32_252271_c1_40_1017 313
190 3300050514 nmdc:mga08x19_282554_c1 nmdc:mga08x19_282554_c1_39_1013 313
191 3300005440 Ga0070705_100092705 Ga0070705_1000927052 314
192 3300005445 Ga0070708_100573215 Ga0070708_1005732151 314
193 3300005458 Ga0070681_10008975 Ga0070681_100089757 314
194 3300005467 Ga0070706_100011112 Ga0070706_1000111126 314
195 3300005468 Ga0070707_100026725 Ga0070707_1000267253 314
196 3300005530 Ga0070679_100494449 Ga0070679_1004944491 314
197 3300005536 Ga0070697_100177760 Ga0070697_1001777602 314
198 3300005547 Ga0070693_100131506 Ga0070693_1001315061 314
199 3300006871 Ga0075434_100045047 Ga0075434_1000450472 314
200 3300025910 Ga0207684_10038693 Ga0207684_100386933 314
201 3300025912 Ga0207707_10150023 Ga0207707_101500232 314
202 3300025921 Ga0207652_10441019 Ga0207652_104410191 314
203 3300025922 Ga0207646_10050419 Ga0207646_100504193 314
204 3300048088 Ga0495602_0346795 Ga0495602_0346795_13_963 314
205 3300005445 Ga0070708_100323604 Ga0070708_1003236042 315
206 3300005937 Ga0081455_10008338 Ga0081455_100083386 315
207 3300007265 Ga0099794_10102192 Ga0099794_101021921 315
208 3300009148 Ga0105243_10178425 Ga0105243_101784252 315
209 3300009177 Ga0105248_10244766 Ga0105248_102447662 315
210 3300009553 Ga0105249_10128069 Ga0105249_101280693 315
211 3300011119 Ga0105246_10087017 Ga0105246_100870172 315
212 3300013297 Ga0157378_10422641 Ga0157378_104226412 315
213 3300013308 Ga0157375_10178636 Ga0157375_101786361 315
214 3300028556 Ga0265337_1010592 Ga0265337_10105921 315
215 3300035691 Ga0373931_0002198 Ga0373931_0002198_3321_4274 315
216 3300035695 Ga0373927_0219489 Ga0373927_0219489_251_1204 315
217 3300035725 Ga0373947_0209132 Ga0373947_0209132_14_967 315
218 3300038443 Ga0395901_0480438 Ga0395901_0480438_300_1256 315
219 3300039447 Ga0436361_1050847 Ga0436361_1050847_75_1052 315
220 3300050490 nmdc:mga03n38_50028_c1 nmdc:mga03n38_50028_c1_485_1438 315
221 3300053096 Ga0500641_0008240 Ga0500641_0008240_619_1572 315
222 3300006038 Ga0075365_10100653 Ga0075365_101006533 316
223 3300050492 nmdc:mga0yw44_40280_c1 nmdc:mga0yw44_40280_c1_697_1674 316
224 3300005530 Ga0070679_100010022 Ga0070679_1000100223 317
225 3300005530 Ga0070679_100033132 Ga0070679_1000331324 317
226 3300009093 Ga0105240_10071834 Ga0105240_100718342 317
227 3300025913 Ga0207695_10199856 Ga0207695_101998561 317
228 3300006195 Ga0075366_10015058 Ga0075366_100150584 318
229 3300009147 Ga0114129_10349352 Ga0114129_103493521 318
230 3300013308 Ga0157375_10252568 Ga0157375_102525682 318
231 3300025907 Ga0207645_10032983 Ga0207645_100329832 318
232 3300050493 nmdc:mga0k408_55261_c1 nmdc:mga0k408_55261_c1_152_1135 318
233 3300053131 Ga0500652_056340 Ga0500652_056340_551_1522 318
234 3300005439 Ga0070711_100230686 Ga0070711_1002306862 319
235 3300005445 Ga0070708_100149223 Ga0070708_1001492232 319
236 3300005467 Ga0070706_100238360 Ga0070706_1002383601 319
237 3300005468 Ga0070707_100057710 Ga0070707_1000577102 319
238 3300005471 Ga0070698_100337524 Ga0070698_1003375241 319
239 3300005518 Ga0070699_100023093 Ga0070699_1000230936 319
240 3300007076 Ga0075435_100041238 Ga0075435_1000412384 319
241 3300025910 Ga0207684_10122888 Ga0207684_101228881 319
242 3300036401 Ga0373937_0000516 Ga0373937_0000516_369_1346 319
243 3300048913 Ga0496110_0010917 Ga0496110_0010917_209_1186 319
244 3300050513 nmdc:mga0rr50_172741_c1 nmdc:mga0rr50_172741_c1_354_1331 319
245 3300053083 Ga0495655_0028527 Ga0495655_0028527_147_1112 319
246 3300005436 Ga0070713_100347667 Ga0070713_1003476671 320
247 3300006175 Ga0070712_100091782 Ga0070712_1000917821 320
248 3300010159 Ga0099796_10031731 Ga0099796_100317312 320
249 3300025915 Ga0207693_10020263 Ga0207693_100202633 320
250 3300031090 Ga0265760_10008390 Ga0265760_100083903 320
251 3300035120 Ga0373957_0052022 Ga0373957_0052022_218_1198 320
252 3300035692 Ga0373935_0218132 Ga0373935_0218132_174_1154 320
253 3300048904 Ga0496101_0220125 Ga0496101_0220125_186_1157 320
254 3300048912 Ga0496109_0033296 Ga0496109_0033296_374_1342 320
255 3300048913 Ga0496110_0196794 Ga0496110_0196794_346_1314 320
256 3300048914 Ga0496111_0137021 Ga0496111_0137021_307_1275 320
257 3300048915 Ga0496112_0029288 Ga0496112_0029288_3785_4753 320
258 3300048916 Ga0496113_0035288 Ga0496113_0035288_574_1542 320
259 3300053077 Ga0495601_0065943 Ga0495601_0065943_513_1484 320
260 3300053085 Ga0495619_0126513 Ga0495619_0126513_422_1393 320
261 3300005331 Ga0070670_100068665 Ga0070670_1000686652 321
262 3300005331 Ga0070670_100159589 Ga0070670_1001595892 321
263 3300005354 Ga0070675_100236301 Ga0070675_1002363012 321
264 3300005364 Ga0070673_100078862 Ga0070673_1000788622 321
265 3300005435 Ga0070714_100076959 Ga0070714_1000769592 321
266 3300005435 Ga0070714_100104574 Ga0070714_1001045742 321
267 3300005535 Ga0070684_100479601 Ga0070684_1004796011 321
268 3300005937 Ga0081455_10032092 Ga0081455_100320922 321
269 3300006028 Ga0070717_10046690 Ga0070717_100466903 321
270 3300006028 Ga0070717_10227872 Ga0070717_102278722 321
271 3300006038 Ga0075365_10003327 Ga0075365_100033276 321
272 3300006051 Ga0075364_10047602 Ga0075364_100476022 321
273 3300006173 Ga0070716_100176522 Ga0070716_1001765221 321
274 3300006175 Ga0070712_100002543 Ga0070712_1000025436 321
275 3300006175 Ga0070712_100004977 Ga0070712_1000049772 321
276 3300006175 Ga0070712_100170666 Ga0070712_1001706661 321
277 3300006844 Ga0075428_100014005 Ga0075428_1000140054 321
278 3300006844 Ga0075428_100026075 Ga0075428_1000260754 321
279 3300006844 Ga0075428_100027123 Ga0075428_1000271236 321
280 3300006844 Ga0075428_100273466 Ga0075428_1002734662 321
281 3300006871 Ga0075434_100040222 Ga0075434_10004022216 321
282 3300006871 Ga0075434_100355857 Ga0075434_1003558573 321
283 3300006871 Ga0075434_100420986 Ga0075434_1004209862 321
284 3300006880 Ga0075429_100003214 Ga0075429_1000032145 321
285 3300006914 Ga0075436_100057676 Ga0075436_1000576763 321
286 3300007076 Ga0075435_100293150 Ga0075435_1002931501 321
287 3300009094 Ga0111539_10011255 Ga0111539_1001125510 321
288 3300009094 Ga0111539_10054718 Ga0111539_100547182 321
289 3300009094 Ga0111539_10067349 Ga0111539_100673494 321
290 3300013306 Ga0163162_10370676 Ga0163162_103706761 321
291 3300014325 Ga0163163_10027007 Ga0163163_100270072 321
292 3300014325 Ga0163163_10095995 Ga0163163_100959951 321
293 3300021384 Ga0213876_10029719 Ga0213876_100297192 321
294 3300025915 Ga0207693_10002435 Ga0207693_100024355 321
295 3300025915 Ga0207693_10004770 Ga0207693_100047708 321
296 3300025915 Ga0207693_10168210 Ga0207693_101682103 321
297 3300025915 Ga0207693_10210096 Ga0207693_102100961 321
298 3300025922 Ga0207646_10301959 Ga0207646_103019592 321
299 3300025925 Ga0207650_10009756 Ga0207650_100097567 321
300 3300025929 Ga0207664_10234546 Ga0207664_102345462 321
301 3300025960 Ga0207651_10056398 Ga0207651_100563981 321
302 3300027907 Ga0207428_10015228 Ga0207428_100152285 321
303 3300027907 Ga0207428_10022443 Ga0207428_100224434 321
304 3300028023 Ga0265357_1006184 Ga0265357_10061841 321
305 3300028800 Ga0265338_10044886 Ga0265338_100448862 321
306 3300030763 Ga0265763_1000647 Ga0265763_10006472 321
307 3300030763 Ga0265763_1001801 Ga0265763_10018012 321
308 3300031247 Ga0265340_10043812 Ga0265340_100438122 321
309 3300031247 Ga0265340_10068000 Ga0265340_100680001 321
310 3300031249 Ga0265339_10000109 Ga0265339_1000010914 321
311 3300031595 Ga0265313_10000257 Ga0265313_1000025741 321
312 3300031712 Ga0265342_10018056 Ga0265342_100180562 321
313 3300032002 Ga0307416_100117916 Ga0307416_1001179162 321
314 3300035089 Ga0373944_0010852 Ga0373944_0010852_1318_2289 321
315 3300035091 Ga0373951_0020164 Ga0373951_0020164_338_1312 321
316 3300035113 Ga0373936_0036167 Ga0373936_0036167_244_1215 321
317 3300035114 Ga0373939_0029775 Ga0373939_0029775_212_1186 321
318 3300035116 Ga0373945_0028448 Ga0373945_0028448_877_1863 321
319 3300035118 Ga0373954_0048002 Ga0373954_0048002_241_1245 321
320 3300035119 Ga0373956_0004575 Ga0373956_0004575_3104_4075 321
321 3300035120 Ga0373957_0005849 Ga0373957_0005849_959_1930 321
322 3300035170 Ga0373943_0057594 Ga0373943_0057594_185_1171 321
323 3300035172 Ga0373955_0000740 Ga0373955_0000740_3064_4035 321
324 3300035172 Ga0373955_0102118 Ga0373955_0102118_152_1129 321
325 3300035242 Ga0373962_0029351 Ga0373962_0029351_465_1439 321
326 3300035410 Ga0373924_0063134 Ga0373924_0063134_380_1351 321
327 3300035410 Ga0373924_0094898 Ga0373924_0094898_237_1223 321
328 3300035691 Ga0373931_0074715 Ga0373931_0074715_718_1707 321
329 3300035692 Ga0373935_0176494 Ga0373935_0176494_289_1275 321
330 3300035724 Ga0373933_0028765 Ga0373933_0028765_329_1300 321
331 3300036401 Ga0373937_0003652 Ga0373937_0003652_1726_2697 321
332 3300036401 Ga0373937_0018126 Ga0373937_0018126_4924_5895 321
333 3300036401 Ga0373937_0038834 Ga0373937_0038834_891_1862 321
334 3300037068 Ga0373925_0243319 Ga0373925_0243319_261_1238 321
335 3300037068 Ga0373925_0250051 Ga0373925_0250051_147_1133 321
336 3300039437 Ga0436365_0566541 Ga0436365_0566541_122_1093 321
337 3300039437 Ga0436365_1323468 Ga0436365_1323468_171_1148 321
338 3300039437 Ga0436365_1680786 Ga0436365_1680786_16_987 321
339 3300039447 Ga0436361_0480515 Ga0436361_0480515_2420_3397 321
340 3300046454 Ga0495592_0031156 Ga0495592_0031156_2972_3949 321
341 3300046455 Ga0495603_0151420 Ga0495603_0151420_207_1184 321
342 3300046459 Ga0495629_0136193 Ga0495629_0136193_326_1303 321
343 3300046459 Ga0495629_0220455 Ga0495629_0220455_219_1205 321
344 3300046472 Ga0495580_0143302 Ga0495580_0143302_276_1262 321
345 3300046475 Ga0495639_0034919 Ga0495639_0034919_1211_2188 321
346 3300046476 Ga0495662_0010230 Ga0495662_0010230_153_1130 321
347 3300046476 Ga0495662_0097610 Ga0495662_0097610_164_1150 321
348 3300046477 Ga0495664_0216966 Ga0495664_0216966_19_990 321
349 3300046511 Ga0495608_0048188 Ga0495608_0048188_1430_2401 321
350 3300046514 Ga0495618_0039444 Ga0495618_0039444_251_1222 321
351 3300046514 Ga0495618_0100863 Ga0495618_0100863_738_1724 321
352 3300046514 Ga0495618_0159573 Ga0495618_0159573_234_1211 321
353 3300046517 Ga0495630_0075614 Ga0495630_0075614_988_1959 321
354 3300046517 Ga0495630_0104617 Ga0495630_0104617_1090_2076 321
355 3300046517 Ga0495630_0254044 Ga0495630_0254044_245_1222 321
356 3300046526 Ga0495666_0048508 Ga0495666_0048508_982_1968 321
357 3300046526 Ga0495666_0163392 Ga0495666_0163392_17_994 321
358 3300046529 Ga0495652_0050303 Ga0495652_0050303_2499_3476 321
359 3300046529 Ga0495652_0260966 Ga0495652_0260966_113_1117 321
360 3300046531 Ga0495665_0010438 Ga0495665_0010438_1211_2182 321
361 3300046531 Ga0495665_0036545 Ga0495665_0036545_162_1139 321
362 3300046531 Ga0495665_0049787 Ga0495665_0049787_283_1269 321
363 3300046533 Ga0495640_0011330 Ga0495640_0011330_325_1302 321
364 3300046533 Ga0495640_0100050 Ga0495640_0100050_345_1322 321
365 3300046533 Ga0495640_0114986 Ga0495640_0114986_685_1659 321
366 3300046533 Ga0495640_0202787 Ga0495640_0202787_181_1167 321
367 3300046535 Ga0495586_0048453 Ga0495586_0048453_1251_2222 321
368 3300046536 Ga0495587_0019961 Ga0495587_0019961_1864_2835 321
369 3300046559 Ga0495667_0189129 Ga0495667_0189129_217_1203 321
370 3300046642 Ga0495634_0008586 Ga0495634_0008586_179_1150 321
371 3300046642 Ga0495634_0013528 Ga0495634_0013528_4342_5319 321
372 3300046642 Ga0495634_0071090 Ga0495634_0071090_1157_2143 321
373 3300046642 Ga0495634_0102067 Ga0495634_0102067_612_1583 321
374 3300046663 Ga0495635_0000280 Ga0495635_0000280_836_1807 321
375 3300046663 Ga0495635_0019209 Ga0495635_0019209_3306_4277 321
376 3300046689 Ga0495613_0079076 Ga0495613_0079076_1283_2269 321
377 3300046690 Ga0495624_0014443 Ga0495624_0014443_1662_2633 321
378 3300046690 Ga0495624_0022670 Ga0495624_0022670_2502_3488 321
379 3300047315 Ga0495581_0012248 Ga0495581_0012248_3349_4320 321
380 3300047317 Ga0495604_0056160 Ga0495604_0056160_1826_2797 321
381 3300047319 Ga0495674_0014327 Ga0495674_0014327_233_1210 321
382 3300047319 Ga0495674_0152748 Ga0495674_0152748_792_1769 321
383 3300047322 Ga0495680_0042100 Ga0495680_0042100_348_1325 321
384 3300047322 Ga0495680_0142114 Ga0495680_0142114_652_1623 321
385 3300047444 Ga0495675_0022442 Ga0495675_0022442_1435_2406 321
386 3300047471 Ga0495684_0011856 Ga0495684_0011856_4737_5723 321
387 3300048905 Ga0496102_0079493 Ga0496102_0079493_577_1548 321
388 3300048905 Ga0496102_0179550 Ga0496102_0179550_746_1720 321
389 3300048907 Ga0496104_0002263 Ga0496104_0002263_7456_8439 321
390 3300048907 Ga0496104_0006375 Ga0496104_0006375_7674_8648 321
391 3300048907 Ga0496104_0030010 Ga0496104_0030010_2348_3319 321
392 3300048908 Ga0496105_0060026 Ga0496105_0060026_1587_2570 321
393 3300048909 Ga0496106_0059497 Ga0496106_0059497_808_1779 321
394 3300048910 Ga0496107_0168521 Ga0496107_0168521_529_1512 321
395 3300048911 Ga0496108_0003508 Ga0496108_0003508_11077_12051 321
396 3300048911 Ga0496108_0005272 Ga0496108_0005272_7713_8684 321
397 3300048912 Ga0496109_0005259 Ga0496109_0005259_3286_4260 321
398 3300048913 Ga0496110_0003787 Ga0496110_0003787_5523_6497 321
399 3300048914 Ga0496111_0001999 Ga0496111_0001999_241_1215 321
400 3300048914 Ga0496111_0104629 Ga0496111_0104629_903_1874 321
401 3300048915 Ga0496112_0003085 Ga0496112_0003085_1707_2678 321
402 3300048915 Ga0496112_0008668 Ga0496112_0008668_4112_5086 321
403 3300048916 Ga0496113_0004374 Ga0496113_0004374_4375_5349 321
404 3300048916 Ga0496113_0071799 Ga0496113_0071799_644_1615 321
405 3300048918 Ga0496115_0011443 Ga0496115_0011443_2089_3072 321
406 3300050491 nmdc:mga00v17_36745_c1 nmdc:mga00v17_36745_c1_1393_2364 321
407 3300050492 nmdc:mga0yw44_4841_c1 nmdc:mga0yw44_4841_c1_1140_2111 321
408 3300050511 nmdc:mga08y16_117534_c1 nmdc:mga08y16_117534_c1_755_1732 321
409 3300050511 nmdc:mga08y16_164510_c1 nmdc:mga08y16_164510_c1_167_1138 321
410 3300050511 nmdc:mga08y16_9291_c1 nmdc:mga08y16_9291_c1_3074_4048 321
411 3300050512 nmdc:mga0n895_155906_c1 nmdc:mga0n895_155906_c1_313_1311 321
412 3300050513 nmdc:mga0rr50_158640_c1 nmdc:mga0rr50_158640_c1_827_1798 321
413 3300050513 nmdc:mga0rr50_309232_c1 nmdc:mga0rr50_309232_c1_206_1204 321
414 3300050514 nmdc:mga08x19_212427_c1 nmdc:mga08x19_212427_c1_104_1102 321
415 3300053077 Ga0495601_0068535 Ga0495601_0068535_840_1817 321
416 3300053077 Ga0495601_0093095 Ga0495601_0093095_540_1511 321
417 3300053077 Ga0495601_0151460 Ga0495601_0151460_416_1402 321
418 3300053078 Ga0495612_0006291 Ga0495612_0006291_2800_3771 321
419 3300053078 Ga0495612_0009962 Ga0495612_0009962_302_1273 321
420 3300053084 Ga0495595_0005469 Ga0495595_0005469_780_1751 321
421 3300053084 Ga0495595_0015956 Ga0495595_0015956_1445_2416 321
422 3300053085 Ga0495619_0012151 Ga0495619_0012151_2013_2984 321
423 3300053085 Ga0495619_0016157 Ga0495619_0016157_341_1318 321
424 3300053085 Ga0495619_0137788 Ga0495619_0137788_566_1552 321
425 3300005331 Ga0070670_100101432 Ga0070670_1001014322 322
426 3300005340 Ga0070689_100008616 Ga0070689_1000086166 322
427 3300005365 Ga0070688_100017289 Ga0070688_1000172893 322
428 3300005439 Ga0070711_100261603 Ga0070711_1002616031 322
429 3300005456 Ga0070678_100478252 Ga0070678_1004782521 322
430 3300005459 Ga0068867_100206310 Ga0068867_1002063102 322
431 3300005937 Ga0081455_10062658 Ga0081455_100626582 322
432 3300005937 Ga0081455_10068729 Ga0081455_100687292 322
433 3300005937 Ga0081455_10181971 Ga0081455_101819712 322
434 3300005983 Ga0081540_1000005 Ga0081540_1000005258 322
435 3300005983 Ga0081540_1044164 Ga0081540_10441641 322
436 3300005983 Ga0081540_1109128 Ga0081540_11091281 322
437 3300006028 Ga0070717_10068282 Ga0070717_100682823 322
438 3300006028 Ga0070717_10136792 Ga0070717_101367922 322
439 3300006028 Ga0070717_10196387 Ga0070717_101963872 322
440 3300006195 Ga0075366_10033495 Ga0075366_100334952 322
441 3300006844 Ga0075428_100346782 Ga0075428_1003467822 322
442 3300006847 Ga0075431_100353182 Ga0075431_1003531822 322
443 3300006871 Ga0075434_100294932 Ga0075434_1002949321 322
444 3300007076 Ga0075435_100346791 Ga0075435_1003467911 322
445 3300007265 Ga0099794_10000511 Ga0099794_100005114 322
446 3300007788 Ga0099795_10001128 Ga0099795_100011285 322
447 3300009094 Ga0111539_10466257 Ga0111539_104662571 322
448 3300009098 Ga0105245_10175251 Ga0105245_101752511 322
449 3300009098 Ga0105245_10391778 Ga0105245_103917782 322
450 3300009101 Ga0105247_10170114 Ga0105247_101701142 322
451 3300009101 Ga0105247_10298740 Ga0105247_102987401 322
452 3300009147 Ga0114129_10806875 Ga0114129_108068751 322
453 3300009148 Ga0105243_10213976 Ga0105243_102139762 322
454 3300009176 Ga0105242_10320870 Ga0105242_103208702 322
455 3300009551 Ga0105238_10171169 Ga0105238_101711691 322
456 3300009553 Ga0105249_10468784 Ga0105249_104687842 322
457 3300010159 Ga0099796_10003060 Ga0099796_100030603 322
458 3300010159 Ga0099796_10007189 Ga0099796_100071892 322
459 3300011119 Ga0105246_10228891 Ga0105246_102288912 322
460 3300013306 Ga0163162_10344151 Ga0163162_103441512 322
461 3300014325 Ga0163163_10052450 Ga0163163_100524502 322
462 3300014325 Ga0163163_10077956 Ga0163163_100779562 322
463 3300014325 Ga0163163_10112113 Ga0163163_101121133 322
464 3300014968 Ga0157379_10249399 Ga0157379_102493992 322
465 3300025925 Ga0207650_10081554 Ga0207650_100815542 322
466 3300025929 Ga0207664_10187373 Ga0207664_101873732 322
467 3300025960 Ga0207651_10450990 Ga0207651_104509901 322
468 3300027512 Ga0209179_1029630 Ga0209179_10296301 322
469 3300027671 Ga0209588_1001180 Ga0209588_10011804 322
470 3300028577 Ga0265318_10089770 Ga0265318_100897701 322
471 3300031238 Ga0265332_10100268 Ga0265332_101002682 322
472 3300031240 Ga0265320_10012936 Ga0265320_100129362 322
473 3300035083 Ga0373926_0004849 Ga0373926_0004849_2155_3129 322
474 3300035111 Ga0373923_0008195 Ga0373923_0008195_2463_3440 322
475 3300035113 Ga0373936_0000132 Ga0373936_0000132_7159_8136 322
476 3300035114 Ga0373939_0056225 Ga0373939_0056225_100_1077 322
477 3300035116 Ga0373945_0007553 Ga0373945_0007553_2354_3331 322
478 3300035117 Ga0373953_0000825 Ga0373953_0000825_3149_4126 322
479 3300035118 Ga0373954_0002809 Ga0373954_0002809_199_1176 322
480 3300035118 Ga0373954_0091647 Ga0373954_0091647_167_1141 322
481 3300035120 Ga0373957_0080745 Ga0373957_0080745_280_1257 322
482 3300035171 Ga0373946_0004139 Ga0373946_0004139_2715_3692 322
483 3300035172 Ga0373955_0001043 Ga0373955_0001043_4597_5574 322
484 3300035172 Ga0373955_0075487 Ga0373955_0075487_179_1153 322
485 3300035410 Ga0373924_0000481 Ga0373924_0000481_6493_7470 322
486 3300035691 Ga0373931_0002781 Ga0373931_0002781_6138_7115 322
487 3300035692 Ga0373935_0000179 Ga0373935_0000179_13481_14458 322
488 3300035695 Ga0373927_0006518 Ga0373927_0006518_2403_3380 322
489 3300035695 Ga0373927_0044431 Ga0373927_0044431_1823_2800 322
490 3300035725 Ga0373947_0006445 Ga0373947_0006445_4683_5660 322
491 3300035725 Ga0373947_0018204 Ga0373947_0018204_2186_3160 322
492 3300036401 Ga0373937_0000691 Ga0373937_0000691_27467_28444 322
493 3300036401 Ga0373937_0083475 Ga0373937_0083475_160_1137 322
494 3300037068 Ga0373925_0000639 Ga0373925_0000639_27023_28000 322
495 3300037068 Ga0373925_0046777 Ga0373925_0046777_2133_3107 322
496 3300046454 Ga0495592_0000348 Ga0495592_0000348_18451_19428 322
497 3300046455 Ga0495603_0213423 Ga0495603_0213423_109_1083 322
498 3300046459 Ga0495629_0071151 Ga0495629_0071151_736_1710 322
499 3300046459 Ga0495629_0091368 Ga0495629_0091368_265_1242 322
500 3300046462 Ga0495651_0000781 Ga0495651_0000781_12228_13205 322
501 3300046463 Ga0495653_0000030 Ga0495653_0000030_44968_45945 322
502 3300046472 Ga0495580_0011401 Ga0495580_0011401_1550_2524 322
503 3300046477 Ga0495664_0000003 Ga0495664_0000003_180418_181395 322
504 3300046477 Ga0495664_0026096 Ga0495664_0026096_1519_2493 322
505 3300046511 Ga0495608_0000011 Ga0495608_0000011_126422_127399 322
506 3300046514 Ga0495618_0000025 Ga0495618_0000025_96716_97693 322
507 3300046514 Ga0495618_0014700 Ga0495618_0014700_1812_2786 322
508 3300046514 Ga0495618_0014992 Ga0495618_0014992_3699_4676 322
509 3300046516 Ga0495628_0000001 Ga0495628_0000001_669819_670796 322
510 3300046517 Ga0495630_0004861 Ga0495630_0004861_1723_2700 322
511 3300046517 Ga0495630_0006811 Ga0495630_0006811_5987_6961 322
512 3300046526 Ga0495666_0157016 Ga0495666_0157016_64_1038 322
513 3300046529 Ga0495652_0000002 Ga0495652_0000002_884353_885330 322
514 3300046529 Ga0495652_0078348 Ga0495652_0078348_175_1149 322
515 3300046531 Ga0495665_0033332 Ga0495665_0033332_782_1759 322
516 3300046533 Ga0495640_0000002 Ga0495640_0000002_124682_125659 322
517 3300046533 Ga0495640_0016212 Ga0495640_0016212_997_1971 322
518 3300046533 Ga0495640_0061377 Ga0495640_0061377_80_1054 322
519 3300046533 Ga0495640_0185473 Ga0495640_0185473_289_1266 322
520 3300046536 Ga0495587_0000001 Ga0495587_0000001_197088_198065 322
521 3300046543 Ga0495645_0000276 Ga0495645_0000276_18287_19264 322
522 3300046559 Ga0495667_0000004 Ga0495667_0000004_96735_97712 322
523 3300046559 Ga0495667_0056279 Ga0495667_0056279_1407_2381 322
524 3300046642 Ga0495634_0001327 Ga0495634_0001327_3310_4287 322
525 3300046642 Ga0495634_0026514 Ga0495634_0026514_15_992 322
526 3300046663 Ga0495635_0000001 Ga0495635_0000001_182899_183876 322
527 3300046663 Ga0495635_0039030 Ga0495635_0039030_1260_2234 322
528 3300046663 Ga0495635_0076345 Ga0495635_0076345_141_1118 322
529 3300046675 Ga0495657_0000190 Ga0495657_0000190_18187_19164 322
530 3300046678 Ga0495599_0000212 Ga0495599_0000212_18464_19441 322
531 3300046679 Ga0495623_0000043 Ga0495623_0000043_15570_16547 322
532 3300046680 Ga0495646_0000009 Ga0495646_0000009_197999_198976 322
533 3300046681 Ga0495647_0020884 Ga0495647_0020884_1187_2161 322
534 3300046683 Ga0495658_0013169 Ga0495658_0013169_1772_2746 322
535 3300046689 Ga0495613_0004409 Ga0495613_0004409_8008_8985 322
536 3300046689 Ga0495613_0022159 Ga0495613_0022159_1922_2896 322
537 3300046690 Ga0495624_0016799 Ga0495624_0016799_2640_3617 322
538 3300046690 Ga0495624_0065362 Ga0495624_0065362_194_1168 322
539 3300046809 Ga0495600_0000017 Ga0495600_0000017_98682_99659 322
540 3300047317 Ga0495604_0000008 Ga0495604_0000008_321969_322946 322
541 3300047317 Ga0495604_0210474 Ga0495604_0210474_348_1325 322
542 3300047319 Ga0495674_0000016 Ga0495674_0000016_18329_19306 322
543 3300047319 Ga0495674_0158720 Ga0495674_0158720_410_1387 322
544 3300047319 Ga0495674_0169816 Ga0495674_0169816_819_1796 322
545 3300047322 Ga0495680_0001034 Ga0495680_0001034_18443_19420 322
546 3300047444 Ga0495675_0000502 Ga0495675_0000502_5994_6971 322
547 3300047471 Ga0495684_0000002 Ga0495684_0000002_322027_323004 322
548 3300047471 Ga0495684_0008654 Ga0495684_0008654_4783_5757 322
549 3300047471 Ga0495684_0072281 Ga0495684_0072281_1540_2517 322
550 3300047673 Ga0495593_0000458 Ga0495593_0000458_4670_5647 322
551 3300047673 Ga0495593_0013235 Ga0495593_0013235_1254_2228 322
552 3300048088 Ga0495602_0000024 Ga0495602_0000024_18443_19420 322
553 3300048903 Ga0496100_0013756 Ga0496100_0013756_2396_3373 322
554 3300048904 Ga0496101_0020816 Ga0496101_0020816_957_1934 322
555 3300048904 Ga0496101_0418413 Ga0496101_0418413_23_1009 322
556 3300048905 Ga0496102_0022950 Ga0496102_0022950_2102_3079 322
557 3300048905 Ga0496102_0036208 Ga0496102_0036208_864_1850 322
558 3300048906 Ga0496103_0247231 Ga0496103_0247231_34_1008 322
559 3300048907 Ga0496104_0064537 Ga0496104_0064537_1040_2017 322
560 3300048907 Ga0496104_0133777 Ga0496104_0133777_1187_2173 322
561 3300048908 Ga0496105_0052689 Ga0496105_0052689_789_1766 322
562 3300048908 Ga0496105_0089023 Ga0496105_0089023_1417_2403 322
563 3300048909 Ga0496106_0033064 Ga0496106_0033064_702_1679 322
564 3300048909 Ga0496106_0372919 Ga0496106_0372919_79_1056 322
565 3300048910 Ga0496107_0036668 Ga0496107_0036668_504_1481 322
566 3300048911 Ga0496108_0050335 Ga0496108_0050335_564_1541 322
567 3300048912 Ga0496109_0009359 Ga0496109_0009359_4579_5565 322
568 3300048912 Ga0496109_0027992 Ga0496109_0027992_3225_4202 322
569 3300048913 Ga0496110_0045254 Ga0496110_0045254_642_1619 322
570 3300048913 Ga0496110_0060616 Ga0496110_0060616_1208_2194 322
571 3300048914 Ga0496111_0041671 Ga0496111_0041671_1540_2517 322
572 3300048915 Ga0496112_0008948 Ga0496112_0008948_3426_4412 322
573 3300048917 Ga0496114_0002808 Ga0496114_0002808_11426_12403 322
574 3300048918 Ga0496115_0008920 Ga0496115_0008920_3618_4595 322
575 3300049741 Ga0501079_0171103 Ga0501079_0171103_177_1151 322
576 3300050490 nmdc:mga03n38_33415_c1 nmdc:mga03n38_33415_c1_913_1890 322
577 3300050515 nmdc:mga0a205_511381_c1 nmdc:mga0a205_511381_c1_62_1039 322
578 3300050516 nmdc:mga0sz30_100804_c1 nmdc:mga0sz30_100804_c1_22_996 322
579 3300053077 Ga0495601_0000001 Ga0495601_0000001_361527_362504 322
580 3300053077 Ga0495601_0033620 Ga0495601_0033620_1899_2876 322
581 3300053077 Ga0495601_0213463 Ga0495601_0213463_60_1037 322
582 3300053077 Ga0495601_0266030 Ga0495601_0266030_107_1084 322
583 3300053078 Ga0495612_0000097 Ga0495612_0000097_18206_19183 322
584 3300053084 Ga0495595_0001132 Ga0495595_0001132_3371_4348 322
585 3300053084 Ga0495595_0036886 Ga0495595_0036886_852_1829 322
586 3300053085 Ga0495619_0000004 Ga0495619_0000004_361558_362535 322
587 3300053085 Ga0495619_0087637 Ga0495619_0087637_710_1687 322
588 3300053085 Ga0495619_0258805 Ga0495619_0258805_80_1057 322
589 3300054114 Ga0501084_0022304 Ga0501084_0022304_3563_4537 322
590 3300001991 JGI24743J22301_10006362 JGI24743J22301_100063622 323
591 3300002074 JGI24748J21848_1006701 JGI24748J21848_10067012 323
592 3300002239 JGI24034J26672_10010156 JGI24034J26672_100101562 323
593 3300002244 JGI24742J22300_10015628 JGI24742J22300_100156282 323
594 3300002459 JGI24751J29686_10020555 JGI24751J29686_100205552 323
595 3300003911 JGI25405J52794_10015483 JGI25405J52794_100154832 323
596 3300005329 Ga0070683_100031717 Ga0070683_1000317175 323
597 3300005329 Ga0070683_100220252 Ga0070683_1002202522 323
598 3300005330 Ga0070690_100046048 Ga0070690_1000460482 323
599 3300005331 Ga0070670_100018569 Ga0070670_1000185692 323
600 3300005331 Ga0070670_100148859 Ga0070670_1001488591 323
601 3300005331 Ga0070670_100192988 Ga0070670_1001929882 323
602 3300005334 Ga0068869_100120806 Ga0068869_1001208061 323
603 3300005335 Ga0070666_10146934 Ga0070666_101469341 323
604 3300005335 Ga0070666_10153657 Ga0070666_101536573 323
605 3300005338 Ga0068868_100066964 Ga0068868_1000669642 323
606 3300005338 Ga0068868_100260967 Ga0068868_1002609672 323
607 3300005339 Ga0070660_100200412 Ga0070660_1002004121 323
608 3300005340 Ga0070689_100009023 Ga0070689_1000090233 323
609 3300005340 Ga0070689_100070241 Ga0070689_1000702412 323
610 3300005340 Ga0070689_100308516 Ga0070689_1003085162 323
611 3300005341 Ga0070691_10036528 Ga0070691_100365282 323
612 3300005343 Ga0070687_100055723 Ga0070687_1000557232 323
613 3300005343 Ga0070687_100098840 Ga0070687_1000988401 323
614 3300005344 Ga0070661_100142219 Ga0070661_1001422191 323
615 3300005347 Ga0070668_100142683 Ga0070668_1001426831 323
616 3300005347 Ga0070668_100308306 Ga0070668_1003083062 323
617 3300005353 Ga0070669_100027048 Ga0070669_1000270482 323
618 3300005353 Ga0070669_100041467 Ga0070669_1000414673 323
619 3300005354 Ga0070675_100011458 Ga0070675_1000114586 323
620 3300005354 Ga0070675_100132780 Ga0070675_1001327802 323
621 3300005354 Ga0070675_100319469 Ga0070675_1003194692 323
622 3300005355 Ga0070671_100020244 Ga0070671_1000202442 323
623 3300005355 Ga0070671_100079554 Ga0070671_1000795542 323
624 3300005355 Ga0070671_100091945 Ga0070671_1000919452 323
625 3300005355 Ga0070671_100241595 Ga0070671_1002415952 323
626 3300005356 Ga0070674_100004853 Ga0070674_1000048537 323
627 3300005356 Ga0070674_100026512 Ga0070674_1000265125 323
628 3300005356 Ga0070674_100065363 Ga0070674_1000653631 323
629 3300005356 Ga0070674_100120073 Ga0070674_1001200731 323
630 3300005356 Ga0070674_100156028 Ga0070674_1001560282 323
631 3300005364 Ga0070673_100032355 Ga0070673_1000323551 323
632 3300005364 Ga0070673_100064182 Ga0070673_1000641822 323
633 3300005364 Ga0070673_100076996 Ga0070673_1000769962 323
634 3300005364 Ga0070673_100403541 Ga0070673_1004035411 323
635 3300005365 Ga0070688_100010373 Ga0070688_1000103733 323
636 3300005365 Ga0070688_100072025 Ga0070688_1000720252 323
637 3300005365 Ga0070688_100125001 Ga0070688_1001250012 323
638 3300005365 Ga0070688_100201012 Ga0070688_1002010121 323
639 3300005367 Ga0070667_100141157 Ga0070667_1001411571 323
640 3300005367 Ga0070667_100379159 Ga0070667_1003791591 323
641 3300005434 Ga0070709_10030645 Ga0070709_100306453 323
642 3300005434 Ga0070709_10047082 Ga0070709_100470821 323
643 3300005434 Ga0070709_10078278 Ga0070709_100782782 323
644 3300005435 Ga0070714_100031518 Ga0070714_1000315184 323
645 3300005436 Ga0070713_100004119 Ga0070713_10000411911 323
646 3300005436 Ga0070713_100008359 Ga0070713_1000083595 323
647 3300005436 Ga0070713_100012035 Ga0070713_1000120352 323
648 3300005436 Ga0070713_100039350 Ga0070713_1000393503 323
649 3300005436 Ga0070713_100116622 Ga0070713_1001166224 323
650 3300005436 Ga0070713_100390687 Ga0070713_1003906872 323
651 3300005436 Ga0070713_100415813 Ga0070713_1004158131 323
652 3300005436 Ga0070713_100511909 Ga0070713_1005119091 323
653 3300005437 Ga0070710_10004450 Ga0070710_100044502 323
654 3300005437 Ga0070710_10005028 Ga0070710_100050285 323
655 3300005437 Ga0070710_10011019 Ga0070710_100110193 323
656 3300005437 Ga0070710_10014050 Ga0070710_100140504 323
657 3300005437 Ga0070710_10031214 Ga0070710_100312142 323
658 3300005437 Ga0070710_10044571 Ga0070710_100445711 323
659 3300005437 Ga0070710_10057405 Ga0070710_100574054 323
660 3300005437 Ga0070710_10077079 Ga0070710_100770793 323
661 3300005437 Ga0070710_10286230 Ga0070710_102862301 323
662 3300005439 Ga0070711_100016408 Ga0070711_1000164084 323
663 3300005439 Ga0070711_100040083 Ga0070711_1000400833 323
664 3300005439 Ga0070711_100077461 Ga0070711_1000774612 323
665 3300005439 Ga0070711_100174991 Ga0070711_1001749913 323
666 3300005440 Ga0070705_100037053 Ga0070705_1000370533 323
667 3300005441 Ga0070700_100059883 Ga0070700_1000598832 323
668 3300005441 Ga0070700_100218670 Ga0070700_1002186702 323
669 3300005445 Ga0070708_100036937 Ga0070708_1000369372 323
670 3300005445 Ga0070708_100044846 Ga0070708_1000448462 323
671 3300005445 Ga0070708_100046364 Ga0070708_1000463643 323
672 3300005445 Ga0070708_100091441 Ga0070708_1000914412 323
673 3300005445 Ga0070708_100429756 Ga0070708_1004297561 323
674 3300005455 Ga0070663_100096720 Ga0070663_1000967202 323
675 3300005455 Ga0070663_100191583 Ga0070663_1001915832 323
676 3300005456 Ga0070678_100011939 Ga0070678_1000119393 323
677 3300005456 Ga0070678_100014681 Ga0070678_1000146812 323
678 3300005456 Ga0070678_100046086 Ga0070678_1000460862 323
679 3300005456 Ga0070678_100128195 Ga0070678_1001281951 323
680 3300005456 Ga0070678_100165995 Ga0070678_1001659952 323
681 3300005457 Ga0070662_100021738 Ga0070662_1000217383 323
682 3300005457 Ga0070662_100070425 Ga0070662_1000704251 323
683 3300005457 Ga0070662_100171871 Ga0070662_1001718712 323
684 3300005458 Ga0070681_10001525 Ga0070681_100015257 323
685 3300005459 Ga0068867_100076646 Ga0068867_1000766462 323
686 3300005466 Ga0070685_10028916 Ga0070685_100289163 323
687 3300005467 Ga0070706_100026569 Ga0070706_1000265693 323
688 3300005467 Ga0070706_100081067 Ga0070706_1000810673 323
689 3300005467 Ga0070706_100122999 Ga0070706_1001229992 323
690 3300005467 Ga0070706_100131942 Ga0070706_1001319423 323
691 3300005467 Ga0070706_100257426 Ga0070706_1002574261 323
692 3300005467 Ga0070706_100360706 Ga0070706_1003607061 323
693 3300005467 Ga0070706_100446342 Ga0070706_1004463422 323
694 3300005468 Ga0070707_100067635 Ga0070707_1000676353 323
695 3300005468 Ga0070707_100167949 Ga0070707_1001679491 323
696 3300005468 Ga0070707_100180883 Ga0070707_1001808832 323
697 3300005468 Ga0070707_100342196 Ga0070707_1003421961 323
698 3300005468 Ga0070707_100355040 Ga0070707_1003550402 323
699 3300005468 Ga0070707_100379341 Ga0070707_1003793412 323
700 3300005471 Ga0070698_100011071 Ga0070698_1000110714 323
701 3300005471 Ga0070698_100040443 Ga0070698_1000404432 323
702 3300005471 Ga0070698_100093887 Ga0070698_1000938873 323
703 3300005471 Ga0070698_100098692 Ga0070698_1000986923 323
704 3300005471 Ga0070698_100122215 Ga0070698_1001222152 323
705 3300005471 Ga0070698_100127613 Ga0070698_1001276132 323
706 3300005471 Ga0070698_100232471 Ga0070698_1002324712 323
707 3300005471 Ga0070698_100271459 Ga0070698_1002714592 323
708 3300005471 Ga0070698_100311683 Ga0070698_1003116832 323
709 3300005471 Ga0070698_100358713 Ga0070698_1003587131 323
710 3300005471 Ga0070698_100371901 Ga0070698_1003719012 323
711 3300005471 Ga0070698_100618614 Ga0070698_1006186141 323
712 3300005518 Ga0070699_100018717 Ga0070699_1000187171 323
713 3300005518 Ga0070699_100022076 Ga0070699_1000220766 323
714 3300005518 Ga0070699_100045971 Ga0070699_1000459713 323
715 3300005518 Ga0070699_100130995 Ga0070699_1001309952 323
716 3300005518 Ga0070699_100178923 Ga0070699_1001789231 323
717 3300005518 Ga0070699_100184997 Ga0070699_1001849972 323
718 3300005518 Ga0070699_100257401 Ga0070699_1002574012 323
719 3300005518 Ga0070699_100408219 Ga0070699_1004082192 323
720 3300005530 Ga0070679_100018585 Ga0070679_1000185854 323
721 3300005535 Ga0070684_100093165 Ga0070684_1000931651 323
722 3300005536 Ga0070697_100014128 Ga0070697_1000141283 323
723 3300005536 Ga0070697_100051701 Ga0070697_1000517012 323
724 3300005536 Ga0070697_100074530 Ga0070697_1000745302 323
725 3300005536 Ga0070697_100297350 Ga0070697_1002973501 323
726 3300005536 Ga0070697_100349192 Ga0070697_1003491921 323
727 3300005536 Ga0070697_100413507 Ga0070697_1004135071 323
728 3300005543 Ga0070672_100083799 Ga0070672_1000837991 323
729 3300005543 Ga0070672_100207515 Ga0070672_1002075152 323
730 3300005543 Ga0070672_100213277 Ga0070672_1002132772 323
731 3300005543 Ga0070672_100371054 Ga0070672_1003710541 323
732 3300005544 Ga0070686_100042774 Ga0070686_1000427742 323
733 3300005544 Ga0070686_100118475 Ga0070686_1001184752 323
734 3300005548 Ga0070665_100077979 Ga0070665_1000779792 323
735 3300005548 Ga0070665_100094212 Ga0070665_1000942122 323
736 3300005548 Ga0070665_100152431 Ga0070665_1001524312 323
737 3300005548 Ga0070665_100515917 Ga0070665_1005159171 323
738 3300005563 Ga0068855_100394387 Ga0068855_1003943872 323
739 3300005564 Ga0070664_100037165 Ga0070664_1000371653 323
740 3300005564 Ga0070664_100108589 Ga0070664_1001085892 323
741 3300005577 Ga0068857_100113920 Ga0068857_1001139202 323
742 3300005578 Ga0068854_100088541 Ga0068854_1000885411 323
743 3300005578 Ga0068854_100148531 Ga0068854_1001485311 323
744 3300005578 Ga0068854_100157066 Ga0068854_1001570661 323
745 3300005614 Ga0068856_100008281 Ga0068856_1000082816 323
746 3300005615 Ga0070702_100013753 Ga0070702_1000137533 323
747 3300005615 Ga0070702_100085925 Ga0070702_1000859252 323
748 3300005616 Ga0068852_100203923 Ga0068852_1002039232 323
749 3300005616 Ga0068852_100235177 Ga0068852_1002351772 323
750 3300005618 Ga0068864_100010129 Ga0068864_1000101293 323
751 3300005618 Ga0068864_100012057 Ga0068864_1000120575 323
752 3300005618 Ga0068864_100082089 Ga0068864_1000820892 323
753 3300005618 Ga0068864_100096904 Ga0068864_1000969043 323
754 3300005719 Ga0068861_100309991 Ga0068861_1003099912 323
755 3300005834 Ga0068851_10040560 Ga0068851_100405601 323
756 3300005840 Ga0068870_10056343 Ga0068870_100563432 323
757 3300005841 Ga0068863_100050391 Ga0068863_1000503915 323
758 3300005841 Ga0068863_100122471 Ga0068863_1001224712 323
759 3300005842 Ga0068858_100164298 Ga0068858_1001642982 323
760 3300005842 Ga0068858_100185999 Ga0068858_1001859992 323
761 3300005842 Ga0068858_100375638 Ga0068858_1003756382 323
762 3300005843 Ga0068860_100034202 Ga0068860_1000342023 323
763 3300005843 Ga0068860_100122235 Ga0068860_1001222354 323
764 3300005844 Ga0068862_100075552 Ga0068862_1000755522 323
765 3300005844 Ga0068862_100218228 Ga0068862_1002182281 323
766 3300005937 Ga0081455_10004238 Ga0081455_100042387 323
767 3300005937 Ga0081455_10005779 Ga0081455_100057797 323
768 3300005937 Ga0081455_10007104 Ga0081455_100071042 323
769 3300005937 Ga0081455_10007366 Ga0081455_100073662 323
770 3300005937 Ga0081455_10009638 Ga0081455_100096382 323
771 3300005937 Ga0081455_10025133 Ga0081455_100251333 323
772 3300005937 Ga0081455_10032158 Ga0081455_100321584 323
773 3300005937 Ga0081455_10034630 Ga0081455_100346304 323
774 3300005937 Ga0081455_10040625 Ga0081455_100406252 323
775 3300005937 Ga0081455_10045542 Ga0081455_100455425 323
776 3300005937 Ga0081455_10052752 Ga0081455_100527522 323
777 3300005937 Ga0081455_10061147 Ga0081455_100611475 323
778 3300005937 Ga0081455_10069112 Ga0081455_100691122 323
779 3300005937 Ga0081455_10093413 Ga0081455_100934134 323
780 3300005937 Ga0081455_10103415 Ga0081455_101034152 323
781 3300005937 Ga0081455_10103415 Ga0081455_101034153 323
782 3300005937 Ga0081455_10105270 Ga0081455_101052701 323
783 3300005937 Ga0081455_10112256 Ga0081455_101122562 323
784 3300005937 Ga0081455_10113490 Ga0081455_101134904 323
785 3300005937 Ga0081455_10202923 Ga0081455_102029232 323
786 3300005937 Ga0081455_10240177 Ga0081455_102401771 323
787 3300005937 Ga0081455_10241328 Ga0081455_102413282 323
788 3300005981 Ga0081538_10061696 Ga0081538_100616962 323
789 3300005983 Ga0081540_1002105 Ga0081540_10021054 323
790 3300005983 Ga0081540_1015575 Ga0081540_10155753 323
791 3300005983 Ga0081540_1088417 Ga0081540_10884172 323
792 3300005985 Ga0081539_10000008 Ga0081539_10000008284 323
793 3300006028 Ga0070717_10002307 Ga0070717_1000230710 323
794 3300006028 Ga0070717_10006917 Ga0070717_100069175 323
795 3300006028 Ga0070717_10013103 Ga0070717_100131034 323
796 3300006028 Ga0070717_10017464 Ga0070717_100174645 323
797 3300006028 Ga0070717_10037566 Ga0070717_100375663 323
798 3300006028 Ga0070717_10048886 Ga0070717_100488862 323
799 3300006028 Ga0070717_10054878 Ga0070717_100548782 323
800 3300006028 Ga0070717_10056592 Ga0070717_100565923 323
801 3300006028 Ga0070717_10176640 Ga0070717_101766402 323
802 3300006028 Ga0070717_10228853 Ga0070717_102288532 323
803 3300006028 Ga0070717_10265500 Ga0070717_102655002 323
804 3300006028 Ga0070717_10278760 Ga0070717_102787601 323
805 3300006028 Ga0070717_10338860 Ga0070717_103388602 323
806 3300006028 Ga0070717_10363678 Ga0070717_103636781 323
807 3300006028 Ga0070717_10380193 Ga0070717_103801932 323
808 3300006038 Ga0075365_10004320 Ga0075365_100043203 323
809 3300006038 Ga0075365_10065284 Ga0075365_100652842 323
810 3300006038 Ga0075365_10267302 Ga0075365_102673021 323
811 3300006038 Ga0075365_10277661 Ga0075365_102776611 323
812 3300006048 Ga0075363_100026119 Ga0075363_1000261193 323
813 3300006048 Ga0075363_100101995 Ga0075363_1001019952 323
814 3300006051 Ga0075364_10038512 Ga0075364_100385123 323
815 3300006163 Ga0070715_10001543 Ga0070715_100015435 323
816 3300006173 Ga0070716_100026846 Ga0070716_1000268462 323
817 3300006175 Ga0070712_100000699 Ga0070712_10000069922 323
818 3300006175 Ga0070712_100009031 Ga0070712_1000090319 323
819 3300006175 Ga0070712_100013407 Ga0070712_1000134074 323
820 3300006175 Ga0070712_100015083 Ga0070712_1000150833 323
821 3300006175 Ga0070712_100037903 Ga0070712_1000379033 323
822 3300006175 Ga0070712_100074349 Ga0070712_1000743492 323
823 3300006175 Ga0070712_100102503 Ga0070712_1001025032 323
824 3300006175 Ga0070712_100123319 Ga0070712_1001233194 323
825 3300006175 Ga0070712_100211885 Ga0070712_1002118852 323
826 3300006175 Ga0070712_100225363 Ga0070712_1002253632 323
827 3300006175 Ga0070712_100258721 Ga0070712_1002587212 323
828 3300006175 Ga0070712_100392108 Ga0070712_1003921082 323
829 3300006175 Ga0070712_100420357 Ga0070712_1004203571 323
830 3300006177 Ga0075362_10006825 Ga0075362_100068252 323
831 3300006178 Ga0075367_10036980 Ga0075367_100369804 323
832 3300006178 Ga0075367_10069218 Ga0075367_100692183 323
833 3300006178 Ga0075367_10126495 Ga0075367_101264951 323
834 3300006195 Ga0075366_10009871 Ga0075366_100098714 323
835 3300006195 Ga0075366_10146137 Ga0075366_101461372 323
836 3300006237 Ga0097621_100278075 Ga0097621_1002780752 323
837 3300006353 Ga0075370_10107044 Ga0075370_101070441 323
838 3300006353 Ga0075370_10243608 Ga0075370_102436081 323
839 3300006358 Ga0068871_100325781 Ga0068871_1003257811 323
840 3300006844 Ga0075428_100010595 Ga0075428_1000105953 323
841 3300006844 Ga0075428_100108686 Ga0075428_1001086862 323
842 3300006844 Ga0075428_100116533 Ga0075428_1001165331 323
843 3300006844 Ga0075428_100157334 Ga0075428_1001573343 323
844 3300006844 Ga0075428_100163984 Ga0075428_1001639842 323
845 3300006844 Ga0075428_100383614 Ga0075428_1003836141 323
846 3300006844 Ga0075428_100619970 Ga0075428_1006199701 323
847 3300006846 Ga0075430_100010004 Ga0075430_1000100043 323
848 3300006846 Ga0075430_100019458 Ga0075430_1000194586 323
849 3300006846 Ga0075430_100036853 Ga0075430_1000368532 323
850 3300006847 Ga0075431_100015344 Ga0075431_1000153444 323
851 3300006847 Ga0075431_100070861 Ga0075431_1000708615 323
852 3300006847 Ga0075431_100072930 Ga0075431_1000729302 323
853 3300006847 Ga0075431_100232961 Ga0075431_1002329612 323
854 3300006847 Ga0075431_100269390 Ga0075431_1002693902 323
855 3300006847 Ga0075431_100416867 Ga0075431_1004168672 323
856 3300006852 Ga0075433_10006873 Ga0075433_100068731 323
857 3300006852 Ga0075433_10221933 Ga0075433_102219332 323
858 3300006852 Ga0075433_10397058 Ga0075433_103970582 323
859 3300006871 Ga0075434_100016953 Ga0075434_1000169533 323
860 3300006871 Ga0075434_100033546 Ga0075434_1000335463 323
861 3300006871 Ga0075434_100034044 Ga0075434_1000340444 323
862 3300006871 Ga0075434_100056864 Ga0075434_1000568644 323
863 3300006871 Ga0075434_100073818 Ga0075434_1000738182 323
864 3300006871 Ga0075434_100269313 Ga0075434_1002693133 323
865 3300006871 Ga0075434_100414619 Ga0075434_1004146192 323
866 3300006880 Ga0075429_100000335 Ga0075429_10000033525 323
867 3300006880 Ga0075429_100024339 Ga0075429_1000243392 323
868 3300006880 Ga0075429_100024840 Ga0075429_1000248404 323
869 3300006880 Ga0075429_100054506 Ga0075429_1000545065 323
870 3300006880 Ga0075429_100235110 Ga0075429_1002351102 323
871 3300006881 Ga0068865_100054285 Ga0068865_1000542852 323
872 3300006881 Ga0068865_100119786 Ga0068865_1001197862 323
873 3300007076 Ga0075435_100092053 Ga0075435_1000920532 323
874 3300007076 Ga0075435_100176243 Ga0075435_1001762432 323
875 3300007076 Ga0075435_100257752 Ga0075435_1002577521 323
876 3300007076 Ga0075435_100409636 Ga0075435_1004096362 323
877 3300007265 Ga0099794_10001409 Ga0099794_100014094 323
878 3300007265 Ga0099794_10003050 Ga0099794_100030503 323
879 3300007265 Ga0099794_10035288 Ga0099794_100352882 323
880 3300007265 Ga0099794_10074272 Ga0099794_100742722 323
881 3300007788 Ga0099795_10000907 Ga0099795_100009078 323
882 3300007788 Ga0099795_10001010 Ga0099795_100010103 323
883 3300007788 Ga0099795_10002700 Ga0099795_100027002 323
884 3300007788 Ga0099795_10006163 Ga0099795_100061632 323
885 3300007788 Ga0099795_10017981 Ga0099795_100179812 323
886 3300007788 Ga0099795_10024295 Ga0099795_100242952 323
887 3300007788 Ga0099795_10033966 Ga0099795_100339663 323
888 3300007788 Ga0099795_10059410 Ga0099795_100594102 323
889 3300007788 Ga0099795_10062717 Ga0099795_100627171 323
890 3300007788 Ga0099795_10115387 Ga0099795_101153871 323
891 3300009094 Ga0111539_10000460 Ga0111539_1000046039 323
892 3300009094 Ga0111539_10007590 Ga0111539_1000759010 323
893 3300009094 Ga0111539_10029907 Ga0111539_100299072 323
894 3300009094 Ga0111539_10080355 Ga0111539_100803552 323
895 3300009094 Ga0111539_10108704 Ga0111539_101087042 323
896 3300009094 Ga0111539_10111949 Ga0111539_101119492 323
897 3300009094 Ga0111539_10265095 Ga0111539_102650952 323
898 3300009098 Ga0105245_10025645 Ga0105245_100256454 323
899 3300009101 Ga0105247_10012908 Ga0105247_100129082 323
900 3300009101 Ga0105247_10030298 Ga0105247_100302982 323
901 3300009101 Ga0105247_10067289 Ga0105247_100672891 323
902 3300009101 Ga0105247_10098504 Ga0105247_100985042 323
903 3300009101 Ga0105247_10342539 Ga0105247_103425391 323
904 3300009147 Ga0114129_10004508 Ga0114129_1000450819 323
905 3300009147 Ga0114129_10016541 Ga0114129_100165419 323
906 3300009147 Ga0114129_10031478 Ga0114129_100314782 323
907 3300009147 Ga0114129_10032128 Ga0114129_100321284 323
908 3300009147 Ga0114129_10163248 Ga0114129_101632482 323
909 3300009147 Ga0114129_10194385 Ga0114129_101943852 323
910 3300009147 Ga0114129_10197123 Ga0114129_101971233 323
911 3300009147 Ga0114129_10254235 Ga0114129_102542351 323
912 3300009147 Ga0114129_10269567 Ga0114129_102695672 323
913 3300009147 Ga0114129_10441005 Ga0114129_104410051 323
914 3300009147 Ga0114129_10569262 Ga0114129_105692622 323
915 3300009147 Ga0114129_10838853 Ga0114129_108388532 323
916 3300009148 Ga0105243_10126095 Ga0105243_101260952 323
917 3300009176 Ga0105242_10021354 Ga0105242_100213542 323
918 3300009176 Ga0105242_10038691 Ga0105242_100386912 323
919 3300009176 Ga0105242_10077711 Ga0105242_100777112 323
920 3300009177 Ga0105248_10011975 Ga0105248_100119758 323
921 3300009177 Ga0105248_10124787 Ga0105248_101247872 323
922 3300009545 Ga0105237_10092733 Ga0105237_100927333 323
923 3300009551 Ga0105238_10041647 Ga0105238_100416475 323
924 3300009553 Ga0105249_10105632 Ga0105249_101056322 323
925 3300010159 Ga0099796_10000392 Ga0099796_100003922 323
926 3300010159 Ga0099796_10005609 Ga0099796_100056092 323
927 3300010159 Ga0099796_10008474 Ga0099796_100084743 323
928 3300010159 Ga0099796_10015304 Ga0099796_100153042 323
929 3300010159 Ga0099796_10017185 Ga0099796_100171851 323
930 3300010159 Ga0099796_10017260 Ga0099796_100172602 323
931 3300010159 Ga0099796_10059150 Ga0099796_100591501 323
932 3300010375 Ga0105239_10014862 Ga0105239_100148627 323
933 3300010375 Ga0105239_10351224 Ga0105239_103512241 323
934 3300010375 Ga0105239_10401504 Ga0105239_104015042 323
935 3300010375 Ga0105239_10682353 Ga0105239_106823531 323
936 3300011119 Ga0105246_10019249 Ga0105246_100192495 323
937 3300011119 Ga0105246_10050531 Ga0105246_100505311 323
938 3300011119 Ga0105246_10156295 Ga0105246_101562952 323
939 3300013102 Ga0157371_10302455 Ga0157371_103024551 323
940 3300013296 Ga0157374_10041727 Ga0157374_100417272 323
941 3300013296 Ga0157374_10065302 Ga0157374_100653022 323
942 3300013306 Ga0163162_10026037 Ga0163162_100260373 323
943 3300013306 Ga0163162_10547752 Ga0163162_105477521 323
944 3300013306 Ga0163162_10689752 Ga0163162_106897522 323
945 3300013307 Ga0157372_10251778 Ga0157372_102517782 323
946 3300013308 Ga0157375_10013199 Ga0157375_100131997 323
947 3300013308 Ga0157375_10087694 Ga0157375_100876942 323
948 3300013308 Ga0157375_10148637 Ga0157375_101486372 323
949 3300013308 Ga0157375_10179167 Ga0157375_101791672 323
950 3300013308 Ga0157375_10188064 Ga0157375_101880643 323
951 3300013308 Ga0157375_10724216 Ga0157375_107242161 323
952 3300014325 Ga0163163_10028539 Ga0163163_100285396 323
953 3300014325 Ga0163163_10082653 Ga0163163_100826534 323
954 3300014325 Ga0163163_10164629 Ga0163163_101646292 323
955 3300014325 Ga0163163_10322030 Ga0163163_103220302 323
956 3300014325 Ga0163163_10533702 Ga0163163_105337022 323
957 3300014326 Ga0157380_10165772 Ga0157380_101657721 323
958 3300014326 Ga0157380_10208959 Ga0157380_102089592 323
959 3300014326 Ga0157380_10335691 Ga0157380_103356912 323
960 3300014326 Ga0157380_10441883 Ga0157380_104418832 323
961 3300014745 Ga0157377_10003368 Ga0157377_100033683 323
962 3300014745 Ga0157377_10008667 Ga0157377_100086674 323
963 3300014745 Ga0157377_10252057 Ga0157377_102520571 323
964 3300014968 Ga0157379_10323234 Ga0157379_103232341 323
965 3300014968 Ga0157379_10338700 Ga0157379_103387002 323
966 3300014968 Ga0157379_10354446 Ga0157379_103544461 323
967 3300014969 Ga0157376_10468574 Ga0157376_104685741 323
968 3300017792 Ga0163161_10027408 Ga0163161_100274082 323
969 3300017792 Ga0163161_10048558 Ga0163161_100485583 323
970 3300017792 Ga0163161_10059104 Ga0163161_100591041 323
971 3300017792 Ga0163161_10071538 Ga0163161_100715382 323
972 3300021361 Ga0213872_10031448 Ga0213872_100314483 323
973 3300021377 Ga0213874_10047992 Ga0213874_100479921 323
974 3300024225 Ga0224572_1005521 Ga0224572_10055212 323
975 3300025297 Ga0209758_1000241 Ga0209758_100024110 323
976 3300025321 Ga0207656_10027635 Ga0207656_100276352 323
977 3300025893 Ga0207682_10040908 Ga0207682_100409081 323
978 3300025898 Ga0207692_10005911 Ga0207692_100059114 323
979 3300025898 Ga0207692_10024236 Ga0207692_100242361 323
980 3300025898 Ga0207692_10054763 Ga0207692_100547632 323
981 3300025898 Ga0207692_10164802 Ga0207692_101648021 323
982 3300025899 Ga0207642_10159539 Ga0207642_101595391 323
983 3300025901 Ga0207688_10003081 Ga0207688_100030817 323
984 3300025901 Ga0207688_10040700 Ga0207688_100407002 323
985 3300025901 Ga0207688_10148391 Ga0207688_101483911 323
986 3300025903 Ga0207680_10112030 Ga0207680_101120301 323
987 3300025903 Ga0207680_10114764 Ga0207680_101147642 323
988 3300025904 Ga0207647_10020750 Ga0207647_100207504 323
989 3300025905 Ga0207685_10002127 Ga0207685_100021272 323
990 3300025906 Ga0207699_10050854 Ga0207699_100508543 323
991 3300025906 Ga0207699_10088241 Ga0207699_100882412 323
992 3300025907 Ga0207645_10022958 Ga0207645_100229583 323
993 3300025908 Ga0207643_10003291 Ga0207643_100032917 323
994 3300025910 Ga0207684_10021505 Ga0207684_100215059 323
995 3300025910 Ga0207684_10032236 Ga0207684_100322364 323
996 3300025910 Ga0207684_10042334 Ga0207684_100423344 323
997 3300025910 Ga0207684_10050122 Ga0207684_100501221 323
998 3300025910 Ga0207684_10059011 Ga0207684_100590111 323
999 3300025910 Ga0207684_10062499 Ga0207684_100624992 323
1000 3300025910 Ga0207684_10123852 Ga0207684_101238522 323
1001 3300025910 Ga0207684_10141993 Ga0207684_101419933 323
1002 3300025910 Ga0207684_10167028 Ga0207684_101670282 323
1003 3300025910 Ga0207684_10194560 Ga0207684_101945602 323
1004 3300025914 Ga0207671_10107589 Ga0207671_101075892 323
1005 3300025915 Ga0207693_10014478 Ga0207693_100144787 323
1006 3300025915 Ga0207693_10014604 Ga0207693_100146045 323
1007 3300025915 Ga0207693_10018937 Ga0207693_100189375 323
1008 3300025915 Ga0207693_10029804 Ga0207693_100298042 323
1009 3300025915 Ga0207693_10043187 Ga0207693_100431873 323
1010 3300025915 Ga0207693_10071374 Ga0207693_100713742 323
1011 3300025915 Ga0207693_10075641 Ga0207693_100756411 323
1012 3300025915 Ga0207693_10097988 Ga0207693_100979882 323
1013 3300025915 Ga0207693_10098829 Ga0207693_100988292 323
1014 3300025915 Ga0207693_10108576 Ga0207693_101085762 323
1015 3300025915 Ga0207693_10109904 Ga0207693_101099041 323
1016 3300025915 Ga0207693_10155775 Ga0207693_101557751 323
1017 3300025915 Ga0207693_10161301 Ga0207693_101613011 323
1018 3300025915 Ga0207693_10209744 Ga0207693_102097441 323
1019 3300025915 Ga0207693_10249755 Ga0207693_102497551 323
1020 3300025915 Ga0207693_10268525 Ga0207693_102685252 323
1021 3300025915 Ga0207693_10325409 Ga0207693_103254091 323
1022 3300025915 Ga0207693_10375435 Ga0207693_103754352 323
1023 3300025916 Ga0207663_10008274 Ga0207663_100082743 323
1024 3300025916 Ga0207663_10011889 Ga0207663_100118892 323
1025 3300025916 Ga0207663_10069792 Ga0207663_100697922 323
1026 3300025916 Ga0207663_10126035 Ga0207663_101260352 323
1027 3300025916 Ga0207663_10135955 Ga0207663_101359552 323
1028 3300025916 Ga0207663_10163780 Ga0207663_101637802 323
1029 3300025916 Ga0207663_10173082 Ga0207663_101730822 323
1030 3300025916 Ga0207663_10186294 Ga0207663_101862941 323
1031 3300025916 Ga0207663_10229378 Ga0207663_102293782 323
1032 3300025916 Ga0207663_10271537 Ga0207663_102715371 323
1033 3300025918 Ga0207662_10006695 Ga0207662_100066955 323
1034 3300025918 Ga0207662_10009387 Ga0207662_100093874 323
1035 3300025919 Ga0207657_10044026 Ga0207657_100440263 323
1036 3300025920 Ga0207649_10204992 Ga0207649_102049922 323
1037 3300025922 Ga0207646_10145651 Ga0207646_101456511 323
1038 3300025922 Ga0207646_10198425 Ga0207646_101984252 323
1039 3300025922 Ga0207646_10309165 Ga0207646_103091651 323
1040 3300025922 Ga0207646_10399499 Ga0207646_103994992 323
1041 3300025923 Ga0207681_10098254 Ga0207681_100982542 323
1042 3300025923 Ga0207681_10161094 Ga0207681_101610942 323
1043 3300025923 Ga0207681_10405173 Ga0207681_104051731 323
1044 3300025925 Ga0207650_10004422 Ga0207650_100044223 323
1045 3300025925 Ga0207650_10059644 Ga0207650_100596441 323
1046 3300025925 Ga0207650_10145623 Ga0207650_101456232 323
1047 3300025926 Ga0207659_10034418 Ga0207659_100344182 323
1048 3300025926 Ga0207659_10038139 Ga0207659_100381392 323
1049 3300025926 Ga0207659_10062519 Ga0207659_100625192 323
1050 3300025926 Ga0207659_10092967 Ga0207659_100929671 323
1051 3300025926 Ga0207659_10221709 Ga0207659_102217091 323
1052 3300025928 Ga0207700_10008546 Ga0207700_100085463 323
1053 3300025928 Ga0207700_10054981 Ga0207700_100549812 323
1054 3300025928 Ga0207700_10057164 Ga0207700_100571643 323
1055 3300025928 Ga0207700_10070744 Ga0207700_100707443 323
1056 3300025928 Ga0207700_10082750 Ga0207700_100827502 323
1057 3300025928 Ga0207700_10090680 Ga0207700_100906802 323
1058 3300025928 Ga0207700_10141734 Ga0207700_101417342 323
1059 3300025928 Ga0207700_10359902 Ga0207700_103599022 323
1060 3300025928 Ga0207700_10392238 Ga0207700_103922381 323
1061 3300025928 Ga0207700_10401039 Ga0207700_104010392 323
1062 3300025929 Ga0207664_10031939 Ga0207664_100319393 323
1063 3300025929 Ga0207664_10169127 Ga0207664_101691272 323
1064 3300025931 Ga0207644_10185763 Ga0207644_101857632 323
1065 3300025931 Ga0207644_10207109 Ga0207644_102071092 323
1066 3300025931 Ga0207644_10252534 Ga0207644_102525342 323
1067 3300025932 Ga0207690_10018264 Ga0207690_100182642 323
1068 3300025932 Ga0207690_10351544 Ga0207690_103515441 323
1069 3300025933 Ga0207706_10009602 Ga0207706_100096021 323
1070 3300025933 Ga0207706_10032201 Ga0207706_100322014 323
1071 3300025933 Ga0207706_10147285 Ga0207706_101472851 323
1072 3300025933 Ga0207706_10163309 Ga0207706_101633091 323
1073 3300025934 Ga0207686_10078208 Ga0207686_100782082 323
1074 3300025934 Ga0207686_10269729 Ga0207686_102697292 323
1075 3300025935 Ga0207709_10044164 Ga0207709_100441642 323
1076 3300025935 Ga0207709_10158719 Ga0207709_101587192 323
1077 3300025935 Ga0207709_10160294 Ga0207709_101602941 323
1078 3300025936 Ga0207670_10028557 Ga0207670_100285571 323
1079 3300025936 Ga0207670_10140000 Ga0207670_101400001 323
1080 3300025937 Ga0207669_10002290 Ga0207669_1000229011 323
1081 3300025937 Ga0207669_10242322 Ga0207669_102423222 323
1082 3300025938 Ga0207704_10120318 Ga0207704_101203181 323
1083 3300025938 Ga0207704_10126032 Ga0207704_101260322 323
1084 3300025939 Ga0207665_10025127 Ga0207665_100251273 323
1085 3300025939 Ga0207665_10128479 Ga0207665_101284791 323
1086 3300025939 Ga0207665_10138249 Ga0207665_101382491 323
1087 3300025939 Ga0207665_10230089 Ga0207665_102300892 323
1088 3300025940 Ga0207691_10003300 Ga0207691_1000330016 323
1089 3300025940 Ga0207691_10015271 Ga0207691_100152715 323
1090 3300025940 Ga0207691_10163302 Ga0207691_101633022 323
1091 3300025940 Ga0207691_10428424 Ga0207691_104284242 323
1092 3300025940 Ga0207691_10477504 Ga0207691_104775041 323
1093 3300025941 Ga0207711_10086829 Ga0207711_100868292 323
1094 3300025942 Ga0207689_10009584 Ga0207689_100095848 323
1095 3300025942 Ga0207689_10024157 Ga0207689_100241573 323
1096 3300025944 Ga0207661_10274124 Ga0207661_102741242 323
1097 3300025945 Ga0207679_10089171 Ga0207679_100891712 323
1098 3300025949 Ga0207667_10179043 Ga0207667_101790432 323
1099 3300025960 Ga0207651_10012695 Ga0207651_100126953 323
1100 3300025960 Ga0207651_10071788 Ga0207651_100717882 323
1101 3300025960 Ga0207651_10339119 Ga0207651_103391191 323
1102 3300025961 Ga0207712_10066196 Ga0207712_100661963 323
1103 3300025972 Ga0207668_10024223 Ga0207668_100242234 323
1104 3300025972 Ga0207668_10098905 Ga0207668_100989052 323
1105 3300025972 Ga0207668_10170902 Ga0207668_101709022 323
1106 3300025972 Ga0207668_10317326 Ga0207668_103173261 323
1107 3300025981 Ga0207640_10079717 Ga0207640_100797172 323
1108 3300025981 Ga0207640_10137644 Ga0207640_101376442 323
1109 3300026023 Ga0207677_10155367 Ga0207677_101553672 323
1110 3300026023 Ga0207677_10317076 Ga0207677_103170761 323
1111 3300026035 Ga0207703_10297754 Ga0207703_102977542 323
1112 3300026041 Ga0207639_10309152 Ga0207639_103091521 323
1113 3300026067 Ga0207678_10129323 Ga0207678_101293232 323
1114 3300026075 Ga0207708_10005502 Ga0207708_100055023 323
1115 3300026075 Ga0207708_10064909 Ga0207708_100649093 323
1116 3300026075 Ga0207708_10352829 Ga0207708_103528292 323
1117 3300026075 Ga0207708_10385111 Ga0207708_103851111 323
1118 3300026078 Ga0207702_10060026 Ga0207702_100600262 323
1119 3300026088 Ga0207641_10038792 Ga0207641_100387923 323
1120 3300026088 Ga0207641_10062646 Ga0207641_100626464 323
1121 3300026089 Ga0207648_10006546 Ga0207648_100065468 323
1122 3300026089 Ga0207648_10117331 Ga0207648_101173311 323
1123 3300026089 Ga0207648_10163211 Ga0207648_101632111 323
1124 3300026089 Ga0207648_10168858 Ga0207648_101688581 323
1125 3300026095 Ga0207676_10020274 Ga0207676_100202742 323
1126 3300026095 Ga0207676_10058061 Ga0207676_100580613 323
1127 3300026116 Ga0207674_10049046 Ga0207674_100490462 323
1128 3300026116 Ga0207674_10151577 Ga0207674_101515772 323
1129 3300026118 Ga0207675_100093444 Ga0207675_1000934442 323
1130 3300026118 Ga0207675_100172498 Ga0207675_1001724982 323
1131 3300026118 Ga0207675_100352628 Ga0207675_1003526281 323
1132 3300026121 Ga0207683_10001645 Ga0207683_1000164521 323
1133 3300026121 Ga0207683_10010160 Ga0207683_100101602 323
1134 3300026121 Ga0207683_10012488 Ga0207683_100124887 323
1135 3300027512 Ga0209179_1002418 Ga0209179_10024182 323
1136 3300027512 Ga0209179_1017013 Ga0209179_10170132 323
1137 3300027671 Ga0209588_1006825 Ga0209588_10068253 323
1138 3300027671 Ga0209588_1013010 Ga0209588_10130101 323
1139 3300027671 Ga0209588_1018279 Ga0209588_10182792 323
1140 3300027671 Ga0209588_1028376 Ga0209588_10283763 323
1141 3300027866 Ga0209813_10036716 Ga0209813_100367162 323
1142 3300027907 Ga0207428_10001335 Ga0207428_100013351 323
1143 3300027907 Ga0207428_10049968 Ga0207428_100499686 323
1144 3300027907 Ga0207428_10117219 Ga0207428_101172192 323
1145 3300027907 Ga0207428_10126322 Ga0207428_101263222 323
1146 3300027907 Ga0207428_10196070 Ga0207428_101960702 323
1147 3300027907 Ga0207428_10274595 Ga0207428_102745951 323
1148 3300028379 Ga0268266_10014049 Ga0268266_100140493 323
1149 3300028379 Ga0268266_10121848 Ga0268266_101218484 323
1150 3300028379 Ga0268266_10363577 Ga0268266_103635771 323
1151 3300028380 Ga0268265_10168941 Ga0268265_101689411 323
1152 3300028381 Ga0268264_10180608 Ga0268264_101806082 323
1153 3300028381 Ga0268264_10188906 Ga0268264_101889062 323
1154 3300028794 Ga0307515_10016334 Ga0307515_1001633415 323
1155 3300031090 Ga0265760_10002462 Ga0265760_100024624 323
1156 3300031090 Ga0265760_10063403 Ga0265760_100634031 323
1157 3300031241 Ga0265325_10000026 Ga0265325_1000002657 323
1158 3300031241 Ga0265325_10066308 Ga0265325_100663082 323
1159 3300031247 Ga0265340_10030638 Ga0265340_100306382 323
1160 3300031249 Ga0265339_10000511 Ga0265339_1000051125 323
1161 3300033180 Ga0307510_10063779 Ga0307510_100637792 323
1162 3300035113 Ga0373936_0001937 Ga0373936_0001937_3361_4338 323
1163 3300035115 Ga0373941_0052341 Ga0373941_0052341_44_1021 323
1164 3300035116 Ga0373945_0001585 Ga0373945_0001585_3711_4688 323
1165 3300035116 Ga0373945_0007645 Ga0373945_0007645_1407_2399 323
1166 3300035116 Ga0373945_0036969 Ga0373945_0036969_589_1566 323
1167 3300035117 Ga0373953_0021424 Ga0373953_0021424_928_1905 323
1168 3300035117 Ga0373953_0039319 Ga0373953_0039319_12_989 323
1169 3300035118 Ga0373954_0030549 Ga0373954_0030549_527_1504 323
1170 3300035119 Ga0373956_0042805 Ga0373956_0042805_62_1039 323
1171 3300035120 Ga0373957_0008078 Ga0373957_0008078_1535_2512 323
1172 3300035170 Ga0373943_0006948 Ga0373943_0006948_2771_3748 323
1173 3300035170 Ga0373943_0093989 Ga0373943_0093989_87_1064 323
1174 3300035170 Ga0373943_0132238 Ga0373943_0132238_69_1046 323
1175 3300035171 Ga0373946_0008578 Ga0373946_0008578_1187_2167 323
1176 3300035171 Ga0373946_0065703 Ga0373946_0065703_378_1355 323
1177 3300035172 Ga0373955_0000213 Ga0373955_0000213_17590_18567 323
1178 3300035172 Ga0373955_0062738 Ga0373955_0062738_882_1859 323
1179 3300035172 Ga0373955_0127352 Ga0373955_0127352_280_1257 323
1180 3300035207 Ga0373942_0015978 Ga0373942_0015978_839_1816 323
1181 3300035241 Ga0373961_0017896 Ga0373961_0017896_784_1761 323
1182 3300035410 Ga0373924_0007873 Ga0373924_0007873_930_1907 323
1183 3300035410 Ga0373924_0021583 Ga0373924_0021583_1366_2349 323
1184 3300035410 Ga0373924_0082033 Ga0373924_0082033_229_1206 323
1185 3300035691 Ga0373931_0004798 Ga0373931_0004798_2243_3220 323
1186 3300035691 Ga0373931_0012398 Ga0373931_0012398_2083_3060 323
1187 3300035691 Ga0373931_0073255 Ga0373931_0073255_485_1519 323
1188 3300035692 Ga0373935_0000131 Ga0373935_0000131_8426_9403 323
1189 3300035692 Ga0373935_0052937 Ga0373935_0052937_967_1944 323
1190 3300035692 Ga0373935_0054554 Ga0373935_0054554_65_1042 323
1191 3300035692 Ga0373935_0123861 Ga0373935_0123861_325_1302 323
1192 3300035695 Ga0373927_0003776 Ga0373927_0003776_7863_8840 323
1193 3300035695 Ga0373927_0004787 Ga0373927_0004787_814_1797 323
1194 3300035695 Ga0373927_0019879 Ga0373927_0019879_2344_3324 323
1195 3300035695 Ga0373927_0025742 Ga0373927_0025742_1685_2662 323
1196 3300035695 Ga0373927_0026311 Ga0373927_0026311_2727_3704 323
1197 3300035695 Ga0373927_0038695 Ga0373927_0038695_1909_2886 323
1198 3300035695 Ga0373927_0043982 Ga0373927_0043982_215_1192 323
1199 3300035695 Ga0373927_0089441 Ga0373927_0089441_878_1861 323
1200 3300035695 Ga0373927_0094751 Ga0373927_0094751_261_1238 323
1201 3300035695 Ga0373927_0162038 Ga0373927_0162038_48_1028 323
1202 3300035724 Ga0373933_0010880 Ga0373933_0010880_2705_3682 323
1203 3300035724 Ga0373933_0027856 Ga0373933_0027856_62_1039 323
1204 3300035725 Ga0373947_0000414 Ga0373947_0000414_324_1301 323
1205 3300035725 Ga0373947_0015493 Ga0373947_0015493_804_1784 323
1206 3300035725 Ga0373947_0038111 Ga0373947_0038111_86_1063 323
1207 3300035725 Ga0373947_0091371 Ga0373947_0091371_888_1865 323
1208 3300035725 Ga0373947_0202396 Ga0373947_0202396_114_1091 323
1209 3300036401 Ga0373937_0000293 Ga0373937_0000293_37940_38917 323
1210 3300036401 Ga0373937_0000514 Ga0373937_0000514_20199_21176 323
1211 3300036401 Ga0373937_0006471 Ga0373937_0006471_3080_4057 323
1212 3300036401 Ga0373937_0015436 Ga0373937_0015436_3683_4660 323
1213 3300036401 Ga0373937_0039364 Ga0373937_0039364_2783_3760 323
1214 3300036401 Ga0373937_0469211 Ga0373937_0469211_191_1168 323
1215 3300037068 Ga0373925_0000087 Ga0373925_0000087_63246_64223 323
1216 3300037068 Ga0373925_0006073 Ga0373925_0006073_6433_7410 323
1217 3300037068 Ga0373925_0019670 Ga0373925_0019670_741_1724 323
1218 3300037068 Ga0373925_0102587 Ga0373925_0102587_86_1063 323
1219 3300037068 Ga0373925_0109214 Ga0373925_0109214_833_1816 323
1220 3300037068 Ga0373925_0129568 Ga0373925_0129568_826_1803 323
1221 3300037068 Ga0373925_0146699 Ga0373925_0146699_13_990 323
1222 3300037068 Ga0373925_0194456 Ga0373925_0194456_558_1574 323
1223 3300037068 Ga0373925_0196387 Ga0373925_0196387_184_1161 323
1224 3300037312 Ga0395899_0033015 Ga0395899_0033015_2110_3087 323
1225 3300037418 Ga0395900_0002052 Ga0395900_0002052_11598_12575 323
1226 3300037466 Ga0395898_0116467 Ga0395898_0116467_213_1193 323
1227 3300038443 Ga0395901_0101347 Ga0395901_0101347_468_1445 323
1228 3300038443 Ga0395901_0271729 Ga0395901_0271729_698_1675 323
1229 3300039437 Ga0436365_0161226 Ga0436365_0161226_4971_5954 323
1230 3300039438 Ga0436360_0558472 Ga0436360_0558472_170_1147 323
1231 3300039447 Ga0436361_0099439 Ga0436361_0099439_2844_3821 323
1232 3300039447 Ga0436361_0436199 Ga0436361_0436199_460_1440 323
1233 3300039447 Ga0436361_0674185 Ga0436361_0674185_310_1356 323
1234 3300039450 Ga0436363_0805331 Ga0436363_0805331_82_1062 323
1235 3300041512 Ga0451853_3783103 Ga0451853_3783103_570_1553 323
1236 3300042005 Ga0439448_0028592 Ga0439448_0028592_305_1282 323
1237 3300042125 Ga0450923_003138 Ga0450923_003138_1030_2007 323
1238 3300045836 Ga0466958_0011478 Ga0466958_0011478_1380_2363 323
1239 3300046452 Ga0495617_020353 Ga0495617_020353_87_1064 323
1240 3300046454 Ga0495592_0000001 Ga0495592_0000001_274564_275541 323
1241 3300046454 Ga0495592_0108456 Ga0495592_0108456_763_1740 323
1242 3300046455 Ga0495603_0024043 Ga0495603_0024043_716_1696 323
1243 3300046455 Ga0495603_0063470 Ga0495603_0063470_1030_2007 323
1244 3300046455 Ga0495603_0189004 Ga0495603_0189004_19_996 323
1245 3300046459 Ga0495629_0057835 Ga0495629_0057835_1275_2252 323
1246 3300046459 Ga0495629_0139301 Ga0495629_0139301_627_1604 323
1247 3300046460 Ga0495638_0022443 Ga0495638_0022443_2614_3591 323
1248 3300046460 Ga0495638_0093554 Ga0495638_0093554_694_1740 323
1249 3300046461 Ga0495641_0076369 Ga0495641_0076369_27_1004 323
1250 3300046462 Ga0495651_0001675 Ga0495651_0001675_9652_10629 323
1251 3300046462 Ga0495651_0182501 Ga0495651_0182501_30_1007 323
1252 3300046463 Ga0495653_0000015 Ga0495653_0000015_44847_45824 323
1253 3300046472 Ga0495580_0048052 Ga0495580_0048052_1024_2004 323
1254 3300046473 Ga0495582_0127912 Ga0495582_0127912_360_1337 323
1255 3300046473 Ga0495582_0151994 Ga0495582_0151994_304_1284 323
1256 3300046473 Ga0495582_0169548 Ga0495582_0169548_105_1088 323
1257 3300046475 Ga0495639_0091247 Ga0495639_0091247_299_1276 323
1258 3300046475 Ga0495639_0097612 Ga0495639_0097612_14_991 323
1259 3300046476 Ga0495662_0000957 Ga0495662_0000957_6162_7139 323
1260 3300046476 Ga0495662_0065174 Ga0495662_0065174_714_1691 323
1261 3300046477 Ga0495664_0000001 Ga0495664_0000001_40819_41796 323
1262 3300046491 Ga0495584_0006062 Ga0495584_0006062_3110_4090 323
1263 3300046491 Ga0495584_0033614 Ga0495584_0033614_1052_2053 323
1264 3300046491 Ga0495584_0035668 Ga0495584_0035668_1444_2421 323
1265 3300046492 Ga0495585_0051896 Ga0495585_0051896_968_1948 323
1266 3300046492 Ga0495585_0114986 Ga0495585_0114986_178_1155 323
1267 3300046492 Ga0495585_0160056 Ga0495585_0160056_152_1132 323
1268 3300046492 Ga0495585_0190690 Ga0495585_0190690_18_995 323
1269 3300046499 Ga0495594_0136573 Ga0495594_0136573_48_1028 323
1270 3300046500 Ga0495596_0029393 Ga0495596_0029393_934_1914 323
1271 3300046501 Ga0495607_0145876 Ga0495607_0145876_83_1060 323
1272 3300046511 Ga0495608_0000066 Ga0495608_0000066_17330_18307 323
1273 3300046511 Ga0495608_0165605 Ga0495608_0165605_394_1377 323
1274 3300046514 Ga0495618_0000021 Ga0495618_0000021_9729_10706 323
1275 3300046516 Ga0495628_0000005 Ga0495628_0000005_292820_293797 323
1276 3300046517 Ga0495630_0000254 Ga0495630_0000254_10541_11518 323
1277 3300046517 Ga0495630_0172291 Ga0495630_0172291_20_997 323
1278 3300046518 Ga0495631_0108418 Ga0495631_0108418_159_1136 323
1279 3300046520 Ga0495637_0032095 Ga0495637_0032095_1245_2225 323
1280 3300046523 Ga0495644_0051792 Ga0495644_0051792_471_1448 323
1281 3300046525 Ga0495663_0058868 Ga0495663_0058868_46_1023 323
1282 3300046526 Ga0495666_0042521 Ga0495666_0042521_111_1091 323
1283 3300046526 Ga0495666_0070493 Ga0495666_0070493_41_1156 323
1284 3300046529 Ga0495652_0000001 Ga0495652_0000001_785369_786346 323
1285 3300046533 Ga0495640_0000006 Ga0495640_0000006_233005_233982 323
1286 3300046533 Ga0495640_0042579 Ga0495640_0042579_519_1496 323
1287 3300046533 Ga0495640_0157875 Ga0495640_0157875_191_1168 323
1288 3300046536 Ga0495587_0000012 Ga0495587_0000012_127010_127987 323
1289 3300046537 Ga0495598_0008201 Ga0495598_0008201_1273_2253 323
1290 3300046537 Ga0495598_0054916 Ga0495598_0054916_82_1059 323
1291 3300046543 Ga0495645_0000041 Ga0495645_0000041_26467_27444 323
1292 3300046558 Ga0495633_0034411 Ga0495633_0034411_830_1873 323
1293 3300046559 Ga0495667_0000001 Ga0495667_0000001_625337_626314 323
1294 3300046559 Ga0495667_0217078 Ga0495667_0217078_183_1160 323
1295 3300046642 Ga0495634_0000624 Ga0495634_0000624_5475_6452 323
1296 3300046642 Ga0495634_0064369 Ga0495634_0064369_873_1850 323
1297 3300046642 Ga0495634_0100293 Ga0495634_0100293_436_1416 323
1298 3300046642 Ga0495634_0160212 Ga0495634_0160212_285_1265 323
1299 3300046663 Ga0495635_0000007 Ga0495635_0000007_65353_66330 323
1300 3300046663 Ga0495635_0115674 Ga0495635_0115674_414_1391 323
1301 3300046665 Ga0495661_0149816 Ga0495661_0149816_86_1057 323
1302 3300046674 Ga0495588_0015185 Ga0495588_0015185_1224_2204 323
1303 3300046675 Ga0495657_0000047 Ga0495657_0000047_76708_77685 323
1304 3300046678 Ga0495599_0000002 Ga0495599_0000002_132405_133382 323
1305 3300046679 Ga0495623_0000023 Ga0495623_0000023_65284_66261 323
1306 3300046680 Ga0495646_0000024 Ga0495646_0000024_66193_67170 323
1307 3300046683 Ga0495658_0020191 Ga0495658_0020191_2084_3067 323
1308 3300046683 Ga0495658_0095155 Ga0495658_0095155_512_1492 323
1309 3300046683 Ga0495658_0161859 Ga0495658_0161859_234_1211 323
1310 3300046689 Ga0495613_0033615 Ga0495613_0033615_702_1679 323
1311 3300046689 Ga0495613_0069404 Ga0495613_0069404_279_1256 323
1312 3300046689 Ga0495613_0074491 Ga0495613_0074491_1218_2198 323
1313 3300046689 Ga0495613_0106562 Ga0495613_0106562_549_1526 323
1314 3300046689 Ga0495613_0160659 Ga0495613_0160659_131_1108 323
1315 3300046689 Ga0495613_0172953 Ga0495613_0172953_83_1060 323
1316 3300046690 Ga0495624_0011265 Ga0495624_0011265_3804_4781 323
1317 3300046690 Ga0495624_0037870 Ga0495624_0037870_1863_2840 323
1318 3300046690 Ga0495624_0083479 Ga0495624_0083479_147_1127 323
1319 3300046690 Ga0495624_0224406 Ga0495624_0224406_152_1129 323
1320 3300046691 Ga0495670_0167128 Ga0495670_0167128_98_1075 323
1321 3300046691 Ga0495670_0174245 Ga0495670_0174245_30_1007 323
1322 3300046809 Ga0495600_0000013 Ga0495600_0000013_96221_97198 323
1323 3300047315 Ga0495581_0009849 Ga0495581_0009849_3169_4146 323
1324 3300047317 Ga0495604_0000007 Ga0495604_0000007_152419_153396 323
1325 3300047319 Ga0495674_0000001 Ga0495674_0000001_240756_241733 323
1326 3300047319 Ga0495674_0163190 Ga0495674_0163190_391_1368 323
1327 3300047320 Ga0495672_0003778 Ga0495672_0003778_5774_6751 323
1328 3300047320 Ga0495672_0005349 Ga0495672_0005349_349_1332 323
1329 3300047321 Ga0495676_0034135 Ga0495676_0034135_1233_2210 323
1330 3300047321 Ga0495676_0089487 Ga0495676_0089487_280_1260 323
1331 3300047321 Ga0495676_0261625 Ga0495676_0261625_61_1041 323
1332 3300047322 Ga0495680_0001437 Ga0495680_0001437_14887_15864 323
1333 3300047322 Ga0495680_0103910 Ga0495680_0103910_893_1870 323
1334 3300047444 Ga0495675_0000014 Ga0495675_0000014_106958_107935 323
1335 3300047446 Ga0495679_033581 Ga0495679_033581_268_1245 323
1336 3300047471 Ga0495684_0000027 Ga0495684_0000027_59176_60153 323
1337 3300047471 Ga0495684_0016981 Ga0495684_0016981_2807_3787 323
1338 3300047471 Ga0495684_0181927 Ga0495684_0181927_77_1054 323
1339 3300047673 Ga0495593_0040902 Ga0495593_0040902_303_1280 323
1340 3300048088 Ga0495602_0000004 Ga0495602_0000004_127053_128030 323
1341 3300048091 Ga0495626_0115273 Ga0495626_0115273_69_1040 323
1342 3300048903 Ga0496100_0025730 Ga0496100_0025730_1876_2853 323
1343 3300048903 Ga0496100_0050216 Ga0496100_0050216_1477_2454 323
1344 3300048903 Ga0496100_0055950 Ga0496100_0055950_440_1495 323
1345 3300048903 Ga0496100_0157439 Ga0496100_0157439_222_1199 323
1346 3300048903 Ga0496100_0271750 Ga0496100_0271750_35_1012 323
1347 3300048904 Ga0496101_0013068 Ga0496101_0013068_3628_4605 323
1348 3300048904 Ga0496101_0022740 Ga0496101_0022740_1213_2190 323
1349 3300048904 Ga0496101_0037733 Ga0496101_0037733_746_1723 323
1350 3300048904 Ga0496101_0044585 Ga0496101_0044585_2042_3025 323
1351 3300048904 Ga0496101_0096658 Ga0496101_0096658_355_1332 323
1352 3300048904 Ga0496101_0251806 Ga0496101_0251806_220_1272 323
1353 3300048904 Ga0496101_0301302 Ga0496101_0301302_111_1091 323
1354 3300048904 Ga0496101_0411660 Ga0496101_0411660_65_1042 323
1355 3300048905 Ga0496102_0021681 Ga0496102_0021681_2800_3777 323
1356 3300048905 Ga0496102_0024733 Ga0496102_0024733_2094_3071 323
1357 3300048905 Ga0496102_0032326 Ga0496102_0032326_389_1366 323
1358 3300048905 Ga0496102_0088104 Ga0496102_0088104_1522_2499 323
1359 3300048905 Ga0496102_0156751 Ga0496102_0156751_780_1757 323
1360 3300048905 Ga0496102_0195259 Ga0496102_0195259_67_1050 323
1361 3300048905 Ga0496102_0299830 Ga0496102_0299830_330_1307 323
1362 3300048906 Ga0496103_0004409 Ga0496103_0004409_2464_3435 323
1363 3300048906 Ga0496103_0018010 Ga0496103_0018010_2515_3492 323
1364 3300048906 Ga0496103_0027853 Ga0496103_0027853_185_1162 323
1365 3300048906 Ga0496103_0095507 Ga0496103_0095507_351_1406 323
1366 3300048906 Ga0496103_0247290 Ga0496103_0247290_114_1091 323
1367 3300048907 Ga0496104_0000660 Ga0496104_0000660_17229_18206 323
1368 3300048907 Ga0496104_0000706 Ga0496104_0000706_23740_24717 323
1369 3300048907 Ga0496104_0000786 Ga0496104_0000786_16185_17162 323
1370 3300048907 Ga0496104_0005703 Ga0496104_0005703_4835_5812 323
1371 3300048907 Ga0496104_0006331 Ga0496104_0006331_8894_9871 323
1372 3300048907 Ga0496104_0006603 Ga0496104_0006603_2434_3489 323
1373 3300048907 Ga0496104_0007595 Ga0496104_0007595_6420_7505 323
1374 3300048907 Ga0496104_0009962 Ga0496104_0009962_3290_4267 323
1375 3300048907 Ga0496104_0010360 Ga0496104_0010360_2081_3058 323
1376 3300048907 Ga0496104_0013393 Ga0496104_0013393_5394_6371 323
1377 3300048907 Ga0496104_0014911 Ga0496104_0014911_1889_2866 323
1378 3300048907 Ga0496104_0017982 Ga0496104_0017982_5139_6122 323
1379 3300048907 Ga0496104_0018223 Ga0496104_0018223_45_1022 323
1380 3300048907 Ga0496104_0028234 Ga0496104_0028234_1319_2296 323
1381 3300048907 Ga0496104_0201058 Ga0496104_0201058_201_1172 323
1382 3300048908 Ga0496105_0001721 Ga0496105_0001721_11287_12264 323
1383 3300048908 Ga0496105_0006722 Ga0496105_0006722_72_1157 323
1384 3300048908 Ga0496105_0027901 Ga0496105_0027901_1745_2722 323
1385 3300048908 Ga0496105_0040825 Ga0496105_0040825_2445_3422 323
1386 3300048908 Ga0496105_0068519 Ga0496105_0068519_1729_2706 323
1387 3300048908 Ga0496105_0074845 Ga0496105_0074845_982_1959 323
1388 3300048908 Ga0496105_0091277 Ga0496105_0091277_1275_2252 323
1389 3300048908 Ga0496105_0129777 Ga0496105_0129777_335_1312 323
1390 3300048908 Ga0496105_0179573 Ga0496105_0179573_429_1406 323
1391 3300048908 Ga0496105_0253998 Ga0496105_0253998_209_1264 323
1392 3300048909 Ga0496106_0031167 Ga0496106_0031167_409_1386 323
1393 3300048909 Ga0496106_0035684 Ga0496106_0035684_2401_3378 323
1394 3300048909 Ga0496106_0039739 Ga0496106_0039739_2208_3185 323
1395 3300048909 Ga0496106_0054072 Ga0496106_0054072_743_1720 323
1396 3300048909 Ga0496106_0102514 Ga0496106_0102514_1168_2145 323
1397 3300048909 Ga0496106_0122586 Ga0496106_0122586_997_1974 323
1398 3300048909 Ga0496106_0199008 Ga0496106_0199008_184_1161 323
1399 3300048909 Ga0496106_0277521 Ga0496106_0277521_28_1083 323
1400 3300048910 Ga0496107_0002409 Ga0496107_0002409_4953_5930 323
1401 3300048910 Ga0496107_0044950 Ga0496107_0044950_292_1269 323
1402 3300048910 Ga0496107_0166124 Ga0496107_0166124_441_1496 323
1403 3300048910 Ga0496107_0170356 Ga0496107_0170356_433_1413 323
1404 3300048910 Ga0496107_0242220 Ga0496107_0242220_110_1087 323
1405 3300048911 Ga0496108_0002679 Ga0496108_0002679_9293_10270 323
1406 3300048911 Ga0496108_0004786 Ga0496108_0004786_1877_2854 323
1407 3300048911 Ga0496108_0008488 Ga0496108_0008488_7022_7999 323
1408 3300048911 Ga0496108_0015120 Ga0496108_0015120_1855_2832 323
1409 3300048911 Ga0496108_0018360 Ga0496108_0018360_3460_4515 323
1410 3300048911 Ga0496108_0032128 Ga0496108_0032128_47_1018 323
1411 3300048911 Ga0496108_0072776 Ga0496108_0072776_1766_2743 323
1412 3300048911 Ga0496108_0164941 Ga0496108_0164941_514_1497 323
1413 3300048911 Ga0496108_0204250 Ga0496108_0204250_209_1210 323
1414 3300048911 Ga0496108_0383834 Ga0496108_0383834_37_1014 323
1415 3300048912 Ga0496109_0003734 Ga0496109_0003734_1703_2758 323
1416 3300048912 Ga0496109_0013061 Ga0496109_0013061_4285_5262 323
1417 3300048912 Ga0496109_0015782 Ga0496109_0015782_4119_5102 323
1418 3300048912 Ga0496109_0048349 Ga0496109_0048349_1876_2853 323
1419 3300048912 Ga0496109_0055084 Ga0496109_0055084_364_1341 323
1420 3300048912 Ga0496109_0060783 Ga0496109_0060783_66_1043 323
1421 3300048912 Ga0496109_0067785 Ga0496109_0067785_355_1332 323
1422 3300048912 Ga0496109_0082220 Ga0496109_0082220_366_1343 323
1423 3300048912 Ga0496109_0111252 Ga0496109_0111252_384_1361 323
1424 3300048912 Ga0496109_0253243 Ga0496109_0253243_74_1051 323
1425 3300048912 Ga0496109_0262256 Ga0496109_0262256_86_1078 323
1426 3300048912 Ga0496109_0331747 Ga0496109_0331747_190_1167 323
1427 3300048913 Ga0496110_0014321 Ga0496110_0014321_4648_5619 323
1428 3300048913 Ga0496110_0018535 Ga0496110_0018535_1924_2901 323
1429 3300048913 Ga0496110_0030620 Ga0496110_0030620_2867_3844 323
1430 3300048913 Ga0496110_0064537 Ga0496110_0064537_1760_2737 323
1431 3300048913 Ga0496110_0065545 Ga0496110_0065545_929_1906 323
1432 3300048913 Ga0496110_0083642 Ga0496110_0083642_1061_2134 323
1433 3300048913 Ga0496110_0086289 Ga0496110_0086289_1492_2547 323
1434 3300048913 Ga0496110_0165018 Ga0496110_0165018_992_1969 323
1435 3300048913 Ga0496110_0262735 Ga0496110_0262735_92_1069 323
1436 3300048913 Ga0496110_0384235 Ga0496110_0384235_98_1078 323
1437 3300048914 Ga0496111_0004046 Ga0496111_0004046_6866_7843 323
1438 3300048914 Ga0496111_0012579 Ga0496111_0012579_4535_5512 323
1439 3300048914 Ga0496111_0012858 Ga0496111_0012858_2493_3470 323
1440 3300048914 Ga0496111_0024082 Ga0496111_0024082_188_1159 323
1441 3300048914 Ga0496111_0035930 Ga0496111_0035930_286_1263 323
1442 3300048914 Ga0496111_0124370 Ga0496111_0124370_647_1702 323
1443 3300048914 Ga0496111_0158355 Ga0496111_0158355_348_1352 323
1444 3300048914 Ga0496111_0288313 Ga0496111_0288313_196_1173 323
1445 3300048915 Ga0496112_0028781 Ga0496112_0028781_4050_5027 323
1446 3300048915 Ga0496112_0087988 Ga0496112_0087988_1674_2651 323
1447 3300048915 Ga0496112_0088334 Ga0496112_0088334_1633_2610 323
1448 3300048915 Ga0496112_0131730 Ga0496112_0131730_364_1341 323
1449 3300048915 Ga0496112_0157063 Ga0496112_0157063_1117_2172 323
1450 3300048915 Ga0496112_0183389 Ga0496112_0183389_268_1245 323
1451 3300048915 Ga0496112_0188740 Ga0496112_0188740_105_1082 323
1452 3300048915 Ga0496112_0327720 Ga0496112_0327720_134_1111 323
1453 3300048915 Ga0496112_0339670 Ga0496112_0339670_446_1423 323
1454 3300048915 Ga0496112_0372930 Ga0496112_0372930_244_1224 323
1455 3300048915 Ga0496112_0529203 Ga0496112_0529203_25_1005 323
1456 3300048916 Ga0496113_0004550 Ga0496113_0004550_7225_8202 323
1457 3300048916 Ga0496113_0017002 Ga0496113_0017002_3536_4513 323
1458 3300048916 Ga0496113_0017381 Ga0496113_0017381_1924_2901 323
1459 3300048916 Ga0496113_0030041 Ga0496113_0030041_2906_3883 323
1460 3300048916 Ga0496113_0062832 Ga0496113_0062832_759_1751 323
1461 3300048916 Ga0496113_0113753 Ga0496113_0113753_122_1099 323
1462 3300048917 Ga0496114_0007847 Ga0496114_0007847_6763_7740 323
1463 3300048917 Ga0496114_0023103 Ga0496114_0023103_563_1540 323
1464 3300048917 Ga0496114_0045749 Ga0496114_0045749_1165_2142 323
1465 3300048917 Ga0496114_0213660 Ga0496114_0213660_516_1493 323
1466 3300048917 Ga0496114_0282396 Ga0496114_0282396_194_1171 323
1467 3300048917 Ga0496114_0295677 Ga0496114_0295677_125_1102 323
1468 3300048918 Ga0496115_0003972 Ga0496115_0003972_2261_3238 323
1469 3300048918 Ga0496115_0019320 Ga0496115_0019320_638_1615 323
1470 3300048918 Ga0496115_0028468 Ga0496115_0028468_2211_3188 323
1471 3300048918 Ga0496115_0094335 Ga0496115_0094335_308_1285 323
1472 3300048918 Ga0496115_0094986 Ga0496115_0094986_593_1678 323
1473 3300048918 Ga0496115_0207083 Ga0496115_0207083_622_1599 323
1474 3300048918 Ga0496115_0239033 Ga0496115_0239033_212_1189 323
1475 3300048924 Ga0496121_0005414 Ga0496121_0005414_15066_16043 323
1476 3300049568 Ga0501031_0031459 Ga0501031_0031459_1195_2184 323
1477 3300049569 Ga0501032_0155311 Ga0501032_0155311_173_1162 323
1478 3300049570 Ga0501033_0192600 Ga0501033_0192600_296_1285 323
1479 3300049571 Ga0501034_0235953 Ga0501034_0235953_462_1451 323
1480 3300049574 Ga0501038_0037381 Ga0501038_0037381_295_1284 323
1481 3300049574 Ga0501038_0074191 Ga0501038_0074191_774_1751 323
1482 3300049575 Ga0501039_0032425 Ga0501039_0032425_2813_3802 323
1483 3300049575 Ga0501039_0175745 Ga0501039_0175745_271_1248 323
1484 3300049579 Ga0501043_0141675 Ga0501043_0141675_596_1573 323
1485 3300049581 Ga0501047_0008410 Ga0501047_0008410_7239_8228 323
1486 3300049581 Ga0501047_0041197 Ga0501047_0041197_1747_2724 323
1487 3300049581 Ga0501047_0212517 Ga0501047_0212517_675_1652 323
1488 3300049583 Ga0501067_0016974 Ga0501067_0016974_2557_3546 323
1489 3300049584 Ga0501068_0002927 Ga0501068_0002927_2671_3660 323
1490 3300049585 Ga0501069_0008835 Ga0501069_0008835_2059_3048 323
1491 3300049586 Ga0501070_0031390 Ga0501070_0031390_291_1280 323
1492 3300049587 Ga0501071_0040890 Ga0501071_0040890_1678_2667 323
1493 3300049588 Ga0501072_0081673 Ga0501072_0081673_850_1827 323
1494 3300049589 Ga0501073_0029902 Ga0501073_0029902_1171_2160 323
1495 3300049590 Ga0501074_0121449 Ga0501074_0121449_295_1284 323
1496 3300049590 Ga0501074_0369902 Ga0501074_0369902_11_988 323
1497 3300049592 Ga0501076_0055417 Ga0501076_0055417_43_1020 323
1498 3300049592 Ga0501076_0260543 Ga0501076_0260543_213_1256 323
1499 3300049593 Ga0501077_0124939 Ga0501077_0124939_324_1301 323
1500 3300049593 Ga0501077_0155433 Ga0501077_0155433_308_1285 323
1501 3300049593 Ga0501077_0222913 Ga0501077_0222913_117_1094 323
1502 3300049743 Ga0501081_0108680 Ga0501081_0108680_15_992 323
1503 3300049822 Ga0501035_0043117 Ga0501035_0043117_585_1574 323
1504 3300049823 Ga0501044_0390020 Ga0501044_0390020_168_1157 323
1505 3300049824 Ga0501045_0039418 Ga0501045_0039418_2051_3040 323
1506 3300049824 Ga0501045_0148684 Ga0501045_0148684_93_1070 323
1507 3300050491 nmdc:mga00v17_33683_c1 nmdc:mga00v17_33683_c1_1928_2908 323
1508 3300050491 nmdc:mga00v17_79235_c1 nmdc:mga00v17_79235_c1_415_1392 323
1509 3300050492 nmdc:mga0yw44_10202_c1 nmdc:mga0yw44_10202_c1_1829_2806 323
1510 3300050492 nmdc:mga0yw44_140480_c1 nmdc:mga0yw44_140480_c1_528_1508 323
1511 3300050492 nmdc:mga0yw44_34353_c1 nmdc:mga0yw44_34353_c1_1676_2656 323
1512 3300050492 nmdc:mga0yw44_9210_c1 nmdc:mga0yw44_9210_c1_1258_2235 323
1513 3300050493 nmdc:mga0k408_8835_c1 nmdc:mga0k408_8835_c1_194_1177 323
1514 3300050496 nmdc:mga07m45_48809_c1 nmdc:mga07m45_48809_c1_20_997 323
1515 3300050507 nmdc:mga05p37_109826_c1 nmdc:mga05p37_109826_c1_1119_2096 323
1516 3300050507 nmdc:mga05p37_145470_c1 nmdc:mga05p37_145470_c1_1464_2531 323
1517 3300050507 nmdc:mga05p37_158571_c1 nmdc:mga05p37_158571_c1_1318_2295 323
1518 3300050507 nmdc:mga05p37_204558_c1 nmdc:mga05p37_204558_c1_194_1171 323
1519 3300050507 nmdc:mga05p37_214420_c1 nmdc:mga05p37_214420_c1_673_1650 323
1520 3300050507 nmdc:mga05p37_24284_c1 nmdc:mga05p37_24284_c1_4739_5719 323
1521 3300050507 nmdc:mga05p37_32710_c1 nmdc:mga05p37_32710_c1_2451_3431 323
1522 3300050507 nmdc:mga05p37_38199_c1 nmdc:mga05p37_38199_c1_2068_3045 323
1523 3300050507 nmdc:mga05p37_82120_c1 nmdc:mga05p37_82120_c1_2781_3758 323
1524 3300050507 nmdc:mga05p37_92500_c1 nmdc:mga05p37_92500_c1_211_1188 323
1525 3300050508 nmdc:mga09592_1301_c1 nmdc:mga09592_1301_c1_12944_13924 323
1526 3300050508 nmdc:mga09592_27694_c1 nmdc:mga09592_27694_c1_781_1761 323
1527 3300050508 nmdc:mga09592_6746_c1 nmdc:mga09592_6746_c1_6984_7961 323
1528 3300050509 nmdc:mga0qj67_135573_c1 nmdc:mga0qj67_135573_c1_181_1158 323
1529 3300050509 nmdc:mga0qj67_32944_c1 nmdc:mga0qj67_32944_c1_2205_3185 323
1530 3300050509 nmdc:mga0qj67_45493_c1 nmdc:mga0qj67_45493_c1_1274_2251 323
1531 3300050509 nmdc:mga0qj67_74831_c1 nmdc:mga0qj67_74831_c1_1712_2689 323
1532 3300050510 nmdc:mga06r32_110199_c1 nmdc:mga06r32_110199_c1_1426_2403 323
1533 3300050510 nmdc:mga06r32_2045_c1 nmdc:mga06r32_2045_c1_14310_15290 323
1534 3300050510 nmdc:mga06r32_208668_c1 nmdc:mga06r32_208668_c1_537_1514 323
1535 3300050510 nmdc:mga06r32_487691_c1 nmdc:mga06r32_487691_c1_221_1198 323
1536 3300050510 nmdc:mga06r32_58247_c1 nmdc:mga06r32_58247_c1_2261_3238 323
1537 3300050510 nmdc:mga06r32_63759_c1 nmdc:mga06r32_63759_c1_1178_2245 323
1538 3300050510 nmdc:mga06r32_64655_c1 nmdc:mga06r32_64655_c1_2204_3181 323
1539 3300050511 nmdc:mga08y16_189386_c1 nmdc:mga08y16_189386_c1_789_1856 323
1540 3300050511 nmdc:mga08y16_50543_c1 nmdc:mga08y16_50543_c1_918_1895 323
1541 3300050511 nmdc:mga08y16_6978_c1 nmdc:mga08y16_6978_c1_3664_4641 323
1542 3300050511 nmdc:mga08y16_81222_c1 nmdc:mga08y16_81222_c1_220_1197 323
1543 3300050511 nmdc:mga08y16_81_c1 nmdc:mga08y16_81_c1_80527_81507 323
1544 3300050512 nmdc:mga0n895_107425_c1 nmdc:mga0n895_107425_c1_599_1750 323
1545 3300050512 nmdc:mga0n895_11780_c1 nmdc:mga0n895_11780_c1_302_1279 323
1546 3300050512 nmdc:mga0n895_212243_c1 nmdc:mga0n895_212243_c1_795_1772 323
1547 3300050512 nmdc:mga0n895_49926_c1 nmdc:mga0n895_49926_c1_2268_3245 323
1548 3300050512 nmdc:mga0n895_51599_c1 nmdc:mga0n895_51599_c1_1859_2836 323
1549 3300050512 nmdc:mga0n895_78393_c1 nmdc:mga0n895_78393_c1_1011_1988 323
1550 3300050513 nmdc:mga0rr50_130193_c1 nmdc:mga0rr50_130193_c1_853_1830 323
1551 3300050513 nmdc:mga0rr50_291980_c1 nmdc:mga0rr50_291980_c1_283_1260 323
1552 3300050515 nmdc:mga0a205_189418_c1 nmdc:mga0a205_189418_c1_231_1208 323
1553 3300050515 nmdc:mga0a205_203591_c1 nmdc:mga0a205_203591_c1_346_1323 323
1554 3300050515 nmdc:mga0a205_404175_c1 nmdc:mga0a205_404175_c1_25_1002 323
1555 3300053077 Ga0495601_0000006 Ga0495601_0000006_80806_81783 323
1556 3300053077 Ga0495601_0026119 Ga0495601_0026119_2300_3277 323
1557 3300053077 Ga0495601_0058771 Ga0495601_0058771_140_1117 323
1558 3300053077 Ga0495601_0127097 Ga0495601_0127097_633_1610 323
1559 3300053077 Ga0495601_0129744 Ga0495601_0129744_297_1370 323
1560 3300053077 Ga0495601_0291658 Ga0495601_0291658_56_1033 323
1561 3300053078 Ga0495612_0000004 Ga0495612_0000004_232877_233854 323
1562 3300053083 Ga0495655_0006096 Ga0495655_0006096_1061_2038 323
1563 3300053083 Ga0495655_0035438 Ga0495655_0035438_219_1190 323
1564 3300053084 Ga0495595_0000006 Ga0495595_0000006_160323_161300 323
1565 3300053084 Ga0495595_0029773 Ga0495595_0029773_1322_2299 323
1566 3300053085 Ga0495619_0000011 Ga0495619_0000011_198877_199854 323
1567 3300053085 Ga0495619_0010124 Ga0495619_0010124_650_1627 323
1568 3300053085 Ga0495619_0054031 Ga0495619_0054031_755_1732 323
1569 3300053085 Ga0495619_0087645 Ga0495619_0087645_298_1275 323
1570 3300053085 Ga0495619_0091235 Ga0495619_0091235_50_1027 323
1571 3300053085 Ga0495619_0101567 Ga0495619_0101567_152_1129 323
1572 3300053146 Ga0500588_0073832 Ga0500588_0073832_51_1028 323
1573 3300053153 Ga0500616_0001749 Ga0500616_0001749_13671_14648 323
1574 3300054114 Ga0501084_0353999 Ga0501084_0353999_95_1072 323
1575 3300060353 Ga0501082_0034728 Ga0501082_0034728_2069_3058 323
1576 3300061734 Ga0530510_0111572 Ga0530510_0111572_91_1068 323

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03401

TctC

Tripartite tricarboxylate transporter family receptor

100

371

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5oku-assembly1.cif.gz_A r. palustris rpa4515 with adipate 0.9782 30 320
8hkb-assembly1.cif.gz_A tpa bound-form of periplasmic terephthalate binding protein (tbp) from ideonella sakaiensis mutant k184d 0.9752 34 320
2dvz-assembly1.cif.gz_A structure of a periplasmic transporter 0.9664 30 322
2f5x-assembly3.cif.gz_C structure of periplasmic binding protein bugd 0.9618 30 320
6hke-assembly1.cif.gz_A matc (rpa3494) from rhodopseudomonas palustris with bound malate 0.9584 30 314
ID Description Score Start End Superfamily
2dvzA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9581 126 241 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9574 125 247 3.40.190.10
4x9tA02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9531 125 241 3.40.190.10
6hkeC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9426 125 247 3.40.190.10
2f5xC02 Alpha Beta;3-Layer(aba) Sandwich;D-Maltodextrin-Binding Protein; domain 2;Periplasmic binding protein-like II 0.9415 127 247 3.40.190.10
ID Description Score Start End GO Terms
AF-A0A520EAY2-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.985 33 322
AF-A0A5C8CF86-F1-model_v4 deleted 0.9832 41 320
AF-A0A4Q7NH98-F1-model_v4 Tripartite-type tricarboxylate transporter receptor subunit TctC 0.9807 30 322
AF-A0A1F4B8I5-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9807 25 320
AF-A0A537DML3-F1-model_v4 Tripartite tricarboxylate transporter substrate binding protein 0.9798 38 320

Feature Viewer

pLDDT pTM Quality
91.36 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map