F494810
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1569 | 693 | 3138 | 88 |
Family's Representative Sequence
| Representative Sequence | 3300005614|Ga0068856_100006491|Ga0068856_1000064914 |
| Length | 93 |
| Sequence | MSEQSKSQVGKRQLAVALHYDRTGAPTVVAKGRGTIGEKIIEIAKEHGIPIEENEVLAGALSNVELGDEIPAELYKAVAEVLIFVLRLSGRVR |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 2 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 5 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 6 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 7 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 11 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 12 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 14 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 15 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 28 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 30 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 31 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 32 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 38 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 39 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 40 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 48 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 54 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 56 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 57 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 59 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 60 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 61 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 62 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 63 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 64 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 65 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 66 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 67 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 70 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 72 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 73 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 75 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 85 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 86 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 87 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 88 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 89 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 90 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 92 | 3300006943 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW | Metagenome | Nodule |
| 93 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 94 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 95 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 96 | 3300009092 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300012492 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 129 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 134 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 135 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 138 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 205 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 206 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 207 | 3300027512 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 215 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 216 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 217 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 218 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 219 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 220 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 221 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 222 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 223 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 225 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 226 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 227 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 228 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 229 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 230 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 231 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 232 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 233 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 234 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 235 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 236 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 237 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 238 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 239 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 240 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 241 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 242 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 243 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 244 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 245 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 246 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 248 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 249 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 251 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 252 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 253 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 254 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 255 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 256 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 257 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 258 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 259 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 260 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 261 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 262 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 263 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 264 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 265 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 266 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 267 | 3300036459 | Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 268 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 269 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 270 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 271 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 272 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 273 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 274 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 275 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 276 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 277 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 278 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 279 | 3300041452 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG | Metagenome | Rhizoplane |
| 280 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 281 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 282 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 283 | 3300041491 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG | Metagenome | Unclassified |
| 284 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 285 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 286 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 287 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 288 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 289 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 290 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 291 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 292 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 293 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 294 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 295 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 296 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 297 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 298 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 299 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 369 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 370 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 371 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 372 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 373 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 381 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 382 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 383 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 384 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 385 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 386 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 387 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 388 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 389 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 390 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 391 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 392 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 393 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 394 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 395 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 396 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 397 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 398 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 399 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 400 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 401 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 402 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 403 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 404 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 405 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 406 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 409 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 410 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 411 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 412 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 413 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 414 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 415 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 416 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 417 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 418 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 419 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 422 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 425 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 426 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 427 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 428 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 429 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 430 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 431 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 432 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 433 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 434 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 435 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 436 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 437 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 438 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 439 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 440 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 442 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 443 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 444 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 445 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 446 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 447 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 448 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 449 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 450 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 451 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 452 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 453 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 454 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 455 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 456 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 457 | 3300053089 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere | Metagenome | Endosphere |
| 458 | 3300053090 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere | Metagenome | Endosphere |
| 459 | 3300053091 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere | Metagenome | Endosphere |
| 460 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 461 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 462 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 463 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 464 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 465 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 466 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 467 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 468 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 469 | 3300053115 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere | Metagenome | Endosphere |
| 470 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 471 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 472 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 473 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 474 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 475 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 476 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 477 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 478 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 479 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 480 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 481 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 482 | 3300053142 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere | Metagenome | Endosphere |
| 483 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 484 | 3300053146 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere | Metagenome | Endosphere |
| 485 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 486 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 487 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 488 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 489 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 490 | 3300053155 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere | Metagenome | Endosphere |
| 491 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 492 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 493 | 3300053159 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere | Metagenome | Endosphere |
| 494 | 3300053160 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere | Metagenome | Endosphere |
| 495 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 496 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 497 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 498 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 499 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 500 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 501 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 502 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 503 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 504 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 505 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 506 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 507 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 508 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 509 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 510 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 511 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 512 | 2513237098 | Bradyrhizobium elkanii WSM2783 | Isolate | Nodule |
| 513 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 514 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 515 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 516 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 517 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 518 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 519 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 520 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 521 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 522 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 523 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 524 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 525 | 2687453129 | Halotalea alkalilenta IHB B 13600 | Isolate | Unclassified |
| 526 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 527 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 528 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 529 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 530 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 531 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 532 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 533 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 534 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 535 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 536 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 537 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 538 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 539 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 540 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 541 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 542 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 543 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 544 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 545 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 546 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 547 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 548 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 549 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 550 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 551 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 552 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 553 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 554 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 555 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 556 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 557 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 558 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 559 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 560 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 561 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 562 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 563 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 564 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 565 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 566 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 567 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 568 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 569 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 570 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 571 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 572 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 573 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 574 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 575 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 576 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 577 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 578 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 579 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 580 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 581 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 582 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 583 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 584 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 585 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 586 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 587 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 588 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 589 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 590 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 591 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 592 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 593 | 2922368715 | |||
| 594 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 595 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 596 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 597 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 598 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 599 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 600 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 601 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 602 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 603 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 604 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 605 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 606 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 607 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 608 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 609 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 610 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 611 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 612 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 613 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 614 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 615 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 616 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 617 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 618 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 619 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 620 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 621 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 622 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 623 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 624 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 625 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 626 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 627 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 628 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 629 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 630 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 631 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 632 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 633 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 634 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 635 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 636 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 637 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 638 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 639 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 640 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 641 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 642 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 643 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 644 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 645 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 646 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 647 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 648 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 649 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 650 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 651 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 652 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 653 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 654 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 655 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 656 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 657 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 658 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 659 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 660 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 661 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 662 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 663 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 664 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 665 | 8016539877 | Bradyrhizobium sp. LM6.10 | Isolate | Nodule |
| 666 | 8016548790 | Bradyrhizobium sp. LM3.6 | Isolate | Nodule |
| 667 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 668 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 669 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 670 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 671 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 672 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 673 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 674 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 675 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 676 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 677 | 8019530166 | Bradyrhizobium sp. LM4.3 | Isolate | Nodule |
| 678 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 679 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 680 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 681 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 682 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 683 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 684 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 685 | 8019648815 | Bradyrhizobium sp. GM24.11 | Isolate | Nodule |
| 686 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 687 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 688 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 689 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 690 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 691 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 692 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 693 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 87.31 |
| Metatranscriptomes | 0.7 |
| Isolates | 11.99 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 9.31 |
| Nodule | 9.11 |
| Rhizoplane | 5.54 |
| Rhizosphere | 67.3 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.76 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0068856_100006491 | 3300005614 | Bacteria | 11469 |
| 2 | JGI24742J22300_10009000 | 3300002244 | Bacteria | 1647 |
| 3 | JGI25406J46586_10000078 | 3300003203 | Bacteria | 44054 |
| 4 | JGI25406J46586_10007863 | 3300003203 | Bacteria | 4851 |
| 5 | JGI25153J46596_10010523 | 3300003215 | Bacteria | 4178 |
| 6 | JGI25153J46596_10022305 | 3300003215 | Bacteria | 2338 |
| 7 | JGI25404J52841_10001821 | 3300003659 | Bacteria | 3871 |
| 8 | JGI25404J52841_10002922 | 3300003659 | Bacteria | 3313 |
| 9 | JGI25404J52841_10032590 | 3300003659 | Bacteria | 1111 |
| 10 | Ga0055542_1002566 | 3300003762 | Bacteria | 5792 |
| 11 | Ga0055529_1021822 | 3300003763 | Bacteria | 794 |
| 12 | Ga0055529_1031775 | 3300003763 | Bacteria | 646 |
| 13 | Ga0070658_10042658 | 3300005327 | Bacteria | 3664 |
| 14 | Ga0070658_10161467 | 3300005327 | Bacteria | 1880 |
| 15 | Ga0070658_10210295 | 3300005327 | Bacteria | 1643 |
| 16 | Ga0070658_10387757 | 3300005327 | Bacteria | 1199 |
| 17 | Ga0070676_10108708 | 3300005328 | Bacteria | 1724 |
| 18 | Ga0070683_101462219 | 3300005329 | Bacteria | 657 |
| 19 | Ga0070683_101647371 | 3300005329 | Bacteria | 617 |
| 20 | Ga0070690_100215512 | 3300005330 | Bacteria | 1343 |
| 21 | Ga0070690_100419124 | 3300005330 | Bacteria | 987 |
| 22 | Ga0070690_101517762 | 3300005330 | Bacteria | 542 |
| 23 | Ga0070677_10740214 | 3300005333 | Bacteria | 557 |
| 24 | Ga0068869_100711069 | 3300005334 | Bacteria | 857 |
| 25 | Ga0068869_100991556 | 3300005334 | Bacteria | 731 |
| 26 | Ga0068869_101356368 | 3300005334 | Bacteria | 628 |
| 27 | Ga0070680_100288044 | 3300005336 | Bacteria | 1392 |
| 28 | Ga0070682_100118026 | 3300005337 | Bacteria | 1777 |
| 29 | Ga0070682_100667417 | 3300005337 | Bacteria | 830 |
| 30 | Ga0070682_101805127 | 3300005337 | Bacteria | 533 |
| 31 | Ga0070660_100064655 | 3300005339 | Bacteria | 2846 |
| 32 | Ga0070660_100167335 | 3300005339 | Bacteria | 1774 |
| 33 | Ga0070689_101529616 | 3300005340 | Bacteria | 605 |
| 34 | Ga0070691_10489537 | 3300005341 | Bacteria | 709 |
| 35 | Ga0070661_100276878 | 3300005344 | Bacteria | 1301 |
| 36 | Ga0070661_100627335 | 3300005344 | Bacteria | 871 |
| 37 | Ga0070661_101487638 | 3300005344 | Bacteria | 571 |
| 38 | Ga0070668_100021296 | 3300005347 | Bacteria | 4900 |
| 39 | Ga0070668_100119222 | 3300005347 | Bacteria | 2107 |
| 40 | Ga0070668_100139245 | 3300005347 | Bacteria | 1954 |
| 41 | Ga0070668_100280847 | 3300005347 | Bacteria | 1390 |
| 42 | Ga0070669_100720157 | 3300005353 | Bacteria | 844 |
| 43 | Ga0070671_100100866 | 3300005355 | Bacteria | 2422 |
| 44 | Ga0070671_100164278 | 3300005355 | Bacteria | 1877 |
| 45 | Ga0070674_100030516 | 3300005356 | Bacteria | 3563 |
| 46 | Ga0070674_100073588 | 3300005356 | Bacteria | 2422 |
| 47 | Ga0070674_100207926 | 3300005356 | Bacteria | 1515 |
| 48 | Ga0070673_100202032 | 3300005364 | Bacteria | 1712 |
| 49 | Ga0070673_100218490 | 3300005364 | Bacteria | 1649 |
| 50 | Ga0070673_100691724 | 3300005364 | Bacteria | 936 |
| 51 | Ga0070673_100812672 | 3300005364 | Bacteria | 864 |
| 52 | Ga0070659_100052649 | 3300005366 | Bacteria | 3202 |
| 53 | Ga0070659_100856376 | 3300005366 | Bacteria | 792 |
| 54 | Ga0070659_101067897 | 3300005366 | Bacteria | 711 |
| 55 | Ga0070667_100070238 | 3300005367 | Bacteria | 2981 |
| 56 | Ga0070667_100199869 | 3300005367 | Bacteria | 1773 |
| 57 | Ga0070667_100758517 | 3300005367 | Bacteria | 900 |
| 58 | Ga0070667_101207043 | 3300005367 | Bacteria | 708 |
| 59 | Ga0070709_10051798 | 3300005434 | Bacteria | 2577 |
| 60 | Ga0070714_100008919 | 3300005435 | Bacteria | 7847 |
| 61 | Ga0070714_100069803 | 3300005435 | Bacteria | 3036 |
| 62 | Ga0070714_101086456 | 3300005435 | Bacteria | 779 |
| 63 | Ga0070713_100002496 | 3300005436 | Bacteria | 12016 |
| 64 | Ga0070713_100043496 | 3300005436 | Bacteria | 3672 |
| 65 | Ga0070713_100051383 | 3300005436 | Bacteria | 3409 |
| 66 | Ga0070713_100188572 | 3300005436 | Bacteria | 1857 |
| 67 | Ga0070713_100196742 | 3300005436 | Bacteria | 1819 |
| 68 | Ga0070713_100417186 | 3300005436 | Bacteria | 1256 |
| 69 | Ga0070713_102188772 | 3300005436 | Bacteria | 536 |
| 70 | Ga0070710_10002216 | 3300005437 | Bacteria | 9176 |
| 71 | Ga0070710_10005858 | 3300005437 | Bacteria | 5865 |
| 72 | Ga0070710_10063822 | 3300005437 | Bacteria | 2105 |
| 73 | Ga0070710_10877299 | 3300005437 | Bacteria | 646 |
| 74 | Ga0070710_11535926 | 3300005437 | Bacteria | 501 |
| 75 | Ga0070701_10309659 | 3300005438 | Bacteria | 974 |
| 76 | Ga0070711_100004598 | 3300005439 | Bacteria | 8168 |
| 77 | Ga0070711_100009923 | 3300005439 | Bacteria | 5872 |
| 78 | Ga0070711_100043803 | 3300005439 | Bacteria | 3034 |
| 79 | Ga0070711_100383681 | 3300005439 | Bacteria | 1137 |
| 80 | Ga0070711_100660610 | 3300005439 | Bacteria | 877 |
| 81 | Ga0070711_101310346 | 3300005439 | Bacteria | 629 |
| 82 | Ga0070700_100205013 | 3300005441 | Bacteria | 1388 |
| 83 | Ga0070700_101759084 | 3300005441 | Bacteria | 533 |
| 84 | Ga0070663_100071153 | 3300005455 | Bacteria | 2531 |
| 85 | Ga0070663_100074690 | 3300005455 | Bacteria | 2476 |
| 86 | Ga0070663_100166747 | 3300005455 | Bacteria | 1699 |
| 87 | Ga0070663_100260411 | 3300005455 | Bacteria | 1376 |
| 88 | Ga0070663_101192185 | 3300005455 | Bacteria | 669 |
| 89 | Ga0070678_100195784 | 3300005456 | Bacteria | 1665 |
| 90 | Ga0070678_100264579 | 3300005456 | Bacteria | 1448 |
| 91 | Ga0070678_100600278 | 3300005456 | Bacteria | 983 |
| 92 | Ga0070678_100999439 | 3300005456 | Bacteria | 769 |
| 93 | Ga0070678_102362768 | 3300005456 | Bacteria | 505 |
| 94 | Ga0070662_100199528 | 3300005457 | Bacteria | 1586 |
| 95 | Ga0070662_100358098 | 3300005457 | Bacteria | 1197 |
| 96 | Ga0070662_100904746 | 3300005457 | Bacteria | 753 |
| 97 | Ga0070662_100933192 | 3300005457 | Bacteria | 741 |
| 98 | Ga0070681_10149264 | 3300005458 | Bacteria | 2265 |
| 99 | Ga0070681_10221402 | 3300005458 | Bacteria | 1808 |
| 100 | Ga0070681_11044690 | 3300005458 | Unclassified | 737 |
| 101 | Ga0070681_11346821 | 3300005458 | Bacteria | 637 |
| 102 | Ga0068867_100362026 | 3300005459 | Bacteria | 1213 |
| 103 | Ga0070685_10227941 | 3300005466 | Bacteria | 1224 |
| 104 | Ga0070706_100104252 | 3300005467 | Bacteria | 2637 |
| 105 | Ga0070707_100651447 | 3300005468 | Bacteria | 1016 |
| 106 | Ga0070698_100095475 | 3300005471 | Bacteria | 2951 |
| 107 | Ga0070698_101029613 | 3300005471 | Bacteria | 771 |
| 108 | Ga0070699_100232537 | 3300005518 | Bacteria | 1644 |
| 109 | Ga0070699_100512689 | 3300005518 | Bacteria | 1090 |
| 110 | Ga0070679_100015207 | 3300005530 | Bacteria | 7392 |
| 111 | Ga0070679_100176711 | 3300005530 | Bacteria | 2107 |
| 112 | Ga0070684_100566673 | 3300005535 | Bacteria | 1055 |
| 113 | Ga0070684_101855553 | 3300005535 | Bacteria | 569 |
| 114 | Ga0070697_100284549 | 3300005536 | Bacteria | 1419 |
| 115 | Ga0068853_100052136 | 3300005539 | Bacteria | 3523 |
| 116 | Ga0068853_100064125 | 3300005539 | Bacteria | 3184 |
| 117 | Ga0068853_100387067 | 3300005539 | Bacteria | 1307 |
| 118 | Ga0068853_101064271 | 3300005539 | Bacteria | 780 |
| 119 | Ga0068853_101523309 | 3300005539 | Bacteria | 647 |
| 120 | Ga0068853_101564149 | 3300005539 | Bacteria | 639 |
| 121 | Ga0070672_100490312 | 3300005543 | Bacteria | 1062 |
| 122 | Ga0070686_100114215 | 3300005544 | Bacteria | 1845 |
| 123 | Ga0070686_101165948 | 3300005544 | Bacteria | 639 |
| 124 | Ga0070696_101209436 | 3300005546 | Bacteria | 639 |
| 125 | Ga0070693_100138758 | 3300005547 | Bacteria | 1528 |
| 126 | Ga0070693_100625821 | 3300005547 | Bacteria | 780 |
| 127 | Ga0070665_100067159 | 3300005548 | Bacteria | 3596 |
| 128 | Ga0070665_100135737 | 3300005548 | Bacteria | 2463 |
| 129 | Ga0070665_100148723 | 3300005548 | Bacteria | 2345 |
| 130 | Ga0070665_100226507 | 3300005548 | Bacteria | 1870 |
| 131 | Ga0070665_100254057 | 3300005548 | Bacteria | 1758 |
| 132 | Ga0070665_100948965 | 3300005548 | Bacteria | 873 |
| 133 | Ga0068855_100008391 | 3300005563 | Bacteria | 12493 |
| 134 | Ga0068855_100023606 | 3300005563 | Bacteria | 7366 |
| 135 | Ga0068855_100212427 | 3300005563 | Bacteria | 2173 |
| 136 | Ga0068855_100427997 | 3300005563 | Bacteria | 1447 |
| 137 | Ga0068855_100433863 | 3300005563 | Bacteria | 1436 |
| 138 | Ga0068855_100677195 | 3300005563 | Bacteria | 1106 |
| 139 | Ga0068855_101121170 | 3300005563 | Bacteria | 821 |
| 140 | Ga0068855_101140637 | 3300005563 | Bacteria | 813 |
| 141 | Ga0068855_101333530 | 3300005563 | Bacteria | 741 |
| 142 | Ga0070664_100055730 | 3300005564 | Bacteria | 3357 |
| 143 | Ga0070664_100390206 | 3300005564 | Bacteria | 1272 |
| 144 | Ga0068857_100362524 | 3300005577 | Bacteria | 1344 |
| 145 | Ga0068857_101065744 | 3300005577 | Bacteria | 780 |
| 146 | Ga0068854_100027459 | 3300005578 | Bacteria | 3924 |
| 147 | Ga0068854_100081207 | 3300005578 | Bacteria | 2394 |
| 148 | Ga0068854_100384302 | 3300005578 | Bacteria | 1158 |
| 149 | Ga0068854_101772312 | 3300005578 | Bacteria | 566 |
| 150 | Ga0068856_100005799 | 3300005614 | Bacteria | 12168 |
| 151 | Ga0068856_100116497 | 3300005614 | Bacteria | 2672 |
| 152 | Ga0068856_100250331 | 3300005614 | Bacteria | 1787 |
| 153 | Ga0068856_100473108 | 3300005614 | Bacteria | 1274 |
| 154 | Ga0068856_100999793 | 3300005614 | Bacteria | 855 |
| 155 | Ga0070702_100175428 | 3300005615 | Bacteria | 1398 |
| 156 | Ga0070702_100468668 | 3300005615 | Bacteria | 918 |
| 157 | Ga0070702_100572428 | 3300005615 | Bacteria | 842 |
| 158 | Ga0068852_100026885 | 3300005616 | Bacteria | 4683 |
| 159 | Ga0068852_100452737 | 3300005616 | Bacteria | 1271 |
| 160 | Ga0068852_100549554 | 3300005616 | Bacteria | 1155 |
| 161 | Ga0068852_100577230 | 3300005616 | Bacteria | 1127 |
| 162 | Ga0068852_100611543 | 3300005616 | Bacteria | 1095 |
| 163 | Ga0068852_101063374 | 3300005616 | Bacteria | 829 |
| 164 | Ga0068859_101596147 | 3300005617 | Unclassified | 720 |
| 165 | Ga0068864_100163405 | 3300005618 | Bacteria | 2025 |
| 166 | Ga0068864_100930207 | 3300005618 | Bacteria | 860 |
| 167 | Ga0068864_101440622 | 3300005618 | Bacteria | 691 |
| 168 | Ga0068866_10498265 | 3300005718 | Bacteria | 805 |
| 169 | Ga0068866_11261235 | 3300005718 | Bacteria | 536 |
| 170 | Ga0068861_100015345 | 3300005719 | Bacteria | 5396 |
| 171 | Ga0068861_101145494 | 3300005719 | Bacteria | 749 |
| 172 | Ga0068861_102533418 | 3300005719 | Bacteria | 516 |
| 173 | Ga0068851_10000888 | 3300005834 | Bacteria | 12916 |
| 174 | Ga0068851_10083850 | 3300005834 | Bacteria | 1668 |
| 175 | Ga0068851_10272875 | 3300005834 | Bacteria | 965 |
| 176 | Ga0068851_10714023 | 3300005834 | Bacteria | 618 |
| 177 | Ga0068870_10825192 | 3300005840 | Bacteria | 650 |
| 178 | Ga0068863_100606370 | 3300005841 | Bacteria | 1084 |
| 179 | Ga0068863_100808947 | 3300005841 | Bacteria | 935 |
| 180 | Ga0068863_100828036 | 3300005841 | Bacteria | 924 |
| 181 | Ga0068858_100149929 | 3300005842 | Bacteria | 2192 |
| 182 | Ga0068858_101694758 | 3300005842 | Unclassified | 624 |
| 183 | Ga0068860_101991785 | 3300005843 | Unclassified | 602 |
| 184 | Ga0068862_100237565 | 3300005844 | Bacteria | 1655 |
| 185 | Ga0081455_10007525 | 3300005937 | Bacteria | 11455 |
| 186 | Ga0081455_10010928 | 3300005937 | Bacteria | 9158 |
| 187 | Ga0081455_10029071 | 3300005937 | Bacteria | 5043 |
| 188 | Ga0081455_10040471 | 3300005937 | Bacteria | 4109 |
| 189 | Ga0081455_10044093 | 3300005937 | Bacteria | 3895 |
| 190 | Ga0081455_10259013 | 3300005937 | Bacteria | 1268 |
| 191 | Ga0081455_10713172 | 3300005937 | Bacteria | 638 |
| 192 | Ga0081538_10105051 | 3300005981 | Bacteria | 1407 |
| 193 | Ga0081540_1001581 | 3300005983 | Bacteria | 19462 |
| 194 | Ga0081540_1005915 | 3300005983 | Bacteria | 9026 |
| 195 | Ga0081540_1007598 | 3300005983 | Bacteria | 7699 |
| 196 | Ga0081540_1028204 | 3300005983 | Bacteria | 3159 |
| 197 | Ga0081540_1140599 | 3300005983 | Bacteria | 970 |
| 198 | Ga0081539_10000273 | 3300005985 | Bacteria | 117936 |
| 199 | Ga0081539_10001396 | 3300005985 | Bacteria | 41607 |
| 200 | Ga0081539_10016511 | 3300005985 | Bacteria | 5262 |
| 201 | Ga0081539_10024577 | 3300005985 | Bacteria | 3903 |
| 202 | Ga0070717_10001732 | 3300006028 | Bacteria | 15222 |
| 203 | Ga0070717_10005433 | 3300006028 | Bacteria | 9305 |
| 204 | Ga0070717_10619675 | 3300006028 | Bacteria | 982 |
| 205 | Ga0070717_10784474 | 3300006028 | Bacteria | 867 |
| 206 | Ga0075365_10059920 | 3300006038 | Bacteria | 2538 |
| 207 | Ga0075365_10111717 | 3300006038 | Bacteria | 1878 |
| 208 | Ga0075365_10133407 | 3300006038 | Bacteria | 1719 |
| 209 | Ga0075365_10850681 | 3300006038 | Bacteria | 643 |
| 210 | Ga0075365_10932833 | 3300006038 | Bacteria | 612 |
| 211 | Ga0075365_11102401 | 3300006038 | Bacteria | 559 |
| 212 | Ga0075365_11216017 | 3300006038 | Bacteria | 530 |
| 213 | Ga0075368_10190425 | 3300006042 | Bacteria | 866 |
| 214 | Ga0075368_10260237 | 3300006042 | Bacteria | 743 |
| 215 | Ga0075363_100127088 | 3300006048 | Bacteria | 1428 |
| 216 | Ga0075363_100301805 | 3300006048 | Bacteria | 929 |
| 217 | Ga0075363_100532338 | 3300006048 | Bacteria | 700 |
| 218 | Ga0075363_100796190 | 3300006048 | Bacteria | 575 |
| 219 | Ga0075363_100946565 | 3300006048 | Bacteria | 529 |
| 220 | Ga0075364_10589544 | 3300006051 | Bacteria | 759 |
| 221 | Ga0075364_10720532 | 3300006051 | Bacteria | 680 |
| 222 | Ga0075364_10904668 | 3300006051 | Bacteria | 601 |
| 223 | Ga0070715_10005372 | 3300006163 | Bacteria | 4269 |
| 224 | Ga0070716_100078714 | 3300006173 | Bacteria | 1961 |
| 225 | Ga0070716_100690990 | 3300006173 | Unclassified | 778 |
| 226 | Ga0070716_101008191 | 3300006173 | Bacteria | 659 |
| 227 | Ga0070712_100098511 | 3300006175 | Bacteria | 2156 |
| 228 | Ga0070712_100142802 | 3300006175 | Bacteria | 1829 |
| 229 | Ga0070712_100238449 | 3300006175 | Bacteria | 1448 |
| 230 | Ga0070712_101486979 | 3300006175 | Bacteria | 592 |
| 231 | Ga0075362_10377500 | 3300006177 | Bacteria | 713 |
| 232 | Ga0075367_10029703 | 3300006178 | Bacteria | 3129 |
| 233 | Ga0075367_10032866 | 3300006178 | Bacteria | 2987 |
| 234 | Ga0075367_10033392 | 3300006178 | Bacteria | 2965 |
| 235 | Ga0075367_10063233 | 3300006178 | Bacteria | 2212 |
| 236 | Ga0075367_10249298 | 3300006178 | Bacteria | 1114 |
| 237 | Ga0075367_10860052 | 3300006178 | Bacteria | 578 |
| 238 | Ga0075369_10111089 | 3300006186 | Bacteria | 1235 |
| 239 | Ga0075366_10184467 | 3300006195 | Bacteria | 1268 |
| 240 | Ga0075366_10483446 | 3300006195 | Bacteria | 765 |
| 241 | Ga0097621_100786338 | 3300006237 | Bacteria | 881 |
| 242 | Ga0097621_101364779 | 3300006237 | Bacteria | 670 |
| 243 | Ga0075370_10110987 | 3300006353 | Bacteria | 1593 |
| 244 | Ga0075370_10237161 | 3300006353 | Bacteria | 1080 |
| 245 | Ga0075370_10588450 | 3300006353 | Bacteria | 674 |
| 246 | Ga0068871_100808109 | 3300006358 | Bacteria | 865 |
| 247 | Ga0068871_100919258 | 3300006358 | Bacteria | 812 |
| 248 | Ga0075434_102396040 | 3300006871 | Bacteria | 530 |
| 249 | Ga0068865_100359398 | 3300006881 | Bacteria | 1182 |
| 250 | Ga0068865_101103683 | 3300006881 | Bacteria | 699 |
| 251 | Ga0097620_101596536 | 3300006931 | Unclassified | 720 |
| 252 | Ga0099824_1004610 | 3300006942 | Bacteria | 19776 |
| 253 | Ga0099822_1001276 | 3300006943 | Bacteria | 28780 |
| 254 | Ga0075435_100156290 | 3300007076 | Bacteria | 1919 |
| 255 | Ga0099794_10037121 | 3300007265 | Bacteria | 2306 |
| 256 | Ga0099794_10044971 | 3300007265 | Bacteria | 2112 |
| 257 | Ga0099794_10052805 | 3300007265 | Bacteria | 1960 |
| 258 | Ga0099795_10028020 | 3300007788 | Bacteria | 1911 |
| 259 | Ga0099795_10330472 | 3300007788 | Bacteria | 677 |
| 260 | Ga0099795_10350483 | 3300007788 | Bacteria | 660 |
| 261 | Ga0099795_10428823 | 3300007788 | Bacteria | 605 |
| 262 | Ga0099795_10532114 | 3300007788 | Bacteria | 552 |
| 263 | Ga0105250_10213935 | 3300009092 | Bacteria | 815 |
| 264 | Ga0105240_10005415 | 3300009093 | Bacteria | 19031 |
| 265 | Ga0105240_10040418 | 3300009093 | Bacteria | 5965 |
| 266 | Ga0105240_10052328 | 3300009093 | Bacteria | 5134 |
| 267 | Ga0105240_10083106 | 3300009093 | Bacteria | 3930 |
| 268 | Ga0105240_10146974 | 3300009093 | Bacteria | 2812 |
| 269 | Ga0105240_10411111 | 3300009093 | Bacteria | 1522 |
| 270 | Ga0105240_11229578 | 3300009093 | Bacteria | 792 |
| 271 | Ga0105240_11334528 | 3300009093 | Bacteria | 756 |
| 272 | Ga0105240_11910566 | 3300009093 | Bacteria | 618 |
| 273 | Ga0111539_10334875 | 3300009094 | Bacteria | 1762 |
| 274 | Ga0105245_10570787 | 3300009098 | Bacteria | 1155 |
| 275 | Ga0105245_10788219 | 3300009098 | Bacteria | 988 |
| 276 | Ga0105245_10844199 | 3300009098 | Bacteria | 956 |
| 277 | Ga0105245_11334991 | 3300009098 | Bacteria | 766 |
| 278 | Ga0105245_13014047 | 3300009098 | Bacteria | 522 |
| 279 | Ga0105247_10151737 | 3300009101 | Bacteria | 1527 |
| 280 | Ga0105247_10257934 | 3300009101 | Bacteria | 1194 |
| 281 | Ga0105247_11070066 | 3300009101 | Bacteria | 634 |
| 282 | Ga0105247_11345461 | 3300009101 | Bacteria | 575 |
| 283 | Ga0114129_12467396 | 3300009147 | Bacteria | 622 |
| 284 | Ga0105243_10215195 | 3300009148 | Bacteria | 1695 |
| 285 | Ga0105243_10351053 | 3300009148 | Bacteria | 1354 |
| 286 | Ga0105243_10493839 | 3300009148 | Bacteria | 1158 |
| 287 | Ga0105243_11980105 | 3300009148 | Bacteria | 617 |
| 288 | Ga0105241_10011989 | 3300009174 | Bacteria | 6365 |
| 289 | Ga0105241_10057701 | 3300009174 | Bacteria | 2979 |
| 290 | Ga0105241_10174510 | 3300009174 | Bacteria | 1778 |
| 291 | Ga0105241_10555106 | 3300009174 | Bacteria | 1032 |
| 292 | Ga0105241_10575649 | 3300009174 | Bacteria | 1014 |
| 293 | Ga0105241_10703849 | 3300009174 | Bacteria | 922 |
| 294 | Ga0105242_11111635 | 3300009176 | Bacteria | 805 |
| 295 | Ga0105242_11277903 | 3300009176 | Bacteria | 757 |
| 296 | Ga0105242_11791518 | 3300009176 | Bacteria | 652 |
| 297 | Ga0105242_12759302 | 3300009176 | Bacteria | 541 |
| 298 | Ga0105248_10132319 | 3300009177 | Bacteria | 2814 |
| 299 | Ga0105248_10319725 | 3300009177 | Bacteria | 1748 |
| 300 | Ga0105248_10530177 | 3300009177 | Bacteria | 1328 |
| 301 | Ga0105248_10574246 | 3300009177 | Bacteria | 1272 |
| 302 | Ga0105248_11361564 | 3300009177 | Bacteria | 803 |
| 303 | Ga0105248_11378649 | 3300009177 | Bacteria | 798 |
| 304 | Ga0105248_13215771 | 3300009177 | Bacteria | 520 |
| 305 | Ga0105237_10003346 | 3300009545 | Bacteria | 19082 |
| 306 | Ga0105237_10033346 | 3300009545 | Bacteria | 5216 |
| 307 | Ga0105237_10174418 | 3300009545 | Bacteria | 2150 |
| 308 | Ga0105237_10175568 | 3300009545 | Bacteria | 2143 |
| 309 | Ga0105237_10210128 | 3300009545 | Bacteria | 1946 |
| 310 | Ga0105237_10241999 | 3300009545 | Bacteria | 1805 |
| 311 | Ga0105237_10559306 | 3300009545 | Bacteria | 1150 |
| 312 | Ga0105237_10583113 | 3300009545 | Bacteria | 1125 |
| 313 | Ga0105237_10647147 | 3300009545 | Bacteria | 1064 |
| 314 | Ga0105237_10821601 | 3300009545 | Bacteria | 936 |
| 315 | Ga0105237_10901653 | 3300009545 | Bacteria | 891 |
| 316 | Ga0105237_11640848 | 3300009545 | Bacteria | 650 |
| 317 | Ga0105238_10008128 | 3300009551 | Bacteria | 10489 |
| 318 | Ga0105238_10010310 | 3300009551 | Bacteria | 9377 |
| 319 | Ga0105238_10020057 | 3300009551 | Bacteria | 6805 |
| 320 | Ga0105238_10111158 | 3300009551 | Bacteria | 2721 |
| 321 | Ga0105238_10111592 | 3300009551 | Bacteria | 2714 |
| 322 | Ga0105238_10685766 | 3300009551 | Bacteria | 1036 |
| 323 | Ga0105238_11137917 | 3300009551 | Bacteria | 804 |
| 324 | Ga0105238_12025769 | 3300009551 | Bacteria | 609 |
| 325 | Ga0105249_10154863 | 3300009553 | Bacteria | 2209 |
| 326 | Ga0105249_10608031 | 3300009553 | Bacteria | 1148 |
| 327 | Ga0105249_12534635 | 3300009553 | Bacteria | 585 |
| 328 | Ga0105249_12780345 | 3300009553 | Bacteria | 561 |
| 329 | Ga0099796_10054915 | 3300010159 | Bacteria | 1394 |
| 330 | Ga0105239_10008096 | 3300010375 | Bacteria | 11998 |
| 331 | Ga0105239_10094734 | 3300010375 | Bacteria | 3298 |
| 332 | Ga0105239_10110779 | 3300010375 | Bacteria | 3043 |
| 333 | Ga0105239_10189475 | 3300010375 | Bacteria | 2302 |
| 334 | Ga0105239_10199526 | 3300010375 | Bacteria | 2241 |
| 335 | Ga0105239_10258381 | 3300010375 | Bacteria | 1957 |
| 336 | Ga0105239_10278959 | 3300010375 | Bacteria | 1881 |
| 337 | Ga0105239_10412241 | 3300010375 | Bacteria | 1530 |
| 338 | Ga0105239_10479498 | 3300010375 | Bacteria | 1413 |
| 339 | Ga0105239_11890350 | 3300010375 | Bacteria | 692 |
| 340 | Ga0105246_10557030 | 3300011119 | Bacteria | 983 |
| 341 | Ga0105246_10669763 | 3300011119 | Bacteria | 905 |
| 342 | Ga0105246_10675893 | 3300011119 | Bacteria | 902 |
| 343 | Ga0105246_11351798 | 3300011119 | Bacteria | 662 |
| 344 | Ga0105246_12596514 | 3300011119 | Bacteria | 500 |
| 345 | Ga0157335_1043756 | 3300012492 | Bacteria | 514 |
| 346 | Ga0157373_10305646 | 3300013100 | Bacteria | 1129 |
| 347 | Ga0157373_11062339 | 3300013100 | Bacteria | 606 |
| 348 | Ga0157371_10215678 | 3300013102 | Bacteria | 1378 |
| 349 | Ga0157371_10244328 | 3300013102 | Bacteria | 1292 |
| 350 | Ga0157371_11175114 | 3300013102 | Bacteria | 591 |
| 351 | Ga0157370_10016462 | 3300013104 | Bacteria | 7485 |
| 352 | Ga0157370_10140677 | 3300013104 | Bacteria | 2249 |
| 353 | Ga0157370_10185303 | 3300013104 | Bacteria | 1933 |
| 354 | Ga0157370_10236824 | 3300013104 | Bacteria | 1689 |
| 355 | Ga0157370_10243505 | 3300013104 | Bacteria | 1664 |
| 356 | Ga0157370_10447684 | 3300013104 | Bacteria | 1187 |
| 357 | Ga0157370_11155309 | 3300013104 | Bacteria | 699 |
| 358 | Ga0157369_10024515 | 3300013105 | Bacteria | 6709 |
| 359 | Ga0157369_10040217 | 3300013105 | Bacteria | 5105 |
| 360 | Ga0157369_10050357 | 3300013105 | Bacteria | 4512 |
| 361 | Ga0157369_10335206 | 3300013105 | Bacteria | 1571 |
| 362 | Ga0157369_11452230 | 3300013105 | Bacteria | 698 |
| 363 | Ga0157369_12181332 | 3300013105 | Bacteria | 562 |
| 364 | Ga0157374_10031861 | 3300013296 | Bacteria | 4796 |
| 365 | Ga0157374_10039337 | 3300013296 | Bacteria | 4352 |
| 366 | Ga0157374_11040664 | 3300013296 | Bacteria | 838 |
| 367 | Ga0157378_10003448 | 3300013297 | Bacteria | 14024 |
| 368 | Ga0157378_10614676 | 3300013297 | Bacteria | 1099 |
| 369 | Ga0163162_10045197 | 3300013306 | Bacteria | 4412 |
| 370 | Ga0163162_10071696 | 3300013306 | Bacteria | 3518 |
| 371 | Ga0163162_10134925 | 3300013306 | Bacteria | 2579 |
| 372 | Ga0163162_10514310 | 3300013306 | Bacteria | 1327 |
| 373 | Ga0163162_11088176 | 3300013306 | Bacteria | 905 |
| 374 | Ga0163162_11428228 | 3300013306 | Bacteria | 787 |
| 375 | Ga0163162_12358142 | 3300013306 | Bacteria | 612 |
| 376 | Ga0157372_10078020 | 3300013307 | Bacteria | 3742 |
| 377 | Ga0157372_10244820 | 3300013307 | Bacteria | 2081 |
| 378 | Ga0157372_10746197 | 3300013307 | Bacteria | 1138 |
| 379 | Ga0157372_12771001 | 3300013307 | Bacteria | 562 |
| 380 | Ga0157372_13473488 | 3300013307 | Bacteria | 501 |
| 381 | Ga0157375_10007186 | 3300013308 | Bacteria | 9732 |
| 382 | Ga0157375_13480546 | 3300013308 | Bacteria | 524 |
| 383 | Ga0163163_10010706 | 3300014325 | Bacteria | 8267 |
| 384 | Ga0163163_10717523 | 3300014325 | Bacteria | 1063 |
| 385 | Ga0157380_10075129 | 3300014326 | Bacteria | 2746 |
| 386 | Ga0157380_10422614 | 3300014326 | Bacteria | 1272 |
| 387 | Ga0157380_10614007 | 3300014326 | Bacteria | 1078 |
| 388 | Ga0157380_10748389 | 3300014326 | Bacteria | 988 |
| 389 | Ga0157377_10094096 | 3300014745 | Bacteria | 1775 |
| 390 | Ga0157377_11349733 | 3300014745 | Bacteria | 560 |
| 391 | Ga0157379_10106263 | 3300014968 | Bacteria | 2520 |
| 392 | Ga0157379_10257354 | 3300014968 | Bacteria | 1585 |
| 393 | Ga0157379_10686939 | 3300014968 | Bacteria | 960 |
| 394 | Ga0157379_11891309 | 3300014968 | Bacteria | 588 |
| 395 | Ga0157379_11992885 | 3300014968 | Bacteria | 574 |
| 396 | Ga0157376_10052581 | 3300014969 | Bacteria | 3388 |
| 397 | Ga0157376_10393643 | 3300014969 | Bacteria | 1338 |
| 398 | Ga0157376_10580615 | 3300014969 | Unclassified | 1113 |
| 399 | Ga0157376_11446977 | 3300014969 | Bacteria | 719 |
| 400 | Ga0163161_10195980 | 3300017792 | Bacteria | 1555 |
| 401 | Ga0163161_10445352 | 3300017792 | Bacteria | 1046 |
| 402 | Ga0163161_11286351 | 3300017792 | Bacteria | 635 |
| 403 | Ga0163161_11438589 | 3300017792 | Bacteria | 603 |
| 404 | Ga0163161_12071814 | 3300017792 | Bacteria | 506 |
| 405 | Ga0197907_11095771 | 3300020069 | Bacteria | 1100 |
| 406 | Ga0197907_11224085 | 3300020069 | Bacteria | 848 |
| 407 | Ga0197907_11225209 | 3300020069 | Bacteria | 847 |
| 408 | Ga0206356_10682141 | 3300020070 | Bacteria | 1118 |
| 409 | Ga0206352_11039941 | 3300020078 | Bacteria | 786 |
| 410 | Ga0206350_10942758 | 3300020080 | Bacteria | 668 |
| 411 | Ga0206350_11631821 | 3300020080 | Bacteria | 979 |
| 412 | Ga0206353_12019823 | 3300020082 | Bacteria | 1243 |
| 413 | Ga0213874_10134625 | 3300021377 | Bacteria | 851 |
| 414 | Ga0213876_10072948 | 3300021384 | Bacteria | 1813 |
| 415 | Ga0213876_10127854 | 3300021384 | Bacteria | 1350 |
| 416 | Ga0213876_10334614 | 3300021384 | Bacteria | 805 |
| 417 | Ga0213875_10087284 | 3300021388 | Bacteria | 1455 |
| 418 | Ga0224712_10073442 | 3300022467 | Bacteria | 1395 |
| 419 | Ga0224712_10122025 | 3300022467 | Bacteria | 1129 |
| 420 | Ga0224570_101679 | 3300022730 | Bacteria | 1592 |
| 421 | Ga0209677_100555 | 3300025253 | Bacteria | 20636 |
| 422 | Ga0209148_1000679 | 3300025254 | Bacteria | 28441 |
| 423 | Ga0209148_1007771 | 3300025254 | Bacteria | 2199 |
| 424 | Ga0209233_1000826 | 3300025261 | Bacteria | 13712 |
| 425 | Ga0209233_1011008 | 3300025261 | Bacteria | 2681 |
| 426 | Ga0209455_1002608 | 3300025272 | Bacteria | 6857 |
| 427 | Ga0209455_1002958 | 3300025272 | Bacteria | 6248 |
| 428 | Ga0209455_1008958 | 3300025272 | Bacteria | 2666 |
| 429 | Ga0209455_1009718 | 3300025272 | Bacteria | 2503 |
| 430 | Ga0209758_1001784 | 3300025297 | Bacteria | 23779 |
| 431 | Ga0209758_1007742 | 3300025297 | Bacteria | 7199 |
| 432 | Ga0209758_1024291 | 3300025297 | Bacteria | 2706 |
| 433 | Ga0209758_1024339 | 3300025297 | Bacteria | 2701 |
| 434 | Ga0207656_10004296 | 3300025321 | Bacteria | 4963 |
| 435 | Ga0207656_10163328 | 3300025321 | Bacteria | 1061 |
| 436 | Ga0207656_10569553 | 3300025321 | Bacteria | 577 |
| 437 | Ga0207653_10452208 | 3300025885 | Bacteria | 504 |
| 438 | Ga0207682_10045943 | 3300025893 | Bacteria | 1793 |
| 439 | Ga0207692_10020408 | 3300025898 | Bacteria | 3013 |
| 440 | Ga0207642_10714977 | 3300025899 | Bacteria | 632 |
| 441 | Ga0207710_10210708 | 3300025900 | Bacteria | 962 |
| 442 | Ga0207710_10515929 | 3300025900 | Bacteria | 621 |
| 443 | Ga0207688_10181400 | 3300025901 | Bacteria | 1256 |
| 444 | Ga0207688_10961159 | 3300025901 | Bacteria | 540 |
| 445 | Ga0207680_10112386 | 3300025903 | Bacteria | 1769 |
| 446 | Ga0207647_10003286 | 3300025904 | Bacteria | 12138 |
| 447 | Ga0207647_10300436 | 3300025904 | Bacteria | 914 |
| 448 | Ga0207647_10596612 | 3300025904 | Bacteria | 609 |
| 449 | Ga0207647_10751145 | 3300025904 | Bacteria | 528 |
| 450 | Ga0207685_10001042 | 3300025905 | Bacteria | 5433 |
| 451 | Ga0207699_10044277 | 3300025906 | Bacteria | 2590 |
| 452 | Ga0207699_10128177 | 3300025906 | Bacteria | 1651 |
| 453 | Ga0207705_10089452 | 3300025909 | Bacteria | 2253 |
| 454 | Ga0207705_10109795 | 3300025909 | Bacteria | 2037 |
| 455 | Ga0207705_10129403 | 3300025909 | Bacteria | 1878 |
| 456 | Ga0207705_10296394 | 3300025909 | Bacteria | 1240 |
| 457 | Ga0207705_10477844 | 3300025909 | Bacteria | 967 |
| 458 | Ga0207684_10051065 | 3300025910 | Bacteria | 3508 |
| 459 | Ga0207684_10092573 | 3300025910 | Bacteria | 2577 |
| 460 | Ga0207654_10003714 | 3300025911 | Bacteria | 7704 |
| 461 | Ga0207654_10094570 | 3300025911 | Bacteria | 1829 |
| 462 | Ga0207654_10743399 | 3300025911 | Bacteria | 706 |
| 463 | Ga0207707_10092864 | 3300025912 | Bacteria | 2636 |
| 464 | Ga0207707_10130915 | 3300025912 | Bacteria | 2194 |
| 465 | Ga0207707_10439382 | 3300025912 | Bacteria | 1117 |
| 466 | Ga0207707_10626553 | 3300025912 | Bacteria | 908 |
| 467 | Ga0207695_10000599 | 3300025913 | Bacteria | 72238 |
| 468 | Ga0207695_10002303 | 3300025913 | Bacteria | 28471 |
| 469 | Ga0207695_10074812 | 3300025913 | Bacteria | 3447 |
| 470 | Ga0207695_10109656 | 3300025913 | Bacteria | 2741 |
| 471 | Ga0207695_10203359 | 3300025913 | Bacteria | 1894 |
| 472 | Ga0207695_10265948 | 3300025913 | Bacteria | 1611 |
| 473 | Ga0207695_10267429 | 3300025913 | Bacteria | 1606 |
| 474 | Ga0207695_10290525 | 3300025913 | Bacteria | 1527 |
| 475 | Ga0207671_10141728 | 3300025914 | Bacteria | 1852 |
| 476 | Ga0207671_10171331 | 3300025914 | Bacteria | 1686 |
| 477 | Ga0207671_10377251 | 3300025914 | Bacteria | 1126 |
| 478 | Ga0207671_10620565 | 3300025914 | Bacteria | 861 |
| 479 | Ga0207671_10932425 | 3300025914 | Bacteria | 686 |
| 480 | Ga0207693_10013985 | 3300025915 | Bacteria | 6463 |
| 481 | Ga0207693_10041374 | 3300025915 | Bacteria | 3627 |
| 482 | Ga0207693_10306622 | 3300025915 | Bacteria | 1243 |
| 483 | Ga0207693_10487333 | 3300025915 | Bacteria | 963 |
| 484 | Ga0207693_11121217 | 3300025915 | Bacteria | 597 |
| 485 | Ga0207663_10002010 | 3300025916 | Bacteria | 9659 |
| 486 | Ga0207663_10002313 | 3300025916 | Bacteria | 9131 |
| 487 | Ga0207663_10691243 | 3300025916 | Bacteria | 807 |
| 488 | Ga0207663_10855896 | 3300025916 | Bacteria | 726 |
| 489 | Ga0207663_11206933 | 3300025916 | Bacteria | 609 |
| 490 | Ga0207660_10212059 | 3300025917 | Bacteria | 1517 |
| 491 | Ga0207660_10252814 | 3300025917 | Bacteria | 1391 |
| 492 | Ga0207660_10577195 | 3300025917 | Bacteria | 915 |
| 493 | Ga0207660_10772991 | 3300025917 | Bacteria | 784 |
| 494 | Ga0207660_11055168 | 3300025917 | Bacteria | 662 |
| 495 | Ga0207657_10009199 | 3300025919 | Bacteria | 9962 |
| 496 | Ga0207657_10085378 | 3300025919 | Bacteria | 2644 |
| 497 | Ga0207657_10125436 | 3300025919 | Bacteria | 2109 |
| 498 | Ga0207657_10700502 | 3300025919 | Bacteria | 787 |
| 499 | Ga0207649_10043126 | 3300025920 | Bacteria | 2756 |
| 500 | Ga0207649_10079206 | 3300025920 | Bacteria | 2122 |
| 501 | Ga0207649_10398824 | 3300025920 | Bacteria | 1029 |
| 502 | Ga0207649_10931210 | 3300025920 | Bacteria | 682 |
| 503 | Ga0207652_10005095 | 3300025921 | Bacteria | 10662 |
| 504 | Ga0207652_10254405 | 3300025921 | Bacteria | 1584 |
| 505 | Ga0207652_10881376 | 3300025921 | Bacteria | 791 |
| 506 | Ga0207681_10194374 | 3300025923 | Bacteria | 1554 |
| 507 | Ga0207694_10000640 | 3300025924 | Bacteria | 31572 |
| 508 | Ga0207694_10134093 | 3300025924 | Bacteria | 1987 |
| 509 | Ga0207694_10459084 | 3300025924 | Bacteria | 1064 |
| 510 | Ga0207694_10602344 | 3300025924 | Bacteria | 924 |
| 511 | Ga0207694_10707534 | 3300025924 | Unclassified | 850 |
| 512 | Ga0207694_10729523 | 3300025924 | Bacteria | 836 |
| 513 | Ga0207650_10873091 | 3300025925 | Bacteria | 763 |
| 514 | Ga0207659_10491751 | 3300025926 | Bacteria | 1038 |
| 515 | Ga0207687_10554607 | 3300025927 | Bacteria | 964 |
| 516 | Ga0207687_10578300 | 3300025927 | Bacteria | 945 |
| 517 | Ga0207687_11009816 | 3300025927 | Bacteria | 713 |
| 518 | Ga0207687_11790879 | 3300025927 | Bacteria | 526 |
| 519 | Ga0207700_10022317 | 3300025928 | Bacteria | 4342 |
| 520 | Ga0207700_10174459 | 3300025928 | Bacteria | 1796 |
| 521 | Ga0207700_10256614 | 3300025928 | Bacteria | 1495 |
| 522 | Ga0207700_10367183 | 3300025928 | Bacteria | 1256 |
| 523 | Ga0207700_10446643 | 3300025928 | Bacteria | 1139 |
| 524 | Ga0207664_10055917 | 3300025929 | Bacteria | 3132 |
| 525 | Ga0207664_10119959 | 3300025929 | Bacteria | 2199 |
| 526 | Ga0207664_10475362 | 3300025929 | Bacteria | 1117 |
| 527 | Ga0207644_10163491 | 3300025931 | Bacteria | 1732 |
| 528 | Ga0207644_10277151 | 3300025931 | Bacteria | 1346 |
| 529 | Ga0207644_10507726 | 3300025931 | Unclassified | 995 |
| 530 | Ga0207690_10890636 | 3300025932 | Bacteria | 738 |
| 531 | Ga0207690_10959011 | 3300025932 | Bacteria | 711 |
| 532 | Ga0207706_10058421 | 3300025933 | Bacteria | 3397 |
| 533 | Ga0207706_11100858 | 3300025933 | Bacteria | 664 |
| 534 | Ga0207709_10065653 | 3300025935 | Bacteria | 2283 |
| 535 | Ga0207709_10184702 | 3300025935 | Bacteria | 1475 |
| 536 | Ga0207709_11478805 | 3300025935 | Bacteria | 563 |
| 537 | Ga0207709_11530521 | 3300025935 | Bacteria | 554 |
| 538 | Ga0207670_11360322 | 3300025936 | Bacteria | 603 |
| 539 | Ga0207669_10070854 | 3300025937 | Bacteria | 2187 |
| 540 | Ga0207669_10076801 | 3300025937 | Bacteria | 2122 |
| 541 | Ga0207669_10658254 | 3300025937 | Bacteria | 857 |
| 542 | Ga0207669_11534020 | 3300025937 | Bacteria | 568 |
| 543 | Ga0207704_10557315 | 3300025938 | Bacteria | 932 |
| 544 | Ga0207704_11119926 | 3300025938 | Bacteria | 669 |
| 545 | Ga0207665_10041850 | 3300025939 | Bacteria | 3062 |
| 546 | Ga0207665_10120497 | 3300025939 | Bacteria | 1853 |
| 547 | Ga0207665_10252968 | 3300025939 | Bacteria | 1302 |
| 548 | Ga0207665_10472413 | 3300025939 | Bacteria | 965 |
| 549 | Ga0207665_10731091 | 3300025939 | Bacteria | 779 |
| 550 | Ga0207665_10959934 | 3300025939 | Bacteria | 679 |
| 551 | Ga0207665_11589355 | 3300025939 | Bacteria | 519 |
| 552 | Ga0207711_10563029 | 3300025941 | Bacteria | 1063 |
| 553 | Ga0207711_10697783 | 3300025941 | Bacteria | 947 |
| 554 | Ga0207689_10309853 | 3300025942 | Bacteria | 1309 |
| 555 | Ga0207689_10380514 | 3300025942 | Bacteria | 1175 |
| 556 | Ga0207661_10374944 | 3300025944 | Bacteria | 1287 |
| 557 | Ga0207679_11700178 | 3300025945 | Bacteria | 577 |
| 558 | Ga0207667_10012446 | 3300025949 | Bacteria | 9802 |
| 559 | Ga0207667_10021203 | 3300025949 | Bacteria | 7203 |
| 560 | Ga0207667_10041398 | 3300025949 | Bacteria | 4899 |
| 561 | Ga0207667_10101350 | 3300025949 | Bacteria | 2970 |
| 562 | Ga0207667_10284556 | 3300025949 | Bacteria | 1689 |
| 563 | Ga0207667_11512159 | 3300025949 | Bacteria | 642 |
| 564 | Ga0207651_10452497 | 3300025960 | Bacteria | 1102 |
| 565 | Ga0207651_10626538 | 3300025960 | Bacteria | 942 |
| 566 | Ga0207712_11345624 | 3300025961 | Bacteria | 639 |
| 567 | Ga0207712_11489807 | 3300025961 | Bacteria | 606 |
| 568 | Ga0207668_10077889 | 3300025972 | Bacteria | 2392 |
| 569 | Ga0207668_10087260 | 3300025972 | Bacteria | 2281 |
| 570 | Ga0207668_11073236 | 3300025972 | Bacteria | 721 |
| 571 | Ga0207668_11521347 | 3300025972 | Bacteria | 604 |
| 572 | Ga0207668_11759665 | 3300025972 | Bacteria | 559 |
| 573 | Ga0207640_10010628 | 3300025981 | Bacteria | 5191 |
| 574 | Ga0207640_10024190 | 3300025981 | Bacteria | 3661 |
| 575 | Ga0207640_10035195 | 3300025981 | Bacteria | 3132 |
| 576 | Ga0207640_10275383 | 3300025981 | Bacteria | 1319 |
| 577 | Ga0207640_10404024 | 3300025981 | Bacteria | 1113 |
| 578 | Ga0207640_10570080 | 3300025981 | Bacteria | 954 |
| 579 | Ga0207640_11320264 | 3300025981 | Bacteria | 644 |
| 580 | Ga0207658_10100841 | 3300025986 | Bacteria | 2261 |
| 581 | Ga0207658_10143622 | 3300025986 | Bacteria | 1935 |
| 582 | Ga0207658_10594233 | 3300025986 | Bacteria | 994 |
| 583 | Ga0207677_10312120 | 3300026023 | Bacteria | 1303 |
| 584 | Ga0207677_11482782 | 3300026023 | Bacteria | 626 |
| 585 | Ga0207703_10194599 | 3300026035 | Bacteria | 1798 |
| 586 | Ga0207703_10714751 | 3300026035 | Bacteria | 953 |
| 587 | Ga0207703_11273723 | 3300026035 | Bacteria | 707 |
| 588 | Ga0207639_10052968 | 3300026041 | Bacteria | 3094 |
| 589 | Ga0207639_10174315 | 3300026041 | Bacteria | 1824 |
| 590 | Ga0207639_10245388 | 3300026041 | Bacteria | 1559 |
| 591 | Ga0207639_10292854 | 3300026041 | Bacteria | 1436 |
| 592 | Ga0207639_10311621 | 3300026041 | Bacteria | 1394 |
| 593 | Ga0207639_10333323 | 3300026041 | Bacteria | 1351 |
| 594 | Ga0207639_10502162 | 3300026041 | Bacteria | 1108 |
| 595 | Ga0207639_11206571 | 3300026041 | Bacteria | 710 |
| 596 | Ga0207639_11277243 | 3300026041 | Bacteria | 689 |
| 597 | Ga0207678_10042283 | 3300026067 | Bacteria | 3949 |
| 598 | Ga0207678_10075869 | 3300026067 | Bacteria | 2880 |
| 599 | Ga0207678_10097040 | 3300026067 | Bacteria | 2519 |
| 600 | Ga0207678_10200354 | 3300026067 | Bacteria | 1707 |
| 601 | Ga0207678_10201488 | 3300026067 | Bacteria | 1702 |
| 602 | Ga0207678_10489075 | 3300026067 | Bacteria | 1072 |
| 603 | Ga0207678_10611270 | 3300026067 | Bacteria | 956 |
| 604 | Ga0207678_11475109 | 3300026067 | Bacteria | 601 |
| 605 | Ga0207708_10068850 | 3300026075 | Bacteria | 2709 |
| 606 | Ga0207708_10394649 | 3300026075 | Bacteria | 1143 |
| 607 | Ga0207702_10000005 | 3300026078 | Bacteria | 420296 |
| 608 | Ga0207702_10000433 | 3300026078 | Bacteria | 47747 |
| 609 | Ga0207702_10020902 | 3300026078 | Bacteria | 5416 |
| 610 | Ga0207702_10194951 | 3300026078 | Bacteria | 1874 |
| 611 | Ga0207702_10300203 | 3300026078 | Bacteria | 1524 |
| 612 | Ga0207702_10990543 | 3300026078 | Bacteria | 834 |
| 613 | Ga0207702_11064745 | 3300026078 | Bacteria | 802 |
| 614 | Ga0207702_11880475 | 3300026078 | Bacteria | 590 |
| 615 | Ga0207702_11897168 | 3300026078 | Bacteria | 587 |
| 616 | Ga0207641_10588933 | 3300026088 | Bacteria | 1088 |
| 617 | Ga0207641_10625206 | 3300026088 | Bacteria | 1056 |
| 618 | Ga0207641_11650193 | 3300026088 | Bacteria | 643 |
| 619 | Ga0207648_10095272 | 3300026089 | Bacteria | 2603 |
| 620 | Ga0207648_11856729 | 3300026089 | Bacteria | 564 |
| 621 | Ga0207676_10137053 | 3300026095 | Bacteria | 2090 |
| 622 | Ga0207676_10550371 | 3300026095 | Bacteria | 1102 |
| 623 | Ga0207674_10025823 | 3300026116 | Bacteria | 6254 |
| 624 | Ga0207674_10233451 | 3300026116 | Bacteria | 1787 |
| 625 | Ga0207674_10338901 | 3300026116 | Bacteria | 1454 |
| 626 | Ga0207674_10910219 | 3300026116 | Bacteria | 848 |
| 627 | Ga0207675_100163882 | 3300026118 | Bacteria | 2122 |
| 628 | Ga0207683_10008058 | 3300026121 | Bacteria | 9009 |
| 629 | Ga0207683_10046111 | 3300026121 | Bacteria | 3813 |
| 630 | Ga0207683_10106690 | 3300026121 | Bacteria | 2505 |
| 631 | Ga0207683_10707076 | 3300026121 | Bacteria | 934 |
| 632 | Ga0207683_10900659 | 3300026121 | Bacteria | 821 |
| 633 | Ga0207683_10944610 | 3300026121 | Bacteria | 801 |
| 634 | Ga0207698_10583589 | 3300026142 | Bacteria | 1100 |
| 635 | Ga0207698_10749213 | 3300026142 | Bacteria | 975 |
| 636 | Ga0207698_10852498 | 3300026142 | Bacteria | 916 |
| 637 | Ga0207698_12713805 | 3300026142 | Bacteria | 504 |
| 638 | Ga0209589_1000030 | 3300027357 | Bacteria | 147457 |
| 639 | Ga0209489_100056 | 3300027361 | Bacteria | 147457 |
| 640 | Ga0209700_100059 | 3300027363 | Bacteria | 147457 |
| 641 | Ga0209179_1004966 | 3300027512 | Bacteria | 2048 |
| 642 | Ga0209179_1017500 | 3300027512 | Bacteria | 1359 |
| 643 | Ga0209588_1079584 | 3300027671 | Bacteria | 1059 |
| 644 | Ga0209588_1183741 | 3300027671 | Bacteria | 655 |
| 645 | Ga0209813_10132975 | 3300027866 | Bacteria | 877 |
| 646 | Ga0207428_10772282 | 3300027907 | Bacteria | 684 |
| 647 | Ga0268266_10232069 | 3300028379 | Bacteria | 1700 |
| 648 | Ga0268266_10360838 | 3300028379 | Bacteria | 1367 |
| 649 | Ga0268266_10807257 | 3300028379 | Bacteria | 906 |
| 650 | Ga0268266_11254070 | 3300028379 | Bacteria | 716 |
| 651 | Ga0268266_11348623 | 3300028379 | Bacteria | 689 |
| 652 | Ga0268266_11649498 | 3300028379 | Bacteria | 617 |
| 653 | Ga0268266_11726338 | 3300028379 | Bacteria | 601 |
| 654 | Ga0268265_10478508 | 3300028380 | Bacteria | 1169 |
| 655 | Ga0268265_10684147 | 3300028380 | Bacteria | 989 |
| 656 | Ga0268264_10924040 | 3300028381 | Unclassified | 877 |
| 657 | Ga0268264_11234764 | 3300028381 | Bacteria | 757 |
| 658 | Ga0307517_10000125 | 3300028786 | Bacteria | 115466 |
| 659 | Ga0307515_10055660 | 3300028794 | Bacteria | 5773 |
| 660 | Ga0307515_10163776 | 3300028794 | Bacteria | 2253 |
| 661 | Ga0265338_10173830 | 3300028800 | Bacteria | 1649 |
| 662 | Ga0265330_10025197 | 3300031235 | Bacteria | 2697 |
| 663 | Ga0265330_10061925 | 3300031235 | Bacteria | 1627 |
| 664 | Ga0265332_10037612 | 3300031238 | Bacteria | 2098 |
| 665 | Ga0265328_10095601 | 3300031239 | Bacteria | 1098 |
| 666 | Ga0265328_10263380 | 3300031239 | Bacteria | 661 |
| 667 | Ga0265329_10289463 | 3300031242 | Bacteria | 552 |
| 668 | Ga0265340_10012295 | 3300031247 | Bacteria | 4523 |
| 669 | Ga0265339_10003767 | 3300031249 | Bacteria | 10572 |
| 670 | Ga0265339_10492337 | 3300031249 | Bacteria | 567 |
| 671 | Ga0265331_10130333 | 3300031250 | Bacteria | 1147 |
| 672 | Ga0265331_10253617 | 3300031250 | Bacteria | 789 |
| 673 | Ga0265316_10180062 | 3300031344 | Bacteria | 1574 |
| 674 | Ga0265316_10397324 | 3300031344 | Bacteria | 993 |
| 675 | Ga0307513_10246201 | 3300031456 | Bacteria | 1588 |
| 676 | Ga0307509_10429566 | 3300031507 | Bacteria | 1020 |
| 677 | Ga0307408_100750454 | 3300031548 | Bacteria | 881 |
| 678 | Ga0265313_10333725 | 3300031595 | Bacteria | 604 |
| 679 | Ga0307508_10055655 | 3300031616 | Bacteria | 3503 |
| 680 | Ga0307508_10128819 | 3300031616 | Bacteria | 2134 |
| 681 | Ga0265314_10001745 | 3300031711 | Bacteria | 23545 |
| 682 | Ga0265314_10070770 | 3300031711 | Bacteria | 2336 |
| 683 | Ga0265314_10175562 | 3300031711 | Bacteria | 1289 |
| 684 | Ga0265342_10107254 | 3300031712 | Bacteria | 1584 |
| 685 | Ga0265342_10364779 | 3300031712 | Bacteria | 750 |
| 686 | Ga0307516_10018995 | 3300031730 | Bacteria | 7133 |
| 687 | Ga0307516_10513343 | 3300031730 | Bacteria | 852 |
| 688 | Ga0307516_10546770 | 3300031730 | Bacteria | 812 |
| 689 | Ga0307516_10707194 | 3300031730 | Bacteria | 665 |
| 690 | Ga0307405_11235505 | 3300031731 | Bacteria | 648 |
| 691 | Ga0307406_10248824 | 3300031901 | Bacteria | 1338 |
| 692 | Ga0307412_10052533 | 3300031911 | Bacteria | 2699 |
| 693 | Ga0307412_10301259 | 3300031911 | Bacteria | 1267 |
| 694 | Ga0307416_100217519 | 3300032002 | Bacteria | 1829 |
| 695 | Ga0307416_100959145 | 3300032002 | Bacteria | 957 |
| 696 | Ga0307411_10904363 | 3300032005 | Bacteria | 784 |
| 697 | Ga0307415_100053891 | 3300032126 | Bacteria | 2743 |
| 698 | Ga0307415_100499764 | 3300032126 | Bacteria | 1063 |
| 699 | Ga0307415_101120864 | 3300032126 | Bacteria | 738 |
| 700 | Ga0307510_10107608 | 3300033180 | Bacteria | 2546 |
| 701 | Ga0307510_10120976 | 3300033180 | Bacteria | 2323 |
| 702 | Ga0307510_10540196 | 3300033180 | Bacteria | 611 |
| 703 | Ga0373930_0038412 | 3300034816 | Bacteria | 1011 |
| 704 | Ga0373958_0036881 | 3300034819 | Bacteria | 984 |
| 705 | Ga0373938_0230309 | 3300034957 | Bacteria | 523 |
| 706 | Ga0373926_0141580 | 3300035083 | Bacteria | 914 |
| 707 | Ga0373926_0318413 | 3300035083 | Bacteria | 608 |
| 708 | Ga0373928_0236558 | 3300035084 | Bacteria | 539 |
| 709 | Ga0373929_0092984 | 3300035085 | Bacteria | 751 |
| 710 | Ga0373934_0073895 | 3300035086 | Bacteria | 1365 |
| 711 | Ga0373934_0133542 | 3300035086 | Bacteria | 1013 |
| 712 | Ga0373934_0411152 | 3300035086 | Bacteria | 566 |
| 713 | Ga0373940_0035284 | 3300035088 | Bacteria | 1353 |
| 714 | Ga0373944_0105233 | 3300035089 | Bacteria | 958 |
| 715 | Ga0373923_0004696 | 3300035111 | Bacteria | 4557 |
| 716 | Ga0373923_0036190 | 3300035111 | Bacteria | 2014 |
| 717 | Ga0373941_0307231 | 3300035115 | Bacteria | 635 |
| 718 | Ga0373945_0010983 | 3300035116 | Bacteria | 2988 |
| 719 | Ga0373953_0000463 | 3300035117 | Bacteria | 11171 |
| 720 | Ga0373953_0180656 | 3300035117 | Bacteria | 910 |
| 721 | Ga0373954_0000100 | 3300035118 | Bacteria | 28999 |
| 722 | Ga0373954_0014263 | 3300035118 | Bacteria | 3544 |
| 723 | Ga0373954_0495116 | 3300035118 | Bacteria | 605 |
| 724 | Ga0373956_0019223 | 3300035119 | Bacteria | 2897 |
| 725 | Ga0373957_0001114 | 3300035120 | Bacteria | 7128 |
| 726 | Ga0373943_0004760 | 3300035170 | Bacteria | 6139 |
| 727 | Ga0373943_0136905 | 3300035170 | Bacteria | 1316 |
| 728 | Ga0373946_0130797 | 3300035171 | Bacteria | 1154 |
| 729 | Ga0373946_0584415 | 3300035171 | Bacteria | 578 |
| 730 | Ga0373955_0010060 | 3300035172 | Bacteria | 4452 |
| 731 | Ga0373955_0127201 | 3300035172 | Bacteria | 1485 |
| 732 | Ga0373962_0036173 | 3300035242 | Bacteria | 1374 |
| 733 | Ga0373962_0060465 | 3300035242 | Bacteria | 1112 |
| 734 | Ga0373924_0013364 | 3300035410 | Bacteria | 3084 |
| 735 | Ga0373931_0001608 | 3300035691 | Bacteria | 9778 |
| 736 | Ga0373935_0004029 | 3300035692 | Bacteria | 8588 |
| 737 | Ga0373935_1372752 | 3300035692 | Bacteria | 528 |
| 738 | Ga0373935_1382231 | 3300035692 | Bacteria | 526 |
| 739 | Ga0373927_0001617 | 3300035695 | Bacteria | 16890 |
| 740 | Ga0373927_0014401 | 3300035695 | Bacteria | 5236 |
| 741 | Ga0373927_0538974 | 3300035695 | Bacteria | 771 |
| 742 | Ga0373933_0001041 | 3300035724 | Bacteria | 16838 |
| 743 | Ga0373933_0340258 | 3300035724 | Bacteria | 974 |
| 744 | Ga0373933_1007008 | 3300035724 | Bacteria | 549 |
| 745 | Ga0373947_0004404 | 3300035725 | Bacteria | 8259 |
| 746 | Ga0373947_0032215 | 3300035725 | Bacteria | 3088 |
| 747 | Ga0373937_0005062 | 3300036401 | Bacteria | 11219 |
| 748 | Ga0373937_0389086 | 3300036401 | Bacteria | 1323 |
| 749 | Ga0373937_0588556 | 3300036401 | Bacteria | 1056 |
| 750 | Ga0373937_0790140 | 3300036401 | Bacteria | 897 |
| 751 | Ga0373937_1017379 | 3300036401 | Bacteria | 777 |
| 752 | Ga0372808_000421 | 3300036459 | Bacteria | 3273 |
| 753 | Ga0373925_0002598 | 3300037068 | Bacteria | 14354 |
| 754 | Ga0373925_0779909 | 3300037068 | Bacteria | 788 |
| 755 | Ga0373925_1588926 | 3300037068 | Bacteria | 535 |
| 756 | Ga0395899_0108428 | 3300037312 | Bacteria | 1998 |
| 757 | Ga0395899_0557658 | 3300037312 | Bacteria | 735 |
| 758 | Ga0395899_0967895 | 3300037312 | Bacteria | 515 |
| 759 | Ga0395900_0002106 | 3300037418 | Bacteria | 22287 |
| 760 | Ga0395900_0158896 | 3300037418 | Bacteria | 2307 |
| 761 | Ga0395900_0244986 | 3300037418 | Bacteria | 1796 |
| 762 | Ga0395900_0289829 | 3300037418 | Bacteria | 1626 |
| 763 | Ga0395900_0469775 | 3300037418 | Bacteria | 1211 |
| 764 | Ga0395900_1172711 | 3300037418 | Bacteria | 684 |
| 765 | Ga0395898_0003923 | 3300037466 | Bacteria | 16417 |
| 766 | Ga0395898_0199944 | 3300037466 | Bacteria | 1908 |
| 767 | Ga0395898_0212749 | 3300037466 | Bacteria | 1844 |
| 768 | Ga0395898_0249329 | 3300037466 | Bacteria | 1693 |
| 769 | Ga0395898_0306631 | 3300037466 | Bacteria | 1514 |
| 770 | Ga0395905_0066254 | 3300037471 | Bacteria | 3382 |
| 771 | Ga0395905_0403856 | 3300037471 | Bacteria | 1261 |
| 772 | Ga0395905_0890155 | 3300037471 | Bacteria | 793 |
| 773 | Ga0436364_0344445 | 3300037853 | Bacteria | 791 |
| 774 | Ga0436364_0626210 | 3300037853 | Bacteria | 870 |
| 775 | Ga0436364_0651896 | 3300037853 | Bacteria | 1528 |
| 776 | Ga0436364_1050259 | 3300037853 | Bacteria | 2335 |
| 777 | Ga0395901_0032684 | 3300038443 | Bacteria | 5366 |
| 778 | Ga0395901_0298980 | 3300038443 | Bacteria | 1669 |
| 779 | Ga0395901_0353548 | 3300038443 | Bacteria | 1516 |
| 780 | Ga0395901_0467589 | 3300038443 | Bacteria | 1288 |
| 781 | Ga0395901_0665552 | 3300038443 | Bacteria | 1043 |
| 782 | Ga0395901_0867720 | 3300038443 | Bacteria | 886 |
| 783 | Ga0395901_1427702 | 3300038443 | Bacteria | 650 |
| 784 | Ga0436365_0992198 | 3300039437 | Bacteria | 1174 |
| 785 | Ga0436365_1078347 | 3300039437 | Bacteria | 637 |
| 786 | Ga0436365_1157227 | 3300039437 | Bacteria | 1481 |
| 787 | Ga0436365_1195892 | 3300039437 | Bacteria | 695 |
| 788 | Ga0436365_1424718 | 3300039437 | Bacteria | 3347 |
| 789 | Ga0436365_1555241 | 3300039437 | Bacteria | 942 |
| 790 | Ga0436365_1647844 | 3300039437 | Bacteria | 1993 |
| 791 | Ga0436365_1732278 | 3300039437 | Bacteria | 534 |
| 792 | Ga0436360_1371031 | 3300039438 | Bacteria | 820 |
| 793 | Ga0436363_0206535 | 3300039450 | Bacteria | 539 |
| 794 | Ga0436363_1215029 | 3300039450 | Bacteria | 891 |
| 795 | Ga0436363_1432430 | 3300039450 | Bacteria | 629 |
| 796 | Ga0436363_1589976 | 3300039450 | Bacteria | 1320 |
| 797 | Ga0439465_0407873 | 3300041413 | Bacteria | 518 |
| 798 | Ga0451793_0327457 | 3300041452 | Bacteria | 531 |
| 799 | Ga0451795_1651510 | 3300041456 | Bacteria | 578 |
| 800 | Ga0451800_1312593 | 3300041459 | Bacteria | 695 |
| 801 | Ga0451802_1094405 | 3300041460 | Bacteria | 969 |
| 802 | Ga0451833_0594095 | 3300041491 | Bacteria | 626 |
| 803 | Ga0451833_0727547 | 3300041491 | Bacteria | 521 |
| 804 | Ga0451837_1227548 | 3300041494 | Bacteria | 646 |
| 805 | Ga0451839_0688458 | 3300041496 | Bacteria | 502 |
| 806 | Ga0451839_1243053 | 3300041496 | Bacteria | 613 |
| 807 | Ga0451853_3366637 | 3300041512 | Bacteria | 863 |
| 808 | Ga0439459_0038845 | 3300042438 | Bacteria | 1003 |
| 809 | Ga0466969_0018365 | 3300044656 | Bacteria | 3644 |
| 810 | Ga0466972_0000156 | 3300044658 | Bacteria | 55040 |
| 811 | Ga0466972_0366117 | 3300044658 | Bacteria | 675 |
| 812 | Ga0466966_0001022 | 3300044684 | Bacteria | 17884 |
| 813 | Ga0466961_0000338 | 3300044693 | Bacteria | 30740 |
| 814 | Ga0466961_0128563 | 3300044693 | Bacteria | 1588 |
| 815 | Ga0466963_0023740 | 3300044694 | Bacteria | 3898 |
| 816 | Ga0466964_0278399 | 3300044706 | Bacteria | 835 |
| 817 | Ga0466970_0146132 | 3300044765 | Bacteria | 1304 |
| 818 | Ga0466970_0767049 | 3300044765 | Bacteria | 564 |
| 819 | Ga0466957_0130623 | 3300044842 | Bacteria | 1609 |
| 820 | Ga0466957_0149405 | 3300044842 | Bacteria | 1510 |
| 821 | Ga0466957_0202595 | 3300044842 | Bacteria | 1304 |
| 822 | Ga0466959_0016981 | 3300045049 | Bacteria | 5327 |
| 823 | Ga0466959_0585822 | 3300045049 | Bacteria | 751 |
| 824 | Ga0466959_0792666 | 3300045049 | Bacteria | 634 |
| 825 | Ga0466958_0075935 | 3300045836 | Bacteria | 2062 |
| 826 | Ga0466967_0047812 | 3300045976 | Bacteria | 3732 |
| 827 | Ga0466967_0094054 | 3300045976 | Bacteria | 2728 |
| 828 | Ga0466967_0125493 | 3300045976 | Bacteria | 2377 |
| 829 | Ga0466967_0127173 | 3300045976 | Bacteria | 2362 |
| 830 | Ga0495617_243007 | 3300046452 | Bacteria | 556 |
| 831 | Ga0495592_0001413 | 3300046454 | Bacteria | 16659 |
| 832 | Ga0495592_0014218 | 3300046454 | Bacteria | 6047 |
| 833 | Ga0495592_0031368 | 3300046454 | Bacteria | 4017 |
| 834 | Ga0495603_0000660 | 3300046455 | Bacteria | 19483 |
| 835 | Ga0495603_0028560 | 3300046455 | Bacteria | 3365 |
| 836 | Ga0495603_0054333 | 3300046455 | Bacteria | 2374 |
| 837 | Ga0495603_0075202 | 3300046455 | Bacteria | 1983 |
| 838 | Ga0495590_0224292 | 3300046457 | Bacteria | 695 |
| 839 | Ga0495629_0000467 | 3300046459 | Bacteria | 33859 |
| 840 | Ga0495629_0002123 | 3300046459 | Bacteria | 15363 |
| 841 | Ga0495629_0225543 | 3300046459 | Bacteria | 1292 |
| 842 | Ga0495629_0330702 | 3300046459 | Bacteria | 1041 |
| 843 | Ga0495638_0012737 | 3300046460 | Bacteria | 5749 |
| 844 | Ga0495638_0040822 | 3300046460 | Bacteria | 2938 |
| 845 | Ga0495641_0007394 | 3300046461 | Bacteria | 6867 |
| 846 | Ga0495641_0584011 | 3300046461 | Bacteria | 511 |
| 847 | Ga0495651_0000990 | 3300046462 | Bacteria | 22041 |
| 848 | Ga0495651_0002095 | 3300046462 | Bacteria | 15390 |
| 849 | Ga0495651_0149571 | 3300046462 | Bacteria | 1685 |
| 850 | Ga0495653_0000149 | 3300046463 | Bacteria | 58288 |
| 851 | Ga0495650_0156834 | 3300046471 | Bacteria | 814 |
| 852 | Ga0495650_0314071 | 3300046471 | Bacteria | 523 |
| 853 | Ga0495580_0003995 | 3300046472 | Bacteria | 12443 |
| 854 | Ga0495582_0000163 | 3300046473 | Bacteria | 35979 |
| 855 | Ga0495605_0151716 | 3300046474 | Bacteria | 1034 |
| 856 | Ga0495639_0000640 | 3300046475 | Bacteria | 16156 |
| 857 | Ga0495639_0025777 | 3300046475 | Bacteria | 2594 |
| 858 | Ga0495662_0000890 | 3300046476 | Bacteria | 14606 |
| 859 | Ga0495662_0372646 | 3300046476 | Bacteria | 701 |
| 860 | Ga0495662_0528146 | 3300046476 | Bacteria | 578 |
| 861 | Ga0495664_0008332 | 3300046477 | Bacteria | 5781 |
| 862 | Ga0495664_0197730 | 3300046477 | Bacteria | 1218 |
| 863 | Ga0495664_0247954 | 3300046477 | Bacteria | 1077 |
| 864 | Ga0495594_0001989 | 3300046499 | Bacteria | 10649 |
| 865 | Ga0495594_0285770 | 3300046499 | Bacteria | 940 |
| 866 | Ga0495596_0078141 | 3300046500 | Bacteria | 1285 |
| 867 | Ga0495596_0185530 | 3300046500 | Bacteria | 809 |
| 868 | Ga0495596_0214352 | 3300046500 | Bacteria | 748 |
| 869 | Ga0495596_0218561 | 3300046500 | Bacteria | 740 |
| 870 | Ga0495583_0032139 | 3300046506 | Bacteria | 2536 |
| 871 | Ga0495606_0001450 | 3300046507 | Bacteria | 31779 |
| 872 | Ga0495606_0006099 | 3300046507 | Bacteria | 11253 |
| 873 | Ga0495606_0080671 | 3300046507 | Bacteria | 2024 |
| 874 | Ga0495608_0005251 | 3300046511 | Bacteria | 9254 |
| 875 | Ga0495608_0015229 | 3300046511 | Bacteria | 5335 |
| 876 | Ga0495608_0755070 | 3300046511 | Bacteria | 576 |
| 877 | Ga0495616_0315095 | 3300046513 | Bacteria | 658 |
| 878 | Ga0495618_0086712 | 3300046514 | Bacteria | 2002 |
| 879 | Ga0495620_0044299 | 3300046515 | Bacteria | 1934 |
| 880 | Ga0495620_0093678 | 3300046515 | Bacteria | 1203 |
| 881 | Ga0495620_0187272 | 3300046515 | Bacteria | 799 |
| 882 | Ga0495628_0010023 | 3300046516 | Bacteria | 8062 |
| 883 | Ga0495628_0020141 | 3300046516 | Bacteria | 5505 |
| 884 | Ga0495628_0765819 | 3300046516 | Bacteria | 677 |
| 885 | Ga0495630_0002387 | 3300046517 | Bacteria | 13052 |
| 886 | Ga0495630_0345867 | 3300046517 | Bacteria | 1138 |
| 887 | Ga0495630_1030519 | 3300046517 | Bacteria | 625 |
| 888 | Ga0495632_0274356 | 3300046519 | Bacteria | 752 |
| 889 | Ga0495637_0016691 | 3300046520 | Bacteria | 3431 |
| 890 | Ga0495643_0112755 | 3300046522 | Bacteria | 1381 |
| 891 | Ga0495644_0065593 | 3300046523 | Bacteria | 1364 |
| 892 | Ga0495648_0007574 | 3300046524 | Bacteria | 8674 |
| 893 | Ga0495648_0106109 | 3300046524 | Bacteria | 1539 |
| 894 | Ga0495648_0111854 | 3300046524 | Bacteria | 1484 |
| 895 | Ga0495648_0146487 | 3300046524 | Bacteria | 1237 |
| 896 | Ga0495666_0021596 | 3300046526 | Bacteria | 3186 |
| 897 | Ga0495652_0005306 | 3300046529 | Bacteria | 12152 |
| 898 | Ga0495652_0023393 | 3300046529 | Bacteria | 5475 |
| 899 | Ga0495652_0209577 | 3300046529 | Bacteria | 1472 |
| 900 | Ga0495654_0012290 | 3300046530 | Bacteria | 4602 |
| 901 | Ga0495665_0000853 | 3300046531 | Bacteria | 15971 |
| 902 | Ga0495665_0040789 | 3300046531 | Bacteria | 2471 |
| 903 | Ga0495665_0604804 | 3300046531 | Bacteria | 548 |
| 904 | Ga0495640_0012917 | 3300046533 | Bacteria | 6366 |
| 905 | Ga0495640_0025937 | 3300046533 | Bacteria | 4244 |
| 906 | Ga0495640_0132066 | 3300046533 | Bacteria | 1615 |
| 907 | Ga0495586_0532602 | 3300046535 | Bacteria | 678 |
| 908 | Ga0495586_0702272 | 3300046535 | Bacteria | 584 |
| 909 | Ga0495587_0001665 | 3300046536 | Bacteria | 14832 |
| 910 | Ga0495587_0008004 | 3300046536 | Bacteria | 6825 |
| 911 | Ga0495598_0061283 | 3300046537 | Bacteria | 1161 |
| 912 | Ga0495645_0023487 | 3300046543 | Bacteria | 4465 |
| 913 | Ga0495645_0129803 | 3300046543 | Bacteria | 1767 |
| 914 | Ga0495622_0003281 | 3300046557 | Bacteria | 7654 |
| 915 | Ga0495622_0016304 | 3300046557 | Bacteria | 3458 |
| 916 | Ga0495622_0332677 | 3300046557 | Bacteria | 659 |
| 917 | Ga0495633_0236463 | 3300046558 | Bacteria | 835 |
| 918 | Ga0495667_0002267 | 3300046559 | Bacteria | 12880 |
| 919 | Ga0495667_0512475 | 3300046559 | Bacteria | 751 |
| 920 | Ga0495667_0698143 | 3300046559 | Bacteria | 629 |
| 921 | Ga0495667_0720396 | 3300046559 | Bacteria | 618 |
| 922 | Ga0495656_0054558 | 3300046615 | Bacteria | 1720 |
| 923 | Ga0495656_0150905 | 3300046615 | Bacteria | 1122 |
| 924 | Ga0495656_0356684 | 3300046615 | Bacteria | 759 |
| 925 | Ga0495668_0064412 | 3300046616 | Bacteria | 2018 |
| 926 | Ga0495668_0373714 | 3300046616 | Bacteria | 783 |
| 927 | Ga0495634_0001271 | 3300046642 | Bacteria | 23127 |
| 928 | Ga0495634_0117765 | 3300046642 | Bacteria | 1703 |
| 929 | Ga0495634_0212368 | 3300046642 | Bacteria | 1197 |
| 930 | Ga0495611_0054760 | 3300046648 | Bacteria | 1804 |
| 931 | Ga0495625_0226442 | 3300046660 | Bacteria | 1223 |
| 932 | Ga0495625_0421953 | 3300046660 | Bacteria | 829 |
| 933 | Ga0495625_0609923 | 3300046660 | Bacteria | 654 |
| 934 | Ga0495635_0001373 | 3300046663 | Bacteria | 16217 |
| 935 | Ga0495635_0015240 | 3300046663 | Bacteria | 5378 |
| 936 | Ga0495635_0036867 | 3300046663 | Bacteria | 3386 |
| 937 | Ga0495659_0030274 | 3300046664 | Bacteria | 1883 |
| 938 | Ga0495661_0057606 | 3300046665 | Bacteria | 2319 |
| 939 | Ga0495588_0027529 | 3300046674 | Bacteria | 2841 |
| 940 | Ga0495657_0000445 | 3300046675 | Bacteria | 38585 |
| 941 | Ga0495657_0001981 | 3300046675 | Bacteria | 17450 |
| 942 | Ga0495657_0186330 | 3300046675 | Bacteria | 1270 |
| 943 | Ga0495657_0267822 | 3300046675 | Bacteria | 1025 |
| 944 | Ga0495599_0000450 | 3300046678 | Bacteria | 23464 |
| 945 | Ga0495599_0318470 | 3300046678 | Bacteria | 936 |
| 946 | Ga0495599_0571704 | 3300046678 | Bacteria | 660 |
| 947 | Ga0495623_0006629 | 3300046679 | Bacteria | 7537 |
| 948 | Ga0495623_0062848 | 3300046679 | Bacteria | 2326 |
| 949 | Ga0495646_0003846 | 3300046680 | Bacteria | 9382 |
| 950 | Ga0495646_0006264 | 3300046680 | Bacteria | 7547 |
| 951 | Ga0495646_0063439 | 3300046680 | Bacteria | 2194 |
| 952 | Ga0495647_0014045 | 3300046681 | Bacteria | 2785 |
| 953 | Ga0495658_0000512 | 3300046683 | Bacteria | 21274 |
| 954 | Ga0495669_0021105 | 3300046684 | Bacteria | 2824 |
| 955 | Ga0495613_0002976 | 3300046689 | Bacteria | 12687 |
| 956 | Ga0495613_0040734 | 3300046689 | Bacteria | 3441 |
| 957 | Ga0495613_0085506 | 3300046689 | Bacteria | 2288 |
| 958 | Ga0495613_0467991 | 3300046689 | Bacteria | 852 |
| 959 | Ga0495624_0019094 | 3300046690 | Bacteria | 4579 |
| 960 | Ga0495624_0226569 | 3300046690 | Bacteria | 1133 |
| 961 | Ga0495670_0277176 | 3300046691 | Bacteria | 896 |
| 962 | Ga0495671_0044571 | 3300046692 | Bacteria | 2223 |
| 963 | Ga0495671_0341762 | 3300046692 | Bacteria | 718 |
| 964 | Ga0495649_0181182 | 3300046694 | Bacteria | 1099 |
| 965 | Ga0495649_0253821 | 3300046694 | Bacteria | 903 |
| 966 | Ga0495589_0028749 | 3300046794 | Bacteria | 2805 |
| 967 | Ga0495600_0000243 | 3300046809 | Bacteria | 30003 |
| 968 | Ga0495600_0001485 | 3300046809 | Bacteria | 13003 |
| 969 | Ga0495600_0136217 | 3300046809 | Bacteria | 1595 |
| 970 | Ga0495600_0676884 | 3300046809 | Bacteria | 622 |
| 971 | Ga0495660_0104445 | 3300046810 | Bacteria | 1454 |
| 972 | Ga0495581_0002361 | 3300047315 | Bacteria | 10645 |
| 973 | Ga0495581_0062660 | 3300047315 | Bacteria | 2149 |
| 974 | Ga0495604_0000525 | 3300047317 | Bacteria | 33842 |
| 975 | Ga0495604_0004201 | 3300047317 | Bacteria | 11413 |
| 976 | Ga0495636_0197309 | 3300047318 | Bacteria | 918 |
| 977 | Ga0495674_0013125 | 3300047319 | Bacteria | 7791 |
| 978 | Ga0495674_0038125 | 3300047319 | Bacteria | 4315 |
| 979 | Ga0495674_0071551 | 3300047319 | Bacteria | 2993 |
| 980 | Ga0495672_0012280 | 3300047320 | Bacteria | 5989 |
| 981 | Ga0495672_0059610 | 3300047320 | Bacteria | 2207 |
| 982 | Ga0495672_0128374 | 3300047320 | Bacteria | 1337 |
| 983 | Ga0495672_0166549 | 3300047320 | Bacteria | 1128 |
| 984 | Ga0495676_0035112 | 3300047321 | Bacteria | 4197 |
| 985 | Ga0495680_0000424 | 3300047322 | Bacteria | 47310 |
| 986 | Ga0495680_0003418 | 3300047322 | Bacteria | 15661 |
| 987 | Ga0495680_0122447 | 3300047322 | Bacteria | 1919 |
| 988 | Ga0495675_0024615 | 3300047444 | Bacteria | 3838 |
| 989 | Ga0495675_0060810 | 3300047444 | Bacteria | 2393 |
| 990 | Ga0495673_0086501 | 3300047469 | Bacteria | 1288 |
| 991 | Ga0495673_0191689 | 3300047469 | Bacteria | 769 |
| 992 | Ga0495673_0338943 | 3300047469 | Bacteria | 532 |
| 993 | Ga0495684_0001470 | 3300047471 | Bacteria | 18854 |
| 994 | Ga0495684_0045796 | 3300047471 | Bacteria | 3347 |
| 995 | Ga0495686_0027149 | 3300047472 | Bacteria | 3740 |
| 996 | Ga0495686_0186386 | 3300047472 | Bacteria | 1199 |
| 997 | Ga0495686_0262306 | 3300047472 | Bacteria | 967 |
| 998 | Ga0495593_0000331 | 3300047673 | Bacteria | 26196 |
| 999 | Ga0495593_0001055 | 3300047673 | Bacteria | 16149 |
| 1000 | Ga0495602_0001865 | 3300048088 | Bacteria | 21070 |
| 1001 | Ga0495602_0008889 | 3300048088 | Bacteria | 10474 |
| 1002 | Ga0495602_0527916 | 3300048088 | Bacteria | 821 |
| 1003 | Ga0495602_0594187 | 3300048088 | Bacteria | 762 |
| 1004 | Ga0495602_0784809 | 3300048088 | Bacteria | 641 |
| 1005 | Ga0495602_1036048 | 3300048088 | Bacteria | 540 |
| 1006 | Ga0495614_0011031 | 3300048089 | Bacteria | 3976 |
| 1007 | Ga0495614_0206206 | 3300048089 | Bacteria | 891 |
| 1008 | Ga0496100_0011680 | 3300048903 | Bacteria | 5005 |
| 1009 | Ga0496100_0110459 | 3300048903 | Bacteria | 1909 |
| 1010 | Ga0496100_0110464 | 3300048903 | Bacteria | 1909 |
| 1011 | Ga0496100_0727466 | 3300048903 | Bacteria | 775 |
| 1012 | Ga0496100_0754261 | 3300048903 | Bacteria | 761 |
| 1013 | Ga0496100_0949607 | 3300048903 | Bacteria | 676 |
| 1014 | Ga0496101_0009265 | 3300048904 | Bacteria | 6464 |
| 1015 | Ga0496101_0068709 | 3300048904 | Bacteria | 2591 |
| 1016 | Ga0496101_0193752 | 3300048904 | Bacteria | 1569 |
| 1017 | Ga0496101_0202769 | 3300048904 | Bacteria | 1534 |
| 1018 | Ga0496101_0470278 | 3300048904 | Bacteria | 992 |
| 1019 | Ga0496101_0715198 | 3300048904 | Bacteria | 791 |
| 1020 | Ga0496101_0938345 | 3300048904 | Bacteria | 681 |
| 1021 | Ga0496102_0022547 | 3300048905 | Bacteria | 5579 |
| 1022 | Ga0496102_0109205 | 3300048905 | Bacteria | 2577 |
| 1023 | Ga0496102_0159967 | 3300048905 | Bacteria | 2118 |
| 1024 | Ga0496102_0435555 | 3300048905 | Bacteria | 1231 |
| 1025 | Ga0496102_0547730 | 3300048905 | Bacteria | 1080 |
| 1026 | Ga0496102_0852909 | 3300048905 | Bacteria | 833 |
| 1027 | Ga0496102_0966253 | 3300048905 | Bacteria | 773 |
| 1028 | Ga0496103_0042036 | 3300048906 | Bacteria | 2811 |
| 1029 | Ga0496104_0011363 | 3300048907 | Bacteria | 7969 |
| 1030 | Ga0496104_0016078 | 3300048907 | Bacteria | 6791 |
| 1031 | Ga0496104_0019100 | 3300048907 | Bacteria | 6265 |
| 1032 | Ga0496104_0074254 | 3300048907 | Bacteria | 3237 |
| 1033 | Ga0496104_0161312 | 3300048907 | Bacteria | 2151 |
| 1034 | Ga0496105_0056294 | 3300048908 | Bacteria | 3246 |
| 1035 | Ga0496105_0080798 | 3300048908 | Bacteria | 2685 |
| 1036 | Ga0496105_0227235 | 3300048908 | Bacteria | 1517 |
| 1037 | Ga0496106_0004969 | 3300048909 | Bacteria | 9837 |
| 1038 | Ga0496106_0047169 | 3300048909 | Bacteria | 3241 |
| 1039 | Ga0496106_0144827 | 3300048909 | Bacteria | 1871 |
| 1040 | Ga0496107_0007254 | 3300048910 | Bacteria | 7638 |
| 1041 | Ga0496107_0031659 | 3300048910 | Bacteria | 3776 |
| 1042 | Ga0496107_0060235 | 3300048910 | Bacteria | 2747 |
| 1043 | Ga0496107_0586757 | 3300048910 | Bacteria | 824 |
| 1044 | Ga0496107_1353749 | 3300048910 | Bacteria | 508 |
| 1045 | Ga0496108_0001645 | 3300048911 | Bacteria | 17709 |
| 1046 | Ga0496108_0003899 | 3300048911 | Bacteria | 11982 |
| 1047 | Ga0496108_0171639 | 3300048911 | Bacteria | 1876 |
| 1048 | Ga0496108_0285441 | 3300048911 | Bacteria | 1437 |
| 1049 | Ga0496108_0463431 | 3300048911 | Bacteria | 1107 |
| 1050 | Ga0496109_0037994 | 3300048912 | Bacteria | 4351 |
| 1051 | Ga0496109_0103725 | 3300048912 | Bacteria | 2639 |
| 1052 | Ga0496109_0150576 | 3300048912 | Bacteria | 2178 |
| 1053 | Ga0496110_0006735 | 3300048913 | Bacteria | 9134 |
| 1054 | Ga0496110_0085956 | 3300048913 | Bacteria | 2807 |
| 1055 | Ga0496110_0495570 | 3300048913 | Bacteria | 1112 |
| 1056 | Ga0496110_0497908 | 3300048913 | Unclassified | 1109 |
| 1057 | Ga0496111_0107288 | 3300048914 | Bacteria | 2056 |
| 1058 | Ga0496111_0186395 | 3300048914 | Bacteria | 1542 |
| 1059 | Ga0496111_0268133 | 3300048914 | Bacteria | 1266 |
| 1060 | Ga0496111_0655654 | 3300048914 | Bacteria | 766 |
| 1061 | Ga0496111_0745204 | 3300048914 | Bacteria | 711 |
| 1062 | Ga0496111_0813560 | 3300048914 | Bacteria | 676 |
| 1063 | Ga0496112_0000021 | 3300048915 | Bacteria | 156561 |
| 1064 | Ga0496112_0006899 | 3300048915 | Bacteria | 10018 |
| 1065 | Ga0496112_0028461 | 3300048915 | Bacteria | 5394 |
| 1066 | Ga0496112_0038222 | 3300048915 | Bacteria | 4686 |
| 1067 | Ga0496112_0191023 | 3300048915 | Bacteria | 2010 |
| 1068 | Ga0496112_0193126 | 3300048915 | Bacteria | 1997 |
| 1069 | Ga0496112_0248747 | 3300048915 | Bacteria | 1729 |
| 1070 | Ga0496112_1441566 | 3300048915 | Bacteria | 603 |
| 1071 | Ga0496113_0025392 | 3300048916 | Bacteria | 4222 |
| 1072 | Ga0496113_0067505 | 3300048916 | Bacteria | 2712 |
| 1073 | Ga0496113_0149239 | 3300048916 | Bacteria | 1843 |
| 1074 | Ga0496113_0446785 | 3300048916 | Bacteria | 1039 |
| 1075 | Ga0496114_0046685 | 3300048917 | Bacteria | 3600 |
| 1076 | Ga0496114_0281081 | 3300048917 | Bacteria | 1467 |
| 1077 | Ga0496114_0291477 | 3300048917 | Bacteria | 1440 |
| 1078 | Ga0496114_0426457 | 3300048917 | Bacteria | 1175 |
| 1079 | Ga0496114_0602887 | 3300048917 | Bacteria | 968 |
| 1080 | Ga0496114_0686591 | 3300048917 | Bacteria | 899 |
| 1081 | Ga0496114_0985766 | 3300048917 | Bacteria | 726 |
| 1082 | Ga0496114_1386197 | 3300048917 | Bacteria | 590 |
| 1083 | Ga0496114_1448124 | 3300048917 | Bacteria | 574 |
| 1084 | Ga0496115_0003144 | 3300048918 | Bacteria | 11870 |
| 1085 | Ga0496115_0034207 | 3300048918 | Bacteria | 4016 |
| 1086 | Ga0496115_0144782 | 3300048918 | Bacteria | 1961 |
| 1087 | Ga0496115_0168065 | 3300048918 | Bacteria | 1814 |
| 1088 | Ga0496115_0198233 | 3300048918 | Bacteria | 1658 |
| 1089 | Ga0496115_0964515 | 3300048918 | Bacteria | 654 |
| 1090 | Ga0496116_0010718 | 3300048919 | Bacteria | 7652 |
| 1091 | Ga0496116_0153382 | 3300048919 | Bacteria | 1275 |
| 1092 | Ga0496116_0314563 | 3300048919 | Bacteria | 737 |
| 1093 | Ga0496117_0021072 | 3300048920 | Bacteria | 5292 |
| 1094 | Ga0496117_0112240 | 3300048920 | Bacteria | 1695 |
| 1095 | Ga0496117_0158226 | 3300048920 | Bacteria | 1331 |
| 1096 | Ga0496117_0581906 | 3300048920 | Bacteria | 527 |
| 1097 | Ga0496118_0034875 | 3300048921 | Bacteria | 4097 |
| 1098 | Ga0496118_0037062 | 3300048921 | Bacteria | 3931 |
| 1099 | Ga0496118_0054161 | 3300048921 | Bacteria | 3041 |
| 1100 | Ga0496118_0057920 | 3300048921 | Bacteria | 2900 |
| 1101 | Ga0496119_0583445 | 3300048922 | Bacteria | 510 |
| 1102 | Ga0496121_0001351 | 3300048924 | Bacteria | 41937 |
| 1103 | Ga0496121_0005807 | 3300048924 | Bacteria | 15649 |
| 1104 | Ga0496121_0006208 | 3300048924 | Bacteria | 14976 |
| 1105 | Ga0496121_0036938 | 3300048924 | Bacteria | 4346 |
| 1106 | Ga0496121_0041756 | 3300048924 | Bacteria | 4004 |
| 1107 | Ga0496121_0071436 | 3300048924 | Bacteria | 2791 |
| 1108 | Ga0496121_0101683 | 3300048924 | Bacteria | 2216 |
| 1109 | Ga0496121_0103599 | 3300048924 | Bacteria | 2188 |
| 1110 | Ga0496121_0132036 | 3300048924 | Bacteria | 1867 |
| 1111 | Ga0496121_0275289 | 3300048924 | Bacteria | 1155 |
| 1112 | Ga0496121_0292349 | 3300048924 | Bacteria | 1109 |
| 1113 | Ga0496121_0340423 | 3300048924 | Bacteria | 1003 |
| 1114 | Ga0496121_0412536 | 3300048924 | Bacteria | 881 |
| 1115 | Ga0496121_0596017 | 3300048924 | Bacteria | 683 |
| 1116 | Ga0496122_0028117 | 3300048925 | Bacteria | 4784 |
| 1117 | Ga0496122_0109985 | 3300048925 | Bacteria | 1812 |
| 1118 | Ga0496123_0014749 | 3300048926 | Bacteria | 6454 |
| 1119 | Ga0496123_0104476 | 3300048926 | Bacteria | 1638 |
| 1120 | Ga0496123_0175184 | 3300048926 | Bacteria | 1127 |
| 1121 | Ga0496124_0080946 | 3300048927 | Bacteria | 2671 |
| 1122 | Ga0496125_0000125 | 3300048928 | Bacteria | 169979 |
| 1123 | Ga0496125_0003380 | 3300048928 | Bacteria | 19422 |
| 1124 | Ga0496125_0004199 | 3300048928 | Bacteria | 16782 |
| 1125 | Ga0496125_0055867 | 3300048928 | Bacteria | 3211 |
| 1126 | Ga0496125_0114143 | 3300048928 | Bacteria | 1946 |
| 1127 | Ga0496126_0002146 | 3300048929 | Bacteria | 27491 |
| 1128 | Ga0496126_0109923 | 3300048929 | Bacteria | 2402 |
| 1129 | Ga0496126_0112096 | 3300048929 | Bacteria | 2375 |
| 1130 | Ga0496126_0123637 | 3300048929 | Bacteria | 2241 |
| 1131 | Ga0496126_0131392 | 3300048929 | Bacteria | 2163 |
| 1132 | Ga0496126_0132135 | 3300048929 | Bacteria | 2156 |
| 1133 | Ga0496126_0243974 | 3300048929 | Bacteria | 1499 |
| 1134 | Ga0496126_0292351 | 3300048929 | Bacteria | 1347 |
| 1135 | Ga0496126_0646895 | 3300048929 | Bacteria | 828 |
| 1136 | Ga0495678_126723 | 3300049459 | Bacteria | 851 |
| 1137 | Ga0501031_0007949 | 3300049568 | Bacteria | 6905 |
| 1138 | Ga0501031_0012029 | 3300049568 | Bacteria | 5643 |
| 1139 | Ga0501031_0457453 | 3300049568 | Bacteria | 824 |
| 1140 | Ga0501031_0601215 | 3300049568 | Bacteria | 708 |
| 1141 | Ga0501032_0000345 | 3300049569 | Bacteria | 38831 |
| 1142 | Ga0501032_0061759 | 3300049569 | Bacteria | 2511 |
| 1143 | Ga0501032_0079352 | 3300049569 | Bacteria | 2185 |
| 1144 | Ga0501032_0245998 | 3300049569 | Bacteria | 1161 |
| 1145 | Ga0501032_0383748 | 3300049569 | Bacteria | 903 |
| 1146 | Ga0501033_0000094 | 3300049570 | Bacteria | 84669 |
| 1147 | Ga0501033_0001745 | 3300049570 | Bacteria | 19006 |
| 1148 | Ga0501033_0011740 | 3300049570 | Bacteria | 6698 |
| 1149 | Ga0501033_0040516 | 3300049570 | Bacteria | 3477 |
| 1150 | Ga0501033_0359876 | 3300049570 | Bacteria | 1018 |
| 1151 | Ga0501034_0000021 | 3300049571 | Bacteria | 266023 |
| 1152 | Ga0501034_0170478 | 3300049571 | Bacteria | 2144 |
| 1153 | Ga0501034_0318165 | 3300049571 | Bacteria | 1489 |
| 1154 | Ga0501034_0562935 | 3300049571 | Bacteria | 1048 |
| 1155 | Ga0501034_0836305 | 3300049571 | Bacteria | 811 |
| 1156 | Ga0501036_0000115 | 3300049572 | Bacteria | 49866 |
| 1157 | Ga0501036_0055368 | 3300049572 | Bacteria | 3360 |
| 1158 | Ga0501036_0325309 | 3300049572 | Bacteria | 1284 |
| 1159 | Ga0501036_0331121 | 3300049572 | Bacteria | 1272 |
| 1160 | Ga0501037_0000450 | 3300049573 | Bacteria | 33712 |
| 1161 | Ga0501037_0000505 | 3300049573 | Bacteria | 31438 |
| 1162 | Ga0501037_0200230 | 3300049573 | Bacteria | 1411 |
| 1163 | Ga0501037_0210562 | 3300049573 | Bacteria | 1371 |
| 1164 | Ga0501037_0736229 | 3300049573 | Bacteria | 654 |
| 1165 | Ga0501038_0000052 | 3300049574 | Bacteria | 94841 |
| 1166 | Ga0501038_0028652 | 3300049574 | Bacteria | 4946 |
| 1167 | Ga0501038_0041409 | 3300049574 | Bacteria | 4017 |
| 1168 | Ga0501038_0061431 | 3300049574 | Bacteria | 3213 |
| 1169 | Ga0501038_0677239 | 3300049574 | Bacteria | 775 |
| 1170 | Ga0501039_0000549 | 3300049575 | Bacteria | 27168 |
| 1171 | Ga0501039_0011127 | 3300049575 | Bacteria | 6857 |
| 1172 | Ga0501039_0085024 | 3300049575 | Bacteria | 2464 |
| 1173 | Ga0501039_0247016 | 3300049575 | Bacteria | 1403 |
| 1174 | Ga0501039_0862199 | 3300049575 | Bacteria | 705 |
| 1175 | Ga0501039_1069999 | 3300049575 | Bacteria | 626 |
| 1176 | Ga0501040_0237002 | 3300049576 | Bacteria | 1300 |
| 1177 | Ga0501041_0062219 | 3300049577 | Bacteria | 2285 |
| 1178 | Ga0501042_0069426 | 3300049578 | Bacteria | 2520 |
| 1179 | Ga0501042_0109003 | 3300049578 | Bacteria | 1993 |
| 1180 | Ga0501043_0001704 | 3300049579 | Bacteria | 19033 |
| 1181 | Ga0501043_0006502 | 3300049579 | Bacteria | 9381 |
| 1182 | Ga0501043_0026498 | 3300049579 | Bacteria | 4547 |
| 1183 | Ga0501043_0075484 | 3300049579 | Bacteria | 2648 |
| 1184 | Ga0501043_0282687 | 3300049579 | Bacteria | 1271 |
| 1185 | Ga0501046_0000133 | 3300049580 | Bacteria | 79467 |
| 1186 | Ga0501046_0052069 | 3300049580 | Bacteria | 3228 |
| 1187 | Ga0501046_0200037 | 3300049580 | Bacteria | 1487 |
| 1188 | Ga0501046_0257938 | 3300049580 | Bacteria | 1281 |
| 1189 | Ga0501046_0370789 | 3300049580 | Bacteria | 1037 |
| 1190 | Ga0501046_0565478 | 3300049580 | Bacteria | 809 |
| 1191 | Ga0501047_0000440 | 3300049581 | Bacteria | 46007 |
| 1192 | Ga0501047_0015373 | 3300049581 | Bacteria | 7289 |
| 1193 | Ga0501047_0035246 | 3300049581 | Bacteria | 4834 |
| 1194 | Ga0501047_0091001 | 3300049581 | Bacteria | 2928 |
| 1195 | Ga0501047_0338417 | 3300049581 | Bacteria | 1343 |
| 1196 | Ga0501047_0776314 | 3300049581 | Bacteria | 773 |
| 1197 | Ga0501048_0008678 | 3300049582 | Bacteria | 7661 |
| 1198 | Ga0501048_0180106 | 3300049582 | Bacteria | 1498 |
| 1199 | Ga0501048_0241732 | 3300049582 | Bacteria | 1281 |
| 1200 | Ga0501048_0415886 | 3300049582 | Bacteria | 962 |
| 1201 | Ga0501048_0776925 | 3300049582 | Bacteria | 688 |
| 1202 | Ga0501048_0918026 | 3300049582 | Bacteria | 630 |
| 1203 | Ga0501067_0000076 | 3300049583 | Bacteria | 56529 |
| 1204 | Ga0501067_0012862 | 3300049583 | Bacteria | 4635 |
| 1205 | Ga0501067_0355283 | 3300049583 | Bacteria | 817 |
| 1206 | Ga0501068_0000511 | 3300049584 | Bacteria | 19711 |
| 1207 | Ga0501068_0040672 | 3300049584 | Bacteria | 2792 |
| 1208 | Ga0501068_0094427 | 3300049584 | Bacteria | 1849 |
| 1209 | Ga0501069_0101728 | 3300049585 | Bacteria | 1631 |
| 1210 | Ga0501069_0364192 | 3300049585 | Bacteria | 853 |
| 1211 | Ga0501070_0051048 | 3300049586 | Bacteria | 3433 |
| 1212 | Ga0501070_0116903 | 3300049586 | Bacteria | 2202 |
| 1213 | Ga0501070_0148834 | 3300049586 | Bacteria | 1932 |
| 1214 | Ga0501070_0495087 | 3300049586 | Bacteria | 982 |
| 1215 | Ga0501070_0559656 | 3300049586 | Bacteria | 915 |
| 1216 | Ga0501070_0562981 | 3300049586 | Bacteria | 911 |
| 1217 | Ga0501071_0871668 | 3300049587 | Bacteria | 694 |
| 1218 | Ga0501071_1187042 | 3300049587 | Bacteria | 590 |
| 1219 | Ga0501072_0009145 | 3300049588 | Bacteria | 7524 |
| 1220 | Ga0501072_1107912 | 3300049588 | Bacteria | 616 |
| 1221 | Ga0501073_0000597 | 3300049589 | Bacteria | 25445 |
| 1222 | Ga0501073_0047040 | 3300049589 | Bacteria | 3033 |
| 1223 | Ga0501073_0054424 | 3300049589 | Bacteria | 2802 |
| 1224 | Ga0501073_0286844 | 3300049589 | Bacteria | 1136 |
| 1225 | Ga0501073_1173081 | 3300049589 | Bacteria | 527 |
| 1226 | Ga0501074_0000285 | 3300049590 | Bacteria | 29182 |
| 1227 | Ga0501074_0661447 | 3300049590 | Bacteria | 738 |
| 1228 | Ga0501074_0802484 | 3300049590 | Bacteria | 663 |
| 1229 | Ga0501075_1338412 | 3300049591 | Bacteria | 543 |
| 1230 | Ga0501076_0143426 | 3300049592 | Bacteria | 1941 |
| 1231 | Ga0501076_0358511 | 3300049592 | Bacteria | 1198 |
| 1232 | Ga0501076_0744897 | 3300049592 | Bacteria | 809 |
| 1233 | Ga0501079_0012998 | 3300049741 | Bacteria | 6350 |
| 1234 | Ga0501079_0523523 | 3300049741 | Bacteria | 932 |
| 1235 | Ga0501079_1102783 | 3300049741 | Bacteria | 625 |
| 1236 | Ga0501080_0001080 | 3300049742 | Bacteria | 22459 |
| 1237 | Ga0501080_0027884 | 3300049742 | Bacteria | 5251 |
| 1238 | Ga0501080_0515348 | 3300049742 | Bacteria | 1067 |
| 1239 | Ga0501083_0000881 | 3300049744 | Bacteria | 19851 |
| 1240 | Ga0501083_0660720 | 3300049744 | Bacteria | 680 |
| 1241 | Ga0501083_1018407 | 3300049744 | Bacteria | 539 |
| 1242 | Ga0501083_1117767 | 3300049744 | Bacteria | 513 |
| 1243 | Ga0501035_0000255 | 3300049822 | Bacteria | 63841 |
| 1244 | Ga0501035_0003073 | 3300049822 | Bacteria | 16022 |
| 1245 | Ga0501035_0176206 | 3300049822 | Bacteria | 1844 |
| 1246 | Ga0501035_0279085 | 3300049822 | Bacteria | 1413 |
| 1247 | Ga0501035_0281484 | 3300049822 | Bacteria | 1405 |
| 1248 | Ga0501035_0286314 | 3300049822 | Bacteria | 1391 |
| 1249 | Ga0501035_0839913 | 3300049822 | Bacteria | 731 |
| 1250 | Ga0501044_0000141 | 3300049823 | Bacteria | 88569 |
| 1251 | Ga0501044_0378703 | 3300049823 | Bacteria | 1330 |
| 1252 | Ga0501044_0544323 | 3300049823 | Bacteria | 1058 |
| 1253 | Ga0501044_1420588 | 3300049823 | Bacteria | 559 |
| 1254 | Ga0501044_1544348 | 3300049823 | Bacteria | 529 |
| 1255 | Ga0501045_0026069 | 3300049824 | Bacteria | 4202 |
| 1256 | nmdc:mga03683_131951_c1 | 3300050489 | Bacteria | 1118 |
| 1257 | nmdc:mga03n38_124467_c1 | 3300050490 | Bacteria | 1271 |
| 1258 | nmdc:mga03n38_199726_c1 | 3300050490 | Bacteria | 1034 |
| 1259 | nmdc:mga03n38_322088_c1 | 3300050490 | Bacteria | 835 |
| 1260 | nmdc:mga03n38_374579_c1 | 3300050490 | Bacteria | 779 |
| 1261 | nmdc:mga03n38_533584_c1 | 3300050490 | Bacteria | 662 |
| 1262 | nmdc:mga00v17_27862_c1 | 3300050491 | Bacteria | 3302 |
| 1263 | nmdc:mga0yw44_15935_c1 | 3300050492 | Bacteria | 4044 |
| 1264 | nmdc:mga0yw44_168663_c1 | 3300050492 | Bacteria | 1436 |
| 1265 | nmdc:mga0yw44_172490_c1 | 3300050492 | Bacteria | 1421 |
| 1266 | nmdc:mga0yw44_435045_c1 | 3300050492 | Bacteria | 889 |
| 1267 | nmdc:mga06z11_218397_c1 | 3300050494 | Bacteria | 1113 |
| 1268 | nmdc:mga06z11_22052_c1 | 3300050494 | Bacteria | 2968 |
| 1269 | nmdc:mga06z11_46278_c1 | 3300050494 | Bacteria | 2204 |
| 1270 | nmdc:mga06z11_686494_c1 | 3300050494 | Bacteria | 624 |
| 1271 | nmdc:mga06z11_998443_c1 | 3300050494 | Bacteria | 510 |
| 1272 | nmdc:mga04h51_153237_c1 | 3300050495 | Bacteria | 882 |
| 1273 | nmdc:mga07m45_20707_c1 | 3300050496 | Bacteria | 3574 |
| 1274 | nmdc:mga07m45_60424_c1 | 3300050496 | Bacteria | 2145 |
| 1275 | nmdc:mga0n895_125876_c1 | 3300050512 | Bacteria | 2586 |
| 1276 | nmdc:mga0n895_157304_c1 | 3300050512 | Bacteria | 2303 |
| 1277 | nmdc:mga0n895_1799724_c1 | 3300050512 | Bacteria | 573 |
| 1278 | nmdc:mga0n895_1842919_c1 | 3300050512 | Bacteria | 565 |
| 1279 | nmdc:mga0n895_427342_c1 | 3300050512 | Bacteria | 1339 |
| 1280 | nmdc:mga0rr50_143496_c1 | 3300050513 | Bacteria | 1923 |
| 1281 | nmdc:mga0rr50_1702083_c1 | 3300050513 | Bacteria | 531 |
| 1282 | nmdc:mga08x19_1263314_c1 | 3300050514 | Unclassified | 523 |
| 1283 | nmdc:mga0a205_81104_c1 | 3300050515 | Bacteria | 3134 |
| 1284 | nmdc:mga0sz30_392822_c1 | 3300050516 | Bacteria | 621 |
| 1285 | Ga0495601_0020961 | 3300053077 | Bacteria | 3997 |
| 1286 | Ga0495601_0081572 | 3300053077 | Bacteria | 2076 |
| 1287 | Ga0495601_0357694 | 3300053077 | Bacteria | 949 |
| 1288 | Ga0495601_0995686 | 3300053077 | Bacteria | 527 |
| 1289 | Ga0500635_0129261 | 3300053080 | Bacteria | 951 |
| 1290 | Ga0495655_0102560 | 3300053083 | Bacteria | 849 |
| 1291 | Ga0495595_0020753 | 3300053084 | Bacteria | 2862 |
| 1292 | Ga0495595_0144385 | 3300053084 | Bacteria | 1169 |
| 1293 | Ga0495595_0199587 | 3300053084 | Bacteria | 996 |
| 1294 | Ga0495595_0343022 | 3300053084 | Bacteria | 753 |
| 1295 | Ga0495619_0007177 | 3300053085 | Bacteria | 7059 |
| 1296 | Ga0495619_0022508 | 3300053085 | Bacteria | 4034 |
| 1297 | Ga0495619_0023422 | 3300053085 | Bacteria | 3959 |
| 1298 | Ga0495619_0041790 | 3300053085 | Bacteria | 3000 |
| 1299 | Ga0500578_0138596 | 3300053086 | Bacteria | 1522 |
| 1300 | Ga0500578_0331562 | 3300053086 | Bacteria | 894 |
| 1301 | Ga0500578_0773748 | 3300053086 | Bacteria | 510 |
| 1302 | Ga0500643_063024 | 3300053087 | Bacteria | 1038 |
| 1303 | Ga0500643_155180 | 3300053087 | Bacteria | 614 |
| 1304 | Ga0500581_153470 | 3300053089 | Bacteria | 1078 |
| 1305 | Ga0500646_0050132 | 3300053090 | Bacteria | 1202 |
| 1306 | Ga0500647_0048290 | 3300053091 | Bacteria | 2046 |
| 1307 | Ga0500651_0028509 | 3300053093 | Bacteria | 3511 |
| 1308 | Ga0500566_0000100 | 3300053094 | Bacteria | 43788 |
| 1309 | Ga0500566_0000307 | 3300053094 | Bacteria | 26281 |
| 1310 | Ga0500566_0000533 | 3300053094 | Bacteria | 21348 |
| 1311 | Ga0500566_0133706 | 3300053094 | Bacteria | 1324 |
| 1312 | Ga0500640_006540 | 3300053095 | Bacteria | 4460 |
| 1313 | Ga0500640_106532 | 3300053095 | Bacteria | 1149 |
| 1314 | Ga0500641_0003537 | 3300053096 | Bacteria | 5524 |
| 1315 | Ga0500650_0003654 | 3300053098 | Bacteria | 5407 |
| 1316 | Ga0500554_001684 | 3300053102 | Bacteria | 4254 |
| 1317 | Ga0500556_0000125 | 3300053104 | Bacteria | 65777 |
| 1318 | Ga0500562_113775 | 3300053108 | Bacteria | 737 |
| 1319 | Ga0500562_214284 | 3300053108 | Bacteria | 521 |
| 1320 | Ga0500572_000670 | 3300053111 | Bacteria | 11297 |
| 1321 | Ga0500572_000830 | 3300053111 | Bacteria | 9731 |
| 1322 | Ga0500572_008998 | 3300053111 | Bacteria | 2349 |
| 1323 | Ga0500591_239844 | 3300053115 | Bacteria | 574 |
| 1324 | Ga0500595_033212 | 3300053119 | Bacteria | 1714 |
| 1325 | Ga0500607_020131 | 3300053121 | Bacteria | 3770 |
| 1326 | Ga0500607_313723 | 3300053121 | Bacteria | 569 |
| 1327 | Ga0500608_067744 | 3300053122 | Bacteria | 1700 |
| 1328 | Ga0500608_118838 | 3300053122 | Bacteria | 1202 |
| 1329 | Ga0500608_203832 | 3300053122 | Bacteria | 815 |
| 1330 | Ga0500608_311678 | 3300053122 | Bacteria | 578 |
| 1331 | Ga0500614_001477 | 3300053123 | Bacteria | 5607 |
| 1332 | Ga0500618_011218 | 3300053125 | Bacteria | 2382 |
| 1333 | Ga0500626_034818 | 3300053128 | Bacteria | 2275 |
| 1334 | Ga0500642_0000105 | 3300053130 | Bacteria | 40593 |
| 1335 | Ga0500652_001527 | 3300053131 | Bacteria | 7103 |
| 1336 | Ga0500655_150258 | 3300053133 | Bacteria | 503 |
| 1337 | Ga0500658_0076936 | 3300053134 | Bacteria | 1419 |
| 1338 | Ga0500559_0000240 | 3300053136 | Bacteria | 43636 |
| 1339 | Ga0500559_0000976 | 3300053136 | Bacteria | 17874 |
| 1340 | Ga0500559_0001326 | 3300053136 | Bacteria | 14251 |
| 1341 | Ga0500559_0238844 | 3300053136 | Bacteria | 856 |
| 1342 | Ga0500568_0004846 | 3300053139 | Bacteria | 7104 |
| 1343 | Ga0500568_0011215 | 3300053139 | Bacteria | 4173 |
| 1344 | Ga0500577_0003197 | 3300053142 | Bacteria | 4240 |
| 1345 | Ga0500586_001365 | 3300053145 | Bacteria | 5132 |
| 1346 | Ga0500588_0158843 | 3300053146 | Bacteria | 822 |
| 1347 | Ga0500590_084113 | 3300053148 | Bacteria | 1558 |
| 1348 | Ga0500590_106540 | 3300053148 | Bacteria | 1337 |
| 1349 | Ga0500603_000017 | 3300053150 | Bacteria | 56324 |
| 1350 | Ga0500603_108545 | 3300053150 | Bacteria | 831 |
| 1351 | Ga0500604_0004360 | 3300053151 | Bacteria | 3759 |
| 1352 | Ga0500616_0000085 | 3300053153 | Bacteria | 193192 |
| 1353 | Ga0500619_151464 | 3300053154 | Bacteria | 788 |
| 1354 | Ga0500620_205274 | 3300053155 | Bacteria | 671 |
| 1355 | Ga0500622_0000822 | 3300053156 | Bacteria | 26570 |
| 1356 | Ga0500622_0250230 | 3300053156 | Bacteria | 778 |
| 1357 | Ga0500624_042027 | 3300053157 | Bacteria | 825 |
| 1358 | Ga0500630_001073 | 3300053159 | Bacteria | 12793 |
| 1359 | Ga0500633_0079886 | 3300053160 | Bacteria | 1182 |
| 1360 | Ga0500638_000755 | 3300053162 | Bacteria | 8802 |
| 1361 | Ga0500638_140583 | 3300053162 | Bacteria | 1085 |
| 1362 | Ga0500639_000306 | 3300053163 | Bacteria | 24115 |
| 1363 | Ga0500639_158482 | 3300053163 | Bacteria | 1033 |
| 1364 | Ga0500636_0000875 | 3300053177 | Bacteria | 16155 |
| 1365 | Ga0500636_0001972 | 3300053177 | Bacteria | 11289 |
| 1366 | Ga0500636_0162034 | 3300053177 | Bacteria | 1218 |
| 1367 | Ga0500636_0295424 | 3300053177 | Bacteria | 801 |
| 1368 | Ga0500637_0237409 | 3300053178 | Bacteria | 1023 |
| 1369 | Ga0500637_0368745 | 3300053178 | Bacteria | 757 |
| 1370 | Ga0500637_0422065 | 3300053178 | Bacteria | 685 |
| 1371 | Ga0500576_148056 | 3300053725 | Bacteria | 882 |
| 1372 | Ga0500625_147381 | 3300053729 | Bacteria | 893 |
| 1373 | Ga0500645_032111 | 3300053730 | Bacteria | 1576 |
| 1374 | Ga0500596_002124 | 3300053735 | Bacteria | 3941 |
| 1375 | Ga0501084_0848909 | 3300054114 | Bacteria | 769 |
| 1376 | Ga0501084_0997352 | 3300054114 | Bacteria | 704 |
| 1377 | Ga0501084_1120743 | 3300054114 | Bacteria | 660 |
| 1378 | Ga0501082_0003023 | 3300060353 | Bacteria | 14697 |
| 1379 | Ga0501082_0546497 | 3300060353 | Bacteria | 1013 |
| 1380 | Ga0501082_1186229 | 3300060353 | Bacteria | 667 |
| 1381 | 2507509744 | 2507262055 | Bacteria | 8048963 |
| 1382 | 2508543760 | 2508501009 | Bacteria | 7784016 |
| 1383 | 2508698452 | 2508501042 | Bacteria | 8719808 |
| 1384 | 2511400342 | 2511231028 | Bacteria | 8046582 |
| 1385 | 2513625305 | 2513237092 | Bacteria | 8341956 |
| 1386 | 2513645105 | 2513237094 | Bacteria | 8789602 |
| 1387 | 2513646190 | 2513237095 | Bacteria | 8976980 |
| 1388 | 2513678583 | 2513237098 | Bacteria | 9902361 |
| 1389 | 2513706642 | 2513237102 | Bacteria | 7703324 |
| 1390 | 2513714981 | 2513237104 | Bacteria | 10034502 |
| 1391 | 2513875823 | 2513237139 | Bacteria | 8737671 |
| 1392 | 2514011511 | 2513237161 | Bacteria | 8871253 |
| 1393 | 2515630044 | 2515154112 | Bacteria | 8294334 |
| 1394 | 2517103558 | 2517093001 | Bacteria | 9002274 |
| 1395 | 2524441065 | 2524023205 | Bacteria | 8918781 |
| 1396 | 2524470053 | 2524023210 | Bacteria | 9029266 |
| 1397 | 2528854169 | 2528768022 | Bacteria | 10457665 |
| 1398 | 2603859834 | 2602042107 | Bacteria | 6226103 |
| 1399 | 2617349267 | 2617270735 | Bacteria | 9163226 |
| 1400 | 2617378209 | 2617270741 | Bacteria | 8201522 |
| 1401 | 2687579451 | 2687453129 | Bacteria | 4387428 |
| 1402 | 2745082412 | 2744054633 | Bacteria | 8678936 |
| 1403 | 2793060281 | 2791355196 | Bacteria | 7323613 |
| 1404 | 2805917647 | 2802429603 | Bacteria | 8777136 |
| 1405 | 2818241471 | 2816332527 | Bacteria | 8933356 |
| 1406 | 2824602150 | 2824600985 | Bacteria | 8488197 |
| 1407 | 2824610138 | 2824609381 | Bacteria | 8672835 |
| 1408 | 2824623848 | 2824617872 | Bacteria | 8814715 |
| 1409 | 2824627738 | 2824626560 | Bacteria | 8813858 |
| 1410 | 2824639274 | 2824635225 | Bacteria | 8785348 |
| 1411 | 2824652024 | 2824644064 | Bacteria | 8743947 |
| 1412 | 2824656117 | 2824653114 | Bacteria | 8493680 |
| 1413 | 2824670778 | 2824661429 | Bacteria | 9877870 |
| 1414 | 2824679497 | 2824671348 | Bacteria | 8369588 |
| 1415 | 2824683961 | 2824679649 | Bacteria | 8248951 |
| 1416 | 2824696125 | 2824687955 | Bacteria | 8360029 |
| 1417 | 2824703797 | 2824696289 | Bacteria | 8335049 |
| 1418 | 2824711384 | 2824704595 | Bacteria | 9667483 |
| 1419 | 2824722189 | 2824714736 | Bacteria | 8717648 |
| 1420 | 2824727681 | 2824723954 | Bacteria | 8758240 |
| 1421 | 2824733522 | 2824732956 | Bacteria | 7810675 |
| 1422 | 2824746898 | 2824746037 | Bacteria | 7911610 |
| 1423 | 2824761691 | 2824753945 | Bacteria | 9787441 |
| 1424 | 2824771306 | 2824763712 | Bacteria | 9792355 |
| 1425 | 2824774001 | 2824773399 | Bacteria | 8360218 |
| 1426 | 2838130050 | 2838122688 | Bacteria | 8803140 |
| 1427 | 2841941207 | 2841941048 | Bacteria | 8688029 |
| 1428 | 2841952766 | 2841949485 | Bacteria | 8680857 |
| 1429 | 2841962279 | 2841957949 | Bacteria | 8652217 |
| 1430 | 2841967362 | 2841966195 | Bacteria | 8673214 |
| 1431 | 2841979241 | 2841974524 | Bacteria | 8931498 |
| 1432 | 2841990816 | 2841983080 | Bacteria | 8395090 |
| 1433 | 2842038657 | 2842038055 | Bacteria | 8002051 |
| 1434 | 2842048398 | 2842045827 | Bacteria | 8006841 |
| 1435 | 2844318056 | 2844315083 | Bacteria | 8138177 |
| 1436 | 2847945429 | 2847939898 | Bacteria | 8606328 |
| 1437 | 2849080383 | 2849076700 | Bacteria | 7039503 |
| 1438 | 2857510267 | 2857509624 | Bacteria | 7472071 |
| 1439 | 2857528482 | 2857524615 | Bacteria | 6615449 |
| 1440 | 2874595146 | 2874590934 | Bacteria | 8299676 |
| 1441 | 2874615616 | 2874612657 | Bacteria | 8252029 |
| 1442 | 2874621640 | 2874620515 | Bacteria | 8290088 |
| 1443 | 2874632725 | 2874628541 | Bacteria | 8630250 |
| 1444 | 2874651007 | 2874645413 | Bacteria | 8214782 |
| 1445 | 2876764508 | 2876761206 | Bacteria | 10111113 |
| 1446 | 2876775082 | 2876771140 | Bacteria | 8287509 |
| 1447 | 2876823897 | 2876818435 | Bacteria | 8274608 |
| 1448 | 2879080525 | 2879074833 | Bacteria | 8279565 |
| 1449 | 2879109374 | 2879099564 | Bacteria | 10442239 |
| 1450 | 2879134869 | 2879127579 | Bacteria | 8294491 |
| 1451 | 2879149180 | 2879142872 | Bacteria | 8267021 |
| 1452 | 2881366259 | 2881364244 | Bacteria | 7710352 |
| 1453 | 2881672887 | 2881665667 | Bacteria | 8175609 |
| 1454 | 2885372851 | 2885366525 | Bacteria | 8326213 |
| 1455 | 2885413027 | 2885409591 | Bacteria | 9235467 |
| 1456 | 2888382851 | 2888378607 | Bacteria | 9652610 |
| 1457 | 2888394946 | 2888388044 | Bacteria | 7304136 |
| 1458 | 2888423330 | 2888419890 | Bacteria | 7857137 |
| 1459 | 2893070202 | 2893066018 | Bacteria | 6158120 |
| 1460 | 2903729635 | 2903727486 | Bacteria | 8281579 |
| 1461 | 2904668644 | 2904666416 | Bacteria | 8226587 |
| 1462 | 2904696933 | 2904690495 | Bacteria | 9412302 |
| 1463 | 2904716638 | 2904711408 | Bacteria | 9771557 |
| 1464 | 2906605783 | 2906602504 | Bacteria | 8295279 |
| 1465 | 2906628237 | 2906626472 | Bacteria | 8826946 |
| 1466 | 2908761510 | 2908756301 | Bacteria | 8864324 |
| 1467 | 2908778974 | 2908775508 | Bacteria | 8092255 |
| 1468 | 2919076153 | 2919073203 | Bacteria | 6531949 |
| 1469 | 2922373060 | |||
| 1470 | 2922392069 | 2922386360 | Bacteria | 7017218 |
| 1471 | 2922395260 | 2922393267 | Bacteria | 8285685 |
| 1472 | 2929615877 | 2929615660 | Bacteria | 9193770 |
| 1473 | 2929630490 | 2929624759 | Bacteria | 9339455 |
| 1474 | 2932792485 | 2932784394 | Bacteria | 9704911 |
| 1475 | 2932800369 | 2932794094 | Bacteria | 7915132 |
| 1476 | 2932804542 | 2932801729 | Bacteria | 7987968 |
| 1477 | 2932814005 | 2932809354 | Bacteria | 9135765 |
| 1478 | 2932819504 | 2932818245 | Bacteria | 9955613 |
| 1479 | 2932833789 | 2932828146 | Bacteria | 9745859 |
| 1480 | 2933578837 | 2933577622 | Bacteria | 9116884 |
| 1481 | 2935611396 | 2935608549 | Bacteria | 8203142 |
| 1482 | 2935618685 | 2935616580 | Bacteria | 9032984 |
| 1483 | 2935644475 | 2935638405 | Bacteria | 10015038 |
| 1484 | 2935648780 | 2935648319 | Bacteria | 8801166 |
| 1485 | 2935657137 | 2935656913 | Bacteria | 8965014 |
| 1486 | 2935674212 | 2935665750 | Bacteria | 9571747 |
| 1487 | 2935678527 | 2935675223 | Bacteria | 9928132 |
| 1488 | 2935687976 | 2935684952 | Bacteria | 9590419 |
| 1489 | 2935701412 | 2935694250 | Bacteria | 9291695 |
| 1490 | 2935708333 | 2935703347 | Bacteria | 10242284 |
| 1491 | 2935714996 | 2935713505 | Bacteria | 9608509 |
| 1492 | 2935726439 | 2935722832 | Bacteria | 9608746 |
| 1493 | 2935733814 | 2935732158 | Bacteria | 9706831 |
| 1494 | 2935743193 | 2935741537 | Bacteria | 9707219 |
| 1495 | 2935754768 | 2935750917 | Bacteria | 9590372 |
| 1496 | 2935765475 | 2935760218 | Bacteria | 9817913 |
| 1497 | 2935775231 | 2935769743 | Bacteria | 7878163 |
| 1498 | 2935779571 | 2935777560 | Bacteria | 8077691 |
| 1499 | 2935791571 | 2935785616 | Bacteria | 7962367 |
| 1500 | 2935799883 | 2935793552 | Bacteria | 8012592 |
| 1501 | 2935805429 | 2935801545 | Bacteria | 9301974 |
| 1502 | 2935816723 | 2935810662 | Bacteria | 9401221 |
| 1503 | 2935820873 | 2935819856 | Bacteria | 8261050 |
| 1504 | 2935833776 | 2935827899 | Bacteria | 10038562 |
| 1505 | 2935839538 | 2935837841 | Bacteria | 9454360 |
| 1506 | 2935850867 | 2935847175 | Bacteria | 8228321 |
| 1507 | 2935857050 | 2935855204 | Bacteria | 9035059 |
| 1508 | 2935871126 | 2935864058 | Bacteria | 9784707 |
| 1509 | 2935876371 | 2935873716 | Bacteria | 9632195 |
| 1510 | 2935889736 | 2935883170 | Bacteria | 7964738 |
| 1511 | 2935913766 | 2935908558 | Bacteria | 8568796 |
| 1512 | 2935920244 | 2935916978 | Bacteria | 9113783 |
| 1513 | 2935930583 | 2935926038 | Bacteria | 8601059 |
| 1514 | 2935939444 | 2935934488 | Bacteria | 8602579 |
| 1515 | 2935946393 | 2935942939 | Bacteria | 8599779 |
| 1516 | 2935955768 | 2935951376 | Bacteria | 8602333 |
| 1517 | 2935966923 | 2935959822 | Bacteria | 7869783 |
| 1518 | 2935972522 | 2935967501 | Bacteria | 8603075 |
| 1519 | 2935991022 | 2935984226 | Bacteria | 8302647 |
| 1520 | 2935997660 | 2935992306 | Bacteria | 9802711 |
| 1521 | 2936007178 | 2936002035 | Bacteria | 9362176 |
| 1522 | 2936011690 | 2936011229 | Bacteria | 8801034 |
| 1523 | 2936020285 | 2936019824 | Bacteria | 8804134 |
| 1524 | 2936028980 | 2936028420 | Bacteria | 8965941 |
| 1525 | 2936043015 | 2936037263 | Bacteria | 9446081 |
| 1526 | 2936047008 | 2936046547 | Bacteria | 8903709 |
| 1527 | 2936058112 | 2936055302 | Bacteria | 8785755 |
| 1528 | 2940559855 | 2940556831 | Bacteria | 9590747 |
| 1529 | 2941536051 | 2941531003 | Bacteria | 7653939 |
| 1530 | 2941540227 | 2941538514 | Bacteria | 9402094 |
| 1531 | 3005488179 | 3005483717 | Bacteria | 7877331 |
| 1532 | 3005512671 | 3005506211 | Bacteria | 6943378 |
| 1533 | 3005590438 | 3005587118 | Bacteria | 7794411 |
| 1534 | 3005598105 | 3005594810 | Bacteria | 8716512 |
| 1535 | 3005713783 | 3005710791 | Bacteria | 7622528 |
| 1536 | 3005721295 | 3005718088 | Bacteria | 8283608 |
| 1537 | 8006928655 | 8006926726 | Bacteria | 6749210 |
| 1538 | 8016514646 | 8016511872 | Bacteria | 9921665 |
| 1539 | 8016530749 | 8016522445 | Bacteria | 8156687 |
| 1540 | 8016536038 | 8016530956 | Bacteria | 8155261 |
| 1541 | 8016540318 | 8016539877 | Bacteria | 8155419 |
| 1542 | 8016552913 | 8016548790 | Bacteria | 8155074 |
| 1543 | 8016561291 | 8016557553 | Bacteria | 8154380 |
| 1544 | 8016574384 | 8016566248 | Bacteria | 8158151 |
| 1545 | 8016578484 | 8016575299 | Bacteria | 8154085 |
| 1546 | 8016591288 | 8016583857 | Bacteria | 10421953 |
| 1547 | 8016599150 | 8016595262 | Bacteria | 8149947 |
| 1548 | 8016611899 | 8016603502 | Bacteria | 8731218 |
| 1549 | 8016621907 | 8016613128 | Bacteria | 8794220 |
| 1550 | 8016627946 | 8016622563 | Bacteria | 7999408 |
| 1551 | 8016632267 | 8016630954 | Bacteria | 9217207 |
| 1552 | 8017061786 | 8017057580 | Bacteria | 10023680 |
| 1553 | 8019535763 | 8019530166 | Bacteria | 8155624 |
| 1554 | 8019543716 | 8019538911 | Bacteria | 7872763 |
| 1555 | 8019555056 | 8019547302 | Bacteria | 7996444 |
| 1556 | 8019581312 | 8019576017 | Bacteria | 10049540 |
| 1557 | 8019588937 | 8019586578 | Bacteria | 10212056 |
| 1558 | 8019616267 | 8019608314 | Bacteria | 10042931 |
| 1559 | 8019626868 | 8019619141 | Bacteria | 9218857 |
| 1560 | 8019635648 | 8019629233 | Bacteria | 8687553 |
| 1561 | 8019657032 | 8019648815 | Bacteria | 10014479 |
| 1562 | 8019673059 | 8019668869 | Bacteria | 8791617 |
| 1563 | 8019683082 | 8019678201 | Bacteria | 8863603 |
| 1564 | 8019688775 | 8019687851 | Bacteria | 8712826 |
| 1565 | 8055747524 | 8055742211 | Bacteria | 9226248 |
| 1566 | 8056680511 | 8056673599 | Bacteria | 7871253 |
| 1567 | 8056683870 | 8056681323 | Bacteria | 8472857 |
| 1568 | 8056691267 | 8056689827 | Bacteria | 6712655 |
| 1569 | 8056972402 | 8056967851 | Bacteria | 9038162 |
| 1570 | Ga0068856_100006491 | |||
| 1571 | JGI24742J22300_10009000 | |||
| 1572 | JGI25406J46586_10000078 | |||
| 1573 | JGI25406J46586_10007863 | |||
| 1574 | JGI25153J46596_10010523 | |||
| 1575 | JGI25153J46596_10022305 | |||
| 1576 | JGI25404J52841_10001821 | |||
| 1577 | JGI25404J52841_10002922 | |||
| 1578 | JGI25404J52841_10032590 | |||
| 1579 | Ga0055542_1002566 | |||
| 1580 | Ga0055529_1021822 | |||
| 1581 | Ga0055529_1031775 | |||
| 1582 | Ga0070658_10042658 | |||
| 1583 | Ga0070658_10161467 | |||
| 1584 | Ga0070658_10210295 | |||
| 1585 | Ga0070658_10387757 | |||
| 1586 | Ga0070676_10108708 | |||
| 1587 | Ga0070683_101462219 | |||
| 1588 | Ga0070683_101647371 | |||
| 1589 | Ga0070690_100215512 | |||
| 1590 | Ga0070690_100419124 | |||
| 1591 | Ga0070690_101517762 | |||
| 1592 | Ga0070677_10740214 | |||
| 1593 | Ga0068869_100711069 | |||
| 1594 | Ga0068869_100991556 | |||
| 1595 | Ga0068869_101356368 | |||
| 1596 | Ga0070680_100288044 | |||
| 1597 | Ga0070682_100118026 | |||
| 1598 | Ga0070682_100667417 | |||
| 1599 | Ga0070682_101805127 | |||
| 1600 | Ga0070660_100064655 | |||
| 1601 | Ga0070660_100167335 | |||
| 1602 | Ga0070689_101529616 | |||
| 1603 | Ga0070691_10489537 | |||
| 1604 | Ga0070661_100276878 | |||
| 1605 | Ga0070661_100627335 | |||
| 1606 | Ga0070661_101487638 | |||
| 1607 | Ga0070668_100021296 | |||
| 1608 | Ga0070668_100119222 | |||
| 1609 | Ga0070668_100139245 | |||
| 1610 | Ga0070668_100280847 | |||
| 1611 | Ga0070669_100720157 | |||
| 1612 | Ga0070671_100100866 | |||
| 1613 | Ga0070671_100164278 | |||
| 1614 | Ga0070674_100030516 | |||
| 1615 | Ga0070674_100073588 | |||
| 1616 | Ga0070674_100207926 | |||
| 1617 | Ga0070673_100202032 | |||
| 1618 | Ga0070673_100218490 | |||
| 1619 | Ga0070673_100691724 | |||
| 1620 | Ga0070673_100812672 | |||
| 1621 | Ga0070659_100052649 | |||
| 1622 | Ga0070659_100856376 | |||
| 1623 | Ga0070659_101067897 | |||
| 1624 | Ga0070667_100070238 | |||
| 1625 | Ga0070667_100199869 | |||
| 1626 | Ga0070667_100758517 | |||
| 1627 | Ga0070667_101207043 | |||
| 1628 | Ga0070709_10051798 | |||
| 1629 | Ga0070714_100008919 | |||
| 1630 | Ga0070714_100069803 | |||
| 1631 | Ga0070714_101086456 | |||
| 1632 | Ga0070713_100002496 | |||
| 1633 | Ga0070713_100043496 | |||
| 1634 | Ga0070713_100051383 | |||
| 1635 | Ga0070713_100188572 | |||
| 1636 | Ga0070713_100196742 | |||
| 1637 | Ga0070713_100417186 | |||
| 1638 | Ga0070713_102188772 | |||
| 1639 | Ga0070710_10002216 | |||
| 1640 | Ga0070710_10005858 | |||
| 1641 | Ga0070710_10063822 | |||
| 1642 | Ga0070710_10877299 | |||
| 1643 | Ga0070710_11535926 | |||
| 1644 | Ga0070701_10309659 | |||
| 1645 | Ga0070711_100004598 | |||
| 1646 | Ga0070711_100009923 | |||
| 1647 | Ga0070711_100043803 | |||
| 1648 | Ga0070711_100383681 | |||
| 1649 | Ga0070711_100660610 | |||
| 1650 | Ga0070711_101310346 | |||
| 1651 | Ga0070700_100205013 | |||
| 1652 | Ga0070700_101759084 | |||
| 1653 | Ga0070663_100071153 | |||
| 1654 | Ga0070663_100074690 | |||
| 1655 | Ga0070663_100166747 | |||
| 1656 | Ga0070663_100260411 | |||
| 1657 | Ga0070663_101192185 | |||
| 1658 | Ga0070678_100195784 | |||
| 1659 | Ga0070678_100264579 | |||
| 1660 | Ga0070678_100600278 | |||
| 1661 | Ga0070678_100999439 | |||
| 1662 | Ga0070678_102362768 | |||
| 1663 | Ga0070662_100199528 | |||
| 1664 | Ga0070662_100358098 | |||
| 1665 | Ga0070662_100904746 | |||
| 1666 | Ga0070662_100933192 | |||
| 1667 | Ga0070681_10149264 | |||
| 1668 | Ga0070681_10221402 | |||
| 1669 | Ga0070681_11044690 | |||
| 1670 | Ga0070681_11346821 | |||
| 1671 | Ga0068867_100362026 | |||
| 1672 | Ga0070685_10227941 | |||
| 1673 | Ga0070706_100104252 | |||
| 1674 | Ga0070707_100651447 | |||
| 1675 | Ga0070698_100095475 | |||
| 1676 | Ga0070698_101029613 | |||
| 1677 | Ga0070699_100232537 | |||
| 1678 | Ga0070699_100512689 | |||
| 1679 | Ga0070679_100015207 | |||
| 1680 | Ga0070679_100176711 | |||
| 1681 | Ga0070684_100566673 | |||
| 1682 | Ga0070684_101855553 | |||
| 1683 | Ga0070697_100284549 | |||
| 1684 | Ga0068853_100052136 | |||
| 1685 | Ga0068853_100064125 | |||
| 1686 | Ga0068853_100387067 | |||
| 1687 | Ga0068853_101064271 | |||
| 1688 | Ga0068853_101523309 | |||
| 1689 | Ga0068853_101564149 | |||
| 1690 | Ga0070672_100490312 | |||
| 1691 | Ga0070686_100114215 | |||
| 1692 | Ga0070686_101165948 | |||
| 1693 | Ga0070696_101209436 | |||
| 1694 | Ga0070693_100138758 | |||
| 1695 | Ga0070693_100625821 | |||
| 1696 | Ga0070665_100067159 | |||
| 1697 | Ga0070665_100135737 | |||
| 1698 | Ga0070665_100148723 | |||
| 1699 | Ga0070665_100226507 | |||
| 1700 | Ga0070665_100254057 | |||
| 1701 | Ga0070665_100948965 | |||
| 1702 | Ga0068855_100008391 | |||
| 1703 | Ga0068855_100023606 | |||
| 1704 | Ga0068855_100212427 | |||
| 1705 | Ga0068855_100427997 | |||
| 1706 | Ga0068855_100433863 | |||
| 1707 | Ga0068855_100677195 | |||
| 1708 | Ga0068855_101121170 | |||
| 1709 | Ga0068855_101140637 | |||
| 1710 | Ga0068855_101333530 | |||
| 1711 | Ga0070664_100055730 | |||
| 1712 | Ga0070664_100390206 | |||
| 1713 | Ga0068857_100362524 | |||
| 1714 | Ga0068857_101065744 | |||
| 1715 | Ga0068854_100027459 | |||
| 1716 | Ga0068854_100081207 | |||
| 1717 | Ga0068854_100384302 | |||
| 1718 | Ga0068854_101772312 | |||
| 1719 | Ga0068856_100005799 | |||
| 1720 | Ga0068856_100116497 | |||
| 1721 | Ga0068856_100250331 | |||
| 1722 | Ga0068856_100473108 | |||
| 1723 | Ga0068856_100999793 | |||
| 1724 | Ga0070702_100175428 | |||
| 1725 | Ga0070702_100468668 | |||
| 1726 | Ga0070702_100572428 | |||
| 1727 | Ga0068852_100026885 | |||
| 1728 | Ga0068852_100452737 | |||
| 1729 | Ga0068852_100549554 | |||
| 1730 | Ga0068852_100577230 | |||
| 1731 | Ga0068852_100611543 | |||
| 1732 | Ga0068852_101063374 | |||
| 1733 | Ga0068859_101596147 | |||
| 1734 | Ga0068864_100163405 | |||
| 1735 | Ga0068864_100930207 | |||
| 1736 | Ga0068864_101440622 | |||
| 1737 | Ga0068866_10498265 | |||
| 1738 | Ga0068866_11261235 | |||
| 1739 | Ga0068861_100015345 | |||
| 1740 | Ga0068861_101145494 | |||
| 1741 | Ga0068861_102533418 | |||
| 1742 | Ga0068851_10000888 | |||
| 1743 | Ga0068851_10083850 | |||
| 1744 | Ga0068851_10272875 | |||
| 1745 | Ga0068851_10714023 | |||
| 1746 | Ga0068870_10825192 | |||
| 1747 | Ga0068863_100606370 | |||
| 1748 | Ga0068863_100808947 | |||
| 1749 | Ga0068863_100828036 | |||
| 1750 | Ga0068858_100149929 | |||
| 1751 | Ga0068858_101694758 | |||
| 1752 | Ga0068860_101991785 | |||
| 1753 | Ga0068862_100237565 | |||
| 1754 | Ga0081455_10007525 | |||
| 1755 | Ga0081455_10010928 | |||
| 1756 | Ga0081455_10029071 | |||
| 1757 | Ga0081455_10040471 | |||
| 1758 | Ga0081455_10044093 | |||
| 1759 | Ga0081455_10259013 | |||
| 1760 | Ga0081455_10713172 | |||
| 1761 | Ga0081538_10105051 | |||
| 1762 | Ga0081540_1001581 | |||
| 1763 | Ga0081540_1005915 | |||
| 1764 | Ga0081540_1007598 | |||
| 1765 | Ga0081540_1028204 | |||
| 1766 | Ga0081540_1140599 | |||
| 1767 | Ga0081539_10000273 | |||
| 1768 | Ga0081539_10001396 | |||
| 1769 | Ga0081539_10016511 | |||
| 1770 | Ga0081539_10024577 | |||
| 1771 | Ga0070717_10001732 | |||
| 1772 | Ga0070717_10005433 | |||
| 1773 | Ga0070717_10619675 | |||
| 1774 | Ga0070717_10784474 | |||
| 1775 | Ga0075365_10059920 | |||
| 1776 | Ga0075365_10111717 | |||
| 1777 | Ga0075365_10133407 | |||
| 1778 | Ga0075365_10850681 | |||
| 1779 | Ga0075365_10932833 | |||
| 1780 | Ga0075365_11102401 | |||
| 1781 | Ga0075365_11216017 | |||
| 1782 | Ga0075368_10190425 | |||
| 1783 | Ga0075368_10260237 | |||
| 1784 | Ga0075363_100127088 | |||
| 1785 | Ga0075363_100301805 | |||
| 1786 | Ga0075363_100532338 | |||
| 1787 | Ga0075363_100796190 | |||
| 1788 | Ga0075363_100946565 | |||
| 1789 | Ga0075364_10589544 | |||
| 1790 | Ga0075364_10720532 | |||
| 1791 | Ga0075364_10904668 | |||
| 1792 | Ga0070715_10005372 | |||
| 1793 | Ga0070716_100078714 | |||
| 1794 | Ga0070716_100690990 | |||
| 1795 | Ga0070716_101008191 | |||
| 1796 | Ga0070712_100098511 | |||
| 1797 | Ga0070712_100142802 | |||
| 1798 | Ga0070712_100238449 | |||
| 1799 | Ga0070712_101486979 | |||
| 1800 | Ga0075362_10377500 | |||
| 1801 | Ga0075367_10029703 | |||
| 1802 | Ga0075367_10032866 | |||
| 1803 | Ga0075367_10033392 | |||
| 1804 | Ga0075367_10063233 | |||
| 1805 | Ga0075367_10249298 | |||
| 1806 | Ga0075367_10860052 | |||
| 1807 | Ga0075369_10111089 | |||
| 1808 | Ga0075366_10184467 | |||
| 1809 | Ga0075366_10483446 | |||
| 1810 | Ga0097621_100786338 | |||
| 1811 | Ga0097621_101364779 | |||
| 1812 | Ga0075370_10110987 | |||
| 1813 | Ga0075370_10237161 | |||
| 1814 | Ga0075370_10588450 | |||
| 1815 | Ga0068871_100808109 | |||
| 1816 | Ga0068871_100919258 | |||
| 1817 | Ga0075434_102396040 | |||
| 1818 | Ga0068865_100359398 | |||
| 1819 | Ga0068865_101103683 | |||
| 1820 | Ga0097620_101596536 | |||
| 1821 | Ga0099824_1004610 | |||
| 1822 | Ga0099822_1001276 | |||
| 1823 | Ga0075435_100156290 | |||
| 1824 | Ga0099794_10037121 | |||
| 1825 | Ga0099794_10044971 | |||
| 1826 | Ga0099794_10052805 | |||
| 1827 | Ga0099795_10028020 | |||
| 1828 | Ga0099795_10330472 | |||
| 1829 | Ga0099795_10350483 | |||
| 1830 | Ga0099795_10428823 | |||
| 1831 | Ga0099795_10532114 | |||
| 1832 | Ga0105250_10213935 | |||
| 1833 | Ga0105240_10005415 | |||
| 1834 | Ga0105240_10040418 | |||
| 1835 | Ga0105240_10052328 | |||
| 1836 | Ga0105240_10083106 | |||
| 1837 | Ga0105240_10146974 | |||
| 1838 | Ga0105240_10411111 | |||
| 1839 | Ga0105240_11229578 | |||
| 1840 | Ga0105240_11334528 | |||
| 1841 | Ga0105240_11910566 | |||
| 1842 | Ga0111539_10334875 | |||
| 1843 | Ga0105245_10570787 | |||
| 1844 | Ga0105245_10788219 | |||
| 1845 | Ga0105245_10844199 | |||
| 1846 | Ga0105245_11334991 | |||
| 1847 | Ga0105245_13014047 | |||
| 1848 | Ga0105247_10151737 | |||
| 1849 | Ga0105247_10257934 | |||
| 1850 | Ga0105247_11070066 | |||
| 1851 | Ga0105247_11345461 | |||
| 1852 | Ga0114129_12467396 | |||
| 1853 | Ga0105243_10215195 | |||
| 1854 | Ga0105243_10351053 | |||
| 1855 | Ga0105243_10493839 | |||
| 1856 | Ga0105243_11980105 | |||
| 1857 | Ga0105241_10011989 | |||
| 1858 | Ga0105241_10057701 | |||
| 1859 | Ga0105241_10174510 | |||
| 1860 | Ga0105241_10555106 | |||
| 1861 | Ga0105241_10575649 | |||
| 1862 | Ga0105241_10703849 | |||
| 1863 | Ga0105242_11111635 | |||
| 1864 | Ga0105242_11277903 | |||
| 1865 | Ga0105242_11791518 | |||
| 1866 | Ga0105242_12759302 | |||
| 1867 | Ga0105248_10132319 | |||
| 1868 | Ga0105248_10319725 | |||
| 1869 | Ga0105248_10530177 | |||
| 1870 | Ga0105248_10574246 | |||
| 1871 | Ga0105248_11361564 | |||
| 1872 | Ga0105248_11378649 | |||
| 1873 | Ga0105248_13215771 | |||
| 1874 | Ga0105237_10003346 | |||
| 1875 | Ga0105237_10033346 | |||
| 1876 | Ga0105237_10174418 | |||
| 1877 | Ga0105237_10175568 | |||
| 1878 | Ga0105237_10210128 | |||
| 1879 | Ga0105237_10241999 | |||
| 1880 | Ga0105237_10559306 | |||
| 1881 | Ga0105237_10583113 | |||
| 1882 | Ga0105237_10647147 | |||
| 1883 | Ga0105237_10821601 | |||
| 1884 | Ga0105237_10901653 | |||
| 1885 | Ga0105237_11640848 | |||
| 1886 | Ga0105238_10008128 | |||
| 1887 | Ga0105238_10010310 | |||
| 1888 | Ga0105238_10020057 | |||
| 1889 | Ga0105238_10111158 | |||
| 1890 | Ga0105238_10111592 | |||
| 1891 | Ga0105238_10685766 | |||
| 1892 | Ga0105238_11137917 | |||
| 1893 | Ga0105238_12025769 | |||
| 1894 | Ga0105249_10154863 | |||
| 1895 | Ga0105249_10608031 | |||
| 1896 | Ga0105249_12534635 | |||
| 1897 | Ga0105249_12780345 | |||
| 1898 | Ga0099796_10054915 | |||
| 1899 | Ga0105239_10008096 | |||
| 1900 | Ga0105239_10094734 | |||
| 1901 | Ga0105239_10110779 | |||
| 1902 | Ga0105239_10189475 | |||
| 1903 | Ga0105239_10199526 | |||
| 1904 | Ga0105239_10258381 | |||
| 1905 | Ga0105239_10278959 | |||
| 1906 | Ga0105239_10412241 | |||
| 1907 | Ga0105239_10479498 | |||
| 1908 | Ga0105239_11890350 | |||
| 1909 | Ga0105246_10557030 | |||
| 1910 | Ga0105246_10669763 | |||
| 1911 | Ga0105246_10675893 | |||
| 1912 | Ga0105246_11351798 | |||
| 1913 | Ga0105246_12596514 | |||
| 1914 | Ga0157335_1043756 | |||
| 1915 | Ga0157373_10305646 | |||
| 1916 | Ga0157373_11062339 | |||
| 1917 | Ga0157371_10215678 | |||
| 1918 | Ga0157371_10244328 | |||
| 1919 | Ga0157371_11175114 | |||
| 1920 | Ga0157370_10016462 | |||
| 1921 | Ga0157370_10140677 | |||
| 1922 | Ga0157370_10185303 | |||
| 1923 | Ga0157370_10236824 | |||
| 1924 | Ga0157370_10243505 | |||
| 1925 | Ga0157370_10447684 | |||
| 1926 | Ga0157370_11155309 | |||
| 1927 | Ga0157369_10024515 | |||
| 1928 | Ga0157369_10040217 | |||
| 1929 | Ga0157369_10050357 | |||
| 1930 | Ga0157369_10335206 | |||
| 1931 | Ga0157369_11452230 | |||
| 1932 | Ga0157369_12181332 | |||
| 1933 | Ga0157374_10031861 | |||
| 1934 | Ga0157374_10039337 | |||
| 1935 | Ga0157374_11040664 | |||
| 1936 | Ga0157378_10003448 | |||
| 1937 | Ga0157378_10614676 | |||
| 1938 | Ga0163162_10045197 | |||
| 1939 | Ga0163162_10071696 | |||
| 1940 | Ga0163162_10134925 | |||
| 1941 | Ga0163162_10514310 | |||
| 1942 | Ga0163162_11088176 | |||
| 1943 | Ga0163162_11428228 | |||
| 1944 | Ga0163162_12358142 | |||
| 1945 | Ga0157372_10078020 | |||
| 1946 | Ga0157372_10244820 | |||
| 1947 | Ga0157372_10746197 | |||
| 1948 | Ga0157372_12771001 | |||
| 1949 | Ga0157372_13473488 | |||
| 1950 | Ga0157375_10007186 | |||
| 1951 | Ga0157375_13480546 | |||
| 1952 | Ga0163163_10010706 | |||
| 1953 | Ga0163163_10717523 | |||
| 1954 | Ga0157380_10075129 | |||
| 1955 | Ga0157380_10422614 | |||
| 1956 | Ga0157380_10614007 | |||
| 1957 | Ga0157380_10748389 | |||
| 1958 | Ga0157377_10094096 | |||
| 1959 | Ga0157377_11349733 | |||
| 1960 | Ga0157379_10106263 | |||
| 1961 | Ga0157379_10257354 | |||
| 1962 | Ga0157379_10686939 | |||
| 1963 | Ga0157379_11891309 | |||
| 1964 | Ga0157379_11992885 | |||
| 1965 | Ga0157376_10052581 | |||
| 1966 | Ga0157376_10393643 | |||
| 1967 | Ga0157376_10580615 | |||
| 1968 | Ga0157376_11446977 | |||
| 1969 | Ga0163161_10195980 | |||
| 1970 | Ga0163161_10445352 | |||
| 1971 | Ga0163161_11286351 | |||
| 1972 | Ga0163161_11438589 | |||
| 1973 | Ga0163161_12071814 | |||
| 1974 | Ga0197907_11095771 | |||
| 1975 | Ga0197907_11224085 | |||
| 1976 | Ga0197907_11225209 | |||
| 1977 | Ga0206356_10682141 | |||
| 1978 | Ga0206352_11039941 | |||
| 1979 | Ga0206350_10942758 | |||
| 1980 | Ga0206350_11631821 | |||
| 1981 | Ga0206353_12019823 | |||
| 1982 | Ga0213874_10134625 | |||
| 1983 | Ga0213876_10072948 | |||
| 1984 | Ga0213876_10127854 | |||
| 1985 | Ga0213876_10334614 | |||
| 1986 | Ga0213875_10087284 | |||
| 1987 | Ga0224712_10073442 | |||
| 1988 | Ga0224712_10122025 | |||
| 1989 | Ga0224570_101679 | |||
| 1990 | Ga0209677_100555 | |||
| 1991 | Ga0209148_1000679 | |||
| 1992 | Ga0209148_1007771 | |||
| 1993 | Ga0209233_1000826 | |||
| 1994 | Ga0209233_1011008 | |||
| 1995 | Ga0209455_1002608 | |||
| 1996 | Ga0209455_1002958 | |||
| 1997 | Ga0209455_1008958 | |||
| 1998 | Ga0209455_1009718 | |||
| 1999 | Ga0209758_1001784 | |||
| 2000 | Ga0209758_1007742 | |||
| 2001 | Ga0209758_1024291 | |||
| 2002 | Ga0209758_1024339 | |||
| 2003 | Ga0207656_10004296 | |||
| 2004 | Ga0207656_10163328 | |||
| 2005 | Ga0207656_10569553 | |||
| 2006 | Ga0207653_10452208 | |||
| 2007 | Ga0207682_10045943 | |||
| 2008 | Ga0207692_10020408 | |||
| 2009 | Ga0207642_10714977 | |||
| 2010 | Ga0207710_10210708 | |||
| 2011 | Ga0207710_10515929 | |||
| 2012 | Ga0207688_10181400 | |||
| 2013 | Ga0207688_10961159 | |||
| 2014 | Ga0207680_10112386 | |||
| 2015 | Ga0207647_10003286 | |||
| 2016 | Ga0207647_10300436 | |||
| 2017 | Ga0207647_10596612 | |||
| 2018 | Ga0207647_10751145 | |||
| 2019 | Ga0207685_10001042 | |||
| 2020 | Ga0207699_10044277 | |||
| 2021 | Ga0207699_10128177 | |||
| 2022 | Ga0207705_10089452 | |||
| 2023 | Ga0207705_10109795 | |||
| 2024 | Ga0207705_10129403 | |||
| 2025 | Ga0207705_10296394 | |||
| 2026 | Ga0207705_10477844 | |||
| 2027 | Ga0207684_10051065 | |||
| 2028 | Ga0207684_10092573 | |||
| 2029 | Ga0207654_10003714 | |||
| 2030 | Ga0207654_10094570 | |||
| 2031 | Ga0207654_10743399 | |||
| 2032 | Ga0207707_10092864 | |||
| 2033 | Ga0207707_10130915 | |||
| 2034 | Ga0207707_10439382 | |||
| 2035 | Ga0207707_10626553 | |||
| 2036 | Ga0207695_10000599 | |||
| 2037 | Ga0207695_10002303 | |||
| 2038 | Ga0207695_10074812 | |||
| 2039 | Ga0207695_10109656 | |||
| 2040 | Ga0207695_10203359 | |||
| 2041 | Ga0207695_10265948 | |||
| 2042 | Ga0207695_10267429 | |||
| 2043 | Ga0207695_10290525 | |||
| 2044 | Ga0207671_10141728 | |||
| 2045 | Ga0207671_10171331 | |||
| 2046 | Ga0207671_10377251 | |||
| 2047 | Ga0207671_10620565 | |||
| 2048 | Ga0207671_10932425 | |||
| 2049 | Ga0207693_10013985 | |||
| 2050 | Ga0207693_10041374 | |||
| 2051 | Ga0207693_10306622 | |||
| 2052 | Ga0207693_10487333 | |||
| 2053 | Ga0207693_11121217 | |||
| 2054 | Ga0207663_10002010 | |||
| 2055 | Ga0207663_10002313 | |||
| 2056 | Ga0207663_10691243 | |||
| 2057 | Ga0207663_10855896 | |||
| 2058 | Ga0207663_11206933 | |||
| 2059 | Ga0207660_10212059 | |||
| 2060 | Ga0207660_10252814 | |||
| 2061 | Ga0207660_10577195 | |||
| 2062 | Ga0207660_10772991 | |||
| 2063 | Ga0207660_11055168 | |||
| 2064 | Ga0207657_10009199 | |||
| 2065 | Ga0207657_10085378 | |||
| 2066 | Ga0207657_10125436 | |||
| 2067 | Ga0207657_10700502 | |||
| 2068 | Ga0207649_10043126 | |||
| 2069 | Ga0207649_10079206 | |||
| 2070 | Ga0207649_10398824 | |||
| 2071 | Ga0207649_10931210 | |||
| 2072 | Ga0207652_10005095 | |||
| 2073 | Ga0207652_10254405 | |||
| 2074 | Ga0207652_10881376 | |||
| 2075 | Ga0207681_10194374 | |||
| 2076 | Ga0207694_10000640 | |||
| 2077 | Ga0207694_10134093 | |||
| 2078 | Ga0207694_10459084 | |||
| 2079 | Ga0207694_10602344 | |||
| 2080 | Ga0207694_10707534 | |||
| 2081 | Ga0207694_10729523 | |||
| 2082 | Ga0207650_10873091 | |||
| 2083 | Ga0207659_10491751 | |||
| 2084 | Ga0207687_10554607 | |||
| 2085 | Ga0207687_10578300 | |||
| 2086 | Ga0207687_11009816 | |||
| 2087 | Ga0207687_11790879 | |||
| 2088 | Ga0207700_10022317 | |||
| 2089 | Ga0207700_10174459 | |||
| 2090 | Ga0207700_10256614 | |||
| 2091 | Ga0207700_10367183 | |||
| 2092 | Ga0207700_10446643 | |||
| 2093 | Ga0207664_10055917 | |||
| 2094 | Ga0207664_10119959 | |||
| 2095 | Ga0207664_10475362 | |||
| 2096 | Ga0207644_10163491 | |||
| 2097 | Ga0207644_10277151 | |||
| 2098 | Ga0207644_10507726 | |||
| 2099 | Ga0207690_10890636 | |||
| 2100 | Ga0207690_10959011 | |||
| 2101 | Ga0207706_10058421 | |||
| 2102 | Ga0207706_11100858 | |||
| 2103 | Ga0207709_10065653 | |||
| 2104 | Ga0207709_10184702 | |||
| 2105 | Ga0207709_11478805 | |||
| 2106 | Ga0207709_11530521 | |||
| 2107 | Ga0207670_11360322 | |||
| 2108 | Ga0207669_10070854 | |||
| 2109 | Ga0207669_10076801 | |||
| 2110 | Ga0207669_10658254 | |||
| 2111 | Ga0207669_11534020 | |||
| 2112 | Ga0207704_10557315 | |||
| 2113 | Ga0207704_11119926 | |||
| 2114 | Ga0207665_10041850 | |||
| 2115 | Ga0207665_10120497 | |||
| 2116 | Ga0207665_10252968 | |||
| 2117 | Ga0207665_10472413 | |||
| 2118 | Ga0207665_10731091 | |||
| 2119 | Ga0207665_10959934 | |||
| 2120 | Ga0207665_11589355 | |||
| 2121 | Ga0207711_10563029 | |||
| 2122 | Ga0207711_10697783 | |||
| 2123 | Ga0207689_10309853 | |||
| 2124 | Ga0207689_10380514 | |||
| 2125 | Ga0207661_10374944 | |||
| 2126 | Ga0207679_11700178 | |||
| 2127 | Ga0207667_10012446 | |||
| 2128 | Ga0207667_10021203 | |||
| 2129 | Ga0207667_10041398 | |||
| 2130 | Ga0207667_10101350 | |||
| 2131 | Ga0207667_10284556 | |||
| 2132 | Ga0207667_11512159 | |||
| 2133 | Ga0207651_10452497 | |||
| 2134 | Ga0207651_10626538 | |||
| 2135 | Ga0207712_11345624 | |||
| 2136 | Ga0207712_11489807 | |||
| 2137 | Ga0207668_10077889 | |||
| 2138 | Ga0207668_10087260 | |||
| 2139 | Ga0207668_11073236 | |||
| 2140 | Ga0207668_11521347 | |||
| 2141 | Ga0207668_11759665 | |||
| 2142 | Ga0207640_10010628 | |||
| 2143 | Ga0207640_10024190 | |||
| 2144 | Ga0207640_10035195 | |||
| 2145 | Ga0207640_10275383 | |||
| 2146 | Ga0207640_10404024 | |||
| 2147 | Ga0207640_10570080 | |||
| 2148 | Ga0207640_11320264 | |||
| 2149 | Ga0207658_10100841 | |||
| 2150 | Ga0207658_10143622 | |||
| 2151 | Ga0207658_10594233 | |||
| 2152 | Ga0207677_10312120 | |||
| 2153 | Ga0207677_11482782 | |||
| 2154 | Ga0207703_10194599 | |||
| 2155 | Ga0207703_10714751 | |||
| 2156 | Ga0207703_11273723 | |||
| 2157 | Ga0207639_10052968 | |||
| 2158 | Ga0207639_10174315 | |||
| 2159 | Ga0207639_10245388 | |||
| 2160 | Ga0207639_10292854 | |||
| 2161 | Ga0207639_10311621 | |||
| 2162 | Ga0207639_10333323 | |||
| 2163 | Ga0207639_10502162 | |||
| 2164 | Ga0207639_11206571 | |||
| 2165 | Ga0207639_11277243 | |||
| 2166 | Ga0207678_10042283 | |||
| 2167 | Ga0207678_10075869 | |||
| 2168 | Ga0207678_10097040 | |||
| 2169 | Ga0207678_10200354 | |||
| 2170 | Ga0207678_10201488 | |||
| 2171 | Ga0207678_10489075 | |||
| 2172 | Ga0207678_10611270 | |||
| 2173 | Ga0207678_11475109 | |||
| 2174 | Ga0207708_10068850 | |||
| 2175 | Ga0207708_10394649 | |||
| 2176 | Ga0207702_10000005 | |||
| 2177 | Ga0207702_10000433 | |||
| 2178 | Ga0207702_10020902 | |||
| 2179 | Ga0207702_10194951 | |||
| 2180 | Ga0207702_10300203 | |||
| 2181 | Ga0207702_10990543 | |||
| 2182 | Ga0207702_11064745 | |||
| 2183 | Ga0207702_11880475 | |||
| 2184 | Ga0207702_11897168 | |||
| 2185 | Ga0207641_10588933 | |||
| 2186 | Ga0207641_10625206 | |||
| 2187 | Ga0207641_11650193 | |||
| 2188 | Ga0207648_10095272 | |||
| 2189 | Ga0207648_11856729 | |||
| 2190 | Ga0207676_10137053 | |||
| 2191 | Ga0207676_10550371 | |||
| 2192 | Ga0207674_10025823 | |||
| 2193 | Ga0207674_10233451 | |||
| 2194 | Ga0207674_10338901 | |||
| 2195 | Ga0207674_10910219 | |||
| 2196 | Ga0207675_100163882 | |||
| 2197 | Ga0207683_10008058 | |||
| 2198 | Ga0207683_10046111 | |||
| 2199 | Ga0207683_10106690 | |||
| 2200 | Ga0207683_10707076 | |||
| 2201 | Ga0207683_10900659 | |||
| 2202 | Ga0207683_10944610 | |||
| 2203 | Ga0207698_10583589 | |||
| 2204 | Ga0207698_10749213 | |||
| 2205 | Ga0207698_10852498 | |||
| 2206 | Ga0207698_12713805 | |||
| 2207 | Ga0209589_1000030 | |||
| 2208 | Ga0209489_100056 | |||
| 2209 | Ga0209700_100059 | |||
| 2210 | Ga0209179_1004966 | |||
| 2211 | Ga0209179_1017500 | |||
| 2212 | Ga0209588_1079584 | |||
| 2213 | Ga0209588_1183741 | |||
| 2214 | Ga0209813_10132975 | |||
| 2215 | Ga0207428_10772282 | |||
| 2216 | Ga0268266_10232069 | |||
| 2217 | Ga0268266_10360838 | |||
| 2218 | Ga0268266_10807257 | |||
| 2219 | Ga0268266_11254070 | |||
| 2220 | Ga0268266_11348623 | |||
| 2221 | Ga0268266_11649498 | |||
| 2222 | Ga0268266_11726338 | |||
| 2223 | Ga0268265_10478508 | |||
| 2224 | Ga0268265_10684147 | |||
| 2225 | Ga0268264_10924040 | |||
| 2226 | Ga0268264_11234764 | |||
| 2227 | Ga0307517_10000125 | |||
| 2228 | Ga0307515_10055660 | |||
| 2229 | Ga0307515_10163776 | |||
| 2230 | Ga0265338_10173830 | |||
| 2231 | Ga0265330_10025197 | |||
| 2232 | Ga0265330_10061925 | |||
| 2233 | Ga0265332_10037612 | |||
| 2234 | Ga0265328_10095601 | |||
| 2235 | Ga0265328_10263380 | |||
| 2236 | Ga0265329_10289463 | |||
| 2237 | Ga0265340_10012295 | |||
| 2238 | Ga0265339_10003767 | |||
| 2239 | Ga0265339_10492337 | |||
| 2240 | Ga0265331_10130333 | |||
| 2241 | Ga0265331_10253617 | |||
| 2242 | Ga0265316_10180062 | |||
| 2243 | Ga0265316_10397324 | |||
| 2244 | Ga0307513_10246201 | |||
| 2245 | Ga0307509_10429566 | |||
| 2246 | Ga0307408_100750454 | |||
| 2247 | Ga0265313_10333725 | |||
| 2248 | Ga0307508_10055655 | |||
| 2249 | Ga0307508_10128819 | |||
| 2250 | Ga0265314_10001745 | |||
| 2251 | Ga0265314_10070770 | |||
| 2252 | Ga0265314_10175562 | |||
| 2253 | Ga0265342_10107254 | |||
| 2254 | Ga0265342_10364779 | |||
| 2255 | Ga0307516_10018995 | |||
| 2256 | Ga0307516_10513343 | |||
| 2257 | Ga0307516_10546770 | |||
| 2258 | Ga0307516_10707194 | |||
| 2259 | Ga0307405_11235505 | |||
| 2260 | Ga0307406_10248824 | |||
| 2261 | Ga0307412_10052533 | |||
| 2262 | Ga0307412_10301259 | |||
| 2263 | Ga0307416_100217519 | |||
| 2264 | Ga0307416_100959145 | |||
| 2265 | Ga0307411_10904363 | |||
| 2266 | Ga0307415_100053891 | |||
| 2267 | Ga0307415_100499764 | |||
| 2268 | Ga0307415_101120864 | |||
| 2269 | Ga0307510_10107608 | |||
| 2270 | Ga0307510_10120976 | |||
| 2271 | Ga0307510_10540196 | |||
| 2272 | Ga0373930_0038412 | |||
| 2273 | Ga0373958_0036881 | |||
| 2274 | Ga0373938_0230309 | |||
| 2275 | Ga0373926_0141580 | |||
| 2276 | Ga0373926_0318413 | |||
| 2277 | Ga0373928_0236558 | |||
| 2278 | Ga0373929_0092984 | |||
| 2279 | Ga0373934_0073895 | |||
| 2280 | Ga0373934_0133542 | |||
| 2281 | Ga0373934_0411152 | |||
| 2282 | Ga0373940_0035284 | |||
| 2283 | Ga0373944_0105233 | |||
| 2284 | Ga0373923_0004696 | |||
| 2285 | Ga0373923_0036190 | |||
| 2286 | Ga0373941_0307231 | |||
| 2287 | Ga0373945_0010983 | |||
| 2288 | Ga0373953_0000463 | |||
| 2289 | Ga0373953_0180656 | |||
| 2290 | Ga0373954_0000100 | |||
| 2291 | Ga0373954_0014263 | |||
| 2292 | Ga0373954_0495116 | |||
| 2293 | Ga0373956_0019223 | |||
| 2294 | Ga0373957_0001114 | |||
| 2295 | Ga0373943_0004760 | |||
| 2296 | Ga0373943_0136905 | |||
| 2297 | Ga0373946_0130797 | |||
| 2298 | Ga0373946_0584415 | |||
| 2299 | Ga0373955_0010060 | |||
| 2300 | Ga0373955_0127201 | |||
| 2301 | Ga0373962_0036173 | |||
| 2302 | Ga0373962_0060465 | |||
| 2303 | Ga0373924_0013364 | |||
| 2304 | Ga0373931_0001608 | |||
| 2305 | Ga0373935_0004029 | |||
| 2306 | Ga0373935_1372752 | |||
| 2307 | Ga0373935_1382231 | |||
| 2308 | Ga0373927_0001617 | |||
| 2309 | Ga0373927_0014401 | |||
| 2310 | Ga0373927_0538974 | |||
| 2311 | Ga0373933_0001041 | |||
| 2312 | Ga0373933_0340258 | |||
| 2313 | Ga0373933_1007008 | |||
| 2314 | Ga0373947_0004404 | |||
| 2315 | Ga0373947_0032215 | |||
| 2316 | Ga0373937_0005062 | |||
| 2317 | Ga0373937_0389086 | |||
| 2318 | Ga0373937_0588556 | |||
| 2319 | Ga0373937_0790140 | |||
| 2320 | Ga0373937_1017379 | |||
| 2321 | Ga0372808_000421 | |||
| 2322 | Ga0373925_0002598 | |||
| 2323 | Ga0373925_0779909 | |||
| 2324 | Ga0373925_1588926 | |||
| 2325 | Ga0395899_0108428 | |||
| 2326 | Ga0395899_0557658 | |||
| 2327 | Ga0395899_0967895 | |||
| 2328 | Ga0395900_0002106 | |||
| 2329 | Ga0395900_0158896 | |||
| 2330 | Ga0395900_0244986 | |||
| 2331 | Ga0395900_0289829 | |||
| 2332 | Ga0395900_0469775 | |||
| 2333 | Ga0395900_1172711 | |||
| 2334 | Ga0395898_0003923 | |||
| 2335 | Ga0395898_0199944 | |||
| 2336 | Ga0395898_0212749 | |||
| 2337 | Ga0395898_0249329 | |||
| 2338 | Ga0395898_0306631 | |||
| 2339 | Ga0395905_0066254 | |||
| 2340 | Ga0395905_0403856 | |||
| 2341 | Ga0395905_0890155 | |||
| 2342 | Ga0436364_0344445 | |||
| 2343 | Ga0436364_0626210 | |||
| 2344 | Ga0436364_0651896 | |||
| 2345 | Ga0436364_1050259 | |||
| 2346 | Ga0395901_0032684 | |||
| 2347 | Ga0395901_0298980 | |||
| 2348 | Ga0395901_0353548 | |||
| 2349 | Ga0395901_0467589 | |||
| 2350 | Ga0395901_0665552 | |||
| 2351 | Ga0395901_0867720 | |||
| 2352 | Ga0395901_1427702 | |||
| 2353 | Ga0436365_0992198 | |||
| 2354 | Ga0436365_1078347 | |||
| 2355 | Ga0436365_1157227 | |||
| 2356 | Ga0436365_1195892 | |||
| 2357 | Ga0436365_1424718 | |||
| 2358 | Ga0436365_1555241 | |||
| 2359 | Ga0436365_1647844 | |||
| 2360 | Ga0436365_1732278 | |||
| 2361 | Ga0436360_1371031 | |||
| 2362 | Ga0436363_0206535 | |||
| 2363 | Ga0436363_1215029 | |||
| 2364 | Ga0436363_1432430 | |||
| 2365 | Ga0436363_1589976 | |||
| 2366 | Ga0439465_0407873 | |||
| 2367 | Ga0451793_0327457 | |||
| 2368 | Ga0451795_1651510 | |||
| 2369 | Ga0451800_1312593 | |||
| 2370 | Ga0451802_1094405 | |||
| 2371 | Ga0451833_0594095 | |||
| 2372 | Ga0451833_0727547 | |||
| 2373 | Ga0451837_1227548 | |||
| 2374 | Ga0451839_0688458 | |||
| 2375 | Ga0451839_1243053 | |||
| 2376 | Ga0451853_3366637 | |||
| 2377 | Ga0439459_0038845 | |||
| 2378 | Ga0466969_0018365 | |||
| 2379 | Ga0466972_0000156 | |||
| 2380 | Ga0466972_0366117 | |||
| 2381 | Ga0466966_0001022 | |||
| 2382 | Ga0466961_0000338 | |||
| 2383 | Ga0466961_0128563 | |||
| 2384 | Ga0466963_0023740 | |||
| 2385 | Ga0466964_0278399 | |||
| 2386 | Ga0466970_0146132 | |||
| 2387 | Ga0466970_0767049 | |||
| 2388 | Ga0466957_0130623 | |||
| 2389 | Ga0466957_0149405 | |||
| 2390 | Ga0466957_0202595 | |||
| 2391 | Ga0466959_0016981 | |||
| 2392 | Ga0466959_0585822 | |||
| 2393 | Ga0466959_0792666 | |||
| 2394 | Ga0466958_0075935 | |||
| 2395 | Ga0466967_0047812 | |||
| 2396 | Ga0466967_0094054 | |||
| 2397 | Ga0466967_0125493 | |||
| 2398 | Ga0466967_0127173 | |||
| 2399 | Ga0495617_243007 | |||
| 2400 | Ga0495592_0001413 | |||
| 2401 | Ga0495592_0014218 | |||
| 2402 | Ga0495592_0031368 | |||
| 2403 | Ga0495603_0000660 | |||
| 2404 | Ga0495603_0028560 | |||
| 2405 | Ga0495603_0054333 | |||
| 2406 | Ga0495603_0075202 | |||
| 2407 | Ga0495590_0224292 | |||
| 2408 | Ga0495629_0000467 | |||
| 2409 | Ga0495629_0002123 | |||
| 2410 | Ga0495629_0225543 | |||
| 2411 | Ga0495629_0330702 | |||
| 2412 | Ga0495638_0012737 | |||
| 2413 | Ga0495638_0040822 | |||
| 2414 | Ga0495641_0007394 | |||
| 2415 | Ga0495641_0584011 | |||
| 2416 | Ga0495651_0000990 | |||
| 2417 | Ga0495651_0002095 | |||
| 2418 | Ga0495651_0149571 | |||
| 2419 | Ga0495653_0000149 | |||
| 2420 | Ga0495650_0156834 | |||
| 2421 | Ga0495650_0314071 | |||
| 2422 | Ga0495580_0003995 | |||
| 2423 | Ga0495582_0000163 | |||
| 2424 | Ga0495605_0151716 | |||
| 2425 | Ga0495639_0000640 | |||
| 2426 | Ga0495639_0025777 | |||
| 2427 | Ga0495662_0000890 | |||
| 2428 | Ga0495662_0372646 | |||
| 2429 | Ga0495662_0528146 | |||
| 2430 | Ga0495664_0008332 | |||
| 2431 | Ga0495664_0197730 | |||
| 2432 | Ga0495664_0247954 | |||
| 2433 | Ga0495594_0001989 | |||
| 2434 | Ga0495594_0285770 | |||
| 2435 | Ga0495596_0078141 | |||
| 2436 | Ga0495596_0185530 | |||
| 2437 | Ga0495596_0214352 | |||
| 2438 | Ga0495596_0218561 | |||
| 2439 | Ga0495583_0032139 | |||
| 2440 | Ga0495606_0001450 | |||
| 2441 | Ga0495606_0006099 | |||
| 2442 | Ga0495606_0080671 | |||
| 2443 | Ga0495608_0005251 | |||
| 2444 | Ga0495608_0015229 | |||
| 2445 | Ga0495608_0755070 | |||
| 2446 | Ga0495616_0315095 | |||
| 2447 | Ga0495618_0086712 | |||
| 2448 | Ga0495620_0044299 | |||
| 2449 | Ga0495620_0093678 | |||
| 2450 | Ga0495620_0187272 | |||
| 2451 | Ga0495628_0010023 | |||
| 2452 | Ga0495628_0020141 | |||
| 2453 | Ga0495628_0765819 | |||
| 2454 | Ga0495630_0002387 | |||
| 2455 | Ga0495630_0345867 | |||
| 2456 | Ga0495630_1030519 | |||
| 2457 | Ga0495632_0274356 | |||
| 2458 | Ga0495637_0016691 | |||
| 2459 | Ga0495643_0112755 | |||
| 2460 | Ga0495644_0065593 | |||
| 2461 | Ga0495648_0007574 | |||
| 2462 | Ga0495648_0106109 | |||
| 2463 | Ga0495648_0111854 | |||
| 2464 | Ga0495648_0146487 | |||
| 2465 | Ga0495666_0021596 | |||
| 2466 | Ga0495652_0005306 | |||
| 2467 | Ga0495652_0023393 | |||
| 2468 | Ga0495652_0209577 | |||
| 2469 | Ga0495654_0012290 | |||
| 2470 | Ga0495665_0000853 | |||
| 2471 | Ga0495665_0040789 | |||
| 2472 | Ga0495665_0604804 | |||
| 2473 | Ga0495640_0012917 | |||
| 2474 | Ga0495640_0025937 | |||
| 2475 | Ga0495640_0132066 | |||
| 2476 | Ga0495586_0532602 | |||
| 2477 | Ga0495586_0702272 | |||
| 2478 | Ga0495587_0001665 | |||
| 2479 | Ga0495587_0008004 | |||
| 2480 | Ga0495598_0061283 | |||
| 2481 | Ga0495645_0023487 | |||
| 2482 | Ga0495645_0129803 | |||
| 2483 | Ga0495622_0003281 | |||
| 2484 | Ga0495622_0016304 | |||
| 2485 | Ga0495622_0332677 | |||
| 2486 | Ga0495633_0236463 | |||
| 2487 | Ga0495667_0002267 | |||
| 2488 | Ga0495667_0512475 | |||
| 2489 | Ga0495667_0698143 | |||
| 2490 | Ga0495667_0720396 | |||
| 2491 | Ga0495656_0054558 | |||
| 2492 | Ga0495656_0150905 | |||
| 2493 | Ga0495656_0356684 | |||
| 2494 | Ga0495668_0064412 | |||
| 2495 | Ga0495668_0373714 | |||
| 2496 | Ga0495634_0001271 | |||
| 2497 | Ga0495634_0117765 | |||
| 2498 | Ga0495634_0212368 | |||
| 2499 | Ga0495611_0054760 | |||
| 2500 | Ga0495625_0226442 | |||
| 2501 | Ga0495625_0421953 | |||
| 2502 | Ga0495625_0609923 | |||
| 2503 | Ga0495635_0001373 | |||
| 2504 | Ga0495635_0015240 | |||
| 2505 | Ga0495635_0036867 | |||
| 2506 | Ga0495659_0030274 | |||
| 2507 | Ga0495661_0057606 | |||
| 2508 | Ga0495588_0027529 | |||
| 2509 | Ga0495657_0000445 | |||
| 2510 | Ga0495657_0001981 | |||
| 2511 | Ga0495657_0186330 | |||
| 2512 | Ga0495657_0267822 | |||
| 2513 | Ga0495599_0000450 | |||
| 2514 | Ga0495599_0318470 | |||
| 2515 | Ga0495599_0571704 | |||
| 2516 | Ga0495623_0006629 | |||
| 2517 | Ga0495623_0062848 | |||
| 2518 | Ga0495646_0003846 | |||
| 2519 | Ga0495646_0006264 | |||
| 2520 | Ga0495646_0063439 | |||
| 2521 | Ga0495647_0014045 | |||
| 2522 | Ga0495658_0000512 | |||
| 2523 | Ga0495669_0021105 | |||
| 2524 | Ga0495613_0002976 | |||
| 2525 | Ga0495613_0040734 | |||
| 2526 | Ga0495613_0085506 | |||
| 2527 | Ga0495613_0467991 | |||
| 2528 | Ga0495624_0019094 | |||
| 2529 | Ga0495624_0226569 | |||
| 2530 | Ga0495670_0277176 | |||
| 2531 | Ga0495671_0044571 | |||
| 2532 | Ga0495671_0341762 | |||
| 2533 | Ga0495649_0181182 | |||
| 2534 | Ga0495649_0253821 | |||
| 2535 | Ga0495589_0028749 | |||
| 2536 | Ga0495600_0000243 | |||
| 2537 | Ga0495600_0001485 | |||
| 2538 | Ga0495600_0136217 | |||
| 2539 | Ga0495600_0676884 | |||
| 2540 | Ga0495660_0104445 | |||
| 2541 | Ga0495581_0002361 | |||
| 2542 | Ga0495581_0062660 | |||
| 2543 | Ga0495604_0000525 | |||
| 2544 | Ga0495604_0004201 | |||
| 2545 | Ga0495636_0197309 | |||
| 2546 | Ga0495674_0013125 | |||
| 2547 | Ga0495674_0038125 | |||
| 2548 | Ga0495674_0071551 | |||
| 2549 | Ga0495672_0012280 | |||
| 2550 | Ga0495672_0059610 | |||
| 2551 | Ga0495672_0128374 | |||
| 2552 | Ga0495672_0166549 | |||
| 2553 | Ga0495676_0035112 | |||
| 2554 | Ga0495680_0000424 | |||
| 2555 | Ga0495680_0003418 | |||
| 2556 | Ga0495680_0122447 | |||
| 2557 | Ga0495675_0024615 | |||
| 2558 | Ga0495675_0060810 | |||
| 2559 | Ga0495673_0086501 | |||
| 2560 | Ga0495673_0191689 | |||
| 2561 | Ga0495673_0338943 | |||
| 2562 | Ga0495684_0001470 | |||
| 2563 | Ga0495684_0045796 | |||
| 2564 | Ga0495686_0027149 | |||
| 2565 | Ga0495686_0186386 | |||
| 2566 | Ga0495686_0262306 | |||
| 2567 | Ga0495593_0000331 | |||
| 2568 | Ga0495593_0001055 | |||
| 2569 | Ga0495602_0001865 | |||
| 2570 | Ga0495602_0008889 | |||
| 2571 | Ga0495602_0527916 | |||
| 2572 | Ga0495602_0594187 | |||
| 2573 | Ga0495602_0784809 | |||
| 2574 | Ga0495602_1036048 | |||
| 2575 | Ga0495614_0011031 | |||
| 2576 | Ga0495614_0206206 | |||
| 2577 | Ga0496100_0011680 | |||
| 2578 | Ga0496100_0110459 | |||
| 2579 | Ga0496100_0110464 | |||
| 2580 | Ga0496100_0727466 | |||
| 2581 | Ga0496100_0754261 | |||
| 2582 | Ga0496100_0949607 | |||
| 2583 | Ga0496101_0009265 | |||
| 2584 | Ga0496101_0068709 | |||
| 2585 | Ga0496101_0193752 | |||
| 2586 | Ga0496101_0202769 | |||
| 2587 | Ga0496101_0470278 | |||
| 2588 | Ga0496101_0715198 | |||
| 2589 | Ga0496101_0938345 | |||
| 2590 | Ga0496102_0022547 | |||
| 2591 | Ga0496102_0109205 | |||
| 2592 | Ga0496102_0159967 | |||
| 2593 | Ga0496102_0435555 | |||
| 2594 | Ga0496102_0547730 | |||
| 2595 | Ga0496102_0852909 | |||
| 2596 | Ga0496102_0966253 | |||
| 2597 | Ga0496103_0042036 | |||
| 2598 | Ga0496104_0011363 | |||
| 2599 | Ga0496104_0016078 | |||
| 2600 | Ga0496104_0019100 | |||
| 2601 | Ga0496104_0074254 | |||
| 2602 | Ga0496104_0161312 | |||
| 2603 | Ga0496105_0056294 | |||
| 2604 | Ga0496105_0080798 | |||
| 2605 | Ga0496105_0227235 | |||
| 2606 | Ga0496106_0004969 | |||
| 2607 | Ga0496106_0047169 | |||
| 2608 | Ga0496106_0144827 | |||
| 2609 | Ga0496107_0007254 | |||
| 2610 | Ga0496107_0031659 | |||
| 2611 | Ga0496107_0060235 | |||
| 2612 | Ga0496107_0586757 | |||
| 2613 | Ga0496107_1353749 | |||
| 2614 | Ga0496108_0001645 | |||
| 2615 | Ga0496108_0003899 | |||
| 2616 | Ga0496108_0171639 | |||
| 2617 | Ga0496108_0285441 | |||
| 2618 | Ga0496108_0463431 | |||
| 2619 | Ga0496109_0037994 | |||
| 2620 | Ga0496109_0103725 | |||
| 2621 | Ga0496109_0150576 | |||
| 2622 | Ga0496110_0006735 | |||
| 2623 | Ga0496110_0085956 | |||
| 2624 | Ga0496110_0495570 | |||
| 2625 | Ga0496110_0497908 | |||
| 2626 | Ga0496111_0107288 | |||
| 2627 | Ga0496111_0186395 | |||
| 2628 | Ga0496111_0268133 | |||
| 2629 | Ga0496111_0655654 | |||
| 2630 | Ga0496111_0745204 | |||
| 2631 | Ga0496111_0813560 | |||
| 2632 | Ga0496112_0000021 | |||
| 2633 | Ga0496112_0006899 | |||
| 2634 | Ga0496112_0028461 | |||
| 2635 | Ga0496112_0038222 | |||
| 2636 | Ga0496112_0191023 | |||
| 2637 | Ga0496112_0193126 | |||
| 2638 | Ga0496112_0248747 | |||
| 2639 | Ga0496112_1441566 | |||
| 2640 | Ga0496113_0025392 | |||
| 2641 | Ga0496113_0067505 | |||
| 2642 | Ga0496113_0149239 | |||
| 2643 | Ga0496113_0446785 | |||
| 2644 | Ga0496114_0046685 | |||
| 2645 | Ga0496114_0281081 | |||
| 2646 | Ga0496114_0291477 | |||
| 2647 | Ga0496114_0426457 | |||
| 2648 | Ga0496114_0602887 | |||
| 2649 | Ga0496114_0686591 | |||
| 2650 | Ga0496114_0985766 | |||
| 2651 | Ga0496114_1386197 | |||
| 2652 | Ga0496114_1448124 | |||
| 2653 | Ga0496115_0003144 | |||
| 2654 | Ga0496115_0034207 | |||
| 2655 | Ga0496115_0144782 | |||
| 2656 | Ga0496115_0168065 | |||
| 2657 | Ga0496115_0198233 | |||
| 2658 | Ga0496115_0964515 | |||
| 2659 | Ga0496116_0010718 | |||
| 2660 | Ga0496116_0153382 | |||
| 2661 | Ga0496116_0314563 | |||
| 2662 | Ga0496117_0021072 | |||
| 2663 | Ga0496117_0112240 | |||
| 2664 | Ga0496117_0158226 | |||
| 2665 | Ga0496117_0581906 | |||
| 2666 | Ga0496118_0034875 | |||
| 2667 | Ga0496118_0037062 | |||
| 2668 | Ga0496118_0054161 | |||
| 2669 | Ga0496118_0057920 | |||
| 2670 | Ga0496119_0583445 | |||
| 2671 | Ga0496121_0001351 | |||
| 2672 | Ga0496121_0005807 | |||
| 2673 | Ga0496121_0006208 | |||
| 2674 | Ga0496121_0036938 | |||
| 2675 | Ga0496121_0041756 | |||
| 2676 | Ga0496121_0071436 | |||
| 2677 | Ga0496121_0101683 | |||
| 2678 | Ga0496121_0103599 | |||
| 2679 | Ga0496121_0132036 | |||
| 2680 | Ga0496121_0275289 | |||
| 2681 | Ga0496121_0292349 | |||
| 2682 | Ga0496121_0340423 | |||
| 2683 | Ga0496121_0412536 | |||
| 2684 | Ga0496121_0596017 | |||
| 2685 | Ga0496122_0028117 | |||
| 2686 | Ga0496122_0109985 | |||
| 2687 | Ga0496123_0014749 | |||
| 2688 | Ga0496123_0104476 | |||
| 2689 | Ga0496123_0175184 | |||
| 2690 | Ga0496124_0080946 | |||
| 2691 | Ga0496125_0000125 | |||
| 2692 | Ga0496125_0003380 | |||
| 2693 | Ga0496125_0004199 | |||
| 2694 | Ga0496125_0055867 | |||
| 2695 | Ga0496125_0114143 | |||
| 2696 | Ga0496126_0002146 | |||
| 2697 | Ga0496126_0109923 | |||
| 2698 | Ga0496126_0112096 | |||
| 2699 | Ga0496126_0123637 | |||
| 2700 | Ga0496126_0131392 | |||
| 2701 | Ga0496126_0132135 | |||
| 2702 | Ga0496126_0243974 | |||
| 2703 | Ga0496126_0292351 | |||
| 2704 | Ga0496126_0646895 | |||
| 2705 | Ga0495678_126723 | |||
| 2706 | Ga0501031_0007949 | |||
| 2707 | Ga0501031_0012029 | |||
| 2708 | Ga0501031_0457453 | |||
| 2709 | Ga0501031_0601215 | |||
| 2710 | Ga0501032_0000345 | |||
| 2711 | Ga0501032_0061759 | |||
| 2712 | Ga0501032_0079352 | |||
| 2713 | Ga0501032_0245998 | |||
| 2714 | Ga0501032_0383748 | |||
| 2715 | Ga0501033_0000094 | |||
| 2716 | Ga0501033_0001745 | |||
| 2717 | Ga0501033_0011740 | |||
| 2718 | Ga0501033_0040516 | |||
| 2719 | Ga0501033_0359876 | |||
| 2720 | Ga0501034_0000021 | |||
| 2721 | Ga0501034_0170478 | |||
| 2722 | Ga0501034_0318165 | |||
| 2723 | Ga0501034_0562935 | |||
| 2724 | Ga0501034_0836305 | |||
| 2725 | Ga0501036_0000115 | |||
| 2726 | Ga0501036_0055368 | |||
| 2727 | Ga0501036_0325309 | |||
| 2728 | Ga0501036_0331121 | |||
| 2729 | Ga0501037_0000450 | |||
| 2730 | Ga0501037_0000505 | |||
| 2731 | Ga0501037_0200230 | |||
| 2732 | Ga0501037_0210562 | |||
| 2733 | Ga0501037_0736229 | |||
| 2734 | Ga0501038_0000052 | |||
| 2735 | Ga0501038_0028652 | |||
| 2736 | Ga0501038_0041409 | |||
| 2737 | Ga0501038_0061431 | |||
| 2738 | Ga0501038_0677239 | |||
| 2739 | Ga0501039_0000549 | |||
| 2740 | Ga0501039_0011127 | |||
| 2741 | Ga0501039_0085024 | |||
| 2742 | Ga0501039_0247016 | |||
| 2743 | Ga0501039_0862199 | |||
| 2744 | Ga0501039_1069999 | |||
| 2745 | Ga0501040_0237002 | |||
| 2746 | Ga0501041_0062219 | |||
| 2747 | Ga0501042_0069426 | |||
| 2748 | Ga0501042_0109003 | |||
| 2749 | Ga0501043_0001704 | |||
| 2750 | Ga0501043_0006502 | |||
| 2751 | Ga0501043_0026498 | |||
| 2752 | Ga0501043_0075484 | |||
| 2753 | Ga0501043_0282687 | |||
| 2754 | Ga0501046_0000133 | |||
| 2755 | Ga0501046_0052069 | |||
| 2756 | Ga0501046_0200037 | |||
| 2757 | Ga0501046_0257938 | |||
| 2758 | Ga0501046_0370789 | |||
| 2759 | Ga0501046_0565478 | |||
| 2760 | Ga0501047_0000440 | |||
| 2761 | Ga0501047_0015373 | |||
| 2762 | Ga0501047_0035246 | |||
| 2763 | Ga0501047_0091001 | |||
| 2764 | Ga0501047_0338417 | |||
| 2765 | Ga0501047_0776314 | |||
| 2766 | Ga0501048_0008678 | |||
| 2767 | Ga0501048_0180106 | |||
| 2768 | Ga0501048_0241732 | |||
| 2769 | Ga0501048_0415886 | |||
| 2770 | Ga0501048_0776925 | |||
| 2771 | Ga0501048_0918026 | |||
| 2772 | Ga0501067_0000076 | |||
| 2773 | Ga0501067_0012862 | |||
| 2774 | Ga0501067_0355283 | |||
| 2775 | Ga0501068_0000511 | |||
| 2776 | Ga0501068_0040672 | |||
| 2777 | Ga0501068_0094427 | |||
| 2778 | Ga0501069_0101728 | |||
| 2779 | Ga0501069_0364192 | |||
| 2780 | Ga0501070_0051048 | |||
| 2781 | Ga0501070_0116903 | |||
| 2782 | Ga0501070_0148834 | |||
| 2783 | Ga0501070_0495087 | |||
| 2784 | Ga0501070_0559656 | |||
| 2785 | Ga0501070_0562981 | |||
| 2786 | Ga0501071_0871668 | |||
| 2787 | Ga0501071_1187042 | |||
| 2788 | Ga0501072_0009145 | |||
| 2789 | Ga0501072_1107912 | |||
| 2790 | Ga0501073_0000597 | |||
| 2791 | Ga0501073_0047040 | |||
| 2792 | Ga0501073_0054424 | |||
| 2793 | Ga0501073_0286844 | |||
| 2794 | Ga0501073_1173081 | |||
| 2795 | Ga0501074_0000285 | |||
| 2796 | Ga0501074_0661447 | |||
| 2797 | Ga0501074_0802484 | |||
| 2798 | Ga0501075_1338412 | |||
| 2799 | Ga0501076_0143426 | |||
| 2800 | Ga0501076_0358511 | |||
| 2801 | Ga0501076_0744897 | |||
| 2802 | Ga0501079_0012998 | |||
| 2803 | Ga0501079_0523523 | |||
| 2804 | Ga0501079_1102783 | |||
| 2805 | Ga0501080_0001080 | |||
| 2806 | Ga0501080_0027884 | |||
| 2807 | Ga0501080_0515348 | |||
| 2808 | Ga0501083_0000881 | |||
| 2809 | Ga0501083_0660720 | |||
| 2810 | Ga0501083_1018407 | |||
| 2811 | Ga0501083_1117767 | |||
| 2812 | Ga0501035_0000255 | |||
| 2813 | Ga0501035_0003073 | |||
| 2814 | Ga0501035_0176206 | |||
| 2815 | Ga0501035_0279085 | |||
| 2816 | Ga0501035_0281484 | |||
| 2817 | Ga0501035_0286314 | |||
| 2818 | Ga0501035_0839913 | |||
| 2819 | Ga0501044_0000141 | |||
| 2820 | Ga0501044_0378703 | |||
| 2821 | Ga0501044_0544323 | |||
| 2822 | Ga0501044_1420588 | |||
| 2823 | Ga0501044_1544348 | |||
| 2824 | Ga0501045_0026069 | |||
| 2825 | nmdc:mga03683_131951_c1 | |||
| 2826 | nmdc:mga03n38_124467_c1 | |||
| 2827 | nmdc:mga03n38_199726_c1 | |||
| 2828 | nmdc:mga03n38_322088_c1 | |||
| 2829 | nmdc:mga03n38_374579_c1 | |||
| 2830 | nmdc:mga03n38_533584_c1 | |||
| 2831 | nmdc:mga00v17_27862_c1 | |||
| 2832 | nmdc:mga0yw44_15935_c1 | |||
| 2833 | nmdc:mga0yw44_168663_c1 | |||
| 2834 | nmdc:mga0yw44_172490_c1 | |||
| 2835 | nmdc:mga0yw44_435045_c1 | |||
| 2836 | nmdc:mga06z11_218397_c1 | |||
| 2837 | nmdc:mga06z11_22052_c1 | |||
| 2838 | nmdc:mga06z11_46278_c1 | |||
| 2839 | nmdc:mga06z11_686494_c1 | |||
| 2840 | nmdc:mga06z11_998443_c1 | |||
| 2841 | nmdc:mga04h51_153237_c1 | |||
| 2842 | nmdc:mga07m45_20707_c1 | |||
| 2843 | nmdc:mga07m45_60424_c1 | |||
| 2844 | nmdc:mga0n895_125876_c1 | |||
| 2845 | nmdc:mga0n895_157304_c1 | |||
| 2846 | nmdc:mga0n895_1799724_c1 | |||
| 2847 | nmdc:mga0n895_1842919_c1 | |||
| 2848 | nmdc:mga0n895_427342_c1 | |||
| 2849 | nmdc:mga0rr50_143496_c1 | |||
| 2850 | nmdc:mga0rr50_1702083_c1 | |||
| 2851 | nmdc:mga08x19_1263314_c1 | |||
| 2852 | nmdc:mga0a205_81104_c1 | |||
| 2853 | nmdc:mga0sz30_392822_c1 | |||
| 2854 | Ga0495601_0020961 | |||
| 2855 | Ga0495601_0081572 | |||
| 2856 | Ga0495601_0357694 | |||
| 2857 | Ga0495601_0995686 | |||
| 2858 | Ga0500635_0129261 | |||
| 2859 | Ga0495655_0102560 | |||
| 2860 | Ga0495595_0020753 | |||
| 2861 | Ga0495595_0144385 | |||
| 2862 | Ga0495595_0199587 | |||
| 2863 | Ga0495595_0343022 | |||
| 2864 | Ga0495619_0007177 | |||
| 2865 | Ga0495619_0022508 | |||
| 2866 | Ga0495619_0023422 | |||
| 2867 | Ga0495619_0041790 | |||
| 2868 | Ga0500578_0138596 | |||
| 2869 | Ga0500578_0331562 | |||
| 2870 | Ga0500578_0773748 | |||
| 2871 | Ga0500643_063024 | |||
| 2872 | Ga0500643_155180 | |||
| 2873 | Ga0500581_153470 | |||
| 2874 | Ga0500646_0050132 | |||
| 2875 | Ga0500647_0048290 | |||
| 2876 | Ga0500651_0028509 | |||
| 2877 | Ga0500566_0000100 | |||
| 2878 | Ga0500566_0000307 | |||
| 2879 | Ga0500566_0000533 | |||
| 2880 | Ga0500566_0133706 | |||
| 2881 | Ga0500640_006540 | |||
| 2882 | Ga0500640_106532 | |||
| 2883 | Ga0500641_0003537 | |||
| 2884 | Ga0500650_0003654 | |||
| 2885 | Ga0500554_001684 | |||
| 2886 | Ga0500556_0000125 | |||
| 2887 | Ga0500562_113775 | |||
| 2888 | Ga0500562_214284 | |||
| 2889 | Ga0500572_000670 | |||
| 2890 | Ga0500572_000830 | |||
| 2891 | Ga0500572_008998 | |||
| 2892 | Ga0500591_239844 | |||
| 2893 | Ga0500595_033212 | |||
| 2894 | Ga0500607_020131 | |||
| 2895 | Ga0500607_313723 | |||
| 2896 | Ga0500608_067744 | |||
| 2897 | Ga0500608_118838 | |||
| 2898 | Ga0500608_203832 | |||
| 2899 | Ga0500608_311678 | |||
| 2900 | Ga0500614_001477 | |||
| 2901 | Ga0500618_011218 | |||
| 2902 | Ga0500626_034818 | |||
| 2903 | Ga0500642_0000105 | |||
| 2904 | Ga0500652_001527 | |||
| 2905 | Ga0500655_150258 | |||
| 2906 | Ga0500658_0076936 | |||
| 2907 | Ga0500559_0000240 | |||
| 2908 | Ga0500559_0000976 | |||
| 2909 | Ga0500559_0001326 | |||
| 2910 | Ga0500559_0238844 | |||
| 2911 | Ga0500568_0004846 | |||
| 2912 | Ga0500568_0011215 | |||
| 2913 | Ga0500577_0003197 | |||
| 2914 | Ga0500586_001365 | |||
| 2915 | Ga0500588_0158843 | |||
| 2916 | Ga0500590_084113 | |||
| 2917 | Ga0500590_106540 | |||
| 2918 | Ga0500603_000017 | |||
| 2919 | Ga0500603_108545 | |||
| 2920 | Ga0500604_0004360 | |||
| 2921 | Ga0500616_0000085 | |||
| 2922 | Ga0500619_151464 | |||
| 2923 | Ga0500620_205274 | |||
| 2924 | Ga0500622_0000822 | |||
| 2925 | Ga0500622_0250230 | |||
| 2926 | Ga0500624_042027 | |||
| 2927 | Ga0500630_001073 | |||
| 2928 | Ga0500633_0079886 | |||
| 2929 | Ga0500638_000755 | |||
| 2930 | Ga0500638_140583 | |||
| 2931 | Ga0500639_000306 | |||
| 2932 | Ga0500639_158482 | |||
| 2933 | Ga0500636_0000875 | |||
| 2934 | Ga0500636_0001972 | |||
| 2935 | Ga0500636_0162034 | |||
| 2936 | Ga0500636_0295424 | |||
| 2937 | Ga0500637_0237409 | |||
| 2938 | Ga0500637_0368745 | |||
| 2939 | Ga0500637_0422065 | |||
| 2940 | Ga0500576_148056 | |||
| 2941 | Ga0500625_147381 | |||
| 2942 | Ga0500645_032111 | |||
| 2943 | Ga0500596_002124 | |||
| 2944 | Ga0501084_0848909 | |||
| 2945 | Ga0501084_0997352 | |||
| 2946 | Ga0501084_1120743 | |||
| 2947 | Ga0501082_0003023 | |||
| 2948 | Ga0501082_0546497 | |||
| 2949 | Ga0501082_1186229 | |||
| 2950 | 2507509744 | |||
| 2951 | 2508543760 | |||
| 2952 | 2508698452 | |||
| 2953 | 2511400342 | |||
| 2954 | 2513625305 | |||
| 2955 | 2513645105 | |||
| 2956 | 2513646190 | |||
| 2957 | 2513678583 | |||
| 2958 | 2513706642 | |||
| 2959 | 2513714981 | |||
| 2960 | 2513875823 | |||
| 2961 | 2514011511 | |||
| 2962 | 2515630044 | |||
| 2963 | 2517103558 | |||
| 2964 | 2524441065 | |||
| 2965 | 2524470053 | |||
| 2966 | 2528854169 | |||
| 2967 | 2603859834 | |||
| 2968 | 2617349267 | |||
| 2969 | 2617378209 | |||
| 2970 | 2687579451 | |||
| 2971 | 2745082412 | |||
| 2972 | 2793060281 | |||
| 2973 | 2805917647 | |||
| 2974 | 2818241471 | |||
| 2975 | 2824602150 | |||
| 2976 | 2824610138 | |||
| 2977 | 2824623848 | |||
| 2978 | 2824627738 | |||
| 2979 | 2824639274 | |||
| 2980 | 2824652024 | |||
| 2981 | 2824656117 | |||
| 2982 | 2824670778 | |||
| 2983 | 2824679497 | |||
| 2984 | 2824683961 | |||
| 2985 | 2824696125 | |||
| 2986 | 2824703797 | |||
| 2987 | 2824711384 | |||
| 2988 | 2824722189 | |||
| 2989 | 2824727681 | |||
| 2990 | 2824733522 | |||
| 2991 | 2824746898 | |||
| 2992 | 2824761691 | |||
| 2993 | 2824771306 | |||
| 2994 | 2824774001 | |||
| 2995 | 2838130050 | |||
| 2996 | 2841941207 | |||
| 2997 | 2841952766 | |||
| 2998 | 2841962279 | |||
| 2999 | 2841967362 | |||
| 3000 | 2841979241 | |||
| 3001 | 2841990816 | |||
| 3002 | 2842038657 | |||
| 3003 | 2842048398 | |||
| 3004 | 2844318056 | |||
| 3005 | 2847945429 | |||
| 3006 | 2849080383 | |||
| 3007 | 2857510267 | |||
| 3008 | 2857528482 | |||
| 3009 | 2874595146 | |||
| 3010 | 2874615616 | |||
| 3011 | 2874621640 | |||
| 3012 | 2874632725 | |||
| 3013 | 2874651007 | |||
| 3014 | 2876764508 | |||
| 3015 | 2876775082 | |||
| 3016 | 2876823897 | |||
| 3017 | 2879080525 | |||
| 3018 | 2879109374 | |||
| 3019 | 2879134869 | |||
| 3020 | 2879149180 | |||
| 3021 | 2881366259 | |||
| 3022 | 2881672887 | |||
| 3023 | 2885372851 | |||
| 3024 | 2885413027 | |||
| 3025 | 2888382851 | |||
| 3026 | 2888394946 | |||
| 3027 | 2888423330 | |||
| 3028 | 2893070202 | |||
| 3029 | 2903729635 | |||
| 3030 | 2904668644 | |||
| 3031 | 2904696933 | |||
| 3032 | 2904716638 | |||
| 3033 | 2906605783 | |||
| 3034 | 2906628237 | |||
| 3035 | 2908761510 | |||
| 3036 | 2908778974 | |||
| 3037 | 2919076153 | |||
| 3038 | 2922373060 | |||
| 3039 | 2922392069 | |||
| 3040 | 2922395260 | |||
| 3041 | 2929615877 | |||
| 3042 | 2929630490 | |||
| 3043 | 2932792485 | |||
| 3044 | 2932800369 | |||
| 3045 | 2932804542 | |||
| 3046 | 2932814005 | |||
| 3047 | 2932819504 | |||
| 3048 | 2932833789 | |||
| 3049 | 2933578837 | |||
| 3050 | 2935611396 | |||
| 3051 | 2935618685 | |||
| 3052 | 2935644475 | |||
| 3053 | 2935648780 | |||
| 3054 | 2935657137 | |||
| 3055 | 2935674212 | |||
| 3056 | 2935678527 | |||
| 3057 | 2935687976 | |||
| 3058 | 2935701412 | |||
| 3059 | 2935708333 | |||
| 3060 | 2935714996 | |||
| 3061 | 2935726439 | |||
| 3062 | 2935733814 | |||
| 3063 | 2935743193 | |||
| 3064 | 2935754768 | |||
| 3065 | 2935765475 | |||
| 3066 | 2935775231 | |||
| 3067 | 2935779571 | |||
| 3068 | 2935791571 | |||
| 3069 | 2935799883 | |||
| 3070 | 2935805429 | |||
| 3071 | 2935816723 | |||
| 3072 | 2935820873 | |||
| 3073 | 2935833776 | |||
| 3074 | 2935839538 | |||
| 3075 | 2935850867 | |||
| 3076 | 2935857050 | |||
| 3077 | 2935871126 | |||
| 3078 | 2935876371 | |||
| 3079 | 2935889736 | |||
| 3080 | 2935913766 | |||
| 3081 | 2935920244 | |||
| 3082 | 2935930583 | |||
| 3083 | 2935939444 | |||
| 3084 | 2935946393 | |||
| 3085 | 2935955768 | |||
| 3086 | 2935966923 | |||
| 3087 | 2935972522 | |||
| 3088 | 2935991022 | |||
| 3089 | 2935997660 | |||
| 3090 | 2936007178 | |||
| 3091 | 2936011690 | |||
| 3092 | 2936020285 | |||
| 3093 | 2936028980 | |||
| 3094 | 2936043015 | |||
| 3095 | 2936047008 | |||
| 3096 | 2936058112 | |||
| 3097 | 2940559855 | |||
| 3098 | 2941536051 | |||
| 3099 | 2941540227 | |||
| 3100 | 3005488179 | |||
| 3101 | 3005512671 | |||
| 3102 | 3005590438 | |||
| 3103 | 3005598105 | |||
| 3104 | 3005713783 | |||
| 3105 | 3005721295 | |||
| 3106 | 8006928655 | |||
| 3107 | 8016514646 | |||
| 3108 | 8016530749 | |||
| 3109 | 8016536038 | |||
| 3110 | 8016540318 | |||
| 3111 | 8016552913 | |||
| 3112 | 8016561291 | |||
| 3113 | 8016574384 | |||
| 3114 | 8016578484 | |||
| 3115 | 8016591288 | |||
| 3116 | 8016599150 | |||
| 3117 | 8016611899 | |||
| 3118 | 8016621907 | |||
| 3119 | 8016627946 | |||
| 3120 | 8016632267 | |||
| 3121 | 8017061786 | |||
| 3122 | 8019535763 | |||
| 3123 | 8019543716 | |||
| 3124 | 8019555056 | |||
| 3125 | 8019581312 | |||
| 3126 | 8019588937 | |||
| 3127 | 8019616267 | |||
| 3128 | 8019626868 | |||
| 3129 | 8019635648 | |||
| 3130 | 8019657032 | |||
| 3131 | 8019673059 | |||
| 3132 | 8019683082 | |||
| 3133 | 8019688775 | |||
| 3134 | 8055747524 | |||
| 3135 | 8056680511 | |||
| 3136 | 8056683870 | |||
| 3137 | 8056691267 | |||
| 3138 | 8056972402 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6z0w-assembly1.cif.gz_A | crystal structure of the cytoplasmic domain of flhb from shewanella putrefaciens | 0.9329 | 7 | 79 |
| 3bzr-assembly1.cif.gz_A | crystal structure of escu c-terminal domain with n262d mutation, space group p 41 21 2 | 0.9315 | 5 | 78 |
| 3b1s-assembly2.cif.gz_D | crystal structure of the cytoplasmic domain of flhb from aquifex aeolicus | 0.9256 | 7 | 79 |
| 3bzz-assembly1.cif.gz_B | crystal structural of the mutated r313t escu/spas c-terminal domain | 0.9256 | 7 | 80 |
| 3c00-assembly1.cif.gz_B | crystal structural of the mutated g247t escu/spas c-terminal domain | 0.924 | 7 | 79 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3c03C00 | Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU | 0.9277 | 7 | 80 | 3.40.1690.10 |
| 3b1sD00 | Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU | 0.9256 | 7 | 79 | 3.40.1690.10 |
| 3bzpA00 | Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU | 0.9169 | 5 | 78 | 3.40.1690.10 |
| 3bzyB00 | Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU | 0.9086 | 4 | 78 | 3.40.1690.10 |
| 2jliA00 | Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU | 0.9038 | 7 | 75 | 3.40.1690.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A426QGL3-F1-model_v4 | Flagellar biosynthetic protein FlhB | 0.9863 | 7 | 83 |
GO:0005886
GO:0009306 |
| AF-A0A3E0H0Z6-F1-model_v4 | Flagellar biosynthetic protein FlhB | 0.9787 | 7 | 83 |
GO:0005886
GO:0009306 |
| AF-Q21JK5-F1-model_v4 | Flagellar biosynthetic protein FlhB | 0.9756 | 5 | 81 |
GO:0005886
GO:0009306 |
| AF-A0A0F4RBX8-F1-model_v4 | Flagellar biosynthetic protein FlhB | 0.9739 | 7 | 81 |
GO:0005886
GO:0009306 |
| AF-A0A1W1WUC3-F1-model_v4 | Flagellar biosynthesis protein | 0.9714 | 7 | 81 |
GO:0005886
GO:0009306 |