F494810

General Info

Members Datasets Scaffolds Average Seq Length
1569 693 3138 88

Family's Representative Sequence

Representative Sequence 3300005614|Ga0068856_100006491|Ga0068856_1000064914
Length 93
Sequence MSEQSKSQVGKRQLAVALHYDRTGAPTVVAKGRGTIGEKIIEIAKEHGIPIEENEVLAGALSNVELGDEIPAELYKAVAEVLIFVLRLSGRVR

Samples

Sample ID Description Type Environment
1 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
2 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
5 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
6 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
7 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
10 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
11 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
15 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
21 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
22 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
23 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
24 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
25 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
26 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
27 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
28 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
29 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
30 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
31 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
32 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
33 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
34 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
35 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
36 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
37 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
38 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
39 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
40 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
41 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
42 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
43 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
44 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
45 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
46 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
47 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
48 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
49 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
50 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
51 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
52 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
53 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
54 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
55 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
56 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
57 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
58 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
59 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
60 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
61 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
62 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
63 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
64 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
65 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
66 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
67 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
70 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
71 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
72 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
73 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
74 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
75 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
85 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
86 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
87 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
88 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
89 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
90 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
91 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
92 3300006943 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW Metagenome Nodule
93 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
94 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
95 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
96 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300012492 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.yng.030610 Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
128 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
129 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
136 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
138 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
139 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
141 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
205 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
206 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
207 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
212 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
215 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
218 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
221 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
222 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
223 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
224 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
225 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
226 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
227 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
228 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
229 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
230 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
231 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
232 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
233 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
234 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
235 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
236 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
237 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
238 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
239 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
240 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
241 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
242 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
243 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
244 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
245 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
246 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
247 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
248 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
249 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
251 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
252 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
253 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
254 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
255 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
256 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
257 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
258 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
259 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
260 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
261 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
262 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
263 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
264 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
265 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
266 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
267 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
268 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
269 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
270 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
271 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
272 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
273 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
274 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
275 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
276 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
277 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
278 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
279 3300041452 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_4 MetaG Metagenome Rhizoplane
280 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
281 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
282 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
283 3300041491 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_1 MetaG Metagenome Unclassified
284 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
285 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
286 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
287 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
288 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
289 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
290 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
291 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
292 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
293 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
294 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
295 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
296 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
297 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
298 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
299 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
300 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
301 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
302 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
303 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
304 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
305 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
306 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
307 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
308 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
309 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
310 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
311 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
312 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
313 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
314 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
315 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
316 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
317 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
318 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
319 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
320 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
321 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
322 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
323 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
324 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
325 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
326 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
327 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
328 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
329 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
330 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
331 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
332 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
333 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
334 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
335 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
336 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
337 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
338 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
339 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
340 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
341 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
342 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
343 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
344 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
345 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
346 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
347 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
348 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
349 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
350 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
351 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
352 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
353 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
354 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
355 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
356 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
357 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
361 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
362 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
363 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
364 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
365 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
366 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
367 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
368 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
369 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
370 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
371 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
372 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
373 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
374 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
375 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
376 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
377 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
378 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
379 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
380 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
381 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
382 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
383 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
384 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
385 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
386 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
387 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
388 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
389 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
390 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
391 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
392 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
393 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
394 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
395 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
396 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
397 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
398 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
399 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
400 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
401 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
402 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
403 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
404 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
405 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
406 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
407 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
409 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
410 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
411 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
412 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
413 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
414 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
415 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
416 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
417 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
418 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
419 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
420 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
421 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
422 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
423 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
424 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
425 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
426 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
427 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
428 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
429 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
430 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
431 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
432 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
433 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
434 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
435 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
436 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
437 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
438 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
439 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
440 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
441 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
442 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
443 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
444 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
445 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
446 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
447 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
448 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
449 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
450 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
451 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
452 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
453 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
454 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
455 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
456 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
457 3300053089 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 endosphere Metagenome Endosphere
458 3300053090 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 endosphere Metagenome Endosphere
459 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
460 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
461 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
462 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
463 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
464 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
465 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
466 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
467 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
468 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
469 3300053115 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 endosphere Metagenome Endosphere
470 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
471 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
472 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
473 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
474 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
475 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
476 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
477 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
478 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
479 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
480 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
481 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
482 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
483 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
484 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
485 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
486 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
487 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
488 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
489 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
490 3300053155 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 endosphere Metagenome Endosphere
491 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
492 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
493 3300053159 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 endosphere Metagenome Endosphere
494 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
495 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
496 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
497 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
498 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
499 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
500 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
501 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
502 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
503 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
504 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
505 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
506 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
507 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
508 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
509 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
510 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
511 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
512 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
513 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
514 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
515 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
516 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
517 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
518 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
519 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
520 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
521 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
522 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
523 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
524 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
525 2687453129 Halotalea alkalilenta IHB B 13600 Isolate Unclassified
526 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
527 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
528 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
529 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
530 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
531 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
532 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
533 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
534 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
535 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
536 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
537 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
538 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
539 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
540 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
541 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
542 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
543 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
544 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
545 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
546 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
547 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
548 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
549 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
550 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
551 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
552 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
553 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
554 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
555 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
556 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
557 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
558 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
559 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
560 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
561 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
562 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
563 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
564 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
565 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
566 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
567 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
568 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
569 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
570 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
571 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
572 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
573 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
574 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
575 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
576 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
577 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
578 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
579 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
580 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
581 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
582 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
583 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
584 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
585 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
586 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
587 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
588 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
589 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
590 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
591 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
592 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
593 2922368715
594 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
595 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
596 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
597 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
598 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
599 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
600 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
601 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
602 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
603 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
604 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
605 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
606 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
607 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
608 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
609 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
610 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
611 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
612 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
613 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
614 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
615 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
616 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
617 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
618 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
619 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
620 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
621 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
622 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
623 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
624 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
625 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
626 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
627 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
628 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
629 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
630 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
631 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
632 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
633 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
634 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
635 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
636 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
637 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
638 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
639 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
640 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
641 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
642 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
643 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
644 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
645 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
646 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
647 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
648 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
649 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
650 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
651 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
652 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
653 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
654 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
655 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
656 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
657 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
658 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
659 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
660 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
661 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
662 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
663 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
664 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
665 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
666 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
667 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
668 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
669 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
670 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
671 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
672 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
673 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
674 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
675 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
676 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
677 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
678 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
679 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
680 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
681 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
682 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
683 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
684 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
685 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
686 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
687 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
688 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
689 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
690 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
691 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
692 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
693 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 87.31
Metatranscriptomes 0.7
Isolates 11.99

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 9.31
Nodule 9.11
Rhizoplane 5.54
Rhizosphere 67.3
Stem 0
Stem Tuber 0
Unclassified 0.76

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068856_100006491 3300005614 Bacteria 11469
2 JGI24742J22300_10009000 3300002244 Bacteria 1647
3 JGI25406J46586_10000078 3300003203 Bacteria 44054
4 JGI25406J46586_10007863 3300003203 Bacteria 4851
5 JGI25153J46596_10010523 3300003215 Bacteria 4178
6 JGI25153J46596_10022305 3300003215 Bacteria 2338
7 JGI25404J52841_10001821 3300003659 Bacteria 3871
8 JGI25404J52841_10002922 3300003659 Bacteria 3313
9 JGI25404J52841_10032590 3300003659 Bacteria 1111
10 Ga0055542_1002566 3300003762 Bacteria 5792
11 Ga0055529_1021822 3300003763 Bacteria 794
12 Ga0055529_1031775 3300003763 Bacteria 646
13 Ga0070658_10042658 3300005327 Bacteria 3664
14 Ga0070658_10161467 3300005327 Bacteria 1880
15 Ga0070658_10210295 3300005327 Bacteria 1643
16 Ga0070658_10387757 3300005327 Bacteria 1199
17 Ga0070676_10108708 3300005328 Bacteria 1724
18 Ga0070683_101462219 3300005329 Bacteria 657
19 Ga0070683_101647371 3300005329 Bacteria 617
20 Ga0070690_100215512 3300005330 Bacteria 1343
21 Ga0070690_100419124 3300005330 Bacteria 987
22 Ga0070690_101517762 3300005330 Bacteria 542
23 Ga0070677_10740214 3300005333 Bacteria 557
24 Ga0068869_100711069 3300005334 Bacteria 857
25 Ga0068869_100991556 3300005334 Bacteria 731
26 Ga0068869_101356368 3300005334 Bacteria 628
27 Ga0070680_100288044 3300005336 Bacteria 1392
28 Ga0070682_100118026 3300005337 Bacteria 1777
29 Ga0070682_100667417 3300005337 Bacteria 830
30 Ga0070682_101805127 3300005337 Bacteria 533
31 Ga0070660_100064655 3300005339 Bacteria 2846
32 Ga0070660_100167335 3300005339 Bacteria 1774
33 Ga0070689_101529616 3300005340 Bacteria 605
34 Ga0070691_10489537 3300005341 Bacteria 709
35 Ga0070661_100276878 3300005344 Bacteria 1301
36 Ga0070661_100627335 3300005344 Bacteria 871
37 Ga0070661_101487638 3300005344 Bacteria 571
38 Ga0070668_100021296 3300005347 Bacteria 4900
39 Ga0070668_100119222 3300005347 Bacteria 2107
40 Ga0070668_100139245 3300005347 Bacteria 1954
41 Ga0070668_100280847 3300005347 Bacteria 1390
42 Ga0070669_100720157 3300005353 Bacteria 844
43 Ga0070671_100100866 3300005355 Bacteria 2422
44 Ga0070671_100164278 3300005355 Bacteria 1877
45 Ga0070674_100030516 3300005356 Bacteria 3563
46 Ga0070674_100073588 3300005356 Bacteria 2422
47 Ga0070674_100207926 3300005356 Bacteria 1515
48 Ga0070673_100202032 3300005364 Bacteria 1712
49 Ga0070673_100218490 3300005364 Bacteria 1649
50 Ga0070673_100691724 3300005364 Bacteria 936
51 Ga0070673_100812672 3300005364 Bacteria 864
52 Ga0070659_100052649 3300005366 Bacteria 3202
53 Ga0070659_100856376 3300005366 Bacteria 792
54 Ga0070659_101067897 3300005366 Bacteria 711
55 Ga0070667_100070238 3300005367 Bacteria 2981
56 Ga0070667_100199869 3300005367 Bacteria 1773
57 Ga0070667_100758517 3300005367 Bacteria 900
58 Ga0070667_101207043 3300005367 Bacteria 708
59 Ga0070709_10051798 3300005434 Bacteria 2577
60 Ga0070714_100008919 3300005435 Bacteria 7847
61 Ga0070714_100069803 3300005435 Bacteria 3036
62 Ga0070714_101086456 3300005435 Bacteria 779
63 Ga0070713_100002496 3300005436 Bacteria 12016
64 Ga0070713_100043496 3300005436 Bacteria 3672
65 Ga0070713_100051383 3300005436 Bacteria 3409
66 Ga0070713_100188572 3300005436 Bacteria 1857
67 Ga0070713_100196742 3300005436 Bacteria 1819
68 Ga0070713_100417186 3300005436 Bacteria 1256
69 Ga0070713_102188772 3300005436 Bacteria 536
70 Ga0070710_10002216 3300005437 Bacteria 9176
71 Ga0070710_10005858 3300005437 Bacteria 5865
72 Ga0070710_10063822 3300005437 Bacteria 2105
73 Ga0070710_10877299 3300005437 Bacteria 646
74 Ga0070710_11535926 3300005437 Bacteria 501
75 Ga0070701_10309659 3300005438 Bacteria 974
76 Ga0070711_100004598 3300005439 Bacteria 8168
77 Ga0070711_100009923 3300005439 Bacteria 5872
78 Ga0070711_100043803 3300005439 Bacteria 3034
79 Ga0070711_100383681 3300005439 Bacteria 1137
80 Ga0070711_100660610 3300005439 Bacteria 877
81 Ga0070711_101310346 3300005439 Bacteria 629
82 Ga0070700_100205013 3300005441 Bacteria 1388
83 Ga0070700_101759084 3300005441 Bacteria 533
84 Ga0070663_100071153 3300005455 Bacteria 2531
85 Ga0070663_100074690 3300005455 Bacteria 2476
86 Ga0070663_100166747 3300005455 Bacteria 1699
87 Ga0070663_100260411 3300005455 Bacteria 1376
88 Ga0070663_101192185 3300005455 Bacteria 669
89 Ga0070678_100195784 3300005456 Bacteria 1665
90 Ga0070678_100264579 3300005456 Bacteria 1448
91 Ga0070678_100600278 3300005456 Bacteria 983
92 Ga0070678_100999439 3300005456 Bacteria 769
93 Ga0070678_102362768 3300005456 Bacteria 505
94 Ga0070662_100199528 3300005457 Bacteria 1586
95 Ga0070662_100358098 3300005457 Bacteria 1197
96 Ga0070662_100904746 3300005457 Bacteria 753
97 Ga0070662_100933192 3300005457 Bacteria 741
98 Ga0070681_10149264 3300005458 Bacteria 2265
99 Ga0070681_10221402 3300005458 Bacteria 1808
100 Ga0070681_11044690 3300005458 Unclassified 737
101 Ga0070681_11346821 3300005458 Bacteria 637
102 Ga0068867_100362026 3300005459 Bacteria 1213
103 Ga0070685_10227941 3300005466 Bacteria 1224
104 Ga0070706_100104252 3300005467 Bacteria 2637
105 Ga0070707_100651447 3300005468 Bacteria 1016
106 Ga0070698_100095475 3300005471 Bacteria 2951
107 Ga0070698_101029613 3300005471 Bacteria 771
108 Ga0070699_100232537 3300005518 Bacteria 1644
109 Ga0070699_100512689 3300005518 Bacteria 1090
110 Ga0070679_100015207 3300005530 Bacteria 7392
111 Ga0070679_100176711 3300005530 Bacteria 2107
112 Ga0070684_100566673 3300005535 Bacteria 1055
113 Ga0070684_101855553 3300005535 Bacteria 569
114 Ga0070697_100284549 3300005536 Bacteria 1419
115 Ga0068853_100052136 3300005539 Bacteria 3523
116 Ga0068853_100064125 3300005539 Bacteria 3184
117 Ga0068853_100387067 3300005539 Bacteria 1307
118 Ga0068853_101064271 3300005539 Bacteria 780
119 Ga0068853_101523309 3300005539 Bacteria 647
120 Ga0068853_101564149 3300005539 Bacteria 639
121 Ga0070672_100490312 3300005543 Bacteria 1062
122 Ga0070686_100114215 3300005544 Bacteria 1845
123 Ga0070686_101165948 3300005544 Bacteria 639
124 Ga0070696_101209436 3300005546 Bacteria 639
125 Ga0070693_100138758 3300005547 Bacteria 1528
126 Ga0070693_100625821 3300005547 Bacteria 780
127 Ga0070665_100067159 3300005548 Bacteria 3596
128 Ga0070665_100135737 3300005548 Bacteria 2463
129 Ga0070665_100148723 3300005548 Bacteria 2345
130 Ga0070665_100226507 3300005548 Bacteria 1870
131 Ga0070665_100254057 3300005548 Bacteria 1758
132 Ga0070665_100948965 3300005548 Bacteria 873
133 Ga0068855_100008391 3300005563 Bacteria 12493
134 Ga0068855_100023606 3300005563 Bacteria 7366
135 Ga0068855_100212427 3300005563 Bacteria 2173
136 Ga0068855_100427997 3300005563 Bacteria 1447
137 Ga0068855_100433863 3300005563 Bacteria 1436
138 Ga0068855_100677195 3300005563 Bacteria 1106
139 Ga0068855_101121170 3300005563 Bacteria 821
140 Ga0068855_101140637 3300005563 Bacteria 813
141 Ga0068855_101333530 3300005563 Bacteria 741
142 Ga0070664_100055730 3300005564 Bacteria 3357
143 Ga0070664_100390206 3300005564 Bacteria 1272
144 Ga0068857_100362524 3300005577 Bacteria 1344
145 Ga0068857_101065744 3300005577 Bacteria 780
146 Ga0068854_100027459 3300005578 Bacteria 3924
147 Ga0068854_100081207 3300005578 Bacteria 2394
148 Ga0068854_100384302 3300005578 Bacteria 1158
149 Ga0068854_101772312 3300005578 Bacteria 566
150 Ga0068856_100005799 3300005614 Bacteria 12168
151 Ga0068856_100116497 3300005614 Bacteria 2672
152 Ga0068856_100250331 3300005614 Bacteria 1787
153 Ga0068856_100473108 3300005614 Bacteria 1274
154 Ga0068856_100999793 3300005614 Bacteria 855
155 Ga0070702_100175428 3300005615 Bacteria 1398
156 Ga0070702_100468668 3300005615 Bacteria 918
157 Ga0070702_100572428 3300005615 Bacteria 842
158 Ga0068852_100026885 3300005616 Bacteria 4683
159 Ga0068852_100452737 3300005616 Bacteria 1271
160 Ga0068852_100549554 3300005616 Bacteria 1155
161 Ga0068852_100577230 3300005616 Bacteria 1127
162 Ga0068852_100611543 3300005616 Bacteria 1095
163 Ga0068852_101063374 3300005616 Bacteria 829
164 Ga0068859_101596147 3300005617 Unclassified 720
165 Ga0068864_100163405 3300005618 Bacteria 2025
166 Ga0068864_100930207 3300005618 Bacteria 860
167 Ga0068864_101440622 3300005618 Bacteria 691
168 Ga0068866_10498265 3300005718 Bacteria 805
169 Ga0068866_11261235 3300005718 Bacteria 536
170 Ga0068861_100015345 3300005719 Bacteria 5396
171 Ga0068861_101145494 3300005719 Bacteria 749
172 Ga0068861_102533418 3300005719 Bacteria 516
173 Ga0068851_10000888 3300005834 Bacteria 12916
174 Ga0068851_10083850 3300005834 Bacteria 1668
175 Ga0068851_10272875 3300005834 Bacteria 965
176 Ga0068851_10714023 3300005834 Bacteria 618
177 Ga0068870_10825192 3300005840 Bacteria 650
178 Ga0068863_100606370 3300005841 Bacteria 1084
179 Ga0068863_100808947 3300005841 Bacteria 935
180 Ga0068863_100828036 3300005841 Bacteria 924
181 Ga0068858_100149929 3300005842 Bacteria 2192
182 Ga0068858_101694758 3300005842 Unclassified 624
183 Ga0068860_101991785 3300005843 Unclassified 602
184 Ga0068862_100237565 3300005844 Bacteria 1655
185 Ga0081455_10007525 3300005937 Bacteria 11455
186 Ga0081455_10010928 3300005937 Bacteria 9158
187 Ga0081455_10029071 3300005937 Bacteria 5043
188 Ga0081455_10040471 3300005937 Bacteria 4109
189 Ga0081455_10044093 3300005937 Bacteria 3895
190 Ga0081455_10259013 3300005937 Bacteria 1268
191 Ga0081455_10713172 3300005937 Bacteria 638
192 Ga0081538_10105051 3300005981 Bacteria 1407
193 Ga0081540_1001581 3300005983 Bacteria 19462
194 Ga0081540_1005915 3300005983 Bacteria 9026
195 Ga0081540_1007598 3300005983 Bacteria 7699
196 Ga0081540_1028204 3300005983 Bacteria 3159
197 Ga0081540_1140599 3300005983 Bacteria 970
198 Ga0081539_10000273 3300005985 Bacteria 117936
199 Ga0081539_10001396 3300005985 Bacteria 41607
200 Ga0081539_10016511 3300005985 Bacteria 5262
201 Ga0081539_10024577 3300005985 Bacteria 3903
202 Ga0070717_10001732 3300006028 Bacteria 15222
203 Ga0070717_10005433 3300006028 Bacteria 9305
204 Ga0070717_10619675 3300006028 Bacteria 982
205 Ga0070717_10784474 3300006028 Bacteria 867
206 Ga0075365_10059920 3300006038 Bacteria 2538
207 Ga0075365_10111717 3300006038 Bacteria 1878
208 Ga0075365_10133407 3300006038 Bacteria 1719
209 Ga0075365_10850681 3300006038 Bacteria 643
210 Ga0075365_10932833 3300006038 Bacteria 612
211 Ga0075365_11102401 3300006038 Bacteria 559
212 Ga0075365_11216017 3300006038 Bacteria 530
213 Ga0075368_10190425 3300006042 Bacteria 866
214 Ga0075368_10260237 3300006042 Bacteria 743
215 Ga0075363_100127088 3300006048 Bacteria 1428
216 Ga0075363_100301805 3300006048 Bacteria 929
217 Ga0075363_100532338 3300006048 Bacteria 700
218 Ga0075363_100796190 3300006048 Bacteria 575
219 Ga0075363_100946565 3300006048 Bacteria 529
220 Ga0075364_10589544 3300006051 Bacteria 759
221 Ga0075364_10720532 3300006051 Bacteria 680
222 Ga0075364_10904668 3300006051 Bacteria 601
223 Ga0070715_10005372 3300006163 Bacteria 4269
224 Ga0070716_100078714 3300006173 Bacteria 1961
225 Ga0070716_100690990 3300006173 Unclassified 778
226 Ga0070716_101008191 3300006173 Bacteria 659
227 Ga0070712_100098511 3300006175 Bacteria 2156
228 Ga0070712_100142802 3300006175 Bacteria 1829
229 Ga0070712_100238449 3300006175 Bacteria 1448
230 Ga0070712_101486979 3300006175 Bacteria 592
231 Ga0075362_10377500 3300006177 Bacteria 713
232 Ga0075367_10029703 3300006178 Bacteria 3129
233 Ga0075367_10032866 3300006178 Bacteria 2987
234 Ga0075367_10033392 3300006178 Bacteria 2965
235 Ga0075367_10063233 3300006178 Bacteria 2212
236 Ga0075367_10249298 3300006178 Bacteria 1114
237 Ga0075367_10860052 3300006178 Bacteria 578
238 Ga0075369_10111089 3300006186 Bacteria 1235
239 Ga0075366_10184467 3300006195 Bacteria 1268
240 Ga0075366_10483446 3300006195 Bacteria 765
241 Ga0097621_100786338 3300006237 Bacteria 881
242 Ga0097621_101364779 3300006237 Bacteria 670
243 Ga0075370_10110987 3300006353 Bacteria 1593
244 Ga0075370_10237161 3300006353 Bacteria 1080
245 Ga0075370_10588450 3300006353 Bacteria 674
246 Ga0068871_100808109 3300006358 Bacteria 865
247 Ga0068871_100919258 3300006358 Bacteria 812
248 Ga0075434_102396040 3300006871 Bacteria 530
249 Ga0068865_100359398 3300006881 Bacteria 1182
250 Ga0068865_101103683 3300006881 Bacteria 699
251 Ga0097620_101596536 3300006931 Unclassified 720
252 Ga0099824_1004610 3300006942 Bacteria 19776
253 Ga0099822_1001276 3300006943 Bacteria 28780
254 Ga0075435_100156290 3300007076 Bacteria 1919
255 Ga0099794_10037121 3300007265 Bacteria 2306
256 Ga0099794_10044971 3300007265 Bacteria 2112
257 Ga0099794_10052805 3300007265 Bacteria 1960
258 Ga0099795_10028020 3300007788 Bacteria 1911
259 Ga0099795_10330472 3300007788 Bacteria 677
260 Ga0099795_10350483 3300007788 Bacteria 660
261 Ga0099795_10428823 3300007788 Bacteria 605
262 Ga0099795_10532114 3300007788 Bacteria 552
263 Ga0105250_10213935 3300009092 Bacteria 815
264 Ga0105240_10005415 3300009093 Bacteria 19031
265 Ga0105240_10040418 3300009093 Bacteria 5965
266 Ga0105240_10052328 3300009093 Bacteria 5134
267 Ga0105240_10083106 3300009093 Bacteria 3930
268 Ga0105240_10146974 3300009093 Bacteria 2812
269 Ga0105240_10411111 3300009093 Bacteria 1522
270 Ga0105240_11229578 3300009093 Bacteria 792
271 Ga0105240_11334528 3300009093 Bacteria 756
272 Ga0105240_11910566 3300009093 Bacteria 618
273 Ga0111539_10334875 3300009094 Bacteria 1762
274 Ga0105245_10570787 3300009098 Bacteria 1155
275 Ga0105245_10788219 3300009098 Bacteria 988
276 Ga0105245_10844199 3300009098 Bacteria 956
277 Ga0105245_11334991 3300009098 Bacteria 766
278 Ga0105245_13014047 3300009098 Bacteria 522
279 Ga0105247_10151737 3300009101 Bacteria 1527
280 Ga0105247_10257934 3300009101 Bacteria 1194
281 Ga0105247_11070066 3300009101 Bacteria 634
282 Ga0105247_11345461 3300009101 Bacteria 575
283 Ga0114129_12467396 3300009147 Bacteria 622
284 Ga0105243_10215195 3300009148 Bacteria 1695
285 Ga0105243_10351053 3300009148 Bacteria 1354
286 Ga0105243_10493839 3300009148 Bacteria 1158
287 Ga0105243_11980105 3300009148 Bacteria 617
288 Ga0105241_10011989 3300009174 Bacteria 6365
289 Ga0105241_10057701 3300009174 Bacteria 2979
290 Ga0105241_10174510 3300009174 Bacteria 1778
291 Ga0105241_10555106 3300009174 Bacteria 1032
292 Ga0105241_10575649 3300009174 Bacteria 1014
293 Ga0105241_10703849 3300009174 Bacteria 922
294 Ga0105242_11111635 3300009176 Bacteria 805
295 Ga0105242_11277903 3300009176 Bacteria 757
296 Ga0105242_11791518 3300009176 Bacteria 652
297 Ga0105242_12759302 3300009176 Bacteria 541
298 Ga0105248_10132319 3300009177 Bacteria 2814
299 Ga0105248_10319725 3300009177 Bacteria 1748
300 Ga0105248_10530177 3300009177 Bacteria 1328
301 Ga0105248_10574246 3300009177 Bacteria 1272
302 Ga0105248_11361564 3300009177 Bacteria 803
303 Ga0105248_11378649 3300009177 Bacteria 798
304 Ga0105248_13215771 3300009177 Bacteria 520
305 Ga0105237_10003346 3300009545 Bacteria 19082
306 Ga0105237_10033346 3300009545 Bacteria 5216
307 Ga0105237_10174418 3300009545 Bacteria 2150
308 Ga0105237_10175568 3300009545 Bacteria 2143
309 Ga0105237_10210128 3300009545 Bacteria 1946
310 Ga0105237_10241999 3300009545 Bacteria 1805
311 Ga0105237_10559306 3300009545 Bacteria 1150
312 Ga0105237_10583113 3300009545 Bacteria 1125
313 Ga0105237_10647147 3300009545 Bacteria 1064
314 Ga0105237_10821601 3300009545 Bacteria 936
315 Ga0105237_10901653 3300009545 Bacteria 891
316 Ga0105237_11640848 3300009545 Bacteria 650
317 Ga0105238_10008128 3300009551 Bacteria 10489
318 Ga0105238_10010310 3300009551 Bacteria 9377
319 Ga0105238_10020057 3300009551 Bacteria 6805
320 Ga0105238_10111158 3300009551 Bacteria 2721
321 Ga0105238_10111592 3300009551 Bacteria 2714
322 Ga0105238_10685766 3300009551 Bacteria 1036
323 Ga0105238_11137917 3300009551 Bacteria 804
324 Ga0105238_12025769 3300009551 Bacteria 609
325 Ga0105249_10154863 3300009553 Bacteria 2209
326 Ga0105249_10608031 3300009553 Bacteria 1148
327 Ga0105249_12534635 3300009553 Bacteria 585
328 Ga0105249_12780345 3300009553 Bacteria 561
329 Ga0099796_10054915 3300010159 Bacteria 1394
330 Ga0105239_10008096 3300010375 Bacteria 11998
331 Ga0105239_10094734 3300010375 Bacteria 3298
332 Ga0105239_10110779 3300010375 Bacteria 3043
333 Ga0105239_10189475 3300010375 Bacteria 2302
334 Ga0105239_10199526 3300010375 Bacteria 2241
335 Ga0105239_10258381 3300010375 Bacteria 1957
336 Ga0105239_10278959 3300010375 Bacteria 1881
337 Ga0105239_10412241 3300010375 Bacteria 1530
338 Ga0105239_10479498 3300010375 Bacteria 1413
339 Ga0105239_11890350 3300010375 Bacteria 692
340 Ga0105246_10557030 3300011119 Bacteria 983
341 Ga0105246_10669763 3300011119 Bacteria 905
342 Ga0105246_10675893 3300011119 Bacteria 902
343 Ga0105246_11351798 3300011119 Bacteria 662
344 Ga0105246_12596514 3300011119 Bacteria 500
345 Ga0157335_1043756 3300012492 Bacteria 514
346 Ga0157373_10305646 3300013100 Bacteria 1129
347 Ga0157373_11062339 3300013100 Bacteria 606
348 Ga0157371_10215678 3300013102 Bacteria 1378
349 Ga0157371_10244328 3300013102 Bacteria 1292
350 Ga0157371_11175114 3300013102 Bacteria 591
351 Ga0157370_10016462 3300013104 Bacteria 7485
352 Ga0157370_10140677 3300013104 Bacteria 2249
353 Ga0157370_10185303 3300013104 Bacteria 1933
354 Ga0157370_10236824 3300013104 Bacteria 1689
355 Ga0157370_10243505 3300013104 Bacteria 1664
356 Ga0157370_10447684 3300013104 Bacteria 1187
357 Ga0157370_11155309 3300013104 Bacteria 699
358 Ga0157369_10024515 3300013105 Bacteria 6709
359 Ga0157369_10040217 3300013105 Bacteria 5105
360 Ga0157369_10050357 3300013105 Bacteria 4512
361 Ga0157369_10335206 3300013105 Bacteria 1571
362 Ga0157369_11452230 3300013105 Bacteria 698
363 Ga0157369_12181332 3300013105 Bacteria 562
364 Ga0157374_10031861 3300013296 Bacteria 4796
365 Ga0157374_10039337 3300013296 Bacteria 4352
366 Ga0157374_11040664 3300013296 Bacteria 838
367 Ga0157378_10003448 3300013297 Bacteria 14024
368 Ga0157378_10614676 3300013297 Bacteria 1099
369 Ga0163162_10045197 3300013306 Bacteria 4412
370 Ga0163162_10071696 3300013306 Bacteria 3518
371 Ga0163162_10134925 3300013306 Bacteria 2579
372 Ga0163162_10514310 3300013306 Bacteria 1327
373 Ga0163162_11088176 3300013306 Bacteria 905
374 Ga0163162_11428228 3300013306 Bacteria 787
375 Ga0163162_12358142 3300013306 Bacteria 612
376 Ga0157372_10078020 3300013307 Bacteria 3742
377 Ga0157372_10244820 3300013307 Bacteria 2081
378 Ga0157372_10746197 3300013307 Bacteria 1138
379 Ga0157372_12771001 3300013307 Bacteria 562
380 Ga0157372_13473488 3300013307 Bacteria 501
381 Ga0157375_10007186 3300013308 Bacteria 9732
382 Ga0157375_13480546 3300013308 Bacteria 524
383 Ga0163163_10010706 3300014325 Bacteria 8267
384 Ga0163163_10717523 3300014325 Bacteria 1063
385 Ga0157380_10075129 3300014326 Bacteria 2746
386 Ga0157380_10422614 3300014326 Bacteria 1272
387 Ga0157380_10614007 3300014326 Bacteria 1078
388 Ga0157380_10748389 3300014326 Bacteria 988
389 Ga0157377_10094096 3300014745 Bacteria 1775
390 Ga0157377_11349733 3300014745 Bacteria 560
391 Ga0157379_10106263 3300014968 Bacteria 2520
392 Ga0157379_10257354 3300014968 Bacteria 1585
393 Ga0157379_10686939 3300014968 Bacteria 960
394 Ga0157379_11891309 3300014968 Bacteria 588
395 Ga0157379_11992885 3300014968 Bacteria 574
396 Ga0157376_10052581 3300014969 Bacteria 3388
397 Ga0157376_10393643 3300014969 Bacteria 1338
398 Ga0157376_10580615 3300014969 Unclassified 1113
399 Ga0157376_11446977 3300014969 Bacteria 719
400 Ga0163161_10195980 3300017792 Bacteria 1555
401 Ga0163161_10445352 3300017792 Bacteria 1046
402 Ga0163161_11286351 3300017792 Bacteria 635
403 Ga0163161_11438589 3300017792 Bacteria 603
404 Ga0163161_12071814 3300017792 Bacteria 506
405 Ga0197907_11095771 3300020069 Bacteria 1100
406 Ga0197907_11224085 3300020069 Bacteria 848
407 Ga0197907_11225209 3300020069 Bacteria 847
408 Ga0206356_10682141 3300020070 Bacteria 1118
409 Ga0206352_11039941 3300020078 Bacteria 786
410 Ga0206350_10942758 3300020080 Bacteria 668
411 Ga0206350_11631821 3300020080 Bacteria 979
412 Ga0206353_12019823 3300020082 Bacteria 1243
413 Ga0213874_10134625 3300021377 Bacteria 851
414 Ga0213876_10072948 3300021384 Bacteria 1813
415 Ga0213876_10127854 3300021384 Bacteria 1350
416 Ga0213876_10334614 3300021384 Bacteria 805
417 Ga0213875_10087284 3300021388 Bacteria 1455
418 Ga0224712_10073442 3300022467 Bacteria 1395
419 Ga0224712_10122025 3300022467 Bacteria 1129
420 Ga0224570_101679 3300022730 Bacteria 1592
421 Ga0209677_100555 3300025253 Bacteria 20636
422 Ga0209148_1000679 3300025254 Bacteria 28441
423 Ga0209148_1007771 3300025254 Bacteria 2199
424 Ga0209233_1000826 3300025261 Bacteria 13712
425 Ga0209233_1011008 3300025261 Bacteria 2681
426 Ga0209455_1002608 3300025272 Bacteria 6857
427 Ga0209455_1002958 3300025272 Bacteria 6248
428 Ga0209455_1008958 3300025272 Bacteria 2666
429 Ga0209455_1009718 3300025272 Bacteria 2503
430 Ga0209758_1001784 3300025297 Bacteria 23779
431 Ga0209758_1007742 3300025297 Bacteria 7199
432 Ga0209758_1024291 3300025297 Bacteria 2706
433 Ga0209758_1024339 3300025297 Bacteria 2701
434 Ga0207656_10004296 3300025321 Bacteria 4963
435 Ga0207656_10163328 3300025321 Bacteria 1061
436 Ga0207656_10569553 3300025321 Bacteria 577
437 Ga0207653_10452208 3300025885 Bacteria 504
438 Ga0207682_10045943 3300025893 Bacteria 1793
439 Ga0207692_10020408 3300025898 Bacteria 3013
440 Ga0207642_10714977 3300025899 Bacteria 632
441 Ga0207710_10210708 3300025900 Bacteria 962
442 Ga0207710_10515929 3300025900 Bacteria 621
443 Ga0207688_10181400 3300025901 Bacteria 1256
444 Ga0207688_10961159 3300025901 Bacteria 540
445 Ga0207680_10112386 3300025903 Bacteria 1769
446 Ga0207647_10003286 3300025904 Bacteria 12138
447 Ga0207647_10300436 3300025904 Bacteria 914
448 Ga0207647_10596612 3300025904 Bacteria 609
449 Ga0207647_10751145 3300025904 Bacteria 528
450 Ga0207685_10001042 3300025905 Bacteria 5433
451 Ga0207699_10044277 3300025906 Bacteria 2590
452 Ga0207699_10128177 3300025906 Bacteria 1651
453 Ga0207705_10089452 3300025909 Bacteria 2253
454 Ga0207705_10109795 3300025909 Bacteria 2037
455 Ga0207705_10129403 3300025909 Bacteria 1878
456 Ga0207705_10296394 3300025909 Bacteria 1240
457 Ga0207705_10477844 3300025909 Bacteria 967
458 Ga0207684_10051065 3300025910 Bacteria 3508
459 Ga0207684_10092573 3300025910 Bacteria 2577
460 Ga0207654_10003714 3300025911 Bacteria 7704
461 Ga0207654_10094570 3300025911 Bacteria 1829
462 Ga0207654_10743399 3300025911 Bacteria 706
463 Ga0207707_10092864 3300025912 Bacteria 2636
464 Ga0207707_10130915 3300025912 Bacteria 2194
465 Ga0207707_10439382 3300025912 Bacteria 1117
466 Ga0207707_10626553 3300025912 Bacteria 908
467 Ga0207695_10000599 3300025913 Bacteria 72238
468 Ga0207695_10002303 3300025913 Bacteria 28471
469 Ga0207695_10074812 3300025913 Bacteria 3447
470 Ga0207695_10109656 3300025913 Bacteria 2741
471 Ga0207695_10203359 3300025913 Bacteria 1894
472 Ga0207695_10265948 3300025913 Bacteria 1611
473 Ga0207695_10267429 3300025913 Bacteria 1606
474 Ga0207695_10290525 3300025913 Bacteria 1527
475 Ga0207671_10141728 3300025914 Bacteria 1852
476 Ga0207671_10171331 3300025914 Bacteria 1686
477 Ga0207671_10377251 3300025914 Bacteria 1126
478 Ga0207671_10620565 3300025914 Bacteria 861
479 Ga0207671_10932425 3300025914 Bacteria 686
480 Ga0207693_10013985 3300025915 Bacteria 6463
481 Ga0207693_10041374 3300025915 Bacteria 3627
482 Ga0207693_10306622 3300025915 Bacteria 1243
483 Ga0207693_10487333 3300025915 Bacteria 963
484 Ga0207693_11121217 3300025915 Bacteria 597
485 Ga0207663_10002010 3300025916 Bacteria 9659
486 Ga0207663_10002313 3300025916 Bacteria 9131
487 Ga0207663_10691243 3300025916 Bacteria 807
488 Ga0207663_10855896 3300025916 Bacteria 726
489 Ga0207663_11206933 3300025916 Bacteria 609
490 Ga0207660_10212059 3300025917 Bacteria 1517
491 Ga0207660_10252814 3300025917 Bacteria 1391
492 Ga0207660_10577195 3300025917 Bacteria 915
493 Ga0207660_10772991 3300025917 Bacteria 784
494 Ga0207660_11055168 3300025917 Bacteria 662
495 Ga0207657_10009199 3300025919 Bacteria 9962
496 Ga0207657_10085378 3300025919 Bacteria 2644
497 Ga0207657_10125436 3300025919 Bacteria 2109
498 Ga0207657_10700502 3300025919 Bacteria 787
499 Ga0207649_10043126 3300025920 Bacteria 2756
500 Ga0207649_10079206 3300025920 Bacteria 2122
501 Ga0207649_10398824 3300025920 Bacteria 1029
502 Ga0207649_10931210 3300025920 Bacteria 682
503 Ga0207652_10005095 3300025921 Bacteria 10662
504 Ga0207652_10254405 3300025921 Bacteria 1584
505 Ga0207652_10881376 3300025921 Bacteria 791
506 Ga0207681_10194374 3300025923 Bacteria 1554
507 Ga0207694_10000640 3300025924 Bacteria 31572
508 Ga0207694_10134093 3300025924 Bacteria 1987
509 Ga0207694_10459084 3300025924 Bacteria 1064
510 Ga0207694_10602344 3300025924 Bacteria 924
511 Ga0207694_10707534 3300025924 Unclassified 850
512 Ga0207694_10729523 3300025924 Bacteria 836
513 Ga0207650_10873091 3300025925 Bacteria 763
514 Ga0207659_10491751 3300025926 Bacteria 1038
515 Ga0207687_10554607 3300025927 Bacteria 964
516 Ga0207687_10578300 3300025927 Bacteria 945
517 Ga0207687_11009816 3300025927 Bacteria 713
518 Ga0207687_11790879 3300025927 Bacteria 526
519 Ga0207700_10022317 3300025928 Bacteria 4342
520 Ga0207700_10174459 3300025928 Bacteria 1796
521 Ga0207700_10256614 3300025928 Bacteria 1495
522 Ga0207700_10367183 3300025928 Bacteria 1256
523 Ga0207700_10446643 3300025928 Bacteria 1139
524 Ga0207664_10055917 3300025929 Bacteria 3132
525 Ga0207664_10119959 3300025929 Bacteria 2199
526 Ga0207664_10475362 3300025929 Bacteria 1117
527 Ga0207644_10163491 3300025931 Bacteria 1732
528 Ga0207644_10277151 3300025931 Bacteria 1346
529 Ga0207644_10507726 3300025931 Unclassified 995
530 Ga0207690_10890636 3300025932 Bacteria 738
531 Ga0207690_10959011 3300025932 Bacteria 711
532 Ga0207706_10058421 3300025933 Bacteria 3397
533 Ga0207706_11100858 3300025933 Bacteria 664
534 Ga0207709_10065653 3300025935 Bacteria 2283
535 Ga0207709_10184702 3300025935 Bacteria 1475
536 Ga0207709_11478805 3300025935 Bacteria 563
537 Ga0207709_11530521 3300025935 Bacteria 554
538 Ga0207670_11360322 3300025936 Bacteria 603
539 Ga0207669_10070854 3300025937 Bacteria 2187
540 Ga0207669_10076801 3300025937 Bacteria 2122
541 Ga0207669_10658254 3300025937 Bacteria 857
542 Ga0207669_11534020 3300025937 Bacteria 568
543 Ga0207704_10557315 3300025938 Bacteria 932
544 Ga0207704_11119926 3300025938 Bacteria 669
545 Ga0207665_10041850 3300025939 Bacteria 3062
546 Ga0207665_10120497 3300025939 Bacteria 1853
547 Ga0207665_10252968 3300025939 Bacteria 1302
548 Ga0207665_10472413 3300025939 Bacteria 965
549 Ga0207665_10731091 3300025939 Bacteria 779
550 Ga0207665_10959934 3300025939 Bacteria 679
551 Ga0207665_11589355 3300025939 Bacteria 519
552 Ga0207711_10563029 3300025941 Bacteria 1063
553 Ga0207711_10697783 3300025941 Bacteria 947
554 Ga0207689_10309853 3300025942 Bacteria 1309
555 Ga0207689_10380514 3300025942 Bacteria 1175
556 Ga0207661_10374944 3300025944 Bacteria 1287
557 Ga0207679_11700178 3300025945 Bacteria 577
558 Ga0207667_10012446 3300025949 Bacteria 9802
559 Ga0207667_10021203 3300025949 Bacteria 7203
560 Ga0207667_10041398 3300025949 Bacteria 4899
561 Ga0207667_10101350 3300025949 Bacteria 2970
562 Ga0207667_10284556 3300025949 Bacteria 1689
563 Ga0207667_11512159 3300025949 Bacteria 642
564 Ga0207651_10452497 3300025960 Bacteria 1102
565 Ga0207651_10626538 3300025960 Bacteria 942
566 Ga0207712_11345624 3300025961 Bacteria 639
567 Ga0207712_11489807 3300025961 Bacteria 606
568 Ga0207668_10077889 3300025972 Bacteria 2392
569 Ga0207668_10087260 3300025972 Bacteria 2281
570 Ga0207668_11073236 3300025972 Bacteria 721
571 Ga0207668_11521347 3300025972 Bacteria 604
572 Ga0207668_11759665 3300025972 Bacteria 559
573 Ga0207640_10010628 3300025981 Bacteria 5191
574 Ga0207640_10024190 3300025981 Bacteria 3661
575 Ga0207640_10035195 3300025981 Bacteria 3132
576 Ga0207640_10275383 3300025981 Bacteria 1319
577 Ga0207640_10404024 3300025981 Bacteria 1113
578 Ga0207640_10570080 3300025981 Bacteria 954
579 Ga0207640_11320264 3300025981 Bacteria 644
580 Ga0207658_10100841 3300025986 Bacteria 2261
581 Ga0207658_10143622 3300025986 Bacteria 1935
582 Ga0207658_10594233 3300025986 Bacteria 994
583 Ga0207677_10312120 3300026023 Bacteria 1303
584 Ga0207677_11482782 3300026023 Bacteria 626
585 Ga0207703_10194599 3300026035 Bacteria 1798
586 Ga0207703_10714751 3300026035 Bacteria 953
587 Ga0207703_11273723 3300026035 Bacteria 707
588 Ga0207639_10052968 3300026041 Bacteria 3094
589 Ga0207639_10174315 3300026041 Bacteria 1824
590 Ga0207639_10245388 3300026041 Bacteria 1559
591 Ga0207639_10292854 3300026041 Bacteria 1436
592 Ga0207639_10311621 3300026041 Bacteria 1394
593 Ga0207639_10333323 3300026041 Bacteria 1351
594 Ga0207639_10502162 3300026041 Bacteria 1108
595 Ga0207639_11206571 3300026041 Bacteria 710
596 Ga0207639_11277243 3300026041 Bacteria 689
597 Ga0207678_10042283 3300026067 Bacteria 3949
598 Ga0207678_10075869 3300026067 Bacteria 2880
599 Ga0207678_10097040 3300026067 Bacteria 2519
600 Ga0207678_10200354 3300026067 Bacteria 1707
601 Ga0207678_10201488 3300026067 Bacteria 1702
602 Ga0207678_10489075 3300026067 Bacteria 1072
603 Ga0207678_10611270 3300026067 Bacteria 956
604 Ga0207678_11475109 3300026067 Bacteria 601
605 Ga0207708_10068850 3300026075 Bacteria 2709
606 Ga0207708_10394649 3300026075 Bacteria 1143
607 Ga0207702_10000005 3300026078 Bacteria 420296
608 Ga0207702_10000433 3300026078 Bacteria 47747
609 Ga0207702_10020902 3300026078 Bacteria 5416
610 Ga0207702_10194951 3300026078 Bacteria 1874
611 Ga0207702_10300203 3300026078 Bacteria 1524
612 Ga0207702_10990543 3300026078 Bacteria 834
613 Ga0207702_11064745 3300026078 Bacteria 802
614 Ga0207702_11880475 3300026078 Bacteria 590
615 Ga0207702_11897168 3300026078 Bacteria 587
616 Ga0207641_10588933 3300026088 Bacteria 1088
617 Ga0207641_10625206 3300026088 Bacteria 1056
618 Ga0207641_11650193 3300026088 Bacteria 643
619 Ga0207648_10095272 3300026089 Bacteria 2603
620 Ga0207648_11856729 3300026089 Bacteria 564
621 Ga0207676_10137053 3300026095 Bacteria 2090
622 Ga0207676_10550371 3300026095 Bacteria 1102
623 Ga0207674_10025823 3300026116 Bacteria 6254
624 Ga0207674_10233451 3300026116 Bacteria 1787
625 Ga0207674_10338901 3300026116 Bacteria 1454
626 Ga0207674_10910219 3300026116 Bacteria 848
627 Ga0207675_100163882 3300026118 Bacteria 2122
628 Ga0207683_10008058 3300026121 Bacteria 9009
629 Ga0207683_10046111 3300026121 Bacteria 3813
630 Ga0207683_10106690 3300026121 Bacteria 2505
631 Ga0207683_10707076 3300026121 Bacteria 934
632 Ga0207683_10900659 3300026121 Bacteria 821
633 Ga0207683_10944610 3300026121 Bacteria 801
634 Ga0207698_10583589 3300026142 Bacteria 1100
635 Ga0207698_10749213 3300026142 Bacteria 975
636 Ga0207698_10852498 3300026142 Bacteria 916
637 Ga0207698_12713805 3300026142 Bacteria 504
638 Ga0209589_1000030 3300027357 Bacteria 147457
639 Ga0209489_100056 3300027361 Bacteria 147457
640 Ga0209700_100059 3300027363 Bacteria 147457
641 Ga0209179_1004966 3300027512 Bacteria 2048
642 Ga0209179_1017500 3300027512 Bacteria 1359
643 Ga0209588_1079584 3300027671 Bacteria 1059
644 Ga0209588_1183741 3300027671 Bacteria 655
645 Ga0209813_10132975 3300027866 Bacteria 877
646 Ga0207428_10772282 3300027907 Bacteria 684
647 Ga0268266_10232069 3300028379 Bacteria 1700
648 Ga0268266_10360838 3300028379 Bacteria 1367
649 Ga0268266_10807257 3300028379 Bacteria 906
650 Ga0268266_11254070 3300028379 Bacteria 716
651 Ga0268266_11348623 3300028379 Bacteria 689
652 Ga0268266_11649498 3300028379 Bacteria 617
653 Ga0268266_11726338 3300028379 Bacteria 601
654 Ga0268265_10478508 3300028380 Bacteria 1169
655 Ga0268265_10684147 3300028380 Bacteria 989
656 Ga0268264_10924040 3300028381 Unclassified 877
657 Ga0268264_11234764 3300028381 Bacteria 757
658 Ga0307517_10000125 3300028786 Bacteria 115466
659 Ga0307515_10055660 3300028794 Bacteria 5773
660 Ga0307515_10163776 3300028794 Bacteria 2253
661 Ga0265338_10173830 3300028800 Bacteria 1649
662 Ga0265330_10025197 3300031235 Bacteria 2697
663 Ga0265330_10061925 3300031235 Bacteria 1627
664 Ga0265332_10037612 3300031238 Bacteria 2098
665 Ga0265328_10095601 3300031239 Bacteria 1098
666 Ga0265328_10263380 3300031239 Bacteria 661
667 Ga0265329_10289463 3300031242 Bacteria 552
668 Ga0265340_10012295 3300031247 Bacteria 4523
669 Ga0265339_10003767 3300031249 Bacteria 10572
670 Ga0265339_10492337 3300031249 Bacteria 567
671 Ga0265331_10130333 3300031250 Bacteria 1147
672 Ga0265331_10253617 3300031250 Bacteria 789
673 Ga0265316_10180062 3300031344 Bacteria 1574
674 Ga0265316_10397324 3300031344 Bacteria 993
675 Ga0307513_10246201 3300031456 Bacteria 1588
676 Ga0307509_10429566 3300031507 Bacteria 1020
677 Ga0307408_100750454 3300031548 Bacteria 881
678 Ga0265313_10333725 3300031595 Bacteria 604
679 Ga0307508_10055655 3300031616 Bacteria 3503
680 Ga0307508_10128819 3300031616 Bacteria 2134
681 Ga0265314_10001745 3300031711 Bacteria 23545
682 Ga0265314_10070770 3300031711 Bacteria 2336
683 Ga0265314_10175562 3300031711 Bacteria 1289
684 Ga0265342_10107254 3300031712 Bacteria 1584
685 Ga0265342_10364779 3300031712 Bacteria 750
686 Ga0307516_10018995 3300031730 Bacteria 7133
687 Ga0307516_10513343 3300031730 Bacteria 852
688 Ga0307516_10546770 3300031730 Bacteria 812
689 Ga0307516_10707194 3300031730 Bacteria 665
690 Ga0307405_11235505 3300031731 Bacteria 648
691 Ga0307406_10248824 3300031901 Bacteria 1338
692 Ga0307412_10052533 3300031911 Bacteria 2699
693 Ga0307412_10301259 3300031911 Bacteria 1267
694 Ga0307416_100217519 3300032002 Bacteria 1829
695 Ga0307416_100959145 3300032002 Bacteria 957
696 Ga0307411_10904363 3300032005 Bacteria 784
697 Ga0307415_100053891 3300032126 Bacteria 2743
698 Ga0307415_100499764 3300032126 Bacteria 1063
699 Ga0307415_101120864 3300032126 Bacteria 738
700 Ga0307510_10107608 3300033180 Bacteria 2546
701 Ga0307510_10120976 3300033180 Bacteria 2323
702 Ga0307510_10540196 3300033180 Bacteria 611
703 Ga0373930_0038412 3300034816 Bacteria 1011
704 Ga0373958_0036881 3300034819 Bacteria 984
705 Ga0373938_0230309 3300034957 Bacteria 523
706 Ga0373926_0141580 3300035083 Bacteria 914
707 Ga0373926_0318413 3300035083 Bacteria 608
708 Ga0373928_0236558 3300035084 Bacteria 539
709 Ga0373929_0092984 3300035085 Bacteria 751
710 Ga0373934_0073895 3300035086 Bacteria 1365
711 Ga0373934_0133542 3300035086 Bacteria 1013
712 Ga0373934_0411152 3300035086 Bacteria 566
713 Ga0373940_0035284 3300035088 Bacteria 1353
714 Ga0373944_0105233 3300035089 Bacteria 958
715 Ga0373923_0004696 3300035111 Bacteria 4557
716 Ga0373923_0036190 3300035111 Bacteria 2014
717 Ga0373941_0307231 3300035115 Bacteria 635
718 Ga0373945_0010983 3300035116 Bacteria 2988
719 Ga0373953_0000463 3300035117 Bacteria 11171
720 Ga0373953_0180656 3300035117 Bacteria 910
721 Ga0373954_0000100 3300035118 Bacteria 28999
722 Ga0373954_0014263 3300035118 Bacteria 3544
723 Ga0373954_0495116 3300035118 Bacteria 605
724 Ga0373956_0019223 3300035119 Bacteria 2897
725 Ga0373957_0001114 3300035120 Bacteria 7128
726 Ga0373943_0004760 3300035170 Bacteria 6139
727 Ga0373943_0136905 3300035170 Bacteria 1316
728 Ga0373946_0130797 3300035171 Bacteria 1154
729 Ga0373946_0584415 3300035171 Bacteria 578
730 Ga0373955_0010060 3300035172 Bacteria 4452
731 Ga0373955_0127201 3300035172 Bacteria 1485
732 Ga0373962_0036173 3300035242 Bacteria 1374
733 Ga0373962_0060465 3300035242 Bacteria 1112
734 Ga0373924_0013364 3300035410 Bacteria 3084
735 Ga0373931_0001608 3300035691 Bacteria 9778
736 Ga0373935_0004029 3300035692 Bacteria 8588
737 Ga0373935_1372752 3300035692 Bacteria 528
738 Ga0373935_1382231 3300035692 Bacteria 526
739 Ga0373927_0001617 3300035695 Bacteria 16890
740 Ga0373927_0014401 3300035695 Bacteria 5236
741 Ga0373927_0538974 3300035695 Bacteria 771
742 Ga0373933_0001041 3300035724 Bacteria 16838
743 Ga0373933_0340258 3300035724 Bacteria 974
744 Ga0373933_1007008 3300035724 Bacteria 549
745 Ga0373947_0004404 3300035725 Bacteria 8259
746 Ga0373947_0032215 3300035725 Bacteria 3088
747 Ga0373937_0005062 3300036401 Bacteria 11219
748 Ga0373937_0389086 3300036401 Bacteria 1323
749 Ga0373937_0588556 3300036401 Bacteria 1056
750 Ga0373937_0790140 3300036401 Bacteria 897
751 Ga0373937_1017379 3300036401 Bacteria 777
752 Ga0372808_000421 3300036459 Bacteria 3273
753 Ga0373925_0002598 3300037068 Bacteria 14354
754 Ga0373925_0779909 3300037068 Bacteria 788
755 Ga0373925_1588926 3300037068 Bacteria 535
756 Ga0395899_0108428 3300037312 Bacteria 1998
757 Ga0395899_0557658 3300037312 Bacteria 735
758 Ga0395899_0967895 3300037312 Bacteria 515
759 Ga0395900_0002106 3300037418 Bacteria 22287
760 Ga0395900_0158896 3300037418 Bacteria 2307
761 Ga0395900_0244986 3300037418 Bacteria 1796
762 Ga0395900_0289829 3300037418 Bacteria 1626
763 Ga0395900_0469775 3300037418 Bacteria 1211
764 Ga0395900_1172711 3300037418 Bacteria 684
765 Ga0395898_0003923 3300037466 Bacteria 16417
766 Ga0395898_0199944 3300037466 Bacteria 1908
767 Ga0395898_0212749 3300037466 Bacteria 1844
768 Ga0395898_0249329 3300037466 Bacteria 1693
769 Ga0395898_0306631 3300037466 Bacteria 1514
770 Ga0395905_0066254 3300037471 Bacteria 3382
771 Ga0395905_0403856 3300037471 Bacteria 1261
772 Ga0395905_0890155 3300037471 Bacteria 793
773 Ga0436364_0344445 3300037853 Bacteria 791
774 Ga0436364_0626210 3300037853 Bacteria 870
775 Ga0436364_0651896 3300037853 Bacteria 1528
776 Ga0436364_1050259 3300037853 Bacteria 2335
777 Ga0395901_0032684 3300038443 Bacteria 5366
778 Ga0395901_0298980 3300038443 Bacteria 1669
779 Ga0395901_0353548 3300038443 Bacteria 1516
780 Ga0395901_0467589 3300038443 Bacteria 1288
781 Ga0395901_0665552 3300038443 Bacteria 1043
782 Ga0395901_0867720 3300038443 Bacteria 886
783 Ga0395901_1427702 3300038443 Bacteria 650
784 Ga0436365_0992198 3300039437 Bacteria 1174
785 Ga0436365_1078347 3300039437 Bacteria 637
786 Ga0436365_1157227 3300039437 Bacteria 1481
787 Ga0436365_1195892 3300039437 Bacteria 695
788 Ga0436365_1424718 3300039437 Bacteria 3347
789 Ga0436365_1555241 3300039437 Bacteria 942
790 Ga0436365_1647844 3300039437 Bacteria 1993
791 Ga0436365_1732278 3300039437 Bacteria 534
792 Ga0436360_1371031 3300039438 Bacteria 820
793 Ga0436363_0206535 3300039450 Bacteria 539
794 Ga0436363_1215029 3300039450 Bacteria 891
795 Ga0436363_1432430 3300039450 Bacteria 629
796 Ga0436363_1589976 3300039450 Bacteria 1320
797 Ga0439465_0407873 3300041413 Bacteria 518
798 Ga0451793_0327457 3300041452 Bacteria 531
799 Ga0451795_1651510 3300041456 Bacteria 578
800 Ga0451800_1312593 3300041459 Bacteria 695
801 Ga0451802_1094405 3300041460 Bacteria 969
802 Ga0451833_0594095 3300041491 Bacteria 626
803 Ga0451833_0727547 3300041491 Bacteria 521
804 Ga0451837_1227548 3300041494 Bacteria 646
805 Ga0451839_0688458 3300041496 Bacteria 502
806 Ga0451839_1243053 3300041496 Bacteria 613
807 Ga0451853_3366637 3300041512 Bacteria 863
808 Ga0439459_0038845 3300042438 Bacteria 1003
809 Ga0466969_0018365 3300044656 Bacteria 3644
810 Ga0466972_0000156 3300044658 Bacteria 55040
811 Ga0466972_0366117 3300044658 Bacteria 675
812 Ga0466966_0001022 3300044684 Bacteria 17884
813 Ga0466961_0000338 3300044693 Bacteria 30740
814 Ga0466961_0128563 3300044693 Bacteria 1588
815 Ga0466963_0023740 3300044694 Bacteria 3898
816 Ga0466964_0278399 3300044706 Bacteria 835
817 Ga0466970_0146132 3300044765 Bacteria 1304
818 Ga0466970_0767049 3300044765 Bacteria 564
819 Ga0466957_0130623 3300044842 Bacteria 1609
820 Ga0466957_0149405 3300044842 Bacteria 1510
821 Ga0466957_0202595 3300044842 Bacteria 1304
822 Ga0466959_0016981 3300045049 Bacteria 5327
823 Ga0466959_0585822 3300045049 Bacteria 751
824 Ga0466959_0792666 3300045049 Bacteria 634
825 Ga0466958_0075935 3300045836 Bacteria 2062
826 Ga0466967_0047812 3300045976 Bacteria 3732
827 Ga0466967_0094054 3300045976 Bacteria 2728
828 Ga0466967_0125493 3300045976 Bacteria 2377
829 Ga0466967_0127173 3300045976 Bacteria 2362
830 Ga0495617_243007 3300046452 Bacteria 556
831 Ga0495592_0001413 3300046454 Bacteria 16659
832 Ga0495592_0014218 3300046454 Bacteria 6047
833 Ga0495592_0031368 3300046454 Bacteria 4017
834 Ga0495603_0000660 3300046455 Bacteria 19483
835 Ga0495603_0028560 3300046455 Bacteria 3365
836 Ga0495603_0054333 3300046455 Bacteria 2374
837 Ga0495603_0075202 3300046455 Bacteria 1983
838 Ga0495590_0224292 3300046457 Bacteria 695
839 Ga0495629_0000467 3300046459 Bacteria 33859
840 Ga0495629_0002123 3300046459 Bacteria 15363
841 Ga0495629_0225543 3300046459 Bacteria 1292
842 Ga0495629_0330702 3300046459 Bacteria 1041
843 Ga0495638_0012737 3300046460 Bacteria 5749
844 Ga0495638_0040822 3300046460 Bacteria 2938
845 Ga0495641_0007394 3300046461 Bacteria 6867
846 Ga0495641_0584011 3300046461 Bacteria 511
847 Ga0495651_0000990 3300046462 Bacteria 22041
848 Ga0495651_0002095 3300046462 Bacteria 15390
849 Ga0495651_0149571 3300046462 Bacteria 1685
850 Ga0495653_0000149 3300046463 Bacteria 58288
851 Ga0495650_0156834 3300046471 Bacteria 814
852 Ga0495650_0314071 3300046471 Bacteria 523
853 Ga0495580_0003995 3300046472 Bacteria 12443
854 Ga0495582_0000163 3300046473 Bacteria 35979
855 Ga0495605_0151716 3300046474 Bacteria 1034
856 Ga0495639_0000640 3300046475 Bacteria 16156
857 Ga0495639_0025777 3300046475 Bacteria 2594
858 Ga0495662_0000890 3300046476 Bacteria 14606
859 Ga0495662_0372646 3300046476 Bacteria 701
860 Ga0495662_0528146 3300046476 Bacteria 578
861 Ga0495664_0008332 3300046477 Bacteria 5781
862 Ga0495664_0197730 3300046477 Bacteria 1218
863 Ga0495664_0247954 3300046477 Bacteria 1077
864 Ga0495594_0001989 3300046499 Bacteria 10649
865 Ga0495594_0285770 3300046499 Bacteria 940
866 Ga0495596_0078141 3300046500 Bacteria 1285
867 Ga0495596_0185530 3300046500 Bacteria 809
868 Ga0495596_0214352 3300046500 Bacteria 748
869 Ga0495596_0218561 3300046500 Bacteria 740
870 Ga0495583_0032139 3300046506 Bacteria 2536
871 Ga0495606_0001450 3300046507 Bacteria 31779
872 Ga0495606_0006099 3300046507 Bacteria 11253
873 Ga0495606_0080671 3300046507 Bacteria 2024
874 Ga0495608_0005251 3300046511 Bacteria 9254
875 Ga0495608_0015229 3300046511 Bacteria 5335
876 Ga0495608_0755070 3300046511 Bacteria 576
877 Ga0495616_0315095 3300046513 Bacteria 658
878 Ga0495618_0086712 3300046514 Bacteria 2002
879 Ga0495620_0044299 3300046515 Bacteria 1934
880 Ga0495620_0093678 3300046515 Bacteria 1203
881 Ga0495620_0187272 3300046515 Bacteria 799
882 Ga0495628_0010023 3300046516 Bacteria 8062
883 Ga0495628_0020141 3300046516 Bacteria 5505
884 Ga0495628_0765819 3300046516 Bacteria 677
885 Ga0495630_0002387 3300046517 Bacteria 13052
886 Ga0495630_0345867 3300046517 Bacteria 1138
887 Ga0495630_1030519 3300046517 Bacteria 625
888 Ga0495632_0274356 3300046519 Bacteria 752
889 Ga0495637_0016691 3300046520 Bacteria 3431
890 Ga0495643_0112755 3300046522 Bacteria 1381
891 Ga0495644_0065593 3300046523 Bacteria 1364
892 Ga0495648_0007574 3300046524 Bacteria 8674
893 Ga0495648_0106109 3300046524 Bacteria 1539
894 Ga0495648_0111854 3300046524 Bacteria 1484
895 Ga0495648_0146487 3300046524 Bacteria 1237
896 Ga0495666_0021596 3300046526 Bacteria 3186
897 Ga0495652_0005306 3300046529 Bacteria 12152
898 Ga0495652_0023393 3300046529 Bacteria 5475
899 Ga0495652_0209577 3300046529 Bacteria 1472
900 Ga0495654_0012290 3300046530 Bacteria 4602
901 Ga0495665_0000853 3300046531 Bacteria 15971
902 Ga0495665_0040789 3300046531 Bacteria 2471
903 Ga0495665_0604804 3300046531 Bacteria 548
904 Ga0495640_0012917 3300046533 Bacteria 6366
905 Ga0495640_0025937 3300046533 Bacteria 4244
906 Ga0495640_0132066 3300046533 Bacteria 1615
907 Ga0495586_0532602 3300046535 Bacteria 678
908 Ga0495586_0702272 3300046535 Bacteria 584
909 Ga0495587_0001665 3300046536 Bacteria 14832
910 Ga0495587_0008004 3300046536 Bacteria 6825
911 Ga0495598_0061283 3300046537 Bacteria 1161
912 Ga0495645_0023487 3300046543 Bacteria 4465
913 Ga0495645_0129803 3300046543 Bacteria 1767
914 Ga0495622_0003281 3300046557 Bacteria 7654
915 Ga0495622_0016304 3300046557 Bacteria 3458
916 Ga0495622_0332677 3300046557 Bacteria 659
917 Ga0495633_0236463 3300046558 Bacteria 835
918 Ga0495667_0002267 3300046559 Bacteria 12880
919 Ga0495667_0512475 3300046559 Bacteria 751
920 Ga0495667_0698143 3300046559 Bacteria 629
921 Ga0495667_0720396 3300046559 Bacteria 618
922 Ga0495656_0054558 3300046615 Bacteria 1720
923 Ga0495656_0150905 3300046615 Bacteria 1122
924 Ga0495656_0356684 3300046615 Bacteria 759
925 Ga0495668_0064412 3300046616 Bacteria 2018
926 Ga0495668_0373714 3300046616 Bacteria 783
927 Ga0495634_0001271 3300046642 Bacteria 23127
928 Ga0495634_0117765 3300046642 Bacteria 1703
929 Ga0495634_0212368 3300046642 Bacteria 1197
930 Ga0495611_0054760 3300046648 Bacteria 1804
931 Ga0495625_0226442 3300046660 Bacteria 1223
932 Ga0495625_0421953 3300046660 Bacteria 829
933 Ga0495625_0609923 3300046660 Bacteria 654
934 Ga0495635_0001373 3300046663 Bacteria 16217
935 Ga0495635_0015240 3300046663 Bacteria 5378
936 Ga0495635_0036867 3300046663 Bacteria 3386
937 Ga0495659_0030274 3300046664 Bacteria 1883
938 Ga0495661_0057606 3300046665 Bacteria 2319
939 Ga0495588_0027529 3300046674 Bacteria 2841
940 Ga0495657_0000445 3300046675 Bacteria 38585
941 Ga0495657_0001981 3300046675 Bacteria 17450
942 Ga0495657_0186330 3300046675 Bacteria 1270
943 Ga0495657_0267822 3300046675 Bacteria 1025
944 Ga0495599_0000450 3300046678 Bacteria 23464
945 Ga0495599_0318470 3300046678 Bacteria 936
946 Ga0495599_0571704 3300046678 Bacteria 660
947 Ga0495623_0006629 3300046679 Bacteria 7537
948 Ga0495623_0062848 3300046679 Bacteria 2326
949 Ga0495646_0003846 3300046680 Bacteria 9382
950 Ga0495646_0006264 3300046680 Bacteria 7547
951 Ga0495646_0063439 3300046680 Bacteria 2194
952 Ga0495647_0014045 3300046681 Bacteria 2785
953 Ga0495658_0000512 3300046683 Bacteria 21274
954 Ga0495669_0021105 3300046684 Bacteria 2824
955 Ga0495613_0002976 3300046689 Bacteria 12687
956 Ga0495613_0040734 3300046689 Bacteria 3441
957 Ga0495613_0085506 3300046689 Bacteria 2288
958 Ga0495613_0467991 3300046689 Bacteria 852
959 Ga0495624_0019094 3300046690 Bacteria 4579
960 Ga0495624_0226569 3300046690 Bacteria 1133
961 Ga0495670_0277176 3300046691 Bacteria 896
962 Ga0495671_0044571 3300046692 Bacteria 2223
963 Ga0495671_0341762 3300046692 Bacteria 718
964 Ga0495649_0181182 3300046694 Bacteria 1099
965 Ga0495649_0253821 3300046694 Bacteria 903
966 Ga0495589_0028749 3300046794 Bacteria 2805
967 Ga0495600_0000243 3300046809 Bacteria 30003
968 Ga0495600_0001485 3300046809 Bacteria 13003
969 Ga0495600_0136217 3300046809 Bacteria 1595
970 Ga0495600_0676884 3300046809 Bacteria 622
971 Ga0495660_0104445 3300046810 Bacteria 1454
972 Ga0495581_0002361 3300047315 Bacteria 10645
973 Ga0495581_0062660 3300047315 Bacteria 2149
974 Ga0495604_0000525 3300047317 Bacteria 33842
975 Ga0495604_0004201 3300047317 Bacteria 11413
976 Ga0495636_0197309 3300047318 Bacteria 918
977 Ga0495674_0013125 3300047319 Bacteria 7791
978 Ga0495674_0038125 3300047319 Bacteria 4315
979 Ga0495674_0071551 3300047319 Bacteria 2993
980 Ga0495672_0012280 3300047320 Bacteria 5989
981 Ga0495672_0059610 3300047320 Bacteria 2207
982 Ga0495672_0128374 3300047320 Bacteria 1337
983 Ga0495672_0166549 3300047320 Bacteria 1128
984 Ga0495676_0035112 3300047321 Bacteria 4197
985 Ga0495680_0000424 3300047322 Bacteria 47310
986 Ga0495680_0003418 3300047322 Bacteria 15661
987 Ga0495680_0122447 3300047322 Bacteria 1919
988 Ga0495675_0024615 3300047444 Bacteria 3838
989 Ga0495675_0060810 3300047444 Bacteria 2393
990 Ga0495673_0086501 3300047469 Bacteria 1288
991 Ga0495673_0191689 3300047469 Bacteria 769
992 Ga0495673_0338943 3300047469 Bacteria 532
993 Ga0495684_0001470 3300047471 Bacteria 18854
994 Ga0495684_0045796 3300047471 Bacteria 3347
995 Ga0495686_0027149 3300047472 Bacteria 3740
996 Ga0495686_0186386 3300047472 Bacteria 1199
997 Ga0495686_0262306 3300047472 Bacteria 967
998 Ga0495593_0000331 3300047673 Bacteria 26196
999 Ga0495593_0001055 3300047673 Bacteria 16149
1000 Ga0495602_0001865 3300048088 Bacteria 21070
1001 Ga0495602_0008889 3300048088 Bacteria 10474
1002 Ga0495602_0527916 3300048088 Bacteria 821
1003 Ga0495602_0594187 3300048088 Bacteria 762
1004 Ga0495602_0784809 3300048088 Bacteria 641
1005 Ga0495602_1036048 3300048088 Bacteria 540
1006 Ga0495614_0011031 3300048089 Bacteria 3976
1007 Ga0495614_0206206 3300048089 Bacteria 891
1008 Ga0496100_0011680 3300048903 Bacteria 5005
1009 Ga0496100_0110459 3300048903 Bacteria 1909
1010 Ga0496100_0110464 3300048903 Bacteria 1909
1011 Ga0496100_0727466 3300048903 Bacteria 775
1012 Ga0496100_0754261 3300048903 Bacteria 761
1013 Ga0496100_0949607 3300048903 Bacteria 676
1014 Ga0496101_0009265 3300048904 Bacteria 6464
1015 Ga0496101_0068709 3300048904 Bacteria 2591
1016 Ga0496101_0193752 3300048904 Bacteria 1569
1017 Ga0496101_0202769 3300048904 Bacteria 1534
1018 Ga0496101_0470278 3300048904 Bacteria 992
1019 Ga0496101_0715198 3300048904 Bacteria 791
1020 Ga0496101_0938345 3300048904 Bacteria 681
1021 Ga0496102_0022547 3300048905 Bacteria 5579
1022 Ga0496102_0109205 3300048905 Bacteria 2577
1023 Ga0496102_0159967 3300048905 Bacteria 2118
1024 Ga0496102_0435555 3300048905 Bacteria 1231
1025 Ga0496102_0547730 3300048905 Bacteria 1080
1026 Ga0496102_0852909 3300048905 Bacteria 833
1027 Ga0496102_0966253 3300048905 Bacteria 773
1028 Ga0496103_0042036 3300048906 Bacteria 2811
1029 Ga0496104_0011363 3300048907 Bacteria 7969
1030 Ga0496104_0016078 3300048907 Bacteria 6791
1031 Ga0496104_0019100 3300048907 Bacteria 6265
1032 Ga0496104_0074254 3300048907 Bacteria 3237
1033 Ga0496104_0161312 3300048907 Bacteria 2151
1034 Ga0496105_0056294 3300048908 Bacteria 3246
1035 Ga0496105_0080798 3300048908 Bacteria 2685
1036 Ga0496105_0227235 3300048908 Bacteria 1517
1037 Ga0496106_0004969 3300048909 Bacteria 9837
1038 Ga0496106_0047169 3300048909 Bacteria 3241
1039 Ga0496106_0144827 3300048909 Bacteria 1871
1040 Ga0496107_0007254 3300048910 Bacteria 7638
1041 Ga0496107_0031659 3300048910 Bacteria 3776
1042 Ga0496107_0060235 3300048910 Bacteria 2747
1043 Ga0496107_0586757 3300048910 Bacteria 824
1044 Ga0496107_1353749 3300048910 Bacteria 508
1045 Ga0496108_0001645 3300048911 Bacteria 17709
1046 Ga0496108_0003899 3300048911 Bacteria 11982
1047 Ga0496108_0171639 3300048911 Bacteria 1876
1048 Ga0496108_0285441 3300048911 Bacteria 1437
1049 Ga0496108_0463431 3300048911 Bacteria 1107
1050 Ga0496109_0037994 3300048912 Bacteria 4351
1051 Ga0496109_0103725 3300048912 Bacteria 2639
1052 Ga0496109_0150576 3300048912 Bacteria 2178
1053 Ga0496110_0006735 3300048913 Bacteria 9134
1054 Ga0496110_0085956 3300048913 Bacteria 2807
1055 Ga0496110_0495570 3300048913 Bacteria 1112
1056 Ga0496110_0497908 3300048913 Unclassified 1109
1057 Ga0496111_0107288 3300048914 Bacteria 2056
1058 Ga0496111_0186395 3300048914 Bacteria 1542
1059 Ga0496111_0268133 3300048914 Bacteria 1266
1060 Ga0496111_0655654 3300048914 Bacteria 766
1061 Ga0496111_0745204 3300048914 Bacteria 711
1062 Ga0496111_0813560 3300048914 Bacteria 676
1063 Ga0496112_0000021 3300048915 Bacteria 156561
1064 Ga0496112_0006899 3300048915 Bacteria 10018
1065 Ga0496112_0028461 3300048915 Bacteria 5394
1066 Ga0496112_0038222 3300048915 Bacteria 4686
1067 Ga0496112_0191023 3300048915 Bacteria 2010
1068 Ga0496112_0193126 3300048915 Bacteria 1997
1069 Ga0496112_0248747 3300048915 Bacteria 1729
1070 Ga0496112_1441566 3300048915 Bacteria 603
1071 Ga0496113_0025392 3300048916 Bacteria 4222
1072 Ga0496113_0067505 3300048916 Bacteria 2712
1073 Ga0496113_0149239 3300048916 Bacteria 1843
1074 Ga0496113_0446785 3300048916 Bacteria 1039
1075 Ga0496114_0046685 3300048917 Bacteria 3600
1076 Ga0496114_0281081 3300048917 Bacteria 1467
1077 Ga0496114_0291477 3300048917 Bacteria 1440
1078 Ga0496114_0426457 3300048917 Bacteria 1175
1079 Ga0496114_0602887 3300048917 Bacteria 968
1080 Ga0496114_0686591 3300048917 Bacteria 899
1081 Ga0496114_0985766 3300048917 Bacteria 726
1082 Ga0496114_1386197 3300048917 Bacteria 590
1083 Ga0496114_1448124 3300048917 Bacteria 574
1084 Ga0496115_0003144 3300048918 Bacteria 11870
1085 Ga0496115_0034207 3300048918 Bacteria 4016
1086 Ga0496115_0144782 3300048918 Bacteria 1961
1087 Ga0496115_0168065 3300048918 Bacteria 1814
1088 Ga0496115_0198233 3300048918 Bacteria 1658
1089 Ga0496115_0964515 3300048918 Bacteria 654
1090 Ga0496116_0010718 3300048919 Bacteria 7652
1091 Ga0496116_0153382 3300048919 Bacteria 1275
1092 Ga0496116_0314563 3300048919 Bacteria 737
1093 Ga0496117_0021072 3300048920 Bacteria 5292
1094 Ga0496117_0112240 3300048920 Bacteria 1695
1095 Ga0496117_0158226 3300048920 Bacteria 1331
1096 Ga0496117_0581906 3300048920 Bacteria 527
1097 Ga0496118_0034875 3300048921 Bacteria 4097
1098 Ga0496118_0037062 3300048921 Bacteria 3931
1099 Ga0496118_0054161 3300048921 Bacteria 3041
1100 Ga0496118_0057920 3300048921 Bacteria 2900
1101 Ga0496119_0583445 3300048922 Bacteria 510
1102 Ga0496121_0001351 3300048924 Bacteria 41937
1103 Ga0496121_0005807 3300048924 Bacteria 15649
1104 Ga0496121_0006208 3300048924 Bacteria 14976
1105 Ga0496121_0036938 3300048924 Bacteria 4346
1106 Ga0496121_0041756 3300048924 Bacteria 4004
1107 Ga0496121_0071436 3300048924 Bacteria 2791
1108 Ga0496121_0101683 3300048924 Bacteria 2216
1109 Ga0496121_0103599 3300048924 Bacteria 2188
1110 Ga0496121_0132036 3300048924 Bacteria 1867
1111 Ga0496121_0275289 3300048924 Bacteria 1155
1112 Ga0496121_0292349 3300048924 Bacteria 1109
1113 Ga0496121_0340423 3300048924 Bacteria 1003
1114 Ga0496121_0412536 3300048924 Bacteria 881
1115 Ga0496121_0596017 3300048924 Bacteria 683
1116 Ga0496122_0028117 3300048925 Bacteria 4784
1117 Ga0496122_0109985 3300048925 Bacteria 1812
1118 Ga0496123_0014749 3300048926 Bacteria 6454
1119 Ga0496123_0104476 3300048926 Bacteria 1638
1120 Ga0496123_0175184 3300048926 Bacteria 1127
1121 Ga0496124_0080946 3300048927 Bacteria 2671
1122 Ga0496125_0000125 3300048928 Bacteria 169979
1123 Ga0496125_0003380 3300048928 Bacteria 19422
1124 Ga0496125_0004199 3300048928 Bacteria 16782
1125 Ga0496125_0055867 3300048928 Bacteria 3211
1126 Ga0496125_0114143 3300048928 Bacteria 1946
1127 Ga0496126_0002146 3300048929 Bacteria 27491
1128 Ga0496126_0109923 3300048929 Bacteria 2402
1129 Ga0496126_0112096 3300048929 Bacteria 2375
1130 Ga0496126_0123637 3300048929 Bacteria 2241
1131 Ga0496126_0131392 3300048929 Bacteria 2163
1132 Ga0496126_0132135 3300048929 Bacteria 2156
1133 Ga0496126_0243974 3300048929 Bacteria 1499
1134 Ga0496126_0292351 3300048929 Bacteria 1347
1135 Ga0496126_0646895 3300048929 Bacteria 828
1136 Ga0495678_126723 3300049459 Bacteria 851
1137 Ga0501031_0007949 3300049568 Bacteria 6905
1138 Ga0501031_0012029 3300049568 Bacteria 5643
1139 Ga0501031_0457453 3300049568 Bacteria 824
1140 Ga0501031_0601215 3300049568 Bacteria 708
1141 Ga0501032_0000345 3300049569 Bacteria 38831
1142 Ga0501032_0061759 3300049569 Bacteria 2511
1143 Ga0501032_0079352 3300049569 Bacteria 2185
1144 Ga0501032_0245998 3300049569 Bacteria 1161
1145 Ga0501032_0383748 3300049569 Bacteria 903
1146 Ga0501033_0000094 3300049570 Bacteria 84669
1147 Ga0501033_0001745 3300049570 Bacteria 19006
1148 Ga0501033_0011740 3300049570 Bacteria 6698
1149 Ga0501033_0040516 3300049570 Bacteria 3477
1150 Ga0501033_0359876 3300049570 Bacteria 1018
1151 Ga0501034_0000021 3300049571 Bacteria 266023
1152 Ga0501034_0170478 3300049571 Bacteria 2144
1153 Ga0501034_0318165 3300049571 Bacteria 1489
1154 Ga0501034_0562935 3300049571 Bacteria 1048
1155 Ga0501034_0836305 3300049571 Bacteria 811
1156 Ga0501036_0000115 3300049572 Bacteria 49866
1157 Ga0501036_0055368 3300049572 Bacteria 3360
1158 Ga0501036_0325309 3300049572 Bacteria 1284
1159 Ga0501036_0331121 3300049572 Bacteria 1272
1160 Ga0501037_0000450 3300049573 Bacteria 33712
1161 Ga0501037_0000505 3300049573 Bacteria 31438
1162 Ga0501037_0200230 3300049573 Bacteria 1411
1163 Ga0501037_0210562 3300049573 Bacteria 1371
1164 Ga0501037_0736229 3300049573 Bacteria 654
1165 Ga0501038_0000052 3300049574 Bacteria 94841
1166 Ga0501038_0028652 3300049574 Bacteria 4946
1167 Ga0501038_0041409 3300049574 Bacteria 4017
1168 Ga0501038_0061431 3300049574 Bacteria 3213
1169 Ga0501038_0677239 3300049574 Bacteria 775
1170 Ga0501039_0000549 3300049575 Bacteria 27168
1171 Ga0501039_0011127 3300049575 Bacteria 6857
1172 Ga0501039_0085024 3300049575 Bacteria 2464
1173 Ga0501039_0247016 3300049575 Bacteria 1403
1174 Ga0501039_0862199 3300049575 Bacteria 705
1175 Ga0501039_1069999 3300049575 Bacteria 626
1176 Ga0501040_0237002 3300049576 Bacteria 1300
1177 Ga0501041_0062219 3300049577 Bacteria 2285
1178 Ga0501042_0069426 3300049578 Bacteria 2520
1179 Ga0501042_0109003 3300049578 Bacteria 1993
1180 Ga0501043_0001704 3300049579 Bacteria 19033
1181 Ga0501043_0006502 3300049579 Bacteria 9381
1182 Ga0501043_0026498 3300049579 Bacteria 4547
1183 Ga0501043_0075484 3300049579 Bacteria 2648
1184 Ga0501043_0282687 3300049579 Bacteria 1271
1185 Ga0501046_0000133 3300049580 Bacteria 79467
1186 Ga0501046_0052069 3300049580 Bacteria 3228
1187 Ga0501046_0200037 3300049580 Bacteria 1487
1188 Ga0501046_0257938 3300049580 Bacteria 1281
1189 Ga0501046_0370789 3300049580 Bacteria 1037
1190 Ga0501046_0565478 3300049580 Bacteria 809
1191 Ga0501047_0000440 3300049581 Bacteria 46007
1192 Ga0501047_0015373 3300049581 Bacteria 7289
1193 Ga0501047_0035246 3300049581 Bacteria 4834
1194 Ga0501047_0091001 3300049581 Bacteria 2928
1195 Ga0501047_0338417 3300049581 Bacteria 1343
1196 Ga0501047_0776314 3300049581 Bacteria 773
1197 Ga0501048_0008678 3300049582 Bacteria 7661
1198 Ga0501048_0180106 3300049582 Bacteria 1498
1199 Ga0501048_0241732 3300049582 Bacteria 1281
1200 Ga0501048_0415886 3300049582 Bacteria 962
1201 Ga0501048_0776925 3300049582 Bacteria 688
1202 Ga0501048_0918026 3300049582 Bacteria 630
1203 Ga0501067_0000076 3300049583 Bacteria 56529
1204 Ga0501067_0012862 3300049583 Bacteria 4635
1205 Ga0501067_0355283 3300049583 Bacteria 817
1206 Ga0501068_0000511 3300049584 Bacteria 19711
1207 Ga0501068_0040672 3300049584 Bacteria 2792
1208 Ga0501068_0094427 3300049584 Bacteria 1849
1209 Ga0501069_0101728 3300049585 Bacteria 1631
1210 Ga0501069_0364192 3300049585 Bacteria 853
1211 Ga0501070_0051048 3300049586 Bacteria 3433
1212 Ga0501070_0116903 3300049586 Bacteria 2202
1213 Ga0501070_0148834 3300049586 Bacteria 1932
1214 Ga0501070_0495087 3300049586 Bacteria 982
1215 Ga0501070_0559656 3300049586 Bacteria 915
1216 Ga0501070_0562981 3300049586 Bacteria 911
1217 Ga0501071_0871668 3300049587 Bacteria 694
1218 Ga0501071_1187042 3300049587 Bacteria 590
1219 Ga0501072_0009145 3300049588 Bacteria 7524
1220 Ga0501072_1107912 3300049588 Bacteria 616
1221 Ga0501073_0000597 3300049589 Bacteria 25445
1222 Ga0501073_0047040 3300049589 Bacteria 3033
1223 Ga0501073_0054424 3300049589 Bacteria 2802
1224 Ga0501073_0286844 3300049589 Bacteria 1136
1225 Ga0501073_1173081 3300049589 Bacteria 527
1226 Ga0501074_0000285 3300049590 Bacteria 29182
1227 Ga0501074_0661447 3300049590 Bacteria 738
1228 Ga0501074_0802484 3300049590 Bacteria 663
1229 Ga0501075_1338412 3300049591 Bacteria 543
1230 Ga0501076_0143426 3300049592 Bacteria 1941
1231 Ga0501076_0358511 3300049592 Bacteria 1198
1232 Ga0501076_0744897 3300049592 Bacteria 809
1233 Ga0501079_0012998 3300049741 Bacteria 6350
1234 Ga0501079_0523523 3300049741 Bacteria 932
1235 Ga0501079_1102783 3300049741 Bacteria 625
1236 Ga0501080_0001080 3300049742 Bacteria 22459
1237 Ga0501080_0027884 3300049742 Bacteria 5251
1238 Ga0501080_0515348 3300049742 Bacteria 1067
1239 Ga0501083_0000881 3300049744 Bacteria 19851
1240 Ga0501083_0660720 3300049744 Bacteria 680
1241 Ga0501083_1018407 3300049744 Bacteria 539
1242 Ga0501083_1117767 3300049744 Bacteria 513
1243 Ga0501035_0000255 3300049822 Bacteria 63841
1244 Ga0501035_0003073 3300049822 Bacteria 16022
1245 Ga0501035_0176206 3300049822 Bacteria 1844
1246 Ga0501035_0279085 3300049822 Bacteria 1413
1247 Ga0501035_0281484 3300049822 Bacteria 1405
1248 Ga0501035_0286314 3300049822 Bacteria 1391
1249 Ga0501035_0839913 3300049822 Bacteria 731
1250 Ga0501044_0000141 3300049823 Bacteria 88569
1251 Ga0501044_0378703 3300049823 Bacteria 1330
1252 Ga0501044_0544323 3300049823 Bacteria 1058
1253 Ga0501044_1420588 3300049823 Bacteria 559
1254 Ga0501044_1544348 3300049823 Bacteria 529
1255 Ga0501045_0026069 3300049824 Bacteria 4202
1256 nmdc:mga03683_131951_c1 3300050489 Bacteria 1118
1257 nmdc:mga03n38_124467_c1 3300050490 Bacteria 1271
1258 nmdc:mga03n38_199726_c1 3300050490 Bacteria 1034
1259 nmdc:mga03n38_322088_c1 3300050490 Bacteria 835
1260 nmdc:mga03n38_374579_c1 3300050490 Bacteria 779
1261 nmdc:mga03n38_533584_c1 3300050490 Bacteria 662
1262 nmdc:mga00v17_27862_c1 3300050491 Bacteria 3302
1263 nmdc:mga0yw44_15935_c1 3300050492 Bacteria 4044
1264 nmdc:mga0yw44_168663_c1 3300050492 Bacteria 1436
1265 nmdc:mga0yw44_172490_c1 3300050492 Bacteria 1421
1266 nmdc:mga0yw44_435045_c1 3300050492 Bacteria 889
1267 nmdc:mga06z11_218397_c1 3300050494 Bacteria 1113
1268 nmdc:mga06z11_22052_c1 3300050494 Bacteria 2968
1269 nmdc:mga06z11_46278_c1 3300050494 Bacteria 2204
1270 nmdc:mga06z11_686494_c1 3300050494 Bacteria 624
1271 nmdc:mga06z11_998443_c1 3300050494 Bacteria 510
1272 nmdc:mga04h51_153237_c1 3300050495 Bacteria 882
1273 nmdc:mga07m45_20707_c1 3300050496 Bacteria 3574
1274 nmdc:mga07m45_60424_c1 3300050496 Bacteria 2145
1275 nmdc:mga0n895_125876_c1 3300050512 Bacteria 2586
1276 nmdc:mga0n895_157304_c1 3300050512 Bacteria 2303
1277 nmdc:mga0n895_1799724_c1 3300050512 Bacteria 573
1278 nmdc:mga0n895_1842919_c1 3300050512 Bacteria 565
1279 nmdc:mga0n895_427342_c1 3300050512 Bacteria 1339
1280 nmdc:mga0rr50_143496_c1 3300050513 Bacteria 1923
1281 nmdc:mga0rr50_1702083_c1 3300050513 Bacteria 531
1282 nmdc:mga08x19_1263314_c1 3300050514 Unclassified 523
1283 nmdc:mga0a205_81104_c1 3300050515 Bacteria 3134
1284 nmdc:mga0sz30_392822_c1 3300050516 Bacteria 621
1285 Ga0495601_0020961 3300053077 Bacteria 3997
1286 Ga0495601_0081572 3300053077 Bacteria 2076
1287 Ga0495601_0357694 3300053077 Bacteria 949
1288 Ga0495601_0995686 3300053077 Bacteria 527
1289 Ga0500635_0129261 3300053080 Bacteria 951
1290 Ga0495655_0102560 3300053083 Bacteria 849
1291 Ga0495595_0020753 3300053084 Bacteria 2862
1292 Ga0495595_0144385 3300053084 Bacteria 1169
1293 Ga0495595_0199587 3300053084 Bacteria 996
1294 Ga0495595_0343022 3300053084 Bacteria 753
1295 Ga0495619_0007177 3300053085 Bacteria 7059
1296 Ga0495619_0022508 3300053085 Bacteria 4034
1297 Ga0495619_0023422 3300053085 Bacteria 3959
1298 Ga0495619_0041790 3300053085 Bacteria 3000
1299 Ga0500578_0138596 3300053086 Bacteria 1522
1300 Ga0500578_0331562 3300053086 Bacteria 894
1301 Ga0500578_0773748 3300053086 Bacteria 510
1302 Ga0500643_063024 3300053087 Bacteria 1038
1303 Ga0500643_155180 3300053087 Bacteria 614
1304 Ga0500581_153470 3300053089 Bacteria 1078
1305 Ga0500646_0050132 3300053090 Bacteria 1202
1306 Ga0500647_0048290 3300053091 Bacteria 2046
1307 Ga0500651_0028509 3300053093 Bacteria 3511
1308 Ga0500566_0000100 3300053094 Bacteria 43788
1309 Ga0500566_0000307 3300053094 Bacteria 26281
1310 Ga0500566_0000533 3300053094 Bacteria 21348
1311 Ga0500566_0133706 3300053094 Bacteria 1324
1312 Ga0500640_006540 3300053095 Bacteria 4460
1313 Ga0500640_106532 3300053095 Bacteria 1149
1314 Ga0500641_0003537 3300053096 Bacteria 5524
1315 Ga0500650_0003654 3300053098 Bacteria 5407
1316 Ga0500554_001684 3300053102 Bacteria 4254
1317 Ga0500556_0000125 3300053104 Bacteria 65777
1318 Ga0500562_113775 3300053108 Bacteria 737
1319 Ga0500562_214284 3300053108 Bacteria 521
1320 Ga0500572_000670 3300053111 Bacteria 11297
1321 Ga0500572_000830 3300053111 Bacteria 9731
1322 Ga0500572_008998 3300053111 Bacteria 2349
1323 Ga0500591_239844 3300053115 Bacteria 574
1324 Ga0500595_033212 3300053119 Bacteria 1714
1325 Ga0500607_020131 3300053121 Bacteria 3770
1326 Ga0500607_313723 3300053121 Bacteria 569
1327 Ga0500608_067744 3300053122 Bacteria 1700
1328 Ga0500608_118838 3300053122 Bacteria 1202
1329 Ga0500608_203832 3300053122 Bacteria 815
1330 Ga0500608_311678 3300053122 Bacteria 578
1331 Ga0500614_001477 3300053123 Bacteria 5607
1332 Ga0500618_011218 3300053125 Bacteria 2382
1333 Ga0500626_034818 3300053128 Bacteria 2275
1334 Ga0500642_0000105 3300053130 Bacteria 40593
1335 Ga0500652_001527 3300053131 Bacteria 7103
1336 Ga0500655_150258 3300053133 Bacteria 503
1337 Ga0500658_0076936 3300053134 Bacteria 1419
1338 Ga0500559_0000240 3300053136 Bacteria 43636
1339 Ga0500559_0000976 3300053136 Bacteria 17874
1340 Ga0500559_0001326 3300053136 Bacteria 14251
1341 Ga0500559_0238844 3300053136 Bacteria 856
1342 Ga0500568_0004846 3300053139 Bacteria 7104
1343 Ga0500568_0011215 3300053139 Bacteria 4173
1344 Ga0500577_0003197 3300053142 Bacteria 4240
1345 Ga0500586_001365 3300053145 Bacteria 5132
1346 Ga0500588_0158843 3300053146 Bacteria 822
1347 Ga0500590_084113 3300053148 Bacteria 1558
1348 Ga0500590_106540 3300053148 Bacteria 1337
1349 Ga0500603_000017 3300053150 Bacteria 56324
1350 Ga0500603_108545 3300053150 Bacteria 831
1351 Ga0500604_0004360 3300053151 Bacteria 3759
1352 Ga0500616_0000085 3300053153 Bacteria 193192
1353 Ga0500619_151464 3300053154 Bacteria 788
1354 Ga0500620_205274 3300053155 Bacteria 671
1355 Ga0500622_0000822 3300053156 Bacteria 26570
1356 Ga0500622_0250230 3300053156 Bacteria 778
1357 Ga0500624_042027 3300053157 Bacteria 825
1358 Ga0500630_001073 3300053159 Bacteria 12793
1359 Ga0500633_0079886 3300053160 Bacteria 1182
1360 Ga0500638_000755 3300053162 Bacteria 8802
1361 Ga0500638_140583 3300053162 Bacteria 1085
1362 Ga0500639_000306 3300053163 Bacteria 24115
1363 Ga0500639_158482 3300053163 Bacteria 1033
1364 Ga0500636_0000875 3300053177 Bacteria 16155
1365 Ga0500636_0001972 3300053177 Bacteria 11289
1366 Ga0500636_0162034 3300053177 Bacteria 1218
1367 Ga0500636_0295424 3300053177 Bacteria 801
1368 Ga0500637_0237409 3300053178 Bacteria 1023
1369 Ga0500637_0368745 3300053178 Bacteria 757
1370 Ga0500637_0422065 3300053178 Bacteria 685
1371 Ga0500576_148056 3300053725 Bacteria 882
1372 Ga0500625_147381 3300053729 Bacteria 893
1373 Ga0500645_032111 3300053730 Bacteria 1576
1374 Ga0500596_002124 3300053735 Bacteria 3941
1375 Ga0501084_0848909 3300054114 Bacteria 769
1376 Ga0501084_0997352 3300054114 Bacteria 704
1377 Ga0501084_1120743 3300054114 Bacteria 660
1378 Ga0501082_0003023 3300060353 Bacteria 14697
1379 Ga0501082_0546497 3300060353 Bacteria 1013
1380 Ga0501082_1186229 3300060353 Bacteria 667
1381 2507509744 2507262055 Bacteria 8048963
1382 2508543760 2508501009 Bacteria 7784016
1383 2508698452 2508501042 Bacteria 8719808
1384 2511400342 2511231028 Bacteria 8046582
1385 2513625305 2513237092 Bacteria 8341956
1386 2513645105 2513237094 Bacteria 8789602
1387 2513646190 2513237095 Bacteria 8976980
1388 2513678583 2513237098 Bacteria 9902361
1389 2513706642 2513237102 Bacteria 7703324
1390 2513714981 2513237104 Bacteria 10034502
1391 2513875823 2513237139 Bacteria 8737671
1392 2514011511 2513237161 Bacteria 8871253
1393 2515630044 2515154112 Bacteria 8294334
1394 2517103558 2517093001 Bacteria 9002274
1395 2524441065 2524023205 Bacteria 8918781
1396 2524470053 2524023210 Bacteria 9029266
1397 2528854169 2528768022 Bacteria 10457665
1398 2603859834 2602042107 Bacteria 6226103
1399 2617349267 2617270735 Bacteria 9163226
1400 2617378209 2617270741 Bacteria 8201522
1401 2687579451 2687453129 Bacteria 4387428
1402 2745082412 2744054633 Bacteria 8678936
1403 2793060281 2791355196 Bacteria 7323613
1404 2805917647 2802429603 Bacteria 8777136
1405 2818241471 2816332527 Bacteria 8933356
1406 2824602150 2824600985 Bacteria 8488197
1407 2824610138 2824609381 Bacteria 8672835
1408 2824623848 2824617872 Bacteria 8814715
1409 2824627738 2824626560 Bacteria 8813858
1410 2824639274 2824635225 Bacteria 8785348
1411 2824652024 2824644064 Bacteria 8743947
1412 2824656117 2824653114 Bacteria 8493680
1413 2824670778 2824661429 Bacteria 9877870
1414 2824679497 2824671348 Bacteria 8369588
1415 2824683961 2824679649 Bacteria 8248951
1416 2824696125 2824687955 Bacteria 8360029
1417 2824703797 2824696289 Bacteria 8335049
1418 2824711384 2824704595 Bacteria 9667483
1419 2824722189 2824714736 Bacteria 8717648
1420 2824727681 2824723954 Bacteria 8758240
1421 2824733522 2824732956 Bacteria 7810675
1422 2824746898 2824746037 Bacteria 7911610
1423 2824761691 2824753945 Bacteria 9787441
1424 2824771306 2824763712 Bacteria 9792355
1425 2824774001 2824773399 Bacteria 8360218
1426 2838130050 2838122688 Bacteria 8803140
1427 2841941207 2841941048 Bacteria 8688029
1428 2841952766 2841949485 Bacteria 8680857
1429 2841962279 2841957949 Bacteria 8652217
1430 2841967362 2841966195 Bacteria 8673214
1431 2841979241 2841974524 Bacteria 8931498
1432 2841990816 2841983080 Bacteria 8395090
1433 2842038657 2842038055 Bacteria 8002051
1434 2842048398 2842045827 Bacteria 8006841
1435 2844318056 2844315083 Bacteria 8138177
1436 2847945429 2847939898 Bacteria 8606328
1437 2849080383 2849076700 Bacteria 7039503
1438 2857510267 2857509624 Bacteria 7472071
1439 2857528482 2857524615 Bacteria 6615449
1440 2874595146 2874590934 Bacteria 8299676
1441 2874615616 2874612657 Bacteria 8252029
1442 2874621640 2874620515 Bacteria 8290088
1443 2874632725 2874628541 Bacteria 8630250
1444 2874651007 2874645413 Bacteria 8214782
1445 2876764508 2876761206 Bacteria 10111113
1446 2876775082 2876771140 Bacteria 8287509
1447 2876823897 2876818435 Bacteria 8274608
1448 2879080525 2879074833 Bacteria 8279565
1449 2879109374 2879099564 Bacteria 10442239
1450 2879134869 2879127579 Bacteria 8294491
1451 2879149180 2879142872 Bacteria 8267021
1452 2881366259 2881364244 Bacteria 7710352
1453 2881672887 2881665667 Bacteria 8175609
1454 2885372851 2885366525 Bacteria 8326213
1455 2885413027 2885409591 Bacteria 9235467
1456 2888382851 2888378607 Bacteria 9652610
1457 2888394946 2888388044 Bacteria 7304136
1458 2888423330 2888419890 Bacteria 7857137
1459 2893070202 2893066018 Bacteria 6158120
1460 2903729635 2903727486 Bacteria 8281579
1461 2904668644 2904666416 Bacteria 8226587
1462 2904696933 2904690495 Bacteria 9412302
1463 2904716638 2904711408 Bacteria 9771557
1464 2906605783 2906602504 Bacteria 8295279
1465 2906628237 2906626472 Bacteria 8826946
1466 2908761510 2908756301 Bacteria 8864324
1467 2908778974 2908775508 Bacteria 8092255
1468 2919076153 2919073203 Bacteria 6531949
1469 2922373060
1470 2922392069 2922386360 Bacteria 7017218
1471 2922395260 2922393267 Bacteria 8285685
1472 2929615877 2929615660 Bacteria 9193770
1473 2929630490 2929624759 Bacteria 9339455
1474 2932792485 2932784394 Bacteria 9704911
1475 2932800369 2932794094 Bacteria 7915132
1476 2932804542 2932801729 Bacteria 7987968
1477 2932814005 2932809354 Bacteria 9135765
1478 2932819504 2932818245 Bacteria 9955613
1479 2932833789 2932828146 Bacteria 9745859
1480 2933578837 2933577622 Bacteria 9116884
1481 2935611396 2935608549 Bacteria 8203142
1482 2935618685 2935616580 Bacteria 9032984
1483 2935644475 2935638405 Bacteria 10015038
1484 2935648780 2935648319 Bacteria 8801166
1485 2935657137 2935656913 Bacteria 8965014
1486 2935674212 2935665750 Bacteria 9571747
1487 2935678527 2935675223 Bacteria 9928132
1488 2935687976 2935684952 Bacteria 9590419
1489 2935701412 2935694250 Bacteria 9291695
1490 2935708333 2935703347 Bacteria 10242284
1491 2935714996 2935713505 Bacteria 9608509
1492 2935726439 2935722832 Bacteria 9608746
1493 2935733814 2935732158 Bacteria 9706831
1494 2935743193 2935741537 Bacteria 9707219
1495 2935754768 2935750917 Bacteria 9590372
1496 2935765475 2935760218 Bacteria 9817913
1497 2935775231 2935769743 Bacteria 7878163
1498 2935779571 2935777560 Bacteria 8077691
1499 2935791571 2935785616 Bacteria 7962367
1500 2935799883 2935793552 Bacteria 8012592
1501 2935805429 2935801545 Bacteria 9301974
1502 2935816723 2935810662 Bacteria 9401221
1503 2935820873 2935819856 Bacteria 8261050
1504 2935833776 2935827899 Bacteria 10038562
1505 2935839538 2935837841 Bacteria 9454360
1506 2935850867 2935847175 Bacteria 8228321
1507 2935857050 2935855204 Bacteria 9035059
1508 2935871126 2935864058 Bacteria 9784707
1509 2935876371 2935873716 Bacteria 9632195
1510 2935889736 2935883170 Bacteria 7964738
1511 2935913766 2935908558 Bacteria 8568796
1512 2935920244 2935916978 Bacteria 9113783
1513 2935930583 2935926038 Bacteria 8601059
1514 2935939444 2935934488 Bacteria 8602579
1515 2935946393 2935942939 Bacteria 8599779
1516 2935955768 2935951376 Bacteria 8602333
1517 2935966923 2935959822 Bacteria 7869783
1518 2935972522 2935967501 Bacteria 8603075
1519 2935991022 2935984226 Bacteria 8302647
1520 2935997660 2935992306 Bacteria 9802711
1521 2936007178 2936002035 Bacteria 9362176
1522 2936011690 2936011229 Bacteria 8801034
1523 2936020285 2936019824 Bacteria 8804134
1524 2936028980 2936028420 Bacteria 8965941
1525 2936043015 2936037263 Bacteria 9446081
1526 2936047008 2936046547 Bacteria 8903709
1527 2936058112 2936055302 Bacteria 8785755
1528 2940559855 2940556831 Bacteria 9590747
1529 2941536051 2941531003 Bacteria 7653939
1530 2941540227 2941538514 Bacteria 9402094
1531 3005488179 3005483717 Bacteria 7877331
1532 3005512671 3005506211 Bacteria 6943378
1533 3005590438 3005587118 Bacteria 7794411
1534 3005598105 3005594810 Bacteria 8716512
1535 3005713783 3005710791 Bacteria 7622528
1536 3005721295 3005718088 Bacteria 8283608
1537 8006928655 8006926726 Bacteria 6749210
1538 8016514646 8016511872 Bacteria 9921665
1539 8016530749 8016522445 Bacteria 8156687
1540 8016536038 8016530956 Bacteria 8155261
1541 8016540318 8016539877 Bacteria 8155419
1542 8016552913 8016548790 Bacteria 8155074
1543 8016561291 8016557553 Bacteria 8154380
1544 8016574384 8016566248 Bacteria 8158151
1545 8016578484 8016575299 Bacteria 8154085
1546 8016591288 8016583857 Bacteria 10421953
1547 8016599150 8016595262 Bacteria 8149947
1548 8016611899 8016603502 Bacteria 8731218
1549 8016621907 8016613128 Bacteria 8794220
1550 8016627946 8016622563 Bacteria 7999408
1551 8016632267 8016630954 Bacteria 9217207
1552 8017061786 8017057580 Bacteria 10023680
1553 8019535763 8019530166 Bacteria 8155624
1554 8019543716 8019538911 Bacteria 7872763
1555 8019555056 8019547302 Bacteria 7996444
1556 8019581312 8019576017 Bacteria 10049540
1557 8019588937 8019586578 Bacteria 10212056
1558 8019616267 8019608314 Bacteria 10042931
1559 8019626868 8019619141 Bacteria 9218857
1560 8019635648 8019629233 Bacteria 8687553
1561 8019657032 8019648815 Bacteria 10014479
1562 8019673059 8019668869 Bacteria 8791617
1563 8019683082 8019678201 Bacteria 8863603
1564 8019688775 8019687851 Bacteria 8712826
1565 8055747524 8055742211 Bacteria 9226248
1566 8056680511 8056673599 Bacteria 7871253
1567 8056683870 8056681323 Bacteria 8472857
1568 8056691267 8056689827 Bacteria 6712655
1569 8056972402 8056967851 Bacteria 9038162
1570 Ga0068856_100006491
1571 JGI24742J22300_10009000
1572 JGI25406J46586_10000078
1573 JGI25406J46586_10007863
1574 JGI25153J46596_10010523
1575 JGI25153J46596_10022305
1576 JGI25404J52841_10001821
1577 JGI25404J52841_10002922
1578 JGI25404J52841_10032590
1579 Ga0055542_1002566
1580 Ga0055529_1021822
1581 Ga0055529_1031775
1582 Ga0070658_10042658
1583 Ga0070658_10161467
1584 Ga0070658_10210295
1585 Ga0070658_10387757
1586 Ga0070676_10108708
1587 Ga0070683_101462219
1588 Ga0070683_101647371
1589 Ga0070690_100215512
1590 Ga0070690_100419124
1591 Ga0070690_101517762
1592 Ga0070677_10740214
1593 Ga0068869_100711069
1594 Ga0068869_100991556
1595 Ga0068869_101356368
1596 Ga0070680_100288044
1597 Ga0070682_100118026
1598 Ga0070682_100667417
1599 Ga0070682_101805127
1600 Ga0070660_100064655
1601 Ga0070660_100167335
1602 Ga0070689_101529616
1603 Ga0070691_10489537
1604 Ga0070661_100276878
1605 Ga0070661_100627335
1606 Ga0070661_101487638
1607 Ga0070668_100021296
1608 Ga0070668_100119222
1609 Ga0070668_100139245
1610 Ga0070668_100280847
1611 Ga0070669_100720157
1612 Ga0070671_100100866
1613 Ga0070671_100164278
1614 Ga0070674_100030516
1615 Ga0070674_100073588
1616 Ga0070674_100207926
1617 Ga0070673_100202032
1618 Ga0070673_100218490
1619 Ga0070673_100691724
1620 Ga0070673_100812672
1621 Ga0070659_100052649
1622 Ga0070659_100856376
1623 Ga0070659_101067897
1624 Ga0070667_100070238
1625 Ga0070667_100199869
1626 Ga0070667_100758517
1627 Ga0070667_101207043
1628 Ga0070709_10051798
1629 Ga0070714_100008919
1630 Ga0070714_100069803
1631 Ga0070714_101086456
1632 Ga0070713_100002496
1633 Ga0070713_100043496
1634 Ga0070713_100051383
1635 Ga0070713_100188572
1636 Ga0070713_100196742
1637 Ga0070713_100417186
1638 Ga0070713_102188772
1639 Ga0070710_10002216
1640 Ga0070710_10005858
1641 Ga0070710_10063822
1642 Ga0070710_10877299
1643 Ga0070710_11535926
1644 Ga0070701_10309659
1645 Ga0070711_100004598
1646 Ga0070711_100009923
1647 Ga0070711_100043803
1648 Ga0070711_100383681
1649 Ga0070711_100660610
1650 Ga0070711_101310346
1651 Ga0070700_100205013
1652 Ga0070700_101759084
1653 Ga0070663_100071153
1654 Ga0070663_100074690
1655 Ga0070663_100166747
1656 Ga0070663_100260411
1657 Ga0070663_101192185
1658 Ga0070678_100195784
1659 Ga0070678_100264579
1660 Ga0070678_100600278
1661 Ga0070678_100999439
1662 Ga0070678_102362768
1663 Ga0070662_100199528
1664 Ga0070662_100358098
1665 Ga0070662_100904746
1666 Ga0070662_100933192
1667 Ga0070681_10149264
1668 Ga0070681_10221402
1669 Ga0070681_11044690
1670 Ga0070681_11346821
1671 Ga0068867_100362026
1672 Ga0070685_10227941
1673 Ga0070706_100104252
1674 Ga0070707_100651447
1675 Ga0070698_100095475
1676 Ga0070698_101029613
1677 Ga0070699_100232537
1678 Ga0070699_100512689
1679 Ga0070679_100015207
1680 Ga0070679_100176711
1681 Ga0070684_100566673
1682 Ga0070684_101855553
1683 Ga0070697_100284549
1684 Ga0068853_100052136
1685 Ga0068853_100064125
1686 Ga0068853_100387067
1687 Ga0068853_101064271
1688 Ga0068853_101523309
1689 Ga0068853_101564149
1690 Ga0070672_100490312
1691 Ga0070686_100114215
1692 Ga0070686_101165948
1693 Ga0070696_101209436
1694 Ga0070693_100138758
1695 Ga0070693_100625821
1696 Ga0070665_100067159
1697 Ga0070665_100135737
1698 Ga0070665_100148723
1699 Ga0070665_100226507
1700 Ga0070665_100254057
1701 Ga0070665_100948965
1702 Ga0068855_100008391
1703 Ga0068855_100023606
1704 Ga0068855_100212427
1705 Ga0068855_100427997
1706 Ga0068855_100433863
1707 Ga0068855_100677195
1708 Ga0068855_101121170
1709 Ga0068855_101140637
1710 Ga0068855_101333530
1711 Ga0070664_100055730
1712 Ga0070664_100390206
1713 Ga0068857_100362524
1714 Ga0068857_101065744
1715 Ga0068854_100027459
1716 Ga0068854_100081207
1717 Ga0068854_100384302
1718 Ga0068854_101772312
1719 Ga0068856_100005799
1720 Ga0068856_100116497
1721 Ga0068856_100250331
1722 Ga0068856_100473108
1723 Ga0068856_100999793
1724 Ga0070702_100175428
1725 Ga0070702_100468668
1726 Ga0070702_100572428
1727 Ga0068852_100026885
1728 Ga0068852_100452737
1729 Ga0068852_100549554
1730 Ga0068852_100577230
1731 Ga0068852_100611543
1732 Ga0068852_101063374
1733 Ga0068859_101596147
1734 Ga0068864_100163405
1735 Ga0068864_100930207
1736 Ga0068864_101440622
1737 Ga0068866_10498265
1738 Ga0068866_11261235
1739 Ga0068861_100015345
1740 Ga0068861_101145494
1741 Ga0068861_102533418
1742 Ga0068851_10000888
1743 Ga0068851_10083850
1744 Ga0068851_10272875
1745 Ga0068851_10714023
1746 Ga0068870_10825192
1747 Ga0068863_100606370
1748 Ga0068863_100808947
1749 Ga0068863_100828036
1750 Ga0068858_100149929
1751 Ga0068858_101694758
1752 Ga0068860_101991785
1753 Ga0068862_100237565
1754 Ga0081455_10007525
1755 Ga0081455_10010928
1756 Ga0081455_10029071
1757 Ga0081455_10040471
1758 Ga0081455_10044093
1759 Ga0081455_10259013
1760 Ga0081455_10713172
1761 Ga0081538_10105051
1762 Ga0081540_1001581
1763 Ga0081540_1005915
1764 Ga0081540_1007598
1765 Ga0081540_1028204
1766 Ga0081540_1140599
1767 Ga0081539_10000273
1768 Ga0081539_10001396
1769 Ga0081539_10016511
1770 Ga0081539_10024577
1771 Ga0070717_10001732
1772 Ga0070717_10005433
1773 Ga0070717_10619675
1774 Ga0070717_10784474
1775 Ga0075365_10059920
1776 Ga0075365_10111717
1777 Ga0075365_10133407
1778 Ga0075365_10850681
1779 Ga0075365_10932833
1780 Ga0075365_11102401
1781 Ga0075365_11216017
1782 Ga0075368_10190425
1783 Ga0075368_10260237
1784 Ga0075363_100127088
1785 Ga0075363_100301805
1786 Ga0075363_100532338
1787 Ga0075363_100796190
1788 Ga0075363_100946565
1789 Ga0075364_10589544
1790 Ga0075364_10720532
1791 Ga0075364_10904668
1792 Ga0070715_10005372
1793 Ga0070716_100078714
1794 Ga0070716_100690990
1795 Ga0070716_101008191
1796 Ga0070712_100098511
1797 Ga0070712_100142802
1798 Ga0070712_100238449
1799 Ga0070712_101486979
1800 Ga0075362_10377500
1801 Ga0075367_10029703
1802 Ga0075367_10032866
1803 Ga0075367_10033392
1804 Ga0075367_10063233
1805 Ga0075367_10249298
1806 Ga0075367_10860052
1807 Ga0075369_10111089
1808 Ga0075366_10184467
1809 Ga0075366_10483446
1810 Ga0097621_100786338
1811 Ga0097621_101364779
1812 Ga0075370_10110987
1813 Ga0075370_10237161
1814 Ga0075370_10588450
1815 Ga0068871_100808109
1816 Ga0068871_100919258
1817 Ga0075434_102396040
1818 Ga0068865_100359398
1819 Ga0068865_101103683
1820 Ga0097620_101596536
1821 Ga0099824_1004610
1822 Ga0099822_1001276
1823 Ga0075435_100156290
1824 Ga0099794_10037121
1825 Ga0099794_10044971
1826 Ga0099794_10052805
1827 Ga0099795_10028020
1828 Ga0099795_10330472
1829 Ga0099795_10350483
1830 Ga0099795_10428823
1831 Ga0099795_10532114
1832 Ga0105250_10213935
1833 Ga0105240_10005415
1834 Ga0105240_10040418
1835 Ga0105240_10052328
1836 Ga0105240_10083106
1837 Ga0105240_10146974
1838 Ga0105240_10411111
1839 Ga0105240_11229578
1840 Ga0105240_11334528
1841 Ga0105240_11910566
1842 Ga0111539_10334875
1843 Ga0105245_10570787
1844 Ga0105245_10788219
1845 Ga0105245_10844199
1846 Ga0105245_11334991
1847 Ga0105245_13014047
1848 Ga0105247_10151737
1849 Ga0105247_10257934
1850 Ga0105247_11070066
1851 Ga0105247_11345461
1852 Ga0114129_12467396
1853 Ga0105243_10215195
1854 Ga0105243_10351053
1855 Ga0105243_10493839
1856 Ga0105243_11980105
1857 Ga0105241_10011989
1858 Ga0105241_10057701
1859 Ga0105241_10174510
1860 Ga0105241_10555106
1861 Ga0105241_10575649
1862 Ga0105241_10703849
1863 Ga0105242_11111635
1864 Ga0105242_11277903
1865 Ga0105242_11791518
1866 Ga0105242_12759302
1867 Ga0105248_10132319
1868 Ga0105248_10319725
1869 Ga0105248_10530177
1870 Ga0105248_10574246
1871 Ga0105248_11361564
1872 Ga0105248_11378649
1873 Ga0105248_13215771
1874 Ga0105237_10003346
1875 Ga0105237_10033346
1876 Ga0105237_10174418
1877 Ga0105237_10175568
1878 Ga0105237_10210128
1879 Ga0105237_10241999
1880 Ga0105237_10559306
1881 Ga0105237_10583113
1882 Ga0105237_10647147
1883 Ga0105237_10821601
1884 Ga0105237_10901653
1885 Ga0105237_11640848
1886 Ga0105238_10008128
1887 Ga0105238_10010310
1888 Ga0105238_10020057
1889 Ga0105238_10111158
1890 Ga0105238_10111592
1891 Ga0105238_10685766
1892 Ga0105238_11137917
1893 Ga0105238_12025769
1894 Ga0105249_10154863
1895 Ga0105249_10608031
1896 Ga0105249_12534635
1897 Ga0105249_12780345
1898 Ga0099796_10054915
1899 Ga0105239_10008096
1900 Ga0105239_10094734
1901 Ga0105239_10110779
1902 Ga0105239_10189475
1903 Ga0105239_10199526
1904 Ga0105239_10258381
1905 Ga0105239_10278959
1906 Ga0105239_10412241
1907 Ga0105239_10479498
1908 Ga0105239_11890350
1909 Ga0105246_10557030
1910 Ga0105246_10669763
1911 Ga0105246_10675893
1912 Ga0105246_11351798
1913 Ga0105246_12596514
1914 Ga0157335_1043756
1915 Ga0157373_10305646
1916 Ga0157373_11062339
1917 Ga0157371_10215678
1918 Ga0157371_10244328
1919 Ga0157371_11175114
1920 Ga0157370_10016462
1921 Ga0157370_10140677
1922 Ga0157370_10185303
1923 Ga0157370_10236824
1924 Ga0157370_10243505
1925 Ga0157370_10447684
1926 Ga0157370_11155309
1927 Ga0157369_10024515
1928 Ga0157369_10040217
1929 Ga0157369_10050357
1930 Ga0157369_10335206
1931 Ga0157369_11452230
1932 Ga0157369_12181332
1933 Ga0157374_10031861
1934 Ga0157374_10039337
1935 Ga0157374_11040664
1936 Ga0157378_10003448
1937 Ga0157378_10614676
1938 Ga0163162_10045197
1939 Ga0163162_10071696
1940 Ga0163162_10134925
1941 Ga0163162_10514310
1942 Ga0163162_11088176
1943 Ga0163162_11428228
1944 Ga0163162_12358142
1945 Ga0157372_10078020
1946 Ga0157372_10244820
1947 Ga0157372_10746197
1948 Ga0157372_12771001
1949 Ga0157372_13473488
1950 Ga0157375_10007186
1951 Ga0157375_13480546
1952 Ga0163163_10010706
1953 Ga0163163_10717523
1954 Ga0157380_10075129
1955 Ga0157380_10422614
1956 Ga0157380_10614007
1957 Ga0157380_10748389
1958 Ga0157377_10094096
1959 Ga0157377_11349733
1960 Ga0157379_10106263
1961 Ga0157379_10257354
1962 Ga0157379_10686939
1963 Ga0157379_11891309
1964 Ga0157379_11992885
1965 Ga0157376_10052581
1966 Ga0157376_10393643
1967 Ga0157376_10580615
1968 Ga0157376_11446977
1969 Ga0163161_10195980
1970 Ga0163161_10445352
1971 Ga0163161_11286351
1972 Ga0163161_11438589
1973 Ga0163161_12071814
1974 Ga0197907_11095771
1975 Ga0197907_11224085
1976 Ga0197907_11225209
1977 Ga0206356_10682141
1978 Ga0206352_11039941
1979 Ga0206350_10942758
1980 Ga0206350_11631821
1981 Ga0206353_12019823
1982 Ga0213874_10134625
1983 Ga0213876_10072948
1984 Ga0213876_10127854
1985 Ga0213876_10334614
1986 Ga0213875_10087284
1987 Ga0224712_10073442
1988 Ga0224712_10122025
1989 Ga0224570_101679
1990 Ga0209677_100555
1991 Ga0209148_1000679
1992 Ga0209148_1007771
1993 Ga0209233_1000826
1994 Ga0209233_1011008
1995 Ga0209455_1002608
1996 Ga0209455_1002958
1997 Ga0209455_1008958
1998 Ga0209455_1009718
1999 Ga0209758_1001784
2000 Ga0209758_1007742
2001 Ga0209758_1024291
2002 Ga0209758_1024339
2003 Ga0207656_10004296
2004 Ga0207656_10163328
2005 Ga0207656_10569553
2006 Ga0207653_10452208
2007 Ga0207682_10045943
2008 Ga0207692_10020408
2009 Ga0207642_10714977
2010 Ga0207710_10210708
2011 Ga0207710_10515929
2012 Ga0207688_10181400
2013 Ga0207688_10961159
2014 Ga0207680_10112386
2015 Ga0207647_10003286
2016 Ga0207647_10300436
2017 Ga0207647_10596612
2018 Ga0207647_10751145
2019 Ga0207685_10001042
2020 Ga0207699_10044277
2021 Ga0207699_10128177
2022 Ga0207705_10089452
2023 Ga0207705_10109795
2024 Ga0207705_10129403
2025 Ga0207705_10296394
2026 Ga0207705_10477844
2027 Ga0207684_10051065
2028 Ga0207684_10092573
2029 Ga0207654_10003714
2030 Ga0207654_10094570
2031 Ga0207654_10743399
2032 Ga0207707_10092864
2033 Ga0207707_10130915
2034 Ga0207707_10439382
2035 Ga0207707_10626553
2036 Ga0207695_10000599
2037 Ga0207695_10002303
2038 Ga0207695_10074812
2039 Ga0207695_10109656
2040 Ga0207695_10203359
2041 Ga0207695_10265948
2042 Ga0207695_10267429
2043 Ga0207695_10290525
2044 Ga0207671_10141728
2045 Ga0207671_10171331
2046 Ga0207671_10377251
2047 Ga0207671_10620565
2048 Ga0207671_10932425
2049 Ga0207693_10013985
2050 Ga0207693_10041374
2051 Ga0207693_10306622
2052 Ga0207693_10487333
2053 Ga0207693_11121217
2054 Ga0207663_10002010
2055 Ga0207663_10002313
2056 Ga0207663_10691243
2057 Ga0207663_10855896
2058 Ga0207663_11206933
2059 Ga0207660_10212059
2060 Ga0207660_10252814
2061 Ga0207660_10577195
2062 Ga0207660_10772991
2063 Ga0207660_11055168
2064 Ga0207657_10009199
2065 Ga0207657_10085378
2066 Ga0207657_10125436
2067 Ga0207657_10700502
2068 Ga0207649_10043126
2069 Ga0207649_10079206
2070 Ga0207649_10398824
2071 Ga0207649_10931210
2072 Ga0207652_10005095
2073 Ga0207652_10254405
2074 Ga0207652_10881376
2075 Ga0207681_10194374
2076 Ga0207694_10000640
2077 Ga0207694_10134093
2078 Ga0207694_10459084
2079 Ga0207694_10602344
2080 Ga0207694_10707534
2081 Ga0207694_10729523
2082 Ga0207650_10873091
2083 Ga0207659_10491751
2084 Ga0207687_10554607
2085 Ga0207687_10578300
2086 Ga0207687_11009816
2087 Ga0207687_11790879
2088 Ga0207700_10022317
2089 Ga0207700_10174459
2090 Ga0207700_10256614
2091 Ga0207700_10367183
2092 Ga0207700_10446643
2093 Ga0207664_10055917
2094 Ga0207664_10119959
2095 Ga0207664_10475362
2096 Ga0207644_10163491
2097 Ga0207644_10277151
2098 Ga0207644_10507726
2099 Ga0207690_10890636
2100 Ga0207690_10959011
2101 Ga0207706_10058421
2102 Ga0207706_11100858
2103 Ga0207709_10065653
2104 Ga0207709_10184702
2105 Ga0207709_11478805
2106 Ga0207709_11530521
2107 Ga0207670_11360322
2108 Ga0207669_10070854
2109 Ga0207669_10076801
2110 Ga0207669_10658254
2111 Ga0207669_11534020
2112 Ga0207704_10557315
2113 Ga0207704_11119926
2114 Ga0207665_10041850
2115 Ga0207665_10120497
2116 Ga0207665_10252968
2117 Ga0207665_10472413
2118 Ga0207665_10731091
2119 Ga0207665_10959934
2120 Ga0207665_11589355
2121 Ga0207711_10563029
2122 Ga0207711_10697783
2123 Ga0207689_10309853
2124 Ga0207689_10380514
2125 Ga0207661_10374944
2126 Ga0207679_11700178
2127 Ga0207667_10012446
2128 Ga0207667_10021203
2129 Ga0207667_10041398
2130 Ga0207667_10101350
2131 Ga0207667_10284556
2132 Ga0207667_11512159
2133 Ga0207651_10452497
2134 Ga0207651_10626538
2135 Ga0207712_11345624
2136 Ga0207712_11489807
2137 Ga0207668_10077889
2138 Ga0207668_10087260
2139 Ga0207668_11073236
2140 Ga0207668_11521347
2141 Ga0207668_11759665
2142 Ga0207640_10010628
2143 Ga0207640_10024190
2144 Ga0207640_10035195
2145 Ga0207640_10275383
2146 Ga0207640_10404024
2147 Ga0207640_10570080
2148 Ga0207640_11320264
2149 Ga0207658_10100841
2150 Ga0207658_10143622
2151 Ga0207658_10594233
2152 Ga0207677_10312120
2153 Ga0207677_11482782
2154 Ga0207703_10194599
2155 Ga0207703_10714751
2156 Ga0207703_11273723
2157 Ga0207639_10052968
2158 Ga0207639_10174315
2159 Ga0207639_10245388
2160 Ga0207639_10292854
2161 Ga0207639_10311621
2162 Ga0207639_10333323
2163 Ga0207639_10502162
2164 Ga0207639_11206571
2165 Ga0207639_11277243
2166 Ga0207678_10042283
2167 Ga0207678_10075869
2168 Ga0207678_10097040
2169 Ga0207678_10200354
2170 Ga0207678_10201488
2171 Ga0207678_10489075
2172 Ga0207678_10611270
2173 Ga0207678_11475109
2174 Ga0207708_10068850
2175 Ga0207708_10394649
2176 Ga0207702_10000005
2177 Ga0207702_10000433
2178 Ga0207702_10020902
2179 Ga0207702_10194951
2180 Ga0207702_10300203
2181 Ga0207702_10990543
2182 Ga0207702_11064745
2183 Ga0207702_11880475
2184 Ga0207702_11897168
2185 Ga0207641_10588933
2186 Ga0207641_10625206
2187 Ga0207641_11650193
2188 Ga0207648_10095272
2189 Ga0207648_11856729
2190 Ga0207676_10137053
2191 Ga0207676_10550371
2192 Ga0207674_10025823
2193 Ga0207674_10233451
2194 Ga0207674_10338901
2195 Ga0207674_10910219
2196 Ga0207675_100163882
2197 Ga0207683_10008058
2198 Ga0207683_10046111
2199 Ga0207683_10106690
2200 Ga0207683_10707076
2201 Ga0207683_10900659
2202 Ga0207683_10944610
2203 Ga0207698_10583589
2204 Ga0207698_10749213
2205 Ga0207698_10852498
2206 Ga0207698_12713805
2207 Ga0209589_1000030
2208 Ga0209489_100056
2209 Ga0209700_100059
2210 Ga0209179_1004966
2211 Ga0209179_1017500
2212 Ga0209588_1079584
2213 Ga0209588_1183741
2214 Ga0209813_10132975
2215 Ga0207428_10772282
2216 Ga0268266_10232069
2217 Ga0268266_10360838
2218 Ga0268266_10807257
2219 Ga0268266_11254070
2220 Ga0268266_11348623
2221 Ga0268266_11649498
2222 Ga0268266_11726338
2223 Ga0268265_10478508
2224 Ga0268265_10684147
2225 Ga0268264_10924040
2226 Ga0268264_11234764
2227 Ga0307517_10000125
2228 Ga0307515_10055660
2229 Ga0307515_10163776
2230 Ga0265338_10173830
2231 Ga0265330_10025197
2232 Ga0265330_10061925
2233 Ga0265332_10037612
2234 Ga0265328_10095601
2235 Ga0265328_10263380
2236 Ga0265329_10289463
2237 Ga0265340_10012295
2238 Ga0265339_10003767
2239 Ga0265339_10492337
2240 Ga0265331_10130333
2241 Ga0265331_10253617
2242 Ga0265316_10180062
2243 Ga0265316_10397324
2244 Ga0307513_10246201
2245 Ga0307509_10429566
2246 Ga0307408_100750454
2247 Ga0265313_10333725
2248 Ga0307508_10055655
2249 Ga0307508_10128819
2250 Ga0265314_10001745
2251 Ga0265314_10070770
2252 Ga0265314_10175562
2253 Ga0265342_10107254
2254 Ga0265342_10364779
2255 Ga0307516_10018995
2256 Ga0307516_10513343
2257 Ga0307516_10546770
2258 Ga0307516_10707194
2259 Ga0307405_11235505
2260 Ga0307406_10248824
2261 Ga0307412_10052533
2262 Ga0307412_10301259
2263 Ga0307416_100217519
2264 Ga0307416_100959145
2265 Ga0307411_10904363
2266 Ga0307415_100053891
2267 Ga0307415_100499764
2268 Ga0307415_101120864
2269 Ga0307510_10107608
2270 Ga0307510_10120976
2271 Ga0307510_10540196
2272 Ga0373930_0038412
2273 Ga0373958_0036881
2274 Ga0373938_0230309
2275 Ga0373926_0141580
2276 Ga0373926_0318413
2277 Ga0373928_0236558
2278 Ga0373929_0092984
2279 Ga0373934_0073895
2280 Ga0373934_0133542
2281 Ga0373934_0411152
2282 Ga0373940_0035284
2283 Ga0373944_0105233
2284 Ga0373923_0004696
2285 Ga0373923_0036190
2286 Ga0373941_0307231
2287 Ga0373945_0010983
2288 Ga0373953_0000463
2289 Ga0373953_0180656
2290 Ga0373954_0000100
2291 Ga0373954_0014263
2292 Ga0373954_0495116
2293 Ga0373956_0019223
2294 Ga0373957_0001114
2295 Ga0373943_0004760
2296 Ga0373943_0136905
2297 Ga0373946_0130797
2298 Ga0373946_0584415
2299 Ga0373955_0010060
2300 Ga0373955_0127201
2301 Ga0373962_0036173
2302 Ga0373962_0060465
2303 Ga0373924_0013364
2304 Ga0373931_0001608
2305 Ga0373935_0004029
2306 Ga0373935_1372752
2307 Ga0373935_1382231
2308 Ga0373927_0001617
2309 Ga0373927_0014401
2310 Ga0373927_0538974
2311 Ga0373933_0001041
2312 Ga0373933_0340258
2313 Ga0373933_1007008
2314 Ga0373947_0004404
2315 Ga0373947_0032215
2316 Ga0373937_0005062
2317 Ga0373937_0389086
2318 Ga0373937_0588556
2319 Ga0373937_0790140
2320 Ga0373937_1017379
2321 Ga0372808_000421
2322 Ga0373925_0002598
2323 Ga0373925_0779909
2324 Ga0373925_1588926
2325 Ga0395899_0108428
2326 Ga0395899_0557658
2327 Ga0395899_0967895
2328 Ga0395900_0002106
2329 Ga0395900_0158896
2330 Ga0395900_0244986
2331 Ga0395900_0289829
2332 Ga0395900_0469775
2333 Ga0395900_1172711
2334 Ga0395898_0003923
2335 Ga0395898_0199944
2336 Ga0395898_0212749
2337 Ga0395898_0249329
2338 Ga0395898_0306631
2339 Ga0395905_0066254
2340 Ga0395905_0403856
2341 Ga0395905_0890155
2342 Ga0436364_0344445
2343 Ga0436364_0626210
2344 Ga0436364_0651896
2345 Ga0436364_1050259
2346 Ga0395901_0032684
2347 Ga0395901_0298980
2348 Ga0395901_0353548
2349 Ga0395901_0467589
2350 Ga0395901_0665552
2351 Ga0395901_0867720
2352 Ga0395901_1427702
2353 Ga0436365_0992198
2354 Ga0436365_1078347
2355 Ga0436365_1157227
2356 Ga0436365_1195892
2357 Ga0436365_1424718
2358 Ga0436365_1555241
2359 Ga0436365_1647844
2360 Ga0436365_1732278
2361 Ga0436360_1371031
2362 Ga0436363_0206535
2363 Ga0436363_1215029
2364 Ga0436363_1432430
2365 Ga0436363_1589976
2366 Ga0439465_0407873
2367 Ga0451793_0327457
2368 Ga0451795_1651510
2369 Ga0451800_1312593
2370 Ga0451802_1094405
2371 Ga0451833_0594095
2372 Ga0451833_0727547
2373 Ga0451837_1227548
2374 Ga0451839_0688458
2375 Ga0451839_1243053
2376 Ga0451853_3366637
2377 Ga0439459_0038845
2378 Ga0466969_0018365
2379 Ga0466972_0000156
2380 Ga0466972_0366117
2381 Ga0466966_0001022
2382 Ga0466961_0000338
2383 Ga0466961_0128563
2384 Ga0466963_0023740
2385 Ga0466964_0278399
2386 Ga0466970_0146132
2387 Ga0466970_0767049
2388 Ga0466957_0130623
2389 Ga0466957_0149405
2390 Ga0466957_0202595
2391 Ga0466959_0016981
2392 Ga0466959_0585822
2393 Ga0466959_0792666
2394 Ga0466958_0075935
2395 Ga0466967_0047812
2396 Ga0466967_0094054
2397 Ga0466967_0125493
2398 Ga0466967_0127173
2399 Ga0495617_243007
2400 Ga0495592_0001413
2401 Ga0495592_0014218
2402 Ga0495592_0031368
2403 Ga0495603_0000660
2404 Ga0495603_0028560
2405 Ga0495603_0054333
2406 Ga0495603_0075202
2407 Ga0495590_0224292
2408 Ga0495629_0000467
2409 Ga0495629_0002123
2410 Ga0495629_0225543
2411 Ga0495629_0330702
2412 Ga0495638_0012737
2413 Ga0495638_0040822
2414 Ga0495641_0007394
2415 Ga0495641_0584011
2416 Ga0495651_0000990
2417 Ga0495651_0002095
2418 Ga0495651_0149571
2419 Ga0495653_0000149
2420 Ga0495650_0156834
2421 Ga0495650_0314071
2422 Ga0495580_0003995
2423 Ga0495582_0000163
2424 Ga0495605_0151716
2425 Ga0495639_0000640
2426 Ga0495639_0025777
2427 Ga0495662_0000890
2428 Ga0495662_0372646
2429 Ga0495662_0528146
2430 Ga0495664_0008332
2431 Ga0495664_0197730
2432 Ga0495664_0247954
2433 Ga0495594_0001989
2434 Ga0495594_0285770
2435 Ga0495596_0078141
2436 Ga0495596_0185530
2437 Ga0495596_0214352
2438 Ga0495596_0218561
2439 Ga0495583_0032139
2440 Ga0495606_0001450
2441 Ga0495606_0006099
2442 Ga0495606_0080671
2443 Ga0495608_0005251
2444 Ga0495608_0015229
2445 Ga0495608_0755070
2446 Ga0495616_0315095
2447 Ga0495618_0086712
2448 Ga0495620_0044299
2449 Ga0495620_0093678
2450 Ga0495620_0187272
2451 Ga0495628_0010023
2452 Ga0495628_0020141
2453 Ga0495628_0765819
2454 Ga0495630_0002387
2455 Ga0495630_0345867
2456 Ga0495630_1030519
2457 Ga0495632_0274356
2458 Ga0495637_0016691
2459 Ga0495643_0112755
2460 Ga0495644_0065593
2461 Ga0495648_0007574
2462 Ga0495648_0106109
2463 Ga0495648_0111854
2464 Ga0495648_0146487
2465 Ga0495666_0021596
2466 Ga0495652_0005306
2467 Ga0495652_0023393
2468 Ga0495652_0209577
2469 Ga0495654_0012290
2470 Ga0495665_0000853
2471 Ga0495665_0040789
2472 Ga0495665_0604804
2473 Ga0495640_0012917
2474 Ga0495640_0025937
2475 Ga0495640_0132066
2476 Ga0495586_0532602
2477 Ga0495586_0702272
2478 Ga0495587_0001665
2479 Ga0495587_0008004
2480 Ga0495598_0061283
2481 Ga0495645_0023487
2482 Ga0495645_0129803
2483 Ga0495622_0003281
2484 Ga0495622_0016304
2485 Ga0495622_0332677
2486 Ga0495633_0236463
2487 Ga0495667_0002267
2488 Ga0495667_0512475
2489 Ga0495667_0698143
2490 Ga0495667_0720396
2491 Ga0495656_0054558
2492 Ga0495656_0150905
2493 Ga0495656_0356684
2494 Ga0495668_0064412
2495 Ga0495668_0373714
2496 Ga0495634_0001271
2497 Ga0495634_0117765
2498 Ga0495634_0212368
2499 Ga0495611_0054760
2500 Ga0495625_0226442
2501 Ga0495625_0421953
2502 Ga0495625_0609923
2503 Ga0495635_0001373
2504 Ga0495635_0015240
2505 Ga0495635_0036867
2506 Ga0495659_0030274
2507 Ga0495661_0057606
2508 Ga0495588_0027529
2509 Ga0495657_0000445
2510 Ga0495657_0001981
2511 Ga0495657_0186330
2512 Ga0495657_0267822
2513 Ga0495599_0000450
2514 Ga0495599_0318470
2515 Ga0495599_0571704
2516 Ga0495623_0006629
2517 Ga0495623_0062848
2518 Ga0495646_0003846
2519 Ga0495646_0006264
2520 Ga0495646_0063439
2521 Ga0495647_0014045
2522 Ga0495658_0000512
2523 Ga0495669_0021105
2524 Ga0495613_0002976
2525 Ga0495613_0040734
2526 Ga0495613_0085506
2527 Ga0495613_0467991
2528 Ga0495624_0019094
2529 Ga0495624_0226569
2530 Ga0495670_0277176
2531 Ga0495671_0044571
2532 Ga0495671_0341762
2533 Ga0495649_0181182
2534 Ga0495649_0253821
2535 Ga0495589_0028749
2536 Ga0495600_0000243
2537 Ga0495600_0001485
2538 Ga0495600_0136217
2539 Ga0495600_0676884
2540 Ga0495660_0104445
2541 Ga0495581_0002361
2542 Ga0495581_0062660
2543 Ga0495604_0000525
2544 Ga0495604_0004201
2545 Ga0495636_0197309
2546 Ga0495674_0013125
2547 Ga0495674_0038125
2548 Ga0495674_0071551
2549 Ga0495672_0012280
2550 Ga0495672_0059610
2551 Ga0495672_0128374
2552 Ga0495672_0166549
2553 Ga0495676_0035112
2554 Ga0495680_0000424
2555 Ga0495680_0003418
2556 Ga0495680_0122447
2557 Ga0495675_0024615
2558 Ga0495675_0060810
2559 Ga0495673_0086501
2560 Ga0495673_0191689
2561 Ga0495673_0338943
2562 Ga0495684_0001470
2563 Ga0495684_0045796
2564 Ga0495686_0027149
2565 Ga0495686_0186386
2566 Ga0495686_0262306
2567 Ga0495593_0000331
2568 Ga0495593_0001055
2569 Ga0495602_0001865
2570 Ga0495602_0008889
2571 Ga0495602_0527916
2572 Ga0495602_0594187
2573 Ga0495602_0784809
2574 Ga0495602_1036048
2575 Ga0495614_0011031
2576 Ga0495614_0206206
2577 Ga0496100_0011680
2578 Ga0496100_0110459
2579 Ga0496100_0110464
2580 Ga0496100_0727466
2581 Ga0496100_0754261
2582 Ga0496100_0949607
2583 Ga0496101_0009265
2584 Ga0496101_0068709
2585 Ga0496101_0193752
2586 Ga0496101_0202769
2587 Ga0496101_0470278
2588 Ga0496101_0715198
2589 Ga0496101_0938345
2590 Ga0496102_0022547
2591 Ga0496102_0109205
2592 Ga0496102_0159967
2593 Ga0496102_0435555
2594 Ga0496102_0547730
2595 Ga0496102_0852909
2596 Ga0496102_0966253
2597 Ga0496103_0042036
2598 Ga0496104_0011363
2599 Ga0496104_0016078
2600 Ga0496104_0019100
2601 Ga0496104_0074254
2602 Ga0496104_0161312
2603 Ga0496105_0056294
2604 Ga0496105_0080798
2605 Ga0496105_0227235
2606 Ga0496106_0004969
2607 Ga0496106_0047169
2608 Ga0496106_0144827
2609 Ga0496107_0007254
2610 Ga0496107_0031659
2611 Ga0496107_0060235
2612 Ga0496107_0586757
2613 Ga0496107_1353749
2614 Ga0496108_0001645
2615 Ga0496108_0003899
2616 Ga0496108_0171639
2617 Ga0496108_0285441
2618 Ga0496108_0463431
2619 Ga0496109_0037994
2620 Ga0496109_0103725
2621 Ga0496109_0150576
2622 Ga0496110_0006735
2623 Ga0496110_0085956
2624 Ga0496110_0495570
2625 Ga0496110_0497908
2626 Ga0496111_0107288
2627 Ga0496111_0186395
2628 Ga0496111_0268133
2629 Ga0496111_0655654
2630 Ga0496111_0745204
2631 Ga0496111_0813560
2632 Ga0496112_0000021
2633 Ga0496112_0006899
2634 Ga0496112_0028461
2635 Ga0496112_0038222
2636 Ga0496112_0191023
2637 Ga0496112_0193126
2638 Ga0496112_0248747
2639 Ga0496112_1441566
2640 Ga0496113_0025392
2641 Ga0496113_0067505
2642 Ga0496113_0149239
2643 Ga0496113_0446785
2644 Ga0496114_0046685
2645 Ga0496114_0281081
2646 Ga0496114_0291477
2647 Ga0496114_0426457
2648 Ga0496114_0602887
2649 Ga0496114_0686591
2650 Ga0496114_0985766
2651 Ga0496114_1386197
2652 Ga0496114_1448124
2653 Ga0496115_0003144
2654 Ga0496115_0034207
2655 Ga0496115_0144782
2656 Ga0496115_0168065
2657 Ga0496115_0198233
2658 Ga0496115_0964515
2659 Ga0496116_0010718
2660 Ga0496116_0153382
2661 Ga0496116_0314563
2662 Ga0496117_0021072
2663 Ga0496117_0112240
2664 Ga0496117_0158226
2665 Ga0496117_0581906
2666 Ga0496118_0034875
2667 Ga0496118_0037062
2668 Ga0496118_0054161
2669 Ga0496118_0057920
2670 Ga0496119_0583445
2671 Ga0496121_0001351
2672 Ga0496121_0005807
2673 Ga0496121_0006208
2674 Ga0496121_0036938
2675 Ga0496121_0041756
2676 Ga0496121_0071436
2677 Ga0496121_0101683
2678 Ga0496121_0103599
2679 Ga0496121_0132036
2680 Ga0496121_0275289
2681 Ga0496121_0292349
2682 Ga0496121_0340423
2683 Ga0496121_0412536
2684 Ga0496121_0596017
2685 Ga0496122_0028117
2686 Ga0496122_0109985
2687 Ga0496123_0014749
2688 Ga0496123_0104476
2689 Ga0496123_0175184
2690 Ga0496124_0080946
2691 Ga0496125_0000125
2692 Ga0496125_0003380
2693 Ga0496125_0004199
2694 Ga0496125_0055867
2695 Ga0496125_0114143
2696 Ga0496126_0002146
2697 Ga0496126_0109923
2698 Ga0496126_0112096
2699 Ga0496126_0123637
2700 Ga0496126_0131392
2701 Ga0496126_0132135
2702 Ga0496126_0243974
2703 Ga0496126_0292351
2704 Ga0496126_0646895
2705 Ga0495678_126723
2706 Ga0501031_0007949
2707 Ga0501031_0012029
2708 Ga0501031_0457453
2709 Ga0501031_0601215
2710 Ga0501032_0000345
2711 Ga0501032_0061759
2712 Ga0501032_0079352
2713 Ga0501032_0245998
2714 Ga0501032_0383748
2715 Ga0501033_0000094
2716 Ga0501033_0001745
2717 Ga0501033_0011740
2718 Ga0501033_0040516
2719 Ga0501033_0359876
2720 Ga0501034_0000021
2721 Ga0501034_0170478
2722 Ga0501034_0318165
2723 Ga0501034_0562935
2724 Ga0501034_0836305
2725 Ga0501036_0000115
2726 Ga0501036_0055368
2727 Ga0501036_0325309
2728 Ga0501036_0331121
2729 Ga0501037_0000450
2730 Ga0501037_0000505
2731 Ga0501037_0200230
2732 Ga0501037_0210562
2733 Ga0501037_0736229
2734 Ga0501038_0000052
2735 Ga0501038_0028652
2736 Ga0501038_0041409
2737 Ga0501038_0061431
2738 Ga0501038_0677239
2739 Ga0501039_0000549
2740 Ga0501039_0011127
2741 Ga0501039_0085024
2742 Ga0501039_0247016
2743 Ga0501039_0862199
2744 Ga0501039_1069999
2745 Ga0501040_0237002
2746 Ga0501041_0062219
2747 Ga0501042_0069426
2748 Ga0501042_0109003
2749 Ga0501043_0001704
2750 Ga0501043_0006502
2751 Ga0501043_0026498
2752 Ga0501043_0075484
2753 Ga0501043_0282687
2754 Ga0501046_0000133
2755 Ga0501046_0052069
2756 Ga0501046_0200037
2757 Ga0501046_0257938
2758 Ga0501046_0370789
2759 Ga0501046_0565478
2760 Ga0501047_0000440
2761 Ga0501047_0015373
2762 Ga0501047_0035246
2763 Ga0501047_0091001
2764 Ga0501047_0338417
2765 Ga0501047_0776314
2766 Ga0501048_0008678
2767 Ga0501048_0180106
2768 Ga0501048_0241732
2769 Ga0501048_0415886
2770 Ga0501048_0776925
2771 Ga0501048_0918026
2772 Ga0501067_0000076
2773 Ga0501067_0012862
2774 Ga0501067_0355283
2775 Ga0501068_0000511
2776 Ga0501068_0040672
2777 Ga0501068_0094427
2778 Ga0501069_0101728
2779 Ga0501069_0364192
2780 Ga0501070_0051048
2781 Ga0501070_0116903
2782 Ga0501070_0148834
2783 Ga0501070_0495087
2784 Ga0501070_0559656
2785 Ga0501070_0562981
2786 Ga0501071_0871668
2787 Ga0501071_1187042
2788 Ga0501072_0009145
2789 Ga0501072_1107912
2790 Ga0501073_0000597
2791 Ga0501073_0047040
2792 Ga0501073_0054424
2793 Ga0501073_0286844
2794 Ga0501073_1173081
2795 Ga0501074_0000285
2796 Ga0501074_0661447
2797 Ga0501074_0802484
2798 Ga0501075_1338412
2799 Ga0501076_0143426
2800 Ga0501076_0358511
2801 Ga0501076_0744897
2802 Ga0501079_0012998
2803 Ga0501079_0523523
2804 Ga0501079_1102783
2805 Ga0501080_0001080
2806 Ga0501080_0027884
2807 Ga0501080_0515348
2808 Ga0501083_0000881
2809 Ga0501083_0660720
2810 Ga0501083_1018407
2811 Ga0501083_1117767
2812 Ga0501035_0000255
2813 Ga0501035_0003073
2814 Ga0501035_0176206
2815 Ga0501035_0279085
2816 Ga0501035_0281484
2817 Ga0501035_0286314
2818 Ga0501035_0839913
2819 Ga0501044_0000141
2820 Ga0501044_0378703
2821 Ga0501044_0544323
2822 Ga0501044_1420588
2823 Ga0501044_1544348
2824 Ga0501045_0026069
2825 nmdc:mga03683_131951_c1
2826 nmdc:mga03n38_124467_c1
2827 nmdc:mga03n38_199726_c1
2828 nmdc:mga03n38_322088_c1
2829 nmdc:mga03n38_374579_c1
2830 nmdc:mga03n38_533584_c1
2831 nmdc:mga00v17_27862_c1
2832 nmdc:mga0yw44_15935_c1
2833 nmdc:mga0yw44_168663_c1
2834 nmdc:mga0yw44_172490_c1
2835 nmdc:mga0yw44_435045_c1
2836 nmdc:mga06z11_218397_c1
2837 nmdc:mga06z11_22052_c1
2838 nmdc:mga06z11_46278_c1
2839 nmdc:mga06z11_686494_c1
2840 nmdc:mga06z11_998443_c1
2841 nmdc:mga04h51_153237_c1
2842 nmdc:mga07m45_20707_c1
2843 nmdc:mga07m45_60424_c1
2844 nmdc:mga0n895_125876_c1
2845 nmdc:mga0n895_157304_c1
2846 nmdc:mga0n895_1799724_c1
2847 nmdc:mga0n895_1842919_c1
2848 nmdc:mga0n895_427342_c1
2849 nmdc:mga0rr50_143496_c1
2850 nmdc:mga0rr50_1702083_c1
2851 nmdc:mga08x19_1263314_c1
2852 nmdc:mga0a205_81104_c1
2853 nmdc:mga0sz30_392822_c1
2854 Ga0495601_0020961
2855 Ga0495601_0081572
2856 Ga0495601_0357694
2857 Ga0495601_0995686
2858 Ga0500635_0129261
2859 Ga0495655_0102560
2860 Ga0495595_0020753
2861 Ga0495595_0144385
2862 Ga0495595_0199587
2863 Ga0495595_0343022
2864 Ga0495619_0007177
2865 Ga0495619_0022508
2866 Ga0495619_0023422
2867 Ga0495619_0041790
2868 Ga0500578_0138596
2869 Ga0500578_0331562
2870 Ga0500578_0773748
2871 Ga0500643_063024
2872 Ga0500643_155180
2873 Ga0500581_153470
2874 Ga0500646_0050132
2875 Ga0500647_0048290
2876 Ga0500651_0028509
2877 Ga0500566_0000100
2878 Ga0500566_0000307
2879 Ga0500566_0000533
2880 Ga0500566_0133706
2881 Ga0500640_006540
2882 Ga0500640_106532
2883 Ga0500641_0003537
2884 Ga0500650_0003654
2885 Ga0500554_001684
2886 Ga0500556_0000125
2887 Ga0500562_113775
2888 Ga0500562_214284
2889 Ga0500572_000670
2890 Ga0500572_000830
2891 Ga0500572_008998
2892 Ga0500591_239844
2893 Ga0500595_033212
2894 Ga0500607_020131
2895 Ga0500607_313723
2896 Ga0500608_067744
2897 Ga0500608_118838
2898 Ga0500608_203832
2899 Ga0500608_311678
2900 Ga0500614_001477
2901 Ga0500618_011218
2902 Ga0500626_034818
2903 Ga0500642_0000105
2904 Ga0500652_001527
2905 Ga0500655_150258
2906 Ga0500658_0076936
2907 Ga0500559_0000240
2908 Ga0500559_0000976
2909 Ga0500559_0001326
2910 Ga0500559_0238844
2911 Ga0500568_0004846
2912 Ga0500568_0011215
2913 Ga0500577_0003197
2914 Ga0500586_001365
2915 Ga0500588_0158843
2916 Ga0500590_084113
2917 Ga0500590_106540
2918 Ga0500603_000017
2919 Ga0500603_108545
2920 Ga0500604_0004360
2921 Ga0500616_0000085
2922 Ga0500619_151464
2923 Ga0500620_205274
2924 Ga0500622_0000822
2925 Ga0500622_0250230
2926 Ga0500624_042027
2927 Ga0500630_001073
2928 Ga0500633_0079886
2929 Ga0500638_000755
2930 Ga0500638_140583
2931 Ga0500639_000306
2932 Ga0500639_158482
2933 Ga0500636_0000875
2934 Ga0500636_0001972
2935 Ga0500636_0162034
2936 Ga0500636_0295424
2937 Ga0500637_0237409
2938 Ga0500637_0368745
2939 Ga0500637_0422065
2940 Ga0500576_148056
2941 Ga0500625_147381
2942 Ga0500645_032111
2943 Ga0500596_002124
2944 Ga0501084_0848909
2945 Ga0501084_0997352
2946 Ga0501084_1120743
2947 Ga0501082_0003023
2948 Ga0501082_0546497
2949 Ga0501082_1186229
2950 2507509744
2951 2508543760
2952 2508698452
2953 2511400342
2954 2513625305
2955 2513645105
2956 2513646190
2957 2513678583
2958 2513706642
2959 2513714981
2960 2513875823
2961 2514011511
2962 2515630044
2963 2517103558
2964 2524441065
2965 2524470053
2966 2528854169
2967 2603859834
2968 2617349267
2969 2617378209
2970 2687579451
2971 2745082412
2972 2793060281
2973 2805917647
2974 2818241471
2975 2824602150
2976 2824610138
2977 2824623848
2978 2824627738
2979 2824639274
2980 2824652024
2981 2824656117
2982 2824670778
2983 2824679497
2984 2824683961
2985 2824696125
2986 2824703797
2987 2824711384
2988 2824722189
2989 2824727681
2990 2824733522
2991 2824746898
2992 2824761691
2993 2824771306
2994 2824774001
2995 2838130050
2996 2841941207
2997 2841952766
2998 2841962279
2999 2841967362
3000 2841979241
3001 2841990816
3002 2842038657
3003 2842048398
3004 2844318056
3005 2847945429
3006 2849080383
3007 2857510267
3008 2857528482
3009 2874595146
3010 2874615616
3011 2874621640
3012 2874632725
3013 2874651007
3014 2876764508
3015 2876775082
3016 2876823897
3017 2879080525
3018 2879109374
3019 2879134869
3020 2879149180
3021 2881366259
3022 2881672887
3023 2885372851
3024 2885413027
3025 2888382851
3026 2888394946
3027 2888423330
3028 2893070202
3029 2903729635
3030 2904668644
3031 2904696933
3032 2904716638
3033 2906605783
3034 2906628237
3035 2908761510
3036 2908778974
3037 2919076153
3038 2922373060
3039 2922392069
3040 2922395260
3041 2929615877
3042 2929630490
3043 2932792485
3044 2932800369
3045 2932804542
3046 2932814005
3047 2932819504
3048 2932833789
3049 2933578837
3050 2935611396
3051 2935618685
3052 2935644475
3053 2935648780
3054 2935657137
3055 2935674212
3056 2935678527
3057 2935687976
3058 2935701412
3059 2935708333
3060 2935714996
3061 2935726439
3062 2935733814
3063 2935743193
3064 2935754768
3065 2935765475
3066 2935775231
3067 2935779571
3068 2935791571
3069 2935799883
3070 2935805429
3071 2935816723
3072 2935820873
3073 2935833776
3074 2935839538
3075 2935850867
3076 2935857050
3077 2935871126
3078 2935876371
3079 2935889736
3080 2935913766
3081 2935920244
3082 2935930583
3083 2935939444
3084 2935946393
3085 2935955768
3086 2935966923
3087 2935972522
3088 2935991022
3089 2935997660
3090 2936007178
3091 2936011690
3092 2936020285
3093 2936028980
3094 2936043015
3095 2936047008
3096 2936058112
3097 2940559855
3098 2941536051
3099 2941540227
3100 3005488179
3101 3005512671
3102 3005590438
3103 3005598105
3104 3005713783
3105 3005721295
3106 8006928655
3107 8016514646
3108 8016530749
3109 8016536038
3110 8016540318
3111 8016552913
3112 8016561291
3113 8016574384
3114 8016578484
3115 8016591288
3116 8016599150
3117 8016611899
3118 8016621907
3119 8016627946
3120 8016632267
3121 8017061786
3122 8019535763
3123 8019543716
3124 8019555056
3125 8019581312
3126 8019588937
3127 8019616267
3128 8019626868
3129 8019635648
3130 8019657032
3131 8019673059
3132 8019683082
3133 8019688775
3134 8055747524
3135 8056680511
3136 8056683870
3137 8056691267
3138 8056972402

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01312

Bac_export_2

FlhB HrpN YscU SpaS Family

12

85

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6z0w-assembly1.cif.gz_A crystal structure of the cytoplasmic domain of flhb from shewanella putrefaciens 0.9329 7 79
3bzr-assembly1.cif.gz_A crystal structure of escu c-terminal domain with n262d mutation, space group p 41 21 2 0.9315 5 78
3b1s-assembly2.cif.gz_D crystal structure of the cytoplasmic domain of flhb from aquifex aeolicus 0.9256 7 79
3bzz-assembly1.cif.gz_B crystal structural of the mutated r313t escu/spas c-terminal domain 0.9256 7 80
3c00-assembly1.cif.gz_B crystal structural of the mutated g247t escu/spas c-terminal domain 0.924 7 79
ID Description Score Start End Superfamily
3c03C00 Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU 0.9277 7 80 3.40.1690.10
3b1sD00 Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU 0.9256 7 79 3.40.1690.10
3bzpA00 Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU 0.9169 5 78 3.40.1690.10
3bzyB00 Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU 0.9086 4 78 3.40.1690.10
2jliA00 Alpha Beta;3-Layer(aba) Sandwich;name from scop;secretion proteins EscU 0.9038 7 75 3.40.1690.10
ID Description Score Start End GO Terms
AF-A0A426QGL3-F1-model_v4 Flagellar biosynthetic protein FlhB 0.9863 7 83 GO:0005886
GO:0009306
AF-A0A3E0H0Z6-F1-model_v4 Flagellar biosynthetic protein FlhB 0.9787 7 83 GO:0005886
GO:0009306
AF-Q21JK5-F1-model_v4 Flagellar biosynthetic protein FlhB 0.9756 5 81 GO:0005886
GO:0009306
AF-A0A0F4RBX8-F1-model_v4 Flagellar biosynthetic protein FlhB 0.9739 7 81 GO:0005886
GO:0009306
AF-A0A1W1WUC3-F1-model_v4 Flagellar biosynthesis protein 0.9714 7 81 GO:0005886
GO:0009306

Map