F494678

General Info

Members Datasets Scaffolds Average Seq Length
1545 349 1542 120

Family's Representative Sequence

Representative Sequence 3300005458|Ga0070681_10030431|Ga0070681_100304313
Length 142
Sequence MSPCRRPSTTLGTNEVCDMTAETTITTAPRRPRPAAVTLTPAAEARVAALMARAPEGTLGVKLSTPRRGCSGLAYSVDYVAEAKPFDERIDTPAGPFFIDSASVLYLIGSTMDWKEDDFTAGFVFDNPNAKGSCGCGESFTV

Samples

Sample ID Description Type Environment
1 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
2 2510917021 Novosphingobium sp. AP12 Isolate Rhizosphere
3 2775507255 Sphingobium indicum B90A Isolate Rhizosphere
4 2896184354 Aurantiacibacter suaedae GH3-15 Isolate Rhizosphere
5 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
6 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
7 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
8 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
9 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
10 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
11 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
12 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
13 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
14 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
15 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
16 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
17 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
18 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
19 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
20 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
21 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
22 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
23 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
24 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
25 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
26 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
27 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
28 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
29 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
30 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
31 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
32 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
33 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
34 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
35 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
36 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
37 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
38 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
39 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
40 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
41 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
42 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
46 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
65 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
66 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
67 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
68 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
76 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
77 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
78 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
79 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
80 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
81 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
82 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
83 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
84 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
85 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
86 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
87 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
89 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
90 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
91 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
92 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
93 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
94 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
95 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
96 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
97 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
98 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
99 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
100 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
101 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
102 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
103 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
104 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
105 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
106 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
107 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
108 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
109 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
110 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
111 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
112 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
113 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
114 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
115 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
116 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
117 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
118 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
119 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
121 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
123 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
124 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
125 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
183 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
186 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
187 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
191 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
192 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
193 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
194 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
195 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
196 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
197 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
198 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
199 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
200 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
201 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
202 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
203 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
204 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
205 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
206 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
207 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
208 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
209 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
210 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
211 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
212 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
222 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
223 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
224 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
225 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
226 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
227 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
228 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
229 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
230 3300042144 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624F_E14_070516_89 Metagenome Rhizosphere
231 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
232 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
233 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
234 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
235 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
236 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
237 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
238 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
239 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
240 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
241 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
242 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
243 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
244 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
245 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
246 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
247 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
248 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
249 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
250 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
251 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
252 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
253 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
256 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
257 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
258 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
259 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
260 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
261 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
262 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
263 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
264 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
265 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
266 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
267 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
268 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
269 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
270 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
271 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
272 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
273 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
274 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
275 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
276 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
277 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
278 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
279 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
280 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
281 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
282 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
283 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
284 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
285 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
286 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
287 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
288 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
289 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
290 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
291 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
292 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
293 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
294 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
295 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
296 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
297 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
298 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
299 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
300 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
301 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
302 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
303 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
304 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
305 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
306 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
309 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
310 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
311 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
312 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
313 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
314 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
315 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
316 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
317 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
318 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
319 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
320 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
321 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
322 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
323 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
324 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
325 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
326 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
327 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
328 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
329 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
330 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
331 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
332 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
333 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
334 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
335 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
336 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
337 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
338 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
339 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
340 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
341 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
342 3300053124 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 endosphere Metagenome Endosphere
343 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
344 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
345 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
346 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
347 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
348 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
349 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.48
Metatranscriptomes 0.32
Isolates 0.19

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.29
Nodule 0.13
Rhizoplane 3.75
Rhizosphere 93.2
Stem 0
Stem Tuber 0
Unclassified 1.62

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 SwRhRL2b_contig_121545 2162886007 Bacteria 1963
2 JGI24741J21665_1005952 3300001915 Bacteria 2496
3 JGI24752J21851_1007762 3300001976 Bacteria 1400
4 JGI24752J21851_1013859 3300001976 Bacteria 1052
5 JGI24740J21852_10010639 3300001979 Bacteria 3533
6 JGI24740J21852_10011240 3300001979 Bacteria 3415
7 JGI24740J21852_10042339 3300001979 Unclassified 1365
8 JGI24740J21852_10047255 3300001979 Bacteria 1258
9 JGI24739J22299_10006827 3300001989 Bacteria 4297
10 JGI24739J22299_10020851 3300001989 Bacteria 2339
11 JGI24739J22299_10028206 3300001989 Bacteria 1958
12 JGI24739J22299_10031542 3300001989 Bacteria 1830
13 JGI24739J22299_10130495 3300001989 Bacteria 748
14 JGI24737J22298_10000725 3300001990 Bacteria 11604
15 JGI24737J22298_10026699 3300001990 Bacteria 1823
16 JGI24737J22298_10033549 3300001990 Bacteria 1594
17 JGI24737J22298_10048317 3300001990 Bacteria 1296
18 JGI24743J22301_10043299 3300001991 Bacteria 907
19 JGI24735J21928_10005106 3300002067 Bacteria 4370
20 JGI24735J21928_10010334 3300002067 Bacteria 2979
21 JGI24735J21928_10017895 3300002067 Bacteria 2189
22 JGI24735J21928_10021837 3300002067 Bacteria 1952
23 JGI24738J21930_10002169 3300002075 Bacteria 5225
24 JGI24738J21930_10007504 3300002075 Bacteria 2513
25 JGI24738J21930_10075207 3300002075 Bacteria 703
26 JGI24749J21850_1003498 3300002076 Bacteria 2194
27 JGI24034J26672_10067221 3300002239 Bacteria 637
28 JGI24034J26672_10114998 3300002239 Bacteria 517
29 JGI24751J29686_10098615 3300002459 Bacteria 610
30 JGI25406J46586_10242486 3300003203 Bacteria 529
31 Ga0065704_10084844 3300005289 Bacteria 3289
32 Ga0065715_10260297 3300005293 Bacteria 1140
33 Ga0070658_10000003 3300005327 Bacteria 465963
34 Ga0070658_10002388 3300005327 Bacteria 15764
35 Ga0070658_10006789 3300005327 Bacteria 9261
36 Ga0070658_10010002 3300005327 Bacteria 7618
37 Ga0070658_10012293 3300005327 Bacteria 6873
38 Ga0070658_10013862 3300005327 Bacteria 6470
39 Ga0070658_10071310 3300005327 Bacteria 2845
40 Ga0070658_10089528 3300005327 Bacteria 2534
41 Ga0070658_10122754 3300005327 Bacteria 2159
42 Ga0070658_10123775 3300005327 Bacteria 2151
43 Ga0070658_10146573 3300005327 Bacteria 1974
44 Ga0070658_10199044 3300005327 Bacteria 1690
45 Ga0070658_10227584 3300005327 Bacteria 1578
46 Ga0070658_10553327 3300005327 Bacteria 996
47 Ga0070658_10643867 3300005327 Bacteria 919
48 Ga0070658_11277977 3300005327 Bacteria 638
49 Ga0070676_10056069 3300005328 Bacteria 2327
50 Ga0070676_10097844 3300005328 Bacteria 1808
51 Ga0070676_10214786 3300005328 Bacteria 1267
52 Ga0070676_10402331 3300005328 Bacteria 953
53 Ga0070676_10676257 3300005328 Bacteria 752
54 Ga0070683_100002385 3300005329 Bacteria 14918
55 Ga0070683_100004410 3300005329 Bacteria 11593
56 Ga0070683_100024152 3300005329 Bacteria 5441
57 Ga0070683_100065348 3300005329 Bacteria 3387
58 Ga0070683_100174155 3300005329 Bacteria 2043
59 Ga0070683_100236677 3300005329 Bacteria 1736
60 Ga0070683_100629787 3300005329 Bacteria 1027
61 Ga0070683_101144133 3300005329 Bacteria 748
62 Ga0070690_100004711 3300005330 Bacteria 7603
63 Ga0070690_101205367 3300005330 Bacteria 604
64 Ga0070670_100004093 3300005331 Bacteria 12187
65 Ga0070670_100010428 3300005331 Bacteria 7930
66 Ga0070670_100016491 3300005331 Bacteria 6343
67 Ga0070670_100106148 3300005331 Bacteria 2420
68 Ga0070670_100120260 3300005331 Bacteria 2265
69 Ga0070670_100131589 3300005331 Bacteria 2161
70 Ga0070670_100236558 3300005331 Bacteria 1590
71 Ga0070677_10013309 3300005333 Bacteria 2875
72 Ga0070677_10039351 3300005333 Bacteria 1855
73 Ga0070677_10308096 3300005333 Bacteria 807
74 Ga0068869_100064347 3300005334 Bacteria 2697
75 Ga0068869_100156979 3300005334 Bacteria 1768
76 Ga0068869_100195708 3300005334 Bacteria 1592
77 Ga0068869_100679179 3300005334 Bacteria 876
78 Ga0070666_10014487 3300005335 Bacteria 5022
79 Ga0070666_10015349 3300005335 Bacteria 4884
80 Ga0070666_10115423 3300005335 Bacteria 1859
81 Ga0070666_10222130 3300005335 Bacteria 1333
82 Ga0070680_100000958 3300005336 Bacteria 20442
83 Ga0070680_100030548 3300005336 Bacteria 4328
84 Ga0070680_100050345 3300005336 Bacteria 3397
85 Ga0070680_100121271 3300005336 Bacteria 2183
86 Ga0070680_100128711 3300005336 Bacteria 2117
87 Ga0070680_100264296 3300005336 Bacteria 1456
88 Ga0070680_100541438 3300005336 Bacteria 997
89 Ga0070680_100648283 3300005336 Bacteria 908
90 Ga0070680_100845984 3300005336 Bacteria 789
91 Ga0070680_101283894 3300005336 Bacteria 633
92 Ga0070682_100006148 3300005337 Bacteria 6723
93 Ga0070682_100021462 3300005337 Bacteria 3811
94 Ga0070682_100035542 3300005337 Bacteria 3043
95 Ga0068868_100060498 3300005338 Bacteria 2999
96 Ga0068868_100178953 3300005338 Bacteria 1758
97 Ga0068868_100428962 3300005338 Bacteria 1146
98 Ga0068868_100600651 3300005338 Bacteria 975
99 Ga0068868_101069541 3300005338 Bacteria 741
100 Ga0068868_101700796 3300005338 Bacteria 594
101 Ga0070660_100000122 3300005339 Bacteria 49000
102 Ga0070660_100000511 3300005339 Bacteria 25935
103 Ga0070660_100001552 3300005339 Bacteria 15770
104 Ga0070660_100002966 3300005339 Bacteria 11674
105 Ga0070660_100017677 3300005339 Bacteria 5198
106 Ga0070660_100051571 3300005339 Bacteria 3169
107 Ga0070660_100067624 3300005339 Bacteria 2784
108 Ga0070660_100108812 3300005339 Bacteria 2203
109 Ga0070660_100121414 3300005339 Bacteria 2085
110 Ga0070660_100123766 3300005339 Bacteria 2065
111 Ga0070660_100136585 3300005339 Bacteria 1965
112 Ga0070660_100139168 3300005339 Bacteria 1946
113 Ga0070660_100242634 3300005339 Bacteria 1468
114 Ga0070660_100284060 3300005339 Bacteria 1354
115 Ga0070660_100493391 3300005339 Bacteria 1018
116 Ga0070660_100944709 3300005339 Bacteria 728
117 Ga0070660_101544103 3300005339 Bacteria 565
118 Ga0070691_10028952 3300005341 Bacteria 2590
119 Ga0070691_10803824 3300005341 Bacteria 573
120 Ga0070687_100100616 3300005343 Bacteria 1617
121 Ga0070661_100000155 3300005344 Bacteria 56344
122 Ga0070661_100000674 3300005344 Bacteria 25042
123 Ga0070661_100001389 3300005344 Bacteria 16919
124 Ga0070661_100066619 3300005344 Bacteria 2646
125 Ga0070661_100136456 3300005344 Bacteria 1846
126 Ga0070661_100235952 3300005344 Bacteria 1407
127 Ga0070661_100243539 3300005344 Bacteria 1385
128 Ga0070661_100247433 3300005344 Bacteria 1375
129 Ga0070661_100282296 3300005344 Bacteria 1288
130 Ga0070661_100412327 3300005344 Bacteria 1070
131 Ga0070661_100414830 3300005344 Bacteria 1066
132 Ga0070661_100419222 3300005344 Bacteria 1061
133 Ga0070692_10007183 3300005345 Bacteria 4890
134 Ga0070692_10076955 3300005345 Bacteria 1789
135 Ga0070668_100004541 3300005347 Bacteria 10297
136 Ga0070668_100059315 3300005347 Bacteria 2962
137 Ga0070668_100409030 3300005347 Bacteria 1160
138 Ga0070668_100685448 3300005347 Bacteria 903
139 Ga0070668_100875805 3300005347 Bacteria 801
140 Ga0070668_101009684 3300005347 Bacteria 748
141 Ga0070668_101127535 3300005347 Bacteria 709
142 Ga0070669_100016538 3300005353 Bacteria 5265
143 Ga0070669_100034942 3300005353 Bacteria 3640
144 Ga0070669_100089879 3300005353 Bacteria 2301
145 Ga0070669_100099311 3300005353 Bacteria 2194
146 Ga0070669_100281490 3300005353 Bacteria 1333
147 Ga0070669_100586409 3300005353 Bacteria 933
148 Ga0070669_101251603 3300005353 Bacteria 642
149 Ga0070675_100009019 3300005354 Bacteria 7746
150 Ga0070675_100015862 3300005354 Bacteria 5966
151 Ga0070675_100030350 3300005354 Bacteria 4364
152 Ga0070675_100061581 3300005354 Bacteria 3099
153 Ga0070675_100885340 3300005354 Bacteria 818
154 Ga0070675_101509039 3300005354 Bacteria 620
155 Ga0070671_100000051 3300005355 Bacteria 79207
156 Ga0070671_100005658 3300005355 Bacteria 9948
157 Ga0070671_100010593 3300005355 Bacteria 7402
158 Ga0070671_100023390 3300005355 Bacteria 5058
159 Ga0070671_100038465 3300005355 Bacteria 3971
160 Ga0070671_100059547 3300005355 Bacteria 3178
161 Ga0070671_100060504 3300005355 Bacteria 3153
162 Ga0070671_100061989 3300005355 Bacteria 3114
163 Ga0070671_100075750 3300005355 Bacteria 2811
164 Ga0070671_100142662 3300005355 Bacteria 2021
165 Ga0070671_100313498 3300005355 Bacteria 1336
166 Ga0070671_100421357 3300005355 Bacteria 1143
167 Ga0070674_100048184 3300005356 Bacteria 2924
168 Ga0070674_100090846 3300005356 Bacteria 2204
169 Ga0070674_100194112 3300005356 Bacteria 1563
170 Ga0070673_100013891 3300005364 Bacteria 5590
171 Ga0070673_100016122 3300005364 Bacteria 5273
172 Ga0070673_100078110 3300005364 Bacteria 2677
173 Ga0070673_100122432 3300005364 Bacteria 2172
174 Ga0070673_100339719 3300005364 Bacteria 1330
175 Ga0070673_102075544 3300005364 Bacteria 540
176 Ga0070659_100000005 3300005366 Bacteria 259902
177 Ga0070659_100002131 3300005366 Bacteria 14106
178 Ga0070659_100002531 3300005366 Bacteria 12994
179 Ga0070659_100007798 3300005366 Bacteria 7787
180 Ga0070659_100039475 3300005366 Bacteria 3685
181 Ga0070659_100047283 3300005366 Bacteria 3374
182 Ga0070659_100117997 3300005366 Bacteria 2146
183 Ga0070659_100138163 3300005366 Bacteria 1983
184 Ga0070659_100139330 3300005366 Bacteria 1974
185 Ga0070659_100145091 3300005366 Bacteria 1934
186 Ga0070659_100331117 3300005366 Bacteria 1274
187 Ga0070659_100437956 3300005366 Bacteria 1107
188 Ga0070659_100507063 3300005366 Bacteria 1029
189 Ga0070659_101164782 3300005366 Bacteria 681
190 Ga0070659_101490564 3300005366 Bacteria 602
191 Ga0070667_100004843 3300005367 Bacteria 11279
192 Ga0070667_100018227 3300005367 Bacteria 5821
193 Ga0070667_100022426 3300005367 Bacteria 5236
194 Ga0070667_100023656 3300005367 Bacteria 5099
195 Ga0070667_100047347 3300005367 Bacteria 3617
196 Ga0070667_100109274 3300005367 Bacteria 2396
197 Ga0070667_100250913 3300005367 Bacteria 1582
198 Ga0070667_100268307 3300005367 Bacteria 1530
199 Ga0070667_100322795 3300005367 Bacteria 1393
200 Ga0070667_100468995 3300005367 Bacteria 1152
201 Ga0070667_101133096 3300005367 Bacteria 732
202 Ga0070714_100056146 3300005435 Bacteria 3368
203 Ga0070714_100144450 3300005435 Bacteria 2139
204 Ga0070714_100882373 3300005435 Bacteria 868
205 Ga0070714_101952601 3300005435 Bacteria 572
206 Ga0070713_101568755 3300005436 Bacteria 639
207 Ga0070705_100404276 3300005440 Bacteria 1012
208 Ga0070705_101218745 3300005440 Bacteria 621
209 Ga0070694_100043437 3300005444 Bacteria 3005
210 Ga0070663_100000754 3300005455 Bacteria 17546
211 Ga0070663_100017308 3300005455 Bacteria 4702
212 Ga0070663_100072370 3300005455 Bacteria 2511
213 Ga0070663_100090754 3300005455 Bacteria 2263
214 Ga0070663_100113475 3300005455 Bacteria 2039
215 Ga0070663_100150775 3300005455 Bacteria 1782
216 Ga0070663_101121099 3300005455 Bacteria 688
217 Ga0070663_101691598 3300005455 Bacteria 566
218 Ga0070678_100003226 3300005456 Bacteria 9058
219 Ga0070678_100006559 3300005456 Bacteria 6839
220 Ga0070678_100008022 3300005456 Bacteria 6295
221 Ga0070678_100152992 3300005456 Bacteria 1860
222 Ga0070678_100666419 3300005456 Bacteria 934
223 Ga0070662_100000012 3300005457 Bacteria 129380
224 Ga0070662_100001195 3300005457 Bacteria 15948
225 Ga0070662_100003219 3300005457 Bacteria 10152
226 Ga0070662_100005921 3300005457 Bacteria 7842
227 Ga0070662_100011103 3300005457 Bacteria 5930
228 Ga0070662_100031175 3300005457 Bacteria 3740
229 Ga0070662_100038748 3300005457 Bacteria 3386
230 Ga0070662_100076065 3300005457 Bacteria 2488
231 Ga0070662_100078627 3300005457 Bacteria 2451
232 Ga0070662_100107279 3300005457 Bacteria 2123
233 Ga0070662_100644255 3300005457 Bacteria 893
234 Ga0070681_10030431 3300005458 Bacteria 5416
235 Ga0070681_10045447 3300005458 Bacteria 4393
236 Ga0070681_10176040 3300005458 Bacteria 2061
237 Ga0070681_10249998 3300005458 Bacteria 1686
238 Ga0068867_100007760 3300005459 Bacteria 7587
239 Ga0068867_100012286 3300005459 Bacteria 6056
240 Ga0068867_100024893 3300005459 Bacteria 4291
241 Ga0068867_100133078 3300005459 Bacteria 1935
242 Ga0068867_100569035 3300005459 Bacteria 984
243 Ga0070685_10633358 3300005466 Bacteria 773
244 Ga0070706_100725602 3300005467 Bacteria 921
245 Ga0070699_101079877 3300005518 Bacteria 736
246 Ga0070679_100000001 3300005530 Bacteria 764811
247 Ga0070679_100007479 3300005530 Bacteria 10213
248 Ga0070679_100070254 3300005530 Bacteria 3494
249 Ga0070679_100151048 3300005530 Bacteria 2299
250 Ga0070679_100185679 3300005530 Bacteria 2050
251 Ga0070679_100309175 3300005530 Bacteria 1531
252 Ga0070679_100757748 3300005530 Bacteria 914
253 Ga0070684_100203640 3300005535 Bacteria 1803
254 Ga0070684_100220175 3300005535 Bacteria 1732
255 Ga0070684_100604714 3300005535 Bacteria 1019
256 Ga0070697_101290798 3300005536 Bacteria 651
257 Ga0068853_100000032 3300005539 Bacteria 114306
258 Ga0068853_100007303 3300005539 Bacteria 8844
259 Ga0068853_100036300 3300005539 Bacteria 4190
260 Ga0068853_100040907 3300005539 Bacteria 3957
261 Ga0068853_100197152 3300005539 Bacteria 1831
262 Ga0068853_100400905 3300005539 Bacteria 1284
263 Ga0068853_100608936 3300005539 Bacteria 1038
264 Ga0068853_100616975 3300005539 Bacteria 1031
265 Ga0068853_100840566 3300005539 Bacteria 880
266 Ga0068853_102143905 3300005539 Bacteria 542
267 Ga0070672_100003732 3300005543 Bacteria 9912
268 Ga0070672_100034628 3300005543 Bacteria 3834
269 Ga0070672_100486808 3300005543 Bacteria 1066
270 Ga0070672_100663382 3300005543 Bacteria 911
271 Ga0070672_100884069 3300005543 Bacteria 789
272 Ga0070672_101551620 3300005543 Bacteria 594
273 Ga0070695_100066652 3300005545 Bacteria 2347
274 Ga0070696_100014446 3300005546 Bacteria 5296
275 Ga0070696_100041111 3300005546 Bacteria 3194
276 Ga0070693_100010001 3300005547 Bacteria 4734
277 Ga0070693_100010933 3300005547 Bacteria 4560
278 Ga0070693_100028510 3300005547 Bacteria 3036
279 Ga0070693_100028546 3300005547 Bacteria 3034
280 Ga0070693_100259115 3300005547 Bacteria 1156
281 Ga0070693_101117695 3300005547 Bacteria 602
282 Ga0070665_100042403 3300005548 Bacteria 4574
283 Ga0070665_100055724 3300005548 Bacteria 3965
284 Ga0070665_100550608 3300005548 Bacteria 1166
285 Ga0070665_100777130 3300005548 Bacteria 971
286 Ga0070665_101132116 3300005548 Bacteria 794
287 Ga0070665_101240828 3300005548 Bacteria 756
288 Ga0070665_101891610 3300005548 Bacteria 603
289 Ga0068855_100000591 3300005563 Bacteria 44412
290 Ga0068855_100026106 3300005563 Bacteria 6988
291 Ga0068855_100044189 3300005563 Bacteria 5273
292 Ga0068855_100069885 3300005563 Bacteria 4086
293 Ga0068855_100104982 3300005563 Bacteria 3249
294 Ga0068855_100108713 3300005563 Bacteria 3185
295 Ga0068855_100315802 3300005563 Bacteria 1728
296 Ga0068855_100338044 3300005563 Bacteria 1661
297 Ga0068855_100831374 3300005563 Bacteria 980
298 Ga0070664_100000187 3300005564 Bacteria 43750
299 Ga0070664_100003691 3300005564 Bacteria 12343
300 Ga0070664_100014495 3300005564 Bacteria 6428
301 Ga0070664_100016187 3300005564 Bacteria 6111
302 Ga0070664_100026954 3300005564 Bacteria 4773
303 Ga0070664_100063041 3300005564 Bacteria 3161
304 Ga0070664_100124949 3300005564 Bacteria 2255
305 Ga0070664_100157203 3300005564 Bacteria 2009
306 Ga0070664_100231486 3300005564 Bacteria 1656
307 Ga0070664_100244720 3300005564 Bacteria 1611
308 Ga0070664_100414152 3300005564 Bacteria 1233
309 Ga0070664_100466364 3300005564 Bacteria 1161
310 Ga0070664_100814300 3300005564 Bacteria 874
311 Ga0070664_100921563 3300005564 Bacteria 820
312 Ga0068857_100011078 3300005577 Bacteria 7845
313 Ga0068857_100012932 3300005577 Bacteria 7271
314 Ga0068857_100040491 3300005577 Bacteria 4131
315 Ga0068857_100086842 3300005577 Bacteria 2798
316 Ga0068857_100124515 3300005577 Bacteria 2322
317 Ga0068857_100207602 3300005577 Bacteria 1787
318 Ga0068857_100498580 3300005577 Bacteria 1142
319 Ga0068857_100566735 3300005577 Bacteria 1071
320 Ga0068857_101810204 3300005577 Bacteria 598
321 Ga0068854_100002329 3300005578 Bacteria 11711
322 Ga0068854_100033054 3300005578 Bacteria 3604
323 Ga0068854_100053631 3300005578 Bacteria 2896
324 Ga0068854_100058080 3300005578 Bacteria 2791
325 Ga0068854_100066578 3300005578 Bacteria 2622
326 Ga0068854_100349089 3300005578 Bacteria 1210
327 Ga0068854_100461831 3300005578 Bacteria 1062
328 Ga0068854_100806321 3300005578 Bacteria 819
329 Ga0068854_100852342 3300005578 Bacteria 798
330 Ga0068854_101211538 3300005578 Bacteria 677
331 Ga0068856_100000291 3300005614 Bacteria 54890
332 Ga0068856_100011950 3300005614 Bacteria 8407
333 Ga0068856_100037313 3300005614 Bacteria 4768
334 Ga0068856_100039087 3300005614 Bacteria 4659
335 Ga0068856_100047342 3300005614 Bacteria 4235
336 Ga0068856_100075467 3300005614 Bacteria 3339
337 Ga0068856_100087145 3300005614 Bacteria 3103
338 Ga0068856_100164644 3300005614 Bacteria 2229
339 Ga0068856_100228325 3300005614 Bacteria 1877
340 Ga0068856_100253791 3300005614 Bacteria 1774
341 Ga0068856_100277447 3300005614 Bacteria 1693
342 Ga0068856_100341105 3300005614 Bacteria 1516
343 Ga0068852_100000395 3300005616 Bacteria 29245
344 Ga0068852_100014616 3300005616 Bacteria 6051
345 Ga0068852_100017959 3300005616 Bacteria 5563
346 Ga0068852_100050804 3300005616 Bacteria 3555
347 Ga0068852_100060821 3300005616 Bacteria 3280
348 Ga0068852_100086976 3300005616 Bacteria 2787
349 Ga0068852_100095204 3300005616 Bacteria 2673
350 Ga0068852_100120505 3300005616 Bacteria 2401
351 Ga0068852_100143197 3300005616 Bacteria 2214
352 Ga0068852_100250618 3300005616 Bacteria 1696
353 Ga0068852_100882398 3300005616 Bacteria 911
354 Ga0068852_101905487 3300005616 Bacteria 617
355 Ga0068852_102342976 3300005616 Bacteria 555
356 Ga0068859_100000685 3300005617 Bacteria 34047
357 Ga0068859_100009717 3300005617 Bacteria 9713
358 Ga0068859_100032301 3300005617 Bacteria 5258
359 Ga0068859_100075823 3300005617 Bacteria 3403
360 Ga0068859_100187836 3300005617 Bacteria 2150
361 Ga0068859_100216981 3300005617 Bacteria 2000
362 Ga0068859_100365273 3300005617 Bacteria 1538
363 Ga0068859_100797164 3300005617 Bacteria 1032
364 Ga0068859_102354761 3300005617 Bacteria 587
365 Ga0068864_100000847 3300005618 Bacteria 25807
366 Ga0068864_100012590 3300005618 Bacteria 6995
367 Ga0068864_100020538 3300005618 Bacteria 5526
368 Ga0068864_100038673 3300005618 Bacteria 4075
369 Ga0068864_100039809 3300005618 Bacteria 4017
370 Ga0068864_100222879 3300005618 Bacteria 1740
371 Ga0068864_100453914 3300005618 Bacteria 1226
372 Ga0068866_10032261 3300005718 Bacteria 2531
373 Ga0068866_10033649 3300005718 Bacteria 2488
374 Ga0068861_100568903 3300005719 Bacteria 1035
375 Ga0068851_10021868 3300005834 Bacteria 3109
376 Ga0068851_10034066 3300005834 Bacteria 2541
377 Ga0068851_10069396 3300005834 Bacteria 1820
378 Ga0068851_10150033 3300005834 Bacteria 1273
379 Ga0068851_10151286 3300005834 Bacteria 1269
380 Ga0068851_10159612 3300005834 Bacteria 1238
381 Ga0068863_100009665 3300005841 Bacteria 9410
382 Ga0068863_100026373 3300005841 Bacteria 5544
383 Ga0068863_100037237 3300005841 Bacteria 4632
384 Ga0068863_100048549 3300005841 Bacteria 4025
385 Ga0068863_100048789 3300005841 Bacteria 4014
386 Ga0068863_100149896 3300005841 Bacteria 2231
387 Ga0068863_100154479 3300005841 Bacteria 2197
388 Ga0068863_100278557 3300005841 Bacteria 1620
389 Ga0068858_100000655 3300005842 Bacteria 36151
390 Ga0068858_100006494 3300005842 Bacteria 11384
391 Ga0068858_100022867 3300005842 Bacteria 5831
392 Ga0068858_100027855 3300005842 Bacteria 5249
393 Ga0068858_100037166 3300005842 Bacteria 4515
394 Ga0068858_100181873 3300005842 Bacteria 1985
395 Ga0068858_100331762 3300005842 Bacteria 1455
396 Ga0068860_100066251 3300005843 Bacteria 3431
397 Ga0068860_100081612 3300005843 Bacteria 3075
398 Ga0068860_100112868 3300005843 Bacteria 2598
399 Ga0068860_100167202 3300005843 Bacteria 2123
400 Ga0068862_100003662 3300005844 Bacteria 13144
401 Ga0068862_100042308 3300005844 Bacteria 3881
402 Ga0068862_100045522 3300005844 Bacteria 3744
403 Ga0068862_100056241 3300005844 Bacteria 3371
404 Ga0068862_100103999 3300005844 Bacteria 2487
405 Ga0068862_100435915 3300005844 Bacteria 1232
406 Ga0081455_10000392 3300005937 Bacteria 57696
407 Ga0081539_10012387 3300005985 Bacteria 6579
408 Ga0081539_10206581 3300005985 Bacteria 903
409 Ga0070717_11235694 3300006028 Bacteria 680
410 Ga0075366_10300596 3300006195 Bacteria 982
411 Ga0075366_10414760 3300006195 Bacteria 829
412 Ga0097621_100013809 3300006237 Bacteria 6029
413 Ga0097621_100030354 3300006237 Bacteria 4278
414 Ga0097621_100097142 3300006237 Bacteria 2473
415 Ga0097621_100172693 3300006237 Bacteria 1864
416 Ga0097621_101000936 3300006237 Bacteria 782
417 Ga0097621_101196018 3300006237 Bacteria 716
418 Ga0097621_101639201 3300006237 Bacteria 612
419 Ga0097621_102058604 3300006237 Bacteria 545
420 Ga0068871_100011802 3300006358 Bacteria 6421
421 Ga0068871_100019859 3300006358 Bacteria 5136
422 Ga0068871_100073340 3300006358 Bacteria 2821
423 Ga0068871_100429466 3300006358 Bacteria 1181
424 Ga0068871_100499049 3300006358 Bacteria 1097
425 Ga0068871_100788857 3300006358 Bacteria 875
426 Ga0068871_101543117 3300006358 Bacteria 628
427 Ga0075428_102082338 3300006844 Bacteria 587
428 Ga0068865_100071228 3300006881 Bacteria 2465
429 Ga0097620_100000685 3300006931 Bacteria 34047
430 Ga0097620_100009717 3300006931 Bacteria 9713
431 Ga0097620_100032302 3300006931 Bacteria 5258
432 Ga0097620_100075824 3300006931 Bacteria 3403
433 Ga0097620_100187838 3300006931 Bacteria 2150
434 Ga0097620_100216980 3300006931 Bacteria 2000
435 Ga0097620_100365287 3300006931 Bacteria 1538
436 Ga0097620_100797221 3300006931 Bacteria 1032
437 Ga0097620_102354698 3300006931 Bacteria 587
438 Ga0079104_1009362 3300006946 Bacteria 3325
439 Ga0105250_10008687 3300009092 Bacteria 4303
440 Ga0105240_10059959 3300009093 Bacteria 4746
441 Ga0105240_10096990 3300009093 Bacteria 3592
442 Ga0105240_10126571 3300009093 Bacteria 3070
443 Ga0105240_10641684 3300009093 Bacteria 1165
444 Ga0105240_10724207 3300009093 Bacteria 1084
445 Ga0111539_10054965 3300009094 Bacteria 4734
446 Ga0111539_10305768 3300009094 Bacteria 1850
447 Ga0105245_10013595 3300009098 Bacteria 7091
448 Ga0105245_10286795 3300009098 Bacteria 1611
449 Ga0114129_11187441 3300009147 Bacteria 951
450 Ga0105243_10521820 3300009148 Bacteria 1130
451 Ga0105243_11160150 3300009148 Bacteria 784
452 Ga0105243_11222811 3300009148 Bacteria 765
453 Ga0105241_10013377 3300009174 Bacteria 6014
454 Ga0105241_10319358 3300009174 Bacteria 1338
455 Ga0105241_10406081 3300009174 Bacteria 1196
456 Ga0105241_10615941 3300009174 Bacteria 982
457 Ga0105241_11027947 3300009174 Bacteria 772
458 Ga0105241_12529510 3300009174 Bacteria 514
459 Ga0105242_10022015 3300009176 Bacteria 5009
460 Ga0105242_10115602 3300009176 Bacteria 2294
461 Ga0105248_10000083 3300009177 Bacteria 110619
462 Ga0105248_10001364 3300009177 Bacteria 27266
463 Ga0105248_10002811 3300009177 Bacteria 19328
464 Ga0105248_10011642 3300009177 Bacteria 9692
465 Ga0105248_10019227 3300009177 Bacteria 7557
466 Ga0105248_10036474 3300009177 Bacteria 5499
467 Ga0105248_10047334 3300009177 Bacteria 4822
468 Ga0105248_10058400 3300009177 Bacteria 4333
469 Ga0105248_10095943 3300009177 Bacteria 3339
470 Ga0105248_10587454 3300009177 Bacteria 1257
471 Ga0105248_12218952 3300009177 Bacteria 625
472 Ga0105237_10036508 3300009545 Bacteria 4973
473 Ga0105237_10056171 3300009545 Bacteria 3941
474 Ga0105237_10246047 3300009545 Bacteria 1790
475 Ga0105237_10935408 3300009545 Bacteria 874
476 Ga0105238_10022113 3300009551 Bacteria 6485
477 Ga0105238_10043379 3300009551 Bacteria 4551
478 Ga0105238_10047590 3300009551 Bacteria 4323
479 Ga0105238_10064726 3300009551 Bacteria 3656
480 Ga0105238_10267660 3300009551 Bacteria 1689
481 Ga0105238_10476697 3300009551 Bacteria 1247
482 Ga0105238_10515315 3300009551 Bacteria 1198
483 Ga0105238_12010997 3300009551 Bacteria 611
484 Ga0105249_10040279 3300009553 Bacteria 4243
485 Ga0105249_10089432 3300009553 Bacteria 2878
486 Ga0105249_10147326 3300009553 Bacteria 2263
487 Ga0105249_10498392 3300009553 Bacteria 1263
488 Ga0105249_10507431 3300009553 Bacteria 1252
489 Ga0105239_10031979 3300010375 Bacteria 5782
490 Ga0105239_10204978 3300010375 Bacteria 2210
491 Ga0105246_10168820 3300011119 Bacteria 1674
492 Ga0105246_10209812 3300011119 Bacteria 1519
493 Ga0157373_10006736 3300013100 Bacteria 8552
494 Ga0157373_10035314 3300013100 Bacteria 3589
495 Ga0157373_10038318 3300013100 Bacteria 3436
496 Ga0157373_10044097 3300013100 Bacteria 3184
497 Ga0157373_10066079 3300013100 Bacteria 2559
498 Ga0157373_10101919 3300013100 Bacteria 2020
499 Ga0157373_10113129 3300013100 Bacteria 1907
500 Ga0157373_10161573 3300013100 Bacteria 1576
501 Ga0157373_10177613 3300013100 Bacteria 1499
502 Ga0157373_10417298 3300013100 Bacteria 963
503 Ga0157373_10969880 3300013100 Bacteria 633
504 Ga0157373_10975130 3300013100 Bacteria 632
505 Ga0157373_11038457 3300013100 Bacteria 613
506 Ga0157373_11488734 3300013100 Bacteria 516
507 Ga0157371_10000785 3300013102 Bacteria 36569
508 Ga0157371_10005575 3300013102 Bacteria 10578
509 Ga0157371_10006691 3300013102 Bacteria 9426
510 Ga0157371_10075118 3300013102 Bacteria 2393
511 Ga0157371_10134492 3300013102 Bacteria 1760
512 Ga0157371_10156983 3300013102 Bacteria 1624
513 Ga0157371_10268596 3300013102 Bacteria 1231
514 Ga0157371_10332232 3300013102 Bacteria 1104
515 Ga0157371_10614735 3300013102 Bacteria 809
516 Ga0157371_10906623 3300013102 Bacteria 669
517 Ga0157371_11605491 3300013102 Bacteria 509
518 Ga0157370_10001694 3300013104 Bacteria 27128
519 Ga0157370_10109271 3300013104 Bacteria 2585
520 Ga0157370_10158100 3300013104 Bacteria 2108
521 Ga0157370_10201061 3300013104 Bacteria 1848
522 Ga0157370_10201109 3300013104 Bacteria 1848
523 Ga0157370_10328849 3300013104 Bacteria 1409
524 Ga0157370_12004036 3300013104 Bacteria 519
525 Ga0157369_10005976 3300013105 Bacteria 14139
526 Ga0157369_10012283 3300013105 Bacteria 9726
527 Ga0157369_10018842 3300013105 Bacteria 7734
528 Ga0157369_10092040 3300013105 Bacteria 3236
529 Ga0157369_10105650 3300013105 Bacteria 2997
530 Ga0157369_10121141 3300013105 Bacteria 2776
531 Ga0157369_10221541 3300013105 Bacteria 1980
532 Ga0157369_10334469 3300013105 Bacteria 1573
533 Ga0157369_10337966 3300013105 Bacteria 1564
534 Ga0157369_10660825 3300013105 Bacteria 1077
535 Ga0157369_10752581 3300013105 Bacteria 1002
536 Ga0157369_11772423 3300013105 Bacteria 627
537 Ga0157374_10011026 3300013296 Bacteria 7805
538 Ga0157374_10051583 3300013296 Bacteria 3828
539 Ga0157374_10070953 3300013296 Bacteria 3283
540 Ga0157374_10480792 3300013296 Bacteria 1245
541 Ga0157374_10490380 3300013296 Bacteria 1232
542 Ga0157374_11673603 3300013296 Bacteria 661
543 Ga0157378_10018559 3300013297 Bacteria 6113
544 Ga0157378_10038607 3300013297 Bacteria 4233
545 Ga0157378_10069268 3300013297 Bacteria 3164
546 Ga0157378_10280770 3300013297 Bacteria 1605
547 Ga0163162_10008489 3300013306 Bacteria 10023
548 Ga0163162_10009361 3300013306 Bacteria 9525
549 Ga0163162_10027725 3300013306 Bacteria 5602
550 Ga0163162_10053795 3300013306 Bacteria 4046
551 Ga0163162_10585853 3300013306 Bacteria 1242
552 Ga0163162_11725676 3300013306 Bacteria 715
553 Ga0157372_10007664 3300013307 Bacteria 11481
554 Ga0157372_10029102 3300013307 Bacteria 6028
555 Ga0157372_10129321 3300013307 Bacteria 2904
556 Ga0157372_10379538 3300013307 Bacteria 1647
557 Ga0157372_10509700 3300013307 Bacteria 1403
558 Ga0157372_11619986 3300013307 Bacteria 745
559 Ga0157372_11682059 3300013307 Bacteria 730
560 Ga0157375_10009672 3300013308 Bacteria 8477
561 Ga0157375_10079159 3300013308 Bacteria 3321
562 Ga0157375_10191240 3300013308 Bacteria 2201
563 Ga0157375_11045413 3300013308 Bacteria 954
564 Ga0157375_11050080 3300013308 Bacteria 952
565 Ga0157375_11054366 3300013308 Bacteria 950
566 Ga0157375_11102121 3300013308 Bacteria 929
567 Ga0163163_10000307 3300014325 Bacteria 48168
568 Ga0163163_10001064 3300014325 Bacteria 23319
569 Ga0163163_10003869 3300014325 Bacteria 12754
570 Ga0163163_10017657 3300014325 Bacteria 6661
571 Ga0163163_10096441 3300014325 Bacteria 2977
572 Ga0163163_10108867 3300014325 Bacteria 2798
573 Ga0163163_10209337 3300014325 Bacteria 1999
574 Ga0163163_12150440 3300014325 Bacteria 617
575 Ga0163163_12807349 3300014325 Bacteria 543
576 Ga0157380_10512868 3300014326 Bacteria 1168
577 Ga0157380_11437355 3300014326 Bacteria 741
578 Ga0157380_13495762 3300014326 Bacteria 503
579 Ga0182008_10059559 3300014497 Bacteria 1884
580 Ga0157377_10023993 3300014745 Bacteria 3239
581 Ga0157377_10291349 3300014745 Bacteria 1074
582 Ga0157379_10011314 3300014968 Bacteria 7778
583 Ga0157379_10017522 3300014968 Bacteria 6304
584 Ga0157379_10035281 3300014968 Bacteria 4460
585 Ga0157379_10116796 3300014968 Bacteria 2400
586 Ga0157379_10262250 3300014968 Bacteria 1570
587 Ga0157379_11674301 3300014968 Bacteria 623
588 Ga0157376_10023310 3300014969 Bacteria 4842
589 Ga0163161_10030144 3300017792 Bacteria 3858
590 Ga0206356_11100275 3300020070 Bacteria 511
591 Ga0206354_10468483 3300020081 Bacteria 595
592 Ga0206354_11000346 3300020081 Bacteria 832
593 Ga0206353_10450254 3300020082 Bacteria 854
594 Ga0213873_10000026 3300021358 Bacteria 74525
595 Ga0213876_10000149 3300021384 Bacteria 74548
596 Ga0213876_10488376 3300021384 Bacteria 655
597 Ga0209147_101097 3300025229 Bacteria 11305
598 Ga0207697_10012170 3300025315 Bacteria 3617
599 Ga0207697_10039440 3300025315 Bacteria 1938
600 Ga0207697_10051789 3300025315 Bacteria 1697
601 Ga0207697_10159899 3300025315 Bacteria 982
602 Ga0207697_10180997 3300025315 Bacteria 924
603 Ga0207697_10185626 3300025315 Bacteria 912
604 Ga0207656_10008586 3300025321 Bacteria 3765
605 Ga0207656_10014077 3300025321 Bacteria 3074
606 Ga0207656_10015639 3300025321 Bacteria 2940
607 Ga0207656_10092980 3300025321 Bacteria 1371
608 Ga0207656_10154202 3300025321 Bacteria 1089
609 Ga0207656_10364980 3300025321 Bacteria 722
610 Ga0207696_1020379 3300025711 Bacteria 2141
611 Ga0207682_10001448 3300025893 Bacteria 10955
612 Ga0207682_10204840 3300025893 Bacteria 908
613 Ga0207682_10239133 3300025893 Bacteria 843
614 Ga0207642_10039484 3300025899 Bacteria 2051
615 Ga0207688_10064945 3300025901 Bacteria 2061
616 Ga0207688_10087959 3300025901 Bacteria 1781
617 Ga0207688_10166899 3300025901 Bacteria 1307
618 Ga0207688_10421776 3300025901 Bacteria 829
619 Ga0207680_10092781 3300025903 Bacteria 1924
620 Ga0207680_10133912 3300025903 Bacteria 1636
621 Ga0207680_10174584 3300025903 Bacteria 1449
622 Ga0207680_10739742 3300025903 Bacteria 705
623 Ga0207647_10007320 3300025904 Bacteria 7984
624 Ga0207647_10014010 3300025904 Bacteria 5548
625 Ga0207647_10014102 3300025904 Bacteria 5521
626 Ga0207647_10032914 3300025904 Bacteria 3325
627 Ga0207647_10062117 3300025904 Bacteria 2277
628 Ga0207647_10091279 3300025904 Bacteria 1816
629 Ga0207647_10212871 3300025904 Bacteria 1115
630 Ga0207647_10630331 3300025904 Bacteria 589
631 Ga0207645_10061671 3300025907 Bacteria 2395
632 Ga0207645_10132562 3300025907 Bacteria 1622
633 Ga0207645_10269655 3300025907 Bacteria 1129
634 Ga0207645_10353349 3300025907 Bacteria 984
635 Ga0207645_10586242 3300025907 Bacteria 757
636 Ga0207643_10339825 3300025908 Bacteria 941
637 Ga0207643_10689194 3300025908 Bacteria 660
638 Ga0207705_10000005 3300025909 Bacteria 673478
639 Ga0207705_10000072 3300025909 Bacteria 126043
640 Ga0207705_10010322 3300025909 Bacteria 6793
641 Ga0207705_10014792 3300025909 Bacteria 5610
642 Ga0207705_10037858 3300025909 Bacteria 3452
643 Ga0207705_10042434 3300025909 Bacteria 3265
644 Ga0207705_10053086 3300025909 Bacteria 2919
645 Ga0207705_10053709 3300025909 Bacteria 2903
646 Ga0207705_10055414 3300025909 Bacteria 2858
647 Ga0207705_10056182 3300025909 Bacteria 2838
648 Ga0207705_10103080 3300025909 Bacteria 2101
649 Ga0207705_10109429 3300025909 Bacteria 2040
650 Ga0207705_10132108 3300025909 Bacteria 1858
651 Ga0207705_10134072 3300025909 Bacteria 1845
652 Ga0207705_10220929 3300025909 Bacteria 1439
653 Ga0207705_10380385 3300025909 Bacteria 1090
654 Ga0207705_10399328 3300025909 Bacteria 1063
655 Ga0207705_10415304 3300025909 Bacteria 1041
656 Ga0207705_10794045 3300025909 Bacteria 735
657 Ga0207705_11142453 3300025909 Bacteria 599
658 Ga0207705_11292949 3300025909 Bacteria 557
659 Ga0207654_10318538 3300025911 Bacteria 1062
660 Ga0207654_10367187 3300025911 Bacteria 994
661 Ga0207654_10763533 3300025911 Bacteria 697
662 Ga0207654_11000936 3300025911 Bacteria 608
663 Ga0207654_11269289 3300025911 Bacteria 537
664 Ga0207707_10026465 3300025912 Bacteria 5070
665 Ga0207707_10042051 3300025912 Bacteria 3990
666 Ga0207707_10234808 3300025912 Bacteria 1595
667 Ga0207695_10008696 3300025913 Bacteria 12665
668 Ga0207695_10022931 3300025913 Bacteria 7070
669 Ga0207695_10119471 3300025913 Bacteria 2606
670 Ga0207695_10451916 3300025913 Bacteria 1168
671 Ga0207695_10728573 3300025913 Bacteria 872
672 Ga0207671_10637791 3300025914 Bacteria 848
673 Ga0207671_10642493 3300025914 Bacteria 845
674 Ga0207660_10000438 3300025917 Bacteria 27496
675 Ga0207660_10000972 3300025917 Bacteria 18963
676 Ga0207660_10040305 3300025917 Bacteria 3270
677 Ga0207660_10097427 3300025917 Bacteria 2191
678 Ga0207660_10179886 3300025917 Bacteria 1642
679 Ga0207660_10220303 3300025917 Bacteria 1489
680 Ga0207660_10249013 3300025917 Bacteria 1402
681 Ga0207660_10280053 3300025917 Bacteria 1323
682 Ga0207660_10288381 3300025917 Bacteria 1304
683 Ga0207660_11150229 3300025917 Bacteria 632
684 Ga0207660_11263061 3300025917 Bacteria 600
685 Ga0207662_10089629 3300025918 Bacteria 1890
686 Ga0207662_11040872 3300025918 Bacteria 581
687 Ga0207657_10000156 3300025919 Bacteria 69892
688 Ga0207657_10000176 3300025919 Bacteria 65856
689 Ga0207657_10000434 3300025919 Bacteria 44542
690 Ga0207657_10000832 3300025919 Bacteria 32589
691 Ga0207657_10001735 3300025919 Bacteria 23492
692 Ga0207657_10006672 3300025919 Bacteria 11938
693 Ga0207657_10008822 3300025919 Bacteria 10198
694 Ga0207657_10014835 3300025919 Bacteria 7585
695 Ga0207657_10022935 3300025919 Bacteria 5824
696 Ga0207657_10023453 3300025919 Bacteria 5745
697 Ga0207657_10027079 3300025919 Bacteria 5255
698 Ga0207657_10039308 3300025919 Bacteria 4206
699 Ga0207657_10095041 3300025919 Bacteria 2480
700 Ga0207657_10100863 3300025919 Bacteria 2396
701 Ga0207657_10111096 3300025919 Bacteria 2264
702 Ga0207657_10137044 3300025919 Bacteria 2002
703 Ga0207657_10328487 3300025919 Bacteria 1208
704 Ga0207657_10349583 3300025919 Bacteria 1166
705 Ga0207657_10667509 3300025919 Bacteria 809
706 Ga0207657_10695177 3300025919 Bacteria 790
707 Ga0207657_11235375 3300025919 Bacteria 567
708 Ga0207657_11410998 3300025919 Bacteria 523
709 Ga0207649_10000016 3300025920 Bacteria 243843
710 Ga0207649_10000158 3300025920 Bacteria 55609
711 Ga0207649_10006454 3300025920 Bacteria 6368
712 Ga0207649_10010472 3300025920 Bacteria 5096
713 Ga0207649_10037336 3300025920 Bacteria 2934
714 Ga0207649_10049011 3300025920 Bacteria 2607
715 Ga0207649_10133304 3300025920 Bacteria 1690
716 Ga0207649_10134267 3300025920 Bacteria 1685
717 Ga0207649_10191608 3300025920 Bacteria 1438
718 Ga0207649_10237251 3300025920 Bacteria 1307
719 Ga0207649_10258656 3300025920 Bacteria 1257
720 Ga0207649_10283278 3300025920 Bacteria 1206
721 Ga0207649_10358224 3300025920 Bacteria 1082
722 Ga0207649_10408676 3300025920 Bacteria 1017
723 Ga0207649_10808297 3300025920 Bacteria 732
724 Ga0207652_10000002 3300025921 Bacteria 878035
725 Ga0207652_10029192 3300025921 Bacteria 4608
726 Ga0207652_10039973 3300025921 Bacteria 3982
727 Ga0207652_10063665 3300025921 Bacteria 3190
728 Ga0207652_10070871 3300025921 Bacteria 3028
729 Ga0207652_10079314 3300025921 Bacteria 2868
730 Ga0207652_10214675 3300025921 Bacteria 1733
731 Ga0207652_10559603 3300025921 Bacteria 1027
732 Ga0207652_10794927 3300025921 Bacteria 840
733 Ga0207652_10878951 3300025921 Bacteria 793
734 Ga0207652_11405599 3300025921 Bacteria 601
735 Ga0207646_10129915 3300025922 Bacteria 2267
736 Ga0207681_10021994 3300025923 Bacteria 4062
737 Ga0207681_10037734 3300025923 Bacteria 3196
738 Ga0207681_10057474 3300025923 Bacteria 2659
739 Ga0207681_10088614 3300025923 Bacteria 2204
740 Ga0207681_10408982 3300025923 Bacteria 1097
741 Ga0207681_10859533 3300025923 Bacteria 759
742 Ga0207681_10948358 3300025923 Bacteria 721
743 Ga0207681_10971770 3300025923 Bacteria 712
744 Ga0207694_10030113 3300025924 Bacteria 4144
745 Ga0207694_10105179 3300025924 Bacteria 2240
746 Ga0207694_10159490 3300025924 Bacteria 1821
747 Ga0207694_10387824 3300025924 Bacteria 1160
748 Ga0207650_10001533 3300025925 Bacteria 16559
749 Ga0207650_10042351 3300025925 Bacteria 3340
750 Ga0207650_10050238 3300025925 Bacteria 3083
751 Ga0207650_10078015 3300025925 Bacteria 2505
752 Ga0207650_10229942 3300025925 Bacteria 1495
753 Ga0207650_10369629 3300025925 Bacteria 1183
754 Ga0207659_10004323 3300025926 Bacteria 8589
755 Ga0207659_10100135 3300025926 Bacteria 2183
756 Ga0207659_10225636 3300025926 Bacteria 1508
757 Ga0207659_10427393 3300025926 Bacteria 1112
758 Ga0207659_10713323 3300025926 Bacteria 859
759 Ga0207687_10067528 3300025927 Bacteria 2544
760 Ga0207687_10136468 3300025927 Bacteria 1856
761 Ga0207664_10041938 3300025929 Bacteria 3568
762 Ga0207664_10125950 3300025929 Bacteria 2150
763 Ga0207664_10312583 3300025929 Bacteria 1384
764 Ga0207644_10000243 3300025931 Bacteria 37412
765 Ga0207644_10003062 3300025931 Bacteria 10764
766 Ga0207644_10005874 3300025931 Bacteria 8004
767 Ga0207644_10013892 3300025931 Bacteria 5379
768 Ga0207644_10039361 3300025931 Bacteria 3336
769 Ga0207644_10066054 3300025931 Bacteria 2632
770 Ga0207644_10140853 3300025931 Bacteria 1857
771 Ga0207644_10147891 3300025931 Bacteria 1815
772 Ga0207690_10000002 3300025932 Bacteria 807473
773 Ga0207690_10000245 3300025932 Bacteria 39464
774 Ga0207690_10001554 3300025932 Bacteria 14378
775 Ga0207690_10005651 3300025932 Bacteria 7390
776 Ga0207690_10008203 3300025932 Bacteria 6196
777 Ga0207690_10010558 3300025932 Bacteria 5495
778 Ga0207690_10018027 3300025932 Bacteria 4323
779 Ga0207690_10041541 3300025932 Bacteria 3014
780 Ga0207690_10077147 3300025932 Bacteria 2315
781 Ga0207690_10205867 3300025932 Bacteria 1497
782 Ga0207690_10225476 3300025932 Bacteria 1436
783 Ga0207690_10236651 3300025932 Bacteria 1404
784 Ga0207690_10246034 3300025932 Bacteria 1379
785 Ga0207690_10574596 3300025932 Bacteria 918
786 Ga0207690_11143124 3300025932 Bacteria 649
787 Ga0207690_11271356 3300025932 Bacteria 615
788 Ga0207706_10000041 3300025933 Bacteria 130090
789 Ga0207706_10000299 3300025933 Bacteria 53751
790 Ga0207706_10000614 3300025933 Bacteria 37833
791 Ga0207706_10001803 3300025933 Bacteria 21030
792 Ga0207706_10009249 3300025933 Bacteria 9054
793 Ga0207706_10012750 3300025933 Bacteria 7650
794 Ga0207706_10029145 3300025933 Bacteria 4929
795 Ga0207706_10044628 3300025933 Bacteria 3929
796 Ga0207706_10072887 3300025933 Bacteria 3020
797 Ga0207706_10095359 3300025933 Bacteria 2617
798 Ga0207706_10115718 3300025933 Bacteria 2358
799 Ga0207706_10125700 3300025933 Bacteria 2255
800 Ga0207706_10150264 3300025933 Bacteria 2048
801 Ga0207706_10305200 3300025933 Bacteria 1386
802 Ga0207706_10695441 3300025933 Bacteria 869
803 Ga0207706_11149092 3300025933 Bacteria 647
804 Ga0207706_11268298 3300025933 Bacteria 610
805 Ga0207686_10116564 3300025934 Bacteria 1811
806 Ga0207686_11086529 3300025934 Bacteria 652
807 Ga0207670_10977185 3300025936 Bacteria 712
808 Ga0207669_10033953 3300025937 Bacteria 2885
809 Ga0207669_10035772 3300025937 Bacteria 2830
810 Ga0207669_10066082 3300025937 Bacteria 2247
811 Ga0207669_10132512 3300025937 Bacteria 1715
812 Ga0207669_10319815 3300025937 Bacteria 1187
813 Ga0207669_10927083 3300025937 Bacteria 729
814 Ga0207704_10022279 3300025938 Bacteria 3391
815 Ga0207691_10000765 3300025940 Bacteria 31799
816 Ga0207691_10008543 3300025940 Bacteria 9832
817 Ga0207691_10026627 3300025940 Bacteria 5425
818 Ga0207691_10135850 3300025940 Bacteria 2169
819 Ga0207691_10350456 3300025940 Bacteria 1263
820 Ga0207691_11104851 3300025940 Bacteria 659
821 Ga0207711_10001243 3300025941 Bacteria 24174
822 Ga0207711_10004361 3300025941 Bacteria 12073
823 Ga0207711_10009998 3300025941 Bacteria 7883
824 Ga0207711_10031506 3300025941 Bacteria 4477
825 Ga0207711_10039055 3300025941 Bacteria 4037
826 Ga0207711_10062568 3300025941 Bacteria 3210
827 Ga0207711_10110682 3300025941 Bacteria 2442
828 Ga0207711_10128005 3300025941 Bacteria 2273
829 Ga0207711_10155432 3300025941 Bacteria 2067
830 Ga0207711_10173099 3300025941 Bacteria 1960
831 Ga0207711_10198552 3300025941 Bacteria 1830
832 Ga0207689_10019180 3300025942 Bacteria 5766
833 Ga0207689_10050354 3300025942 Bacteria 3435
834 Ga0207661_10006910 3300025944 Bacteria 8046
835 Ga0207661_10025722 3300025944 Bacteria 4478
836 Ga0207661_10321377 3300025944 Bacteria 1391
837 Ga0207661_10515227 3300025944 Bacteria 1094
838 Ga0207661_10530837 3300025944 Bacteria 1077
839 Ga0207661_10595878 3300025944 Bacteria 1014
840 Ga0207661_10712240 3300025944 Bacteria 923
841 Ga0207661_11289405 3300025944 Bacteria 671
842 Ga0207661_11386545 3300025944 Bacteria 645
843 Ga0207679_10000243 3300025945 Bacteria 41706
844 Ga0207679_10004033 3300025945 Bacteria 9119
845 Ga0207679_10037237 3300025945 Bacteria 3456
846 Ga0207679_10043581 3300025945 Bacteria 3232
847 Ga0207679_10050397 3300025945 Bacteria 3042
848 Ga0207679_10108555 3300025945 Bacteria 2185
849 Ga0207679_10128221 3300025945 Bacteria 2031
850 Ga0207679_10183284 3300025945 Bacteria 1734
851 Ga0207679_10187376 3300025945 Bacteria 1717
852 Ga0207679_10472738 3300025945 Bacteria 1115
853 Ga0207679_10552654 3300025945 Bacteria 1033
854 Ga0207679_10767099 3300025945 Bacteria 878
855 Ga0207679_10913322 3300025945 Bacteria 803
856 Ga0207679_11572655 3300025945 Bacteria 603
857 Ga0207667_10002008 3300025949 Bacteria 25533
858 Ga0207667_10002631 3300025949 Bacteria 22203
859 Ga0207667_10007585 3300025949 Bacteria 13014
860 Ga0207667_10056598 3300025949 Bacteria 4119
861 Ga0207667_10167647 3300025949 Bacteria 2257
862 Ga0207667_10187096 3300025949 Bacteria 2125
863 Ga0207667_10253451 3300025949 Bacteria 1800
864 Ga0207667_10272508 3300025949 Bacteria 1730
865 Ga0207667_10444962 3300025949 Bacteria 1317
866 Ga0207667_10456546 3300025949 Bacteria 1298
867 Ga0207667_10533107 3300025949 Bacteria 1189
868 Ga0207667_10575269 3300025949 Bacteria 1138
869 Ga0207667_10714524 3300025949 Bacteria 1004
870 Ga0207667_11428024 3300025949 Bacteria 665
871 Ga0207667_11750035 3300025949 Bacteria 587
872 Ga0207651_10004605 3300025960 Bacteria 6982
873 Ga0207651_10007284 3300025960 Bacteria 5880
874 Ga0207651_10039183 3300025960 Bacteria 3122
875 Ga0207651_10053889 3300025960 Bacteria 2752
876 Ga0207651_10136105 3300025960 Bacteria 1890
877 Ga0207651_10241452 3300025960 Bacteria 1472
878 Ga0207651_11114672 3300025960 Bacteria 707
879 Ga0207712_10039903 3300025961 Bacteria 3219
880 Ga0207712_10156973 3300025961 Bacteria 1763
881 Ga0207712_10189774 3300025961 Bacteria 1621
882 Ga0207668_10000704 3300025972 Bacteria 20478
883 Ga0207668_10002721 3300025972 Bacteria 10348
884 Ga0207668_10034340 3300025972 Bacteria 3367
885 Ga0207668_10041566 3300025972 Bacteria 3109
886 Ga0207668_10066229 3300025972 Bacteria 2560
887 Ga0207668_10066683 3300025972 Bacteria 2552
888 Ga0207668_10159121 3300025972 Bacteria 1758
889 Ga0207668_10194079 3300025972 Bacteria 1612
890 Ga0207668_10290590 3300025972 Bacteria 1345
891 Ga0207668_10594843 3300025972 Bacteria 963
892 Ga0207668_10734230 3300025972 Bacteria 870
893 Ga0207668_10880332 3300025972 Bacteria 796
894 Ga0207668_11090944 3300025972 Bacteria 715
895 Ga0207668_11188825 3300025972 Bacteria 685
896 Ga0207640_10006942 3300025981 Bacteria 6229
897 Ga0207640_10010452 3300025981 Bacteria 5228
898 Ga0207640_10035619 3300025981 Bacteria 3116
899 Ga0207640_10070002 3300025981 Bacteria 2358
900 Ga0207640_10109389 3300025981 Bacteria 1955
901 Ga0207640_10123546 3300025981 Bacteria 1859
902 Ga0207640_10144294 3300025981 Bacteria 1740
903 Ga0207640_10147333 3300025981 Bacteria 1724
904 Ga0207640_10177882 3300025981 Bacteria 1592
905 Ga0207640_10180084 3300025981 Bacteria 1584
906 Ga0207640_10417352 3300025981 Bacteria 1097
907 Ga0207640_10941777 3300025981 Bacteria 757
908 Ga0207640_10967998 3300025981 Bacteria 747
909 Ga0207658_10008745 3300025986 Bacteria 6879
910 Ga0207658_10010095 3300025986 Bacteria 6413
911 Ga0207658_10010272 3300025986 Bacteria 6360
912 Ga0207658_10012485 3300025986 Bacteria 5804
913 Ga0207658_10022779 3300025986 Bacteria 4363
914 Ga0207658_10029984 3300025986 Bacteria 3848
915 Ga0207658_10157388 3300025986 Bacteria 1858
916 Ga0207658_10210966 3300025986 Bacteria 1627
917 Ga0207658_10623316 3300025986 Bacteria 970
918 Ga0207677_10000529 3300026023 Bacteria 24143
919 Ga0207677_10109180 3300026023 Bacteria 2056
920 Ga0207677_10219322 3300026023 Bacteria 1524
921 Ga0207677_10272603 3300026023 Bacteria 1385
922 Ga0207677_10324075 3300026023 Bacteria 1281
923 Ga0207677_10467951 3300026023 Bacteria 1083
924 Ga0207677_10562093 3300026023 Bacteria 996
925 Ga0207677_11032086 3300026023 Bacteria 747
926 Ga0207703_10012417 3300026035 Bacteria 6639
927 Ga0207703_10014764 3300026035 Bacteria 6096
928 Ga0207703_10015617 3300026035 Bacteria 5923
929 Ga0207703_10112765 3300026035 Bacteria 2323
930 Ga0207703_10251054 3300026035 Bacteria 1594
931 Ga0207703_10478489 3300026035 Bacteria 1167
932 Ga0207639_10000074 3300026041 Bacteria 91671
933 Ga0207639_10000850 3300026041 Bacteria 20753
934 Ga0207639_10001184 3300026041 Bacteria 17717
935 Ga0207639_10004542 3300026041 Bacteria 9353
936 Ga0207639_10006339 3300026041 Bacteria 8033
937 Ga0207639_10110332 3300026041 Bacteria 2241
938 Ga0207639_10167706 3300026041 Bacteria 1856
939 Ga0207639_10180103 3300026041 Bacteria 1797
940 Ga0207639_10319993 3300026041 Bacteria 1377
941 Ga0207639_10330178 3300026041 Bacteria 1357
942 Ga0207639_10437170 3300026041 Bacteria 1186
943 Ga0207639_10533382 3300026041 Bacteria 1076
944 Ga0207639_10558906 3300026041 Bacteria 1051
945 Ga0207639_10824661 3300026041 Bacteria 865
946 Ga0207639_11348653 3300026041 Bacteria 669
947 Ga0207639_11728536 3300026041 Bacteria 586
948 Ga0207678_10007056 3300026067 Bacteria 9976
949 Ga0207678_10007788 3300026067 Bacteria 9463
950 Ga0207678_10012837 3300026067 Bacteria 7354
951 Ga0207678_10016026 3300026067 Bacteria 6585
952 Ga0207678_10040429 3300026067 Bacteria 4045
953 Ga0207678_10042935 3300026067 Bacteria 3914
954 Ga0207678_10097907 3300026067 Bacteria 2506
955 Ga0207678_10149292 3300026067 Bacteria 1995
956 Ga0207678_10184195 3300026067 Bacteria 1783
957 Ga0207678_10330942 3300026067 Bacteria 1311
958 Ga0207702_10000074 3300026078 Bacteria 113070
959 Ga0207702_10004609 3300026078 Bacteria 12211
960 Ga0207702_10030325 3300026078 Bacteria 4506
961 Ga0207702_10033258 3300026078 Bacteria 4306
962 Ga0207702_10091866 3300026078 Bacteria 2659
963 Ga0207702_10111922 3300026078 Bacteria 2429
964 Ga0207702_10147162 3300026078 Bacteria 2139
965 Ga0207702_10152516 3300026078 Bacteria 2103
966 Ga0207702_10210354 3300026078 Bacteria 1808
967 Ga0207702_10808677 3300026078 Bacteria 927
968 Ga0207702_10885324 3300026078 Bacteria 884
969 Ga0207702_11726740 3300026078 Bacteria 619
970 Ga0207641_10000502 3300026088 Bacteria 44127
971 Ga0207641_10027657 3300026088 Bacteria 4684
972 Ga0207641_10084618 3300026088 Bacteria 2761
973 Ga0207641_10104078 3300026088 Bacteria 2505
974 Ga0207641_10126635 3300026088 Bacteria 2287
975 Ga0207641_10325003 3300026088 Bacteria 1459
976 Ga0207641_10413712 3300026088 Bacteria 1297
977 Ga0207641_10593662 3300026088 Bacteria 1083
978 Ga0207641_10608571 3300026088 Bacteria 1070
979 Ga0207641_10909883 3300026088 Bacteria 874
980 Ga0207648_10008755 3300026089 Bacteria 9754
981 Ga0207648_10011459 3300026089 Bacteria 8349
982 Ga0207648_10015863 3300026089 Bacteria 6907
983 Ga0207648_10068610 3300026089 Bacteria 3090
984 Ga0207648_10206529 3300026089 Bacteria 1743
985 Ga0207648_10566111 3300026089 Bacteria 1045
986 Ga0207676_10000694 3300026095 Bacteria 26554
987 Ga0207676_10002166 3300026095 Bacteria 14176
988 Ga0207676_10011661 3300026095 Bacteria 6286
989 Ga0207676_10045412 3300026095 Bacteria 3394
990 Ga0207676_10454236 3300026095 Bacteria 1208
991 Ga0207676_11441305 3300026095 Bacteria 685
992 Ga0207676_11507555 3300026095 Bacteria 669
993 Ga0207676_11568361 3300026095 Bacteria 656
994 Ga0207676_11720448 3300026095 Bacteria 625
995 Ga0207674_10001687 3300026116 Bacteria 28359
996 Ga0207674_10002589 3300026116 Bacteria 22783
997 Ga0207674_10005845 3300026116 Bacteria 14590
998 Ga0207674_10009464 3300026116 Bacteria 11130
999 Ga0207674_10029572 3300026116 Bacteria 5767
1000 Ga0207674_10031516 3300026116 Bacteria 5569
1001 Ga0207674_10045876 3300026116 Bacteria 4492
1002 Ga0207674_10049173 3300026116 Bacteria 4314
1003 Ga0207674_10073036 3300026116 Bacteria 3445
1004 Ga0207674_10138795 3300026116 Bacteria 2391
1005 Ga0207674_10289515 3300026116 Bacteria 1586
1006 Ga0207674_11392015 3300026116 Bacteria 671
1007 Ga0207674_11984069 3300026116 Bacteria 547
1008 Ga0207675_100088082 3300026118 Bacteria 2916
1009 Ga0207683_10000846 3300026121 Bacteria 28093
1010 Ga0207683_10003293 3300026121 Bacteria 14080
1011 Ga0207683_10004238 3300026121 Bacteria 12379
1012 Ga0207683_10005095 3300026121 Bacteria 11274
1013 Ga0207683_10188073 3300026121 Bacteria 1874
1014 Ga0207683_10558819 3300026121 Bacteria 1058
1015 Ga0207698_10003349 3300026142 Bacteria 9648
1016 Ga0207698_10005133 3300026142 Bacteria 8047
1017 Ga0207698_10012096 3300026142 Bacteria 5630
1018 Ga0207698_10042442 3300026142 Bacteria 3398
1019 Ga0207698_10067653 3300026142 Bacteria 2817
1020 Ga0207698_10083046 3300026142 Bacteria 2592
1021 Ga0207698_10098838 3300026142 Bacteria 2412
1022 Ga0207698_10241713 3300026142 Bacteria 1646
1023 Ga0207698_10276171 3300026142 Bacteria 1552
1024 Ga0207698_10360641 3300026142 Bacteria 1376
1025 Ga0207698_10568208 3300026142 Bacteria 1114
1026 Ga0207698_10727760 3300026142 Bacteria 989
1027 Ga0207698_11162008 3300026142 Bacteria 785
1028 Ga0207698_12173106 3300026142 Bacteria 568
1029 Ga0209281_1031254 3300027111 Bacteria 950
1030 Ga0209967_1042469 3300027364 Bacteria 692
1031 Ga0209970_1020228 3300027614 Bacteria 1124
1032 Ga0209974_10119293 3300027876 Bacteria 933
1033 Ga0207428_10176052 3300027907 Bacteria 1618
1034 Ga0268266_10012072 3300028379 Bacteria 7475
1035 Ga0268266_10012623 3300028379 Bacteria 7299
1036 Ga0268266_10032066 3300028379 Bacteria 4463
1037 Ga0268266_10085215 3300028379 Bacteria 2760
1038 Ga0268266_10307181 3300028379 Bacteria 1481
1039 Ga0268266_10416978 3300028379 Bacteria 1272
1040 Ga0268266_10562702 3300028379 Bacteria 1093
1041 Ga0268266_10570947 3300028379 Bacteria 1085
1042 Ga0268266_11298270 3300028379 Bacteria 703
1043 Ga0268266_11417181 3300028379 Bacteria 670
1044 Ga0268266_12382684 3300028379 Bacteria 500
1045 Ga0268265_10003659 3300028380 Bacteria 10962
1046 Ga0268265_10011100 3300028380 Bacteria 6087
1047 Ga0268265_10018499 3300028380 Bacteria 4830
1048 Ga0268265_10046757 3300028380 Bacteria 3237
1049 Ga0268265_10102892 3300028380 Bacteria 2311
1050 Ga0268265_10247232 3300028380 Bacteria 1577
1051 Ga0268265_10324733 3300028380 Bacteria 1395
1052 Ga0268265_10630034 3300028380 Bacteria 1028
1053 Ga0268264_10000410 3300028381 Bacteria 60680
1054 Ga0268264_10000418 3300028381 Bacteria 59942
1055 Ga0268264_10070538 3300028381 Bacteria 2958
1056 Ga0268264_10199932 3300028381 Bacteria 1828
1057 Ga0268264_10420368 3300028381 Bacteria 1289
1058 Ga0268264_10652944 3300028381 Bacteria 1041
1059 Ga0316177_1154915 3300030731 Bacteria 1534
1060 Ga0316182_1092649 3300030745 Bacteria 1973
1061 Ga0307408_100001159 3300031548 Bacteria 20050
1062 Ga0307408_100070719 3300031548 Bacteria 2577
1063 Ga0307408_100094196 3300031548 Bacteria 2267
1064 Ga0307408_100122210 3300031548 Bacteria 2019
1065 Ga0307408_100205143 3300031548 Bacteria 1598
1066 Ga0307408_100356372 3300031548 Bacteria 1243
1067 Ga0307408_100525978 3300031548 Bacteria 1039
1068 Ga0307408_100533943 3300031548 Bacteria 1032
1069 Ga0307408_100647643 3300031548 Bacteria 944
1070 Ga0307408_100894390 3300031548 Bacteria 812
1071 Ga0307405_10000240 3300031731 Bacteria 19933
1072 Ga0307405_10077415 3300031731 Bacteria 2161
1073 Ga0307405_10200219 3300031731 Bacteria 1450
1074 Ga0307405_10272613 3300031731 Bacteria 1269
1075 Ga0307405_10282073 3300031731 Bacteria 1251
1076 Ga0307405_10288778 3300031731 Bacteria 1239
1077 Ga0307405_10425224 3300031731 Bacteria 1046
1078 Ga0307405_10504487 3300031731 Bacteria 970
1079 Ga0307405_10522425 3300031731 Bacteria 955
1080 Ga0307405_10569470 3300031731 Bacteria 919
1081 Ga0307405_10679536 3300031731 Bacteria 850
1082 Ga0307405_11049208 3300031731 Bacteria 698
1083 Ga0307405_11518406 3300031731 Bacteria 589
1084 Ga0307405_11579065 3300031731 Bacteria 578
1085 Ga0307413_10000171 3300031824 Bacteria 18223
1086 Ga0307413_10000456 3300031824 Bacteria 13342
1087 Ga0307413_10000616 3300031824 Bacteria 11983
1088 Ga0307413_10002633 3300031824 Bacteria 7345
1089 Ga0307413_10057194 3300031824 Bacteria 2383
1090 Ga0307413_10132492 3300031824 Bacteria 1708
1091 Ga0307413_10158825 3300031824 Bacteria 1585
1092 Ga0307413_10259832 3300031824 Bacteria 1294
1093 Ga0307413_10311972 3300031824 Bacteria 1197
1094 Ga0307413_10336377 3300031824 Bacteria 1159
1095 Ga0307413_10455385 3300031824 Bacteria 1017
1096 Ga0307413_11849956 3300031824 Bacteria 541
1097 Ga0307410_10000393 3300031852 Bacteria 17209
1098 Ga0307410_10002578 3300031852 Bacteria 8796
1099 Ga0307410_10006997 3300031852 Bacteria 6138
1100 Ga0307410_10029803 3300031852 Bacteria 3479
1101 Ga0307410_10061629 3300031852 Bacteria 2567
1102 Ga0307410_10095855 3300031852 Bacteria 2116
1103 Ga0307410_10167664 3300031852 Bacteria 1652
1104 Ga0307410_10372687 3300031852 Bacteria 1146
1105 Ga0307410_10403784 3300031852 Bacteria 1104
1106 Ga0307410_10623002 3300031852 Bacteria 902
1107 Ga0307406_10011286 3300031901 Bacteria 5066
1108 Ga0307406_10039192 3300031901 Bacteria 2938
1109 Ga0307406_10090168 3300031901 Bacteria 2062
1110 Ga0307406_10106024 3300031901 Bacteria 1924
1111 Ga0307406_10167231 3300031901 Bacteria 1588
1112 Ga0307406_10225324 3300031901 Bacteria 1396
1113 Ga0307406_10399964 3300031901 Bacteria 1088
1114 Ga0307406_10454337 3300031901 Bacteria 1028
1115 Ga0307406_10462780 3300031901 Bacteria 1020
1116 Ga0307406_10874391 3300031901 Bacteria 763
1117 Ga0307406_11277197 3300031901 Bacteria 640
1118 Ga0307406_11307370 3300031901 Bacteria 633
1119 Ga0307407_10000541 3300031903 Bacteria 11794
1120 Ga0307407_10004230 3300031903 Bacteria 6057
1121 Ga0307407_10007325 3300031903 Bacteria 4988
1122 Ga0307407_10007478 3300031903 Bacteria 4949
1123 Ga0307407_10017174 3300031903 Bacteria 3623
1124 Ga0307407_10019151 3300031903 Bacteria 3479
1125 Ga0307407_10330013 3300031903 Bacteria 1073
1126 Ga0307407_10759949 3300031903 Bacteria 734
1127 Ga0307407_11581411 3300031903 Bacteria 520
1128 Ga0307412_10000248 3300031911 Bacteria 35008
1129 Ga0307412_10000920 3300031911 Bacteria 16793
1130 Ga0307412_10036375 3300031911 Bacteria 3153
1131 Ga0307412_10073640 3300031911 Bacteria 2337
1132 Ga0307412_10180953 3300031911 Bacteria 1585
1133 Ga0307412_10342896 3300031911 Bacteria 1196
1134 Ga0307412_10489124 3300031911 Bacteria 1022
1135 Ga0307412_10572932 3300031911 Bacteria 952
1136 Ga0307412_10766119 3300031911 Bacteria 834
1137 Ga0307412_11113001 3300031911 Bacteria 703
1138 Ga0307412_11372855 3300031911 Bacteria 638
1139 Ga0307409_100000418 3300031995 Bacteria 18065
1140 Ga0307409_100004995 3300031995 Bacteria 7552
1141 Ga0307409_100006369 3300031995 Bacteria 6927
1142 Ga0307409_100044516 3300031995 Bacteria 3343
1143 Ga0307409_100089672 3300031995 Bacteria 2514
1144 Ga0307409_100507706 3300031995 Bacteria 1175
1145 Ga0307409_100842510 3300031995 Bacteria 927
1146 Ga0307409_100923504 3300031995 Bacteria 887
1147 Ga0307409_101377052 3300031995 Bacteria 731
1148 Ga0307409_101396599 3300031995 Bacteria 726
1149 Ga0307409_102390185 3300031995 Bacteria 557
1150 Ga0307416_100001974 3300032002 Bacteria 11501
1151 Ga0307416_100010790 3300032002 Bacteria 6053
1152 Ga0307416_100086559 3300032002 Bacteria 2672
1153 Ga0307416_100102321 3300032002 Bacteria 2497
1154 Ga0307416_100208837 3300032002 Bacteria 1860
1155 Ga0307416_100246439 3300032002 Bacteria 1735
1156 Ga0307416_100380033 3300032002 Bacteria 1442
1157 Ga0307416_100531174 3300032002 Bacteria 1246
1158 Ga0307416_100576432 3300032002 Bacteria 1202
1159 Ga0307416_100606313 3300032002 Bacteria 1175
1160 Ga0307416_100712657 3300032002 Bacteria 1093
1161 Ga0307416_100771578 3300032002 Bacteria 1055
1162 Ga0307416_101097374 3300032002 Bacteria 900
1163 Ga0307416_101751942 3300032002 Bacteria 725
1164 Ga0307416_101844870 3300032002 Bacteria 708
1165 Ga0307416_102323092 3300032002 Bacteria 636
1166 Ga0307414_10002328 3300032004 Bacteria 9923
1167 Ga0307414_10006871 3300032004 Bacteria 6367
1168 Ga0307414_10007116 3300032004 Bacteria 6278
1169 Ga0307414_10008907 3300032004 Bacteria 5731
1170 Ga0307414_10010462 3300032004 Bacteria 5384
1171 Ga0307414_10024082 3300032004 Bacteria 3875
1172 Ga0307414_10105995 3300032004 Bacteria 2126
1173 Ga0307414_10129419 3300032004 Bacteria 1957
1174 Ga0307414_10184543 3300032004 Bacteria 1681
1175 Ga0307414_10378487 3300032004 Bacteria 1223
1176 Ga0307414_10613526 3300032004 Bacteria 977
1177 Ga0307414_11431910 3300032004 Bacteria 642
1178 Ga0307414_11746126 3300032004 Bacteria 580
1179 Ga0307411_10001520 3300032005 Bacteria 9552
1180 Ga0307411_10001702 3300032005 Bacteria 9227
1181 Ga0307411_10006005 3300032005 Bacteria 6034
1182 Ga0307411_10010793 3300032005 Bacteria 4890
1183 Ga0307411_10015612 3300032005 Bacteria 4272
1184 Ga0307411_10026563 3300032005 Bacteria 3487
1185 Ga0307411_10485176 3300032005 Bacteria 1041
1186 Ga0307411_10516503 3300032005 Bacteria 1013
1187 Ga0307411_11119781 3300032005 Bacteria 710
1188 Ga0307411_11464456 3300032005 Bacteria 626
1189 Ga0307411_11505769 3300032005 Bacteria 618
1190 Ga0307411_11992118 3300032005 Bacteria 542
1191 Ga0307411_12251844 3300032005 Bacteria 511
1192 Ga0307415_100012547 3300032126 Bacteria 4904
1193 Ga0307415_100014987 3300032126 Bacteria 4575
1194 Ga0307415_100461041 3300032126 Bacteria 1101
1195 Ga0307415_100742955 3300032126 Bacteria 890
1196 Ga0307415_100929204 3300032126 Bacteria 804
1197 Ga0373959_0026237 3300034820 Bacteria 1150
1198 Ga0373938_0132885 3300034957 Bacteria 650
1199 Ga0373929_0033403 3300035085 Bacteria 1111
1200 Ga0373929_0110729 3300035085 Bacteria 702
1201 Ga0373932_0384512 3300035112 Bacteria 540
1202 Ga0373939_0544239 3300035114 Bacteria 501
1203 Ga0373942_0099642 3300035207 Bacteria 886
1204 Ga0373961_0304910 3300035241 Bacteria 590
1205 Ga0373962_0024104 3300035242 Bacteria 1625
1206 Ga0373931_0054399 3300035691 Bacteria 2139
1207 Ga0373931_0065502 3300035691 Bacteria 1969
1208 Ga0373931_0490898 3300035691 Bacteria 791
1209 Ga0395899_0079177 3300037312 Bacteria 2393
1210 Ga0395899_0116947 3300037312 Bacteria 1912
1211 Ga0395899_0171669 3300037312 Bacteria 1527
1212 Ga0395899_0174573 3300037312 Bacteria 1512
1213 Ga0395899_0285502 3300037312 Bacteria 1121
1214 Ga0395899_0295389 3300037312 Bacteria 1098
1215 Ga0395899_0491389 3300037312 Bacteria 797
1216 Ga0395899_0520463 3300037312 Bacteria 769
1217 Ga0395899_0713983 3300037312 Bacteria 627
1218 Ga0395899_0890547 3300037312 Bacteria 543
1219 Ga0395900_0005528 3300037418 Bacteria 13234
1220 Ga0395900_0017256 3300037418 Bacteria 7367
1221 Ga0395900_0023430 3300037418 Bacteria 6319
1222 Ga0395900_0024977 3300037418 Bacteria 6115
1223 Ga0395900_0046853 3300037418 Bacteria 4451
1224 Ga0395900_0102787 3300037418 Bacteria 2935
1225 Ga0395900_0121687 3300037418 Bacteria 2677
1226 Ga0395900_0176896 3300037418 Bacteria 2170
1227 Ga0395900_0236266 3300037418 Bacteria 1835
1228 Ga0395900_0252276 3300037418 Bacteria 1765
1229 Ga0395900_0267452 3300037418 Bacteria 1705
1230 Ga0395900_0277811 3300037418 Bacteria 1668
1231 Ga0395900_0316968 3300037418 Bacteria 1541
1232 Ga0395900_0405581 3300037418 Bacteria 1326
1233 Ga0395900_0511995 3300037418 Bacteria 1149
1234 Ga0395900_0529378 3300037418 Bacteria 1125
1235 Ga0395900_0833817 3300037418 Bacteria 848
1236 Ga0395900_0911049 3300037418 Bacteria 802
1237 Ga0395900_1069649 3300037418 Bacteria 725
1238 Ga0395900_1226560 3300037418 Bacteria 665
1239 Ga0395900_1498913 3300037418 Bacteria 586
1240 Ga0395900_1892307 3300037418 Bacteria 507
1241 Ga0395898_0037311 3300037466 Bacteria 4822
1242 Ga0395898_0105080 3300037466 Bacteria 2708
1243 Ga0395898_0106663 3300037466 Bacteria 2687
1244 Ga0395898_0225961 3300037466 Bacteria 1785
1245 Ga0395898_0418874 3300037466 Bacteria 1276
1246 Ga0395898_0554735 3300037466 Bacteria 1091
1247 Ga0395898_0991383 3300037466 Bacteria 776
1248 Ga0395905_0000500 3300037471 Bacteria 53853
1249 Ga0395905_0002055 3300037471 Bacteria 22979
1250 Ga0395905_0005143 3300037471 Bacteria 13426
1251 Ga0395905_0013259 3300037471 Bacteria 7906
1252 Ga0395905_0031061 3300037471 Bacteria 5030
1253 Ga0395905_0043361 3300037471 Bacteria 4220
1254 Ga0395905_0088944 3300037471 Bacteria 2894
1255 Ga0395905_0098036 3300037471 Bacteria 2752
1256 Ga0395905_0135174 3300037471 Bacteria 2319
1257 Ga0395905_0165338 3300037471 Bacteria 2079
1258 Ga0395905_0231025 3300037471 Bacteria 1729
1259 Ga0395905_0283815 3300037471 Bacteria 1542
1260 Ga0395905_0402671 3300037471 Bacteria 1263
1261 Ga0395905_0406546 3300037471 Bacteria 1256
1262 Ga0395905_0426613 3300037471 Bacteria 1222
1263 Ga0395905_0678969 3300037471 Bacteria 932
1264 Ga0395905_0701517 3300037471 Bacteria 914
1265 Ga0395905_0856736 3300037471 Bacteria 812
1266 Ga0395905_1079747 3300037471 Bacteria 706
1267 Ga0395901_0000181 3300038443 Bacteria 81816
1268 Ga0395901_0022448 3300038443 Bacteria 6468
1269 Ga0395901_0063228 3300038443 Bacteria 3852
1270 Ga0395901_0246812 3300038443 Bacteria 1861
1271 Ga0395901_0296884 3300038443 Bacteria 1675
1272 Ga0395901_0393462 3300038443 Bacteria 1425
1273 Ga0395901_0446961 3300038443 Bacteria 1322
1274 Ga0395901_0513390 3300038443 Bacteria 1218
1275 Ga0395901_0561561 3300038443 Bacteria 1155
1276 Ga0395901_0582346 3300038443 Bacteria 1130
1277 Ga0395901_0672947 3300038443 Bacteria 1036
1278 Ga0395901_1211334 3300038443 Bacteria 720
1279 Ga0395901_1558123 3300038443 Bacteria 615
1280 Ga0395901_2130677 3300038443 Bacteria 505
1281 Ga0436365_0800730 3300039437 Bacteria 775
1282 Ga0436365_1025078 3300039437 Bacteria 33251
1283 Ga0436363_1052346 3300039450 Bacteria 591
1284 Ga0436362_0376260 3300039453 Bacteria 74620
1285 Ga0436362_1278918 3300039453 Bacteria 907
1286 Ga0451802_1859926 3300041460 Bacteria 788
1287 Ga0451837_1278723 3300041494 Bacteria 2367
1288 Ga0451849_1584927 3300041505 Bacteria 534
1289 Ga0439445_0000195 3300042004 Bacteria 10998
1290 Ga0439445_0193063 3300042004 Bacteria 600
1291 Ga0439432_157005 3300042006 Bacteria 666
1292 Ga0450920_037897 3300042122 Bacteria 958
1293 Ga0450890_034774 3300042127 Bacteria 728
1294 Ga0450904_008362 3300042139 Bacteria 1022
1295 Ga0450905_008711 3300042142 Bacteria 1391
1296 Ga0450889_000026 3300042144 Bacteria 12524
1297 Ga0439446_0171616 3300042156 Bacteria 721
1298 Ga0439464_0008150 3300042439 Bacteria 2747
1299 Ga0439464_0072308 3300042439 Bacteria 1022
1300 Ga0451577_0370266 3300042876 Bacteria 1300
1301 Ga0451577_1467132 3300042876 Bacteria 604
1302 Ga0466969_0001727 3300044656 Bacteria 11674
1303 Ga0466972_0219599 3300044658 Bacteria 889
1304 Ga0466965_0851235 3300044683 Bacteria 530
1305 Ga0466966_0045000 3300044684 Bacteria 2823
1306 Ga0466966_0054338 3300044684 Bacteria 2538
1307 Ga0466966_0116457 3300044684 Bacteria 1645
1308 Ga0466966_0306706 3300044684 Bacteria 954
1309 Ga0466961_0035670 3300044693 Bacteria 3193
1310 Ga0466961_0095871 3300044693 Bacteria 1871
1311 Ga0466961_0138979 3300044693 Bacteria 1521
1312 Ga0466963_0044224 3300044694 Bacteria 2931
1313 Ga0466963_0047053 3300044694 Bacteria 2846
1314 Ga0466963_0089857 3300044694 Bacteria 2090
1315 Ga0466963_0880903 3300044694 Bacteria 631
1316 Ga0466964_0054588 3300044706 Bacteria 1647
1317 Ga0466971_0020418 3300044719 Bacteria 2945
1318 Ga0466971_0251980 3300044719 Bacteria 841
1319 Ga0466968_0032517 3300044735 Bacteria 2170
1320 Ga0466968_0311740 3300044735 Bacteria 758
1321 Ga0466970_0032272 3300044765 Bacteria 2767
1322 Ga0466970_0051723 3300044765 Bacteria 2193
1323 Ga0466970_0106639 3300044765 Bacteria 1528
1324 Ga0466957_0019583 3300044842 Bacteria 3981
1325 Ga0466957_0037997 3300044842 Bacteria 2899
1326 Ga0466957_0092909 3300044842 Bacteria 1893
1327 Ga0466957_0260444 3300044842 Bacteria 1156
1328 Ga0466957_0499067 3300044842 Bacteria 843
1329 Ga0466957_0621521 3300044842 Bacteria 758
1330 Ga0466957_0800070 3300044842 Bacteria 670
1331 Ga0466959_0024051 3300045049 Bacteria 4511
1332 Ga0466959_0068301 3300045049 Bacteria 2575
1333 Ga0466959_0076144 3300045049 Bacteria 2423
1334 Ga0466959_0184898 3300045049 Bacteria 1456
1335 Ga0451576_0000017 3300045051 Bacteria 558261
1336 Ga0451576_1327574 3300045051 Bacteria 749
1337 Ga0466958_0125675 3300045836 Bacteria 1608
1338 Ga0466958_0155521 3300045836 Bacteria 1443
1339 Ga0466958_0715644 3300045836 Bacteria 652
1340 Ga0466967_0102570 3300045976 Bacteria 2617
1341 Ga0466967_0126481 3300045976 Bacteria 2368
1342 Ga0466967_0335837 3300045976 Bacteria 1460
1343 Ga0466967_0510384 3300045976 Bacteria 1181
1344 Ga0466967_1091947 3300045976 Bacteria 795
1345 Ga0466967_1578699 3300045976 Bacteria 653
1346 Ga0466967_1991209 3300045976 Bacteria 577
1347 Ga0466967_2459887 3300045976 Bacteria 516
1348 Ga0495617_010266 3300046452 Bacteria 3206
1349 Ga0495617_010616 3300046452 Bacteria 3154
1350 Ga0495627_013753 3300046453 Bacteria 2841
1351 Ga0495627_025157 3300046453 Bacteria 1932
1352 Ga0495590_0036074 3300046457 Bacteria 1725
1353 Ga0495629_0352914 3300046459 Bacteria 1003
1354 Ga0495638_0068595 3300046460 Bacteria 2174
1355 Ga0495585_0505363 3300046492 Bacteria 574
1356 Ga0495596_0001017 3300046500 Bacteria 16671
1357 Ga0495607_0179086 3300046501 Bacteria 1064
1358 Ga0495583_0018720 3300046506 Bacteria 3639
1359 Ga0495583_0298773 3300046506 Bacteria 640
1360 Ga0495606_0487393 3300046507 Bacteria 625
1361 Ga0495610_0000083 3300046512 Bacteria 112946
1362 Ga0495610_0012788 3300046512 Bacteria 5023
1363 Ga0495610_0178695 3300046512 Bacteria 884
1364 Ga0495632_0000730 3300046519 Bacteria 29768
1365 Ga0495632_0115259 3300046519 Bacteria 1259
1366 Ga0495637_0000836 3300046520 Bacteria 20354
1367 Ga0495643_0000529 3300046522 Bacteria 47569
1368 Ga0495663_0007255 3300046525 Bacteria 3059
1369 Ga0495663_0015380 3300046525 Bacteria 2155
1370 Ga0495663_0390648 3300046525 Bacteria 511
1371 Ga0495654_0003959 3300046530 Bacteria 8932
1372 Ga0495654_0091422 3300046530 Bacteria 1412
1373 Ga0495598_0023824 3300046537 Bacteria 1652
1374 Ga0495621_0071079 3300046539 Bacteria 1282
1375 Ga0495621_0268782 3300046539 Bacteria 700
1376 Ga0495633_0071686 3300046558 Bacteria 1616
1377 Ga0495633_0124253 3300046558 Bacteria 1194
1378 Ga0495633_0163693 3300046558 Bacteria 1026
1379 Ga0495633_0239768 3300046558 Bacteria 828
1380 Ga0495668_0008602 3300046616 Bacteria 6348
1381 Ga0495668_0111600 3300046616 Bacteria 1495
1382 Ga0495668_0418844 3300046616 Bacteria 736
1383 Ga0495611_0051546 3300046648 Bacteria 1855
1384 Ga0495625_0005930 3300046660 Bacteria 10993
1385 Ga0495625_0064175 3300046660 Bacteria 2591
1386 Ga0495625_0127438 3300046660 Bacteria 1727
1387 Ga0495625_0253728 3300046660 Bacteria 1141
1388 Ga0495659_0101748 3300046664 Bacteria 1114
1389 Ga0495669_0000089 3300046684 Bacteria 60373
1390 Ga0495669_0008648 3300046684 Bacteria 4284
1391 Ga0495669_0010286 3300046684 Bacteria 3953
1392 Ga0495669_0020371 3300046684 Bacteria 2869
1393 Ga0495669_0045621 3300046684 Bacteria 1955
1394 Ga0495669_0183643 3300046684 Bacteria 997
1395 Ga0495669_0459097 3300046684 Bacteria 619
1396 Ga0495669_0557769 3300046684 Bacteria 557
1397 Ga0495670_0163845 3300046691 Bacteria 1169
1398 Ga0495670_0173271 3300046691 Bacteria 1137
1399 Ga0495670_0176927 3300046691 Bacteria 1125
1400 Ga0495670_0215970 3300046691 Bacteria 1018
1401 Ga0495671_0005306 3300046692 Bacteria 7562
1402 Ga0495589_0103862 3300046794 Bacteria 1373
1403 Ga0495636_0182038 3300047318 Bacteria 954
1404 Ga0495672_0269554 3300047320 Bacteria 818
1405 Ga0495677_0027213 3300047445 Bacteria 2075
1406 Ga0495677_0054416 3300047445 Bacteria 1476
1407 Ga0495677_0196253 3300047445 Bacteria 784
1408 Ga0495685_096162 3300047447 Bacteria 979
1409 Ga0495685_196185 3300047447 Bacteria 648
1410 Ga0495681_0000279 3300047470 Bacteria 40888
1411 Ga0495686_0026771 3300047472 Bacteria 3772
1412 Ga0495626_0001180 3300048091 Bacteria 21706
1413 Ga0496100_0000774 3300048903 Bacteria 15222
1414 Ga0496100_0012042 3300048903 Bacteria 4945
1415 Ga0496100_1688035 3300048903 Bacteria 501
1416 Ga0496101_0000256 3300048904 Bacteria 37912
1417 Ga0496101_0009833 3300048904 Bacteria 6301
1418 Ga0496101_0436000 3300048904 Bacteria 1033
1419 Ga0496102_0019099 3300048905 Bacteria 6034
1420 Ga0496102_0095370 3300048905 Bacteria 2757
1421 Ga0496102_0416986 3300048905 Bacteria 1261
1422 Ga0496102_0467248 3300048905 Bacteria 1182
1423 Ga0496102_0575392 3300048905 Bacteria 1049
1424 Ga0496103_0006781 3300048906 Bacteria 6833
1425 Ga0496103_0044873 3300048906 Bacteria 2725
1426 Ga0496103_0150287 3300048906 Bacteria 1492
1427 Ga0496104_0816852 3300048907 Bacteria 838
1428 Ga0496105_0041939 3300048908 Bacteria 3772
1429 Ga0496106_0053723 3300048909 Bacteria 3043
1430 Ga0496106_0252532 3300048909 Bacteria 1410
1431 Ga0496106_1080466 3300048909 Bacteria 629
1432 Ga0496107_0001584 3300048910 Bacteria 14147
1433 Ga0496107_0213645 3300048910 Bacteria 1434
1434 Ga0496107_0232874 3300048910 Bacteria 1370
1435 Ga0496107_0682475 3300048910 Bacteria 756
1436 Ga0496107_1060673 3300048910 Bacteria 586
1437 Ga0496108_0001376 3300048911 Bacteria 19132
1438 Ga0496108_0004508 3300048911 Bacteria 11220
1439 Ga0496108_0005703 3300048911 Bacteria 10081
1440 Ga0496108_0077874 3300048911 Bacteria 2805
1441 Ga0496109_0005202 3300048912 Bacteria 10866
1442 Ga0496109_0016785 3300048912 Bacteria 6406
1443 Ga0496109_0022324 3300048912 Bacteria 5604
1444 Ga0496109_0212144 3300048912 Bacteria 1821
1445 Ga0496109_1906989 3300048912 Bacteria 527
1446 Ga0496110_0001683 3300048913 Bacteria 16224
1447 Ga0496110_0005779 3300048913 Bacteria 9722
1448 Ga0496110_0009451 3300048913 Bacteria 7895
1449 Ga0496110_0026844 3300048913 Bacteria 4931
1450 Ga0496110_0149650 3300048913 Bacteria 2113
1451 Ga0496110_0347040 3300048913 Bacteria 1352
1452 Ga0496110_0498378 3300048913 Bacteria 1109
1453 Ga0496111_0000420 3300048914 Bacteria 21379
1454 Ga0496111_0023371 3300048914 Bacteria 4338
1455 Ga0496111_0042371 3300048914 Bacteria 3268
1456 Ga0496111_0045914 3300048914 Bacteria 3144
1457 Ga0496111_0420396 3300048914 Bacteria 987
1458 Ga0496112_0061448 3300048915 Bacteria 3703
1459 Ga0496112_0084881 3300048915 Bacteria 3132
1460 Ga0496112_0301567 3300048915 Bacteria 1547
1461 Ga0496112_0341434 3300048915 Bacteria 1441
1462 Ga0496113_0000242 3300048916 Bacteria 25756
1463 Ga0496113_0044373 3300048916 Bacteria 3293
1464 Ga0496113_0188974 3300048916 Bacteria 1635
1465 Ga0496113_0217111 3300048916 Bacteria 1523
1466 Ga0496113_0546028 3300048916 Bacteria 929
1467 Ga0496114_0000016 3300048917 Bacteria 274656
1468 Ga0496114_0032733 3300048917 Bacteria 4281
1469 Ga0496115_0069416 3300048918 Bacteria 2854
1470 Ga0496116_0023996 3300048919 Bacteria 4524
1471 Ga0496117_0024831 3300048920 Bacteria 4725
1472 Ga0496117_0525201 3300048920 Bacteria 569
1473 Ga0496118_0001805 3300048921 Bacteria 30834
1474 Ga0496118_0097624 3300048921 Bacteria 1998
1475 Ga0496118_0312380 3300048921 Bacteria 857
1476 Ga0496121_0000997 3300048924 Bacteria 50601
1477 Ga0496122_0115718 3300048925 Bacteria 1746
1478 Ga0496122_0286055 3300048925 Bacteria 898
1479 Ga0496123_0302957 3300048926 Bacteria 762
1480 Ga0496124_0066652 3300048927 Bacteria 2997
1481 Ga0496124_0089483 3300048927 Bacteria 2513
1482 Ga0496124_0122572 3300048927 Bacteria 2075
1483 Ga0496124_0269391 3300048927 Bacteria 1248
1484 Ga0496124_0873036 3300048927 Bacteria 549
1485 Ga0496125_0028356 3300048928 Bacteria 5059
1486 Ga0496125_0038468 3300048928 Bacteria 4139
1487 Ga0496126_0252234 3300048929 Bacteria 1470
1488 Ga0495678_049583 3300049459 Bacteria 1631
1489 Ga0495682_0083275 3300049460 Bacteria 1150
1490 Ga0501034_0087683 3300049571 Bacteria 3111
1491 Ga0501034_0299076 3300049571 Bacteria 1546
1492 Ga0501034_1338035 3300049571 Bacteria 592
1493 Ga0501041_1024997 3300049577 Bacteria 531
1494 Ga0501067_0021297 3300049583 Bacteria 3587
1495 Ga0501069_0623809 3300049585 Bacteria 648
1496 Ga0501071_0944067 3300049587 Bacteria 666
1497 Ga0501074_0269000 3300049590 Bacteria 1211
1498 Ga0501223_000706 3300049663 Bacteria 7954
1499 Ga0501223_124403 3300049663 Bacteria 547
1500 Ga0501224_000027 3300049664 Bacteria 53610
1501 Ga0501233_000213 3300049668 Bacteria 8666
1502 Ga0501235_012419 3300049669 Bacteria 1873
1503 Ga0501242_062022 3300049674 Bacteria 570
1504 Ga0501249_013906 3300049679 Bacteria 1713
1505 Ga0501257_014790 3300049686 Bacteria 1800
1506 Ga0501258_013324 3300049687 Bacteria 902
1507 Ga0501225_0000057 3300049705 Bacteria 37809
1508 Ga0501234_001997 3300049707 Bacteria 3225
1509 Ga0501080_0033777 3300049742 Bacteria 4775
1510 Ga0501241_018984 3300049758 Bacteria 1261
1511 Ga0501241_057319 3300049758 Bacteria 777
1512 Ga0501263_011039 3300049760 Bacteria 1117
1513 Ga0501268_005019 3300049765 Bacteria 1885
1514 Ga0501272_026557 3300049769 Bacteria 719
1515 Ga0501044_0131203 3300049823 Bacteria 2500
1516 Ga0501226_000068 3300049853 Bacteria 32699
1517 nmdc:mga05p37_994002_c1 3300050507 Bacteria 892
1518 nmdc:mga08y16_215338_c1 3300050511 Bacteria 1989
1519 nmdc:mga08y16_231553_c1 3300050511 Bacteria 1911
1520 nmdc:mga08x19_1258411_c1 3300050514 Bacteria 524
1521 nmdc:mga0sz30_71784_c1 3300050516 Bacteria 1491
1522 Ga0500643_004345 3300053087 Bacteria 6453
1523 Ga0500643_028450 3300053087 Bacteria 1728
1524 Ga0500643_126397 3300053087 Bacteria 688
1525 Ga0500650_0073511 3300053098 Bacteria 1598
1526 Ga0500650_0471895 3300053098 Bacteria 536
1527 Ga0500556_0000014 3300053104 Bacteria 232989
1528 Ga0500594_0048960 3300053118 Bacteria 1183
1529 Ga0500608_024286 3300053122 Bacteria 2829
1530 Ga0500617_107203 3300053124 Bacteria 1173
1531 Ga0500642_0000001 3300053130 Bacteria 1468402
1532 Ga0500622_0130928 3300053156 Bacteria 1206
1533 Ga0500622_0160636 3300053156 Bacteria 1054
1534 Ga0500624_000101 3300053157 Bacteria 41193
1535 Ga0500627_0000898 3300053158 Bacteria 7977
1536 Ga0500627_0305300 3300053158 Bacteria 694
1537 Ga0500645_000999 3300053730 Bacteria 15949
1538 Ga0587076_205535 3300059645 Bacteria 509
1539 Ga0466962_0019719 3300061719 Bacteria 3240
1540 Ga0466962_0061883 3300061719 Bacteria 1787
1541 Ga0466962_0262286 3300061719 Bacteria 850
1542 Ga0466962_0311338 3300061719 Bacteria 780

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300003203 JGI25406J46586_10242486 JGI25406J46586_102424861 111
2 3300005985 Ga0081539_10206581 Ga0081539_102065812 113
3 3300013297 Ga0157378_10018559 Ga0157378_100185594 113
4 3300005331 Ga0070670_100106148 Ga0070670_1001061482 115
5 3300005355 Ga0070671_100038465 Ga0070671_1000384653 115
6 3300005841 Ga0068863_100278557 Ga0068863_1002785572 115
7 3300026088 Ga0207641_10413712 Ga0207641_104137122 115
8 3300049590 Ga0501074_0269000 Ga0501074_0269000_447_794 115
9 3300049742 Ga0501080_0033777 Ga0501080_0033777_1578_1925 115
10 3300049758 Ga0501241_018984 Ga0501241_018984_700_1050 115
11 3300049823 Ga0501044_0131203 Ga0501044_0131203_218_577 115
12 iso_pu_bacteria 2510917021 2511128375 115
13 iso_pu_bacteria 2896184354 2896186200 115
14 3300005327 Ga0070658_10123775 Ga0070658_101237753 116
15 3300005329 Ga0070683_100629787 Ga0070683_1006297872 116
16 3300005336 Ga0070680_100264296 Ga0070680_1002642963 116
17 3300005339 Ga0070660_100067624 Ga0070660_1000676244 116
18 3300005347 Ga0070668_100875805 Ga0070668_1008758051 116
19 3300005366 Ga0070659_100039475 Ga0070659_1000394754 116
20 3300005367 Ga0070667_100250913 Ga0070667_1002509131 116
21 3300005455 Ga0070663_100090754 Ga0070663_1000907542 116
22 3300005457 Ga0070662_100107279 Ga0070662_1001072793 116
23 3300005564 Ga0070664_100063041 Ga0070664_1000630413 116
24 3300005844 Ga0068862_100045522 Ga0068862_1000455224 116
25 3300009098 Ga0105245_10286795 Ga0105245_102867953 116
26 3300009177 Ga0105248_10019227 Ga0105248_100192277 116
27 3300013100 Ga0157373_10417298 Ga0157373_104172982 116
28 3300013104 Ga0157370_12004036 Ga0157370_120040361 116
29 3300013307 Ga0157372_11619986 Ga0157372_116199862 116
30 3300025917 Ga0207660_10220303 Ga0207660_102203033 116
31 3300025919 Ga0207657_10095041 Ga0207657_100950413 116
32 3300025920 Ga0207649_10283278 Ga0207649_102832781 116
33 3300025931 Ga0207644_10140853 Ga0207644_101408532 116
34 3300025932 Ga0207690_10041541 Ga0207690_100415414 116
35 3300025933 Ga0207706_10072887 Ga0207706_100728873 116
36 3300025941 Ga0207711_10128005 Ga0207711_101280053 116
37 3300025945 Ga0207679_10913322 Ga0207679_109133222 116
38 3300025972 Ga0207668_10000704 Ga0207668_100007047 116
39 3300025986 Ga0207658_10029984 Ga0207658_100299845 116
40 3300026041 Ga0207639_10180103 Ga0207639_101801033 116
41 3300026067 Ga0207678_10007056 Ga0207678_100070564 116
42 3300026116 Ga0207674_10049173 Ga0207674_100491734 116
43 3300028379 Ga0268266_10416978 Ga0268266_104169783 116
44 3300028380 Ga0268265_10102892 Ga0268265_101028923 116
45 3300039450 Ga0436363_1052346 Ga0436363_1052346_60_413 116
46 3300042876 Ga0451577_1467132 Ga0451577_1467132_189_554 116
47 3300044683 Ga0466965_0851235 Ga0466965_0851235_109_462 116
48 3300045051 Ga0451576_0000017 Ga0451576_0000017_126344_126709 116
49 3300046648 Ga0495611_0051546 Ga0495611_0051546_482_835 116
50 3300048920 Ga0496117_0024831 Ga0496117_0024831_1204_1557 116
51 3300048921 Ga0496118_0001805 Ga0496118_0001805_3070_3423 116
52 3300048925 Ga0496122_0115718 Ga0496122_0115718_258_611 116
53 3300048927 Ga0496124_0122572 Ga0496124_0122572_1335_1688 116
54 3300048927 Ga0496124_0873036 Ga0496124_0873036_154_507 116
55 3300049571 Ga0501034_1338035 Ga0501034_1338035_129_479 116
56 3300049663 Ga0501223_124403 Ga0501223_124403_116_469 116
57 3300050507 nmdc:mga05p37_994002_c1 nmdc:mga05p37_994002_c1_497_850 116
58 iso_pu_bacteria 2775507255 2778125470 116
59 3300005333 Ga0070677_10039351 Ga0070677_100393512 117
60 3300005336 Ga0070680_100121271 Ga0070680_1001212714 117
61 3300005344 Ga0070661_100000155 Ga0070661_10000015537 117
62 3300005347 Ga0070668_100004541 Ga0070668_1000045415 117
63 3300005347 Ga0070668_101009684 Ga0070668_1010096842 117
64 3300005366 Ga0070659_101164782 Ga0070659_1011647822 117
65 3300005457 Ga0070662_100001195 Ga0070662_1000011954 117
66 3300005530 Ga0070679_100070254 Ga0070679_1000702544 117
67 3300005539 Ga0068853_100840566 Ga0068853_1008405661 117
68 3300006358 Ga0068871_101543117 Ga0068871_1015431172 117
69 3300006946 Ga0079104_1009362 Ga0079104_10093622 117
70 3300009177 Ga0105248_10001364 Ga0105248_1000136411 117
71 3300013100 Ga0157373_10044097 Ga0157373_100440971 117
72 3300013100 Ga0157373_10969880 Ga0157373_109698802 117
73 3300013306 Ga0163162_11725676 Ga0163162_117256761 117
74 3300013308 Ga0157375_10191240 Ga0157375_101912403 117
75 3300014325 Ga0163163_10096441 Ga0163163_100964413 117
76 3300025893 Ga0207682_10239133 Ga0207682_102391332 117
77 3300025908 Ga0207643_10689194 Ga0207643_106891942 117
78 3300025917 Ga0207660_11263061 Ga0207660_112630612 117
79 3300025920 Ga0207649_10000016 Ga0207649_10000016251 117
80 3300025921 Ga0207652_10039973 Ga0207652_100399734 117
81 3300025932 Ga0207690_11143124 Ga0207690_111431241 117
82 3300025933 Ga0207706_10000299 Ga0207706_1000029953 117
83 3300025937 Ga0207669_10066082 Ga0207669_100660822 117
84 3300025941 Ga0207711_10031506 Ga0207711_100315065 117
85 3300025945 Ga0207679_10187376 Ga0207679_101873761 117
86 3300025972 Ga0207668_10002721 Ga0207668_100027215 117
87 3300025972 Ga0207668_10880332 Ga0207668_108803322 117
88 3300026067 Ga0207678_10040429 Ga0207678_100404292 117
89 3300026067 Ga0207678_10330942 Ga0207678_103309423 117
90 3300027111 Ga0209281_1031254 Ga0209281_10312542 117
91 3300027876 Ga0209974_10119293 Ga0209974_101192932 117
92 3300028380 Ga0268265_10324733 Ga0268265_103247332 117
93 3300031548 Ga0307408_100356372 Ga0307408_1003563722 117
94 3300031548 Ga0307408_100647643 Ga0307408_1006476432 117
95 3300031731 Ga0307405_10077415 Ga0307405_100774152 117
96 3300031731 Ga0307405_10425224 Ga0307405_104252243 117
97 3300031824 Ga0307413_10000171 Ga0307413_1000017121 117
98 3300031824 Ga0307413_10132492 Ga0307413_101324923 117
99 3300031824 Ga0307413_10336377 Ga0307413_103363772 117
100 3300031852 Ga0307410_10002578 Ga0307410_100025788 117
101 3300031852 Ga0307410_10061629 Ga0307410_100616293 117
102 3300031852 Ga0307410_10372687 Ga0307410_103726872 117
103 3300031901 Ga0307406_10874391 Ga0307406_108743911 117
104 3300031903 Ga0307407_10004230 Ga0307407_100042304 117
105 3300031903 Ga0307407_10007478 Ga0307407_100074782 117
106 3300031911 Ga0307412_10342896 Ga0307412_103428963 117
107 3300031911 Ga0307412_10766119 Ga0307412_107661191 117
108 3300031995 Ga0307409_100044516 Ga0307409_1000445164 117
109 3300031995 Ga0307409_100842510 Ga0307409_1008425102 117
110 3300031995 Ga0307409_101396599 Ga0307409_1013965991 117
111 3300032002 Ga0307416_100531174 Ga0307416_1005311743 117
112 3300032004 Ga0307414_10002328 Ga0307414_100023284 117
113 3300032004 Ga0307414_10010462 Ga0307414_100104623 117
114 3300032004 Ga0307414_11746126 Ga0307414_117461261 117
115 3300032005 Ga0307411_10001702 Ga0307411_100017029 117
116 3300032005 Ga0307411_10516503 Ga0307411_105165032 117
117 3300032005 Ga0307411_11119781 Ga0307411_111197812 117
118 3300032126 Ga0307415_100461041 Ga0307415_1004610413 117
119 3300032126 Ga0307415_100742955 Ga0307415_1007429552 117
120 3300042004 Ga0439445_0000195 Ga0439445_0000195_7816_8169 117
121 3300042156 Ga0439446_0171616 Ga0439446_0171616_44_397 117
122 3300046507 Ga0495606_0487393 Ga0495606_0487393_116_469 117
123 3300046684 Ga0495669_0008648 Ga0495669_0008648_548_901 117
124 3300047445 Ga0495677_0054416 Ga0495677_0054416_597_950 117
125 3300048912 Ga0496109_0212144 Ga0496109_0212144_1065_1418 117
126 3300048913 Ga0496110_0005779 Ga0496110_0005779_411_764 117
127 3300048914 Ga0496111_0023371 Ga0496111_0023371_381_734 117
128 3300053087 Ga0500643_126397 Ga0500643_126397_45_401 117
129 3300001989 JGI24739J22299_10006827 JGI24739J22299_100068274 118
130 3300001990 JGI24737J22298_10048317 JGI24737J22298_100483172 118
131 3300002075 JGI24738J21930_10007504 JGI24738J21930_100075043 118
132 3300002459 JGI24751J29686_10098615 JGI24751J29686_100986151 118
133 3300005327 Ga0070658_10000003 Ga0070658_10000003279 118
134 3300005329 Ga0070683_100065348 Ga0070683_1000653485 118
135 3300005331 Ga0070670_100016491 Ga0070670_1000164913 118
136 3300005331 Ga0070670_100120260 Ga0070670_1001202604 118
137 3300005336 Ga0070680_100050345 Ga0070680_1000503453 118
138 3300005339 Ga0070660_100000122 Ga0070660_10000012214 118
139 3300005339 Ga0070660_100051571 Ga0070660_1000515713 118
140 3300005344 Ga0070661_100001389 Ga0070661_10000138918 118
141 3300005354 Ga0070675_101509039 Ga0070675_1015090392 118
142 3300005366 Ga0070659_100002131 Ga0070659_10000213113 118
143 3300005457 Ga0070662_100011103 Ga0070662_1000111033 118
144 3300005457 Ga0070662_100031175 Ga0070662_1000311754 118
145 3300005530 Ga0070679_100007479 Ga0070679_1000074798 118
146 3300005530 Ga0070679_100185679 Ga0070679_1001856792 118
147 3300005535 Ga0070684_100203640 Ga0070684_1002036403 118
148 3300005539 Ga0068853_100007303 Ga0068853_1000073035 118
149 3300005539 Ga0068853_100040907 Ga0068853_1000409073 118
150 3300005539 Ga0068853_100608936 Ga0068853_1006089363 118
151 3300005563 Ga0068855_100069885 Ga0068855_1000698854 118
152 3300005564 Ga0070664_100016187 Ga0070664_1000161878 118
153 3300005577 Ga0068857_100086842 Ga0068857_1000868423 118
154 3300005577 Ga0068857_100498580 Ga0068857_1004985802 118
155 3300005577 Ga0068857_100566735 Ga0068857_1005667352 118
156 3300005578 Ga0068854_100033054 Ga0068854_1000330542 118
157 3300005578 Ga0068854_100053631 Ga0068854_1000536314 118
158 3300005578 Ga0068854_100349089 Ga0068854_1003490892 118
159 3300005614 Ga0068856_100011950 Ga0068856_1000119503 118
160 3300005614 Ga0068856_100253791 Ga0068856_1002537911 118
161 3300005616 Ga0068852_100050804 Ga0068852_1000508043 118
162 3300005618 Ga0068864_100222879 Ga0068864_1002228793 118
163 3300005937 Ga0081455_10000392 Ga0081455_1000039232 118
164 3300006195 Ga0075366_10414760 Ga0075366_104147602 118
165 3300009093 Ga0105240_10724207 Ga0105240_107242072 118
166 3300009174 Ga0105241_10319358 Ga0105241_103193582 118
167 3300009177 Ga0105248_10047334 Ga0105248_100473342 118
168 3300009551 Ga0105238_10476697 Ga0105238_104766971 118
169 3300009551 Ga0105238_12010997 Ga0105238_120109972 118
170 3300009553 Ga0105249_10147326 Ga0105249_101473262 118
171 3300010375 Ga0105239_10204978 Ga0105239_102049783 118
172 3300013100 Ga0157373_10006736 Ga0157373_100067364 118
173 3300013102 Ga0157371_10000785 Ga0157371_1000078519 118
174 3300013102 Ga0157371_10332232 Ga0157371_103322322 118
175 3300013104 Ga0157370_10001694 Ga0157370_1000169412 118
176 3300013105 Ga0157369_10005976 Ga0157369_1000597610 118
177 3300013105 Ga0157369_10012283 Ga0157369_1001228310 118
178 3300013307 Ga0157372_10029102 Ga0157372_100291028 118
179 3300013307 Ga0157372_11682059 Ga0157372_116820592 118
180 3300014325 Ga0163163_12150440 Ga0163163_121504401 118
181 3300021384 Ga0213876_10488376 Ga0213876_104883761 118
182 3300025904 Ga0207647_10212871 Ga0207647_102128713 118
183 3300025904 Ga0207647_10630331 Ga0207647_106303312 118
184 3300025909 Ga0207705_10000005 Ga0207705_10000005281 118
185 3300025909 Ga0207705_10010322 Ga0207705_100103226 118
186 3300025909 Ga0207705_10794045 Ga0207705_107940452 118
187 3300025911 Ga0207654_10367187 Ga0207654_103671872 118
188 3300025912 Ga0207707_10042051 Ga0207707_100420514 118
189 3300025913 Ga0207695_10728573 Ga0207695_107285731 118
190 3300025917 Ga0207660_10097427 Ga0207660_100974273 118
191 3300025917 Ga0207660_10179886 Ga0207660_101798861 118
192 3300025919 Ga0207657_10000156 Ga0207657_1000015652 118
193 3300025919 Ga0207657_10000832 Ga0207657_1000083223 118
194 3300025919 Ga0207657_11235375 Ga0207657_112353752 118
195 3300025920 Ga0207649_10049011 Ga0207649_100490113 118
196 3300025921 Ga0207652_10029192 Ga0207652_100291926 118
197 3300025921 Ga0207652_10063665 Ga0207652_100636653 118
198 3300025921 Ga0207652_10214675 Ga0207652_102146752 118
199 3300025922 Ga0207646_10129915 Ga0207646_101299153 118
200 3300025923 Ga0207681_10037734 Ga0207681_100377345 118
201 3300025925 Ga0207650_10050238 Ga0207650_100502384 118
202 3300025932 Ga0207690_10001554 Ga0207690_1000155414 118
203 3300025932 Ga0207690_10010558 Ga0207690_100105584 118
204 3300025932 Ga0207690_11271356 Ga0207690_112713562 118
205 3300025933 Ga0207706_10001803 Ga0207706_1000180318 118
206 3300025933 Ga0207706_10115718 Ga0207706_101157183 118
207 3300025941 Ga0207711_10155432 Ga0207711_101554322 118
208 3300025944 Ga0207661_10025722 Ga0207661_100257228 118
209 3300025944 Ga0207661_11386545 Ga0207661_113865451 118
210 3300025945 Ga0207679_10050397 Ga0207679_100503973 118
211 3300025949 Ga0207667_10002631 Ga0207667_100026314 118
212 3300025949 Ga0207667_10056598 Ga0207667_100565983 118
213 3300025949 Ga0207667_10533107 Ga0207667_105331073 118
214 3300025961 Ga0207712_10156973 Ga0207712_101569732 118
215 3300025981 Ga0207640_10006942 Ga0207640_100069423 118
216 3300025981 Ga0207640_10035619 Ga0207640_100356192 118
217 3300025981 Ga0207640_10147333 Ga0207640_101473332 118
218 3300026041 Ga0207639_10001184 Ga0207639_100011844 118
219 3300026041 Ga0207639_10004542 Ga0207639_100045428 118
220 3300026041 Ga0207639_10533382 Ga0207639_105333823 118
221 3300026041 Ga0207639_11348653 Ga0207639_113486531 118
222 3300026078 Ga0207702_10111922 Ga0207702_101119223 118
223 3300026078 Ga0207702_10808677 Ga0207702_108086771 118
224 3300026116 Ga0207674_10009464 Ga0207674_100094646 118
225 3300026116 Ga0207674_10073036 Ga0207674_100730362 118
226 3300026116 Ga0207674_10138795 Ga0207674_101387953 118
227 3300026142 Ga0207698_10241713 Ga0207698_102417133 118
228 3300026142 Ga0207698_10568208 Ga0207698_105682082 118
229 3300026142 Ga0207698_11162008 Ga0207698_111620082 118
230 3300031548 Ga0307408_100070719 Ga0307408_1000707192 118
231 3300031548 Ga0307408_100205143 Ga0307408_1002051431 118
232 3300031548 Ga0307408_100533943 Ga0307408_1005339432 118
233 3300031731 Ga0307405_10569470 Ga0307405_105694702 118
234 3300031731 Ga0307405_11049208 Ga0307405_110492081 118
235 3300031731 Ga0307405_11579065 Ga0307405_115790652 118
236 3300031852 Ga0307410_10095855 Ga0307410_100958553 118
237 3300031901 Ga0307406_10106024 Ga0307406_101060243 118
238 3300031901 Ga0307406_10399964 Ga0307406_103999642 118
239 3300031901 Ga0307406_11307370 Ga0307406_113073702 118
240 3300031911 Ga0307412_10000920 Ga0307412_100009208 118
241 3300031911 Ga0307412_10036375 Ga0307412_100363752 118
242 3300031911 Ga0307412_11113001 Ga0307412_111130012 118
243 3300031911 Ga0307412_11372855 Ga0307412_113728551 118
244 3300032002 Ga0307416_100208837 Ga0307416_1002088374 118
245 3300032002 Ga0307416_100380033 Ga0307416_1003800332 118
246 3300032002 Ga0307416_100712657 Ga0307416_1007126572 118
247 3300032002 Ga0307416_101844870 Ga0307416_1018448701 118
248 3300032004 Ga0307414_10007116 Ga0307414_100071167 118
249 3300032004 Ga0307414_10613526 Ga0307414_106135261 118
250 3300032005 Ga0307411_12251844 Ga0307411_122518441 118
251 3300032126 Ga0307415_100929204 Ga0307415_1009292042 118
252 3300039437 Ga0436365_0800730 Ga0436365_0800730_43_402 118
253 3300042876 Ga0451577_0370266 Ga0451577_0370266_846_1208 118
254 3300044735 Ga0466968_0032517 Ga0466968_0032517_1247_1609 118
255 3300044735 Ga0466968_0311740 Ga0466968_0311740_350_712 118
256 3300045051 Ga0451576_1327574 Ga0451576_1327574_92_454 118
257 3300046452 Ga0495617_010266 Ga0495617_010266_1742_2101 118
258 3300046452 Ga0495617_010616 Ga0495617_010616_2614_2973 118
259 3300046453 Ga0495627_013753 Ga0495627_013753_2339_2698 118
260 3300046453 Ga0495627_025157 Ga0495627_025157_739_1098 118
261 3300046457 Ga0495590_0036074 Ga0495590_0036074_237_599 118
262 3300046460 Ga0495638_0068595 Ga0495638_0068595_128_493 118
263 3300046501 Ga0495607_0179086 Ga0495607_0179086_33_392 118
264 3300046506 Ga0495583_0018720 Ga0495583_0018720_1121_1492 118
265 3300046506 Ga0495583_0298773 Ga0495583_0298773_148_510 118
266 3300046512 Ga0495610_0000083 Ga0495610_0000083_63186_63545 118
267 3300046519 Ga0495632_0000730 Ga0495632_0000730_4369_4728 118
268 3300046519 Ga0495632_0115259 Ga0495632_0115259_416_775 118
269 3300046520 Ga0495637_0000836 Ga0495637_0000836_16240_16599 118
270 3300046522 Ga0495643_0000529 Ga0495643_0000529_13225_13596 118
271 3300046525 Ga0495663_0007255 Ga0495663_0007255_2450_2809 118
272 3300046530 Ga0495654_0003959 Ga0495654_0003959_3798_4157 118
273 3300046537 Ga0495598_0023824 Ga0495598_0023824_1067_1423 118
274 3300046558 Ga0495633_0124253 Ga0495633_0124253_636_995 118
275 3300046616 Ga0495668_0008602 Ga0495668_0008602_3458_3817 118
276 3300046660 Ga0495625_0005930 Ga0495625_0005930_1537_1908 118
277 3300046660 Ga0495625_0064175 Ga0495625_0064175_2200_2565 118
278 3300046660 Ga0495625_0127438 Ga0495625_0127438_865_1224 118
279 3300046794 Ga0495589_0103862 Ga0495589_0103862_639_998 118
280 3300047320 Ga0495672_0269554 Ga0495672_0269554_423_782 118
281 3300047470 Ga0495681_0000279 Ga0495681_0000279_32847_33206 118
282 3300048905 Ga0496102_0467248 Ga0496102_0467248_182_541 118
283 3300048912 Ga0496109_1906989 Ga0496109_1906989_126_485 118
284 3300048921 Ga0496118_0097624 Ga0496118_0097624_82_441 118
285 3300049459 Ga0495678_049583 Ga0495678_049583_1190_1549 118
286 3300049571 Ga0501034_0087683 Ga0501034_0087683_124_480 118
287 3300049571 Ga0501034_0299076 Ga0501034_0299076_317_673 118
288 3300049758 Ga0501241_057319 Ga0501241_057319_284_649 118
289 3300053087 Ga0500643_028450 Ga0500643_028450_1337_1702 118
290 3300053098 Ga0500650_0073511 Ga0500650_0073511_376_738 118
291 3300053104 Ga0500556_0000014 Ga0500556_0000014_2239_2601 118
292 3300053122 Ga0500608_024286 Ga0500608_024286_49_411 118
293 3300053124 Ga0500617_107203 Ga0500617_107203_342_707 118
294 3300053130 Ga0500642_0000001 Ga0500642_0000001_634450_634815 118
295 3300053156 Ga0500622_0130928 Ga0500622_0130928_310_669 118
296 3300053156 Ga0500622_0160636 Ga0500622_0160636_358_720 118
297 3300053157 Ga0500624_000101 Ga0500624_000101_1095_1454 118
298 3300053158 Ga0500627_0000898 Ga0500627_0000898_3831_4190 118
299 3300053730 Ga0500645_000999 Ga0500645_000999_9989_10351 118
300 2162886007 SwRhRL2b_contig_121545 SwRhRL2b_0932.00006170 119
301 3300001915 JGI24741J21665_1005952 JGI24741J21665_10059522 119
302 3300001976 JGI24752J21851_1007762 JGI24752J21851_10077623 119
303 3300001976 JGI24752J21851_1013859 JGI24752J21851_10138592 119
304 3300001979 JGI24740J21852_10010639 JGI24740J21852_100106394 119
305 3300001979 JGI24740J21852_10011240 JGI24740J21852_100112404 119
306 3300001979 JGI24740J21852_10042339 JGI24740J21852_100423393 119
307 3300001979 JGI24740J21852_10047255 JGI24740J21852_100472553 119
308 3300001989 JGI24739J22299_10020851 JGI24739J22299_100208513 119
309 3300001989 JGI24739J22299_10028206 JGI24739J22299_100282064 119
310 3300001989 JGI24739J22299_10031542 JGI24739J22299_100315424 119
311 3300001989 JGI24739J22299_10130495 JGI24739J22299_101304952 119
312 3300001990 JGI24737J22298_10000725 JGI24737J22298_1000072511 119
313 3300001990 JGI24737J22298_10026699 JGI24737J22298_100266992 119
314 3300001990 JGI24737J22298_10033549 JGI24737J22298_100335493 119
315 3300001991 JGI24743J22301_10043299 JGI24743J22301_100432991 119
316 3300002067 JGI24735J21928_10005106 JGI24735J21928_100051065 119
317 3300002067 JGI24735J21928_10010334 JGI24735J21928_100103343 119
318 3300002067 JGI24735J21928_10017895 JGI24735J21928_100178952 119
319 3300002067 JGI24735J21928_10021837 JGI24735J21928_100218374 119
320 3300002075 JGI24738J21930_10002169 JGI24738J21930_100021694 119
321 3300002075 JGI24738J21930_10075207 JGI24738J21930_100752072 119
322 3300002076 JGI24749J21850_1003498 JGI24749J21850_10034983 119
323 3300002239 JGI24034J26672_10067221 JGI24034J26672_100672212 119
324 3300002239 JGI24034J26672_10114998 JGI24034J26672_101149981 119
325 3300005289 Ga0065704_10084844 Ga0065704_100848443 119
326 3300005293 Ga0065715_10260297 Ga0065715_102602971 119
327 3300005327 Ga0070658_10002388 Ga0070658_1000238814 119
328 3300005327 Ga0070658_10006789 Ga0070658_1000678913 119
329 3300005327 Ga0070658_10010002 Ga0070658_100100022 119
330 3300005327 Ga0070658_10012293 Ga0070658_100122933 119
331 3300005327 Ga0070658_10013862 Ga0070658_100138624 119
332 3300005327 Ga0070658_10071310 Ga0070658_100713102 119
333 3300005327 Ga0070658_10089528 Ga0070658_100895284 119
334 3300005327 Ga0070658_10122754 Ga0070658_101227543 119
335 3300005327 Ga0070658_10146573 Ga0070658_101465733 119
336 3300005327 Ga0070658_10199044 Ga0070658_101990442 119
337 3300005327 Ga0070658_10227584 Ga0070658_102275842 119
338 3300005327 Ga0070658_10553327 Ga0070658_105533272 119
339 3300005327 Ga0070658_10643867 Ga0070658_106438672 119
340 3300005327 Ga0070658_11277977 Ga0070658_112779771 119
341 3300005328 Ga0070676_10056069 Ga0070676_100560692 119
342 3300005328 Ga0070676_10097844 Ga0070676_100978443 119
343 3300005328 Ga0070676_10214786 Ga0070676_102147863 119
344 3300005328 Ga0070676_10402331 Ga0070676_104023312 119
345 3300005328 Ga0070676_10676257 Ga0070676_106762572 119
346 3300005329 Ga0070683_100002385 Ga0070683_10000238514 119
347 3300005329 Ga0070683_100004410 Ga0070683_1000044103 119
348 3300005329 Ga0070683_100024152 Ga0070683_1000241525 119
349 3300005329 Ga0070683_100174155 Ga0070683_1001741554 119
350 3300005329 Ga0070683_100236677 Ga0070683_1002366772 119
351 3300005329 Ga0070683_101144133 Ga0070683_1011441331 119
352 3300005330 Ga0070690_100004711 Ga0070690_1000047117 119
353 3300005330 Ga0070690_101205367 Ga0070690_1012053671 119
354 3300005331 Ga0070670_100004093 Ga0070670_1000040937 119
355 3300005331 Ga0070670_100010428 Ga0070670_1000104286 119
356 3300005331 Ga0070670_100131589 Ga0070670_1001315891 119
357 3300005331 Ga0070670_100236558 Ga0070670_1002365583 119
358 3300005333 Ga0070677_10013309 Ga0070677_100133093 119
359 3300005333 Ga0070677_10308096 Ga0070677_103080962 119
360 3300005334 Ga0068869_100064347 Ga0068869_1000643473 119
361 3300005334 Ga0068869_100156979 Ga0068869_1001569792 119
362 3300005334 Ga0068869_100195708 Ga0068869_1001957083 119
363 3300005334 Ga0068869_100679179 Ga0068869_1006791791 119
364 3300005335 Ga0070666_10014487 Ga0070666_100144873 119
365 3300005335 Ga0070666_10015349 Ga0070666_100153494 119
366 3300005335 Ga0070666_10115423 Ga0070666_101154233 119
367 3300005335 Ga0070666_10222130 Ga0070666_102221303 119
368 3300005336 Ga0070680_100000958 Ga0070680_10000095824 119
369 3300005336 Ga0070680_100030548 Ga0070680_1000305485 119
370 3300005336 Ga0070680_100128711 Ga0070680_1001287112 119
371 3300005336 Ga0070680_100541438 Ga0070680_1005414382 119
372 3300005336 Ga0070680_100648283 Ga0070680_1006482831 119
373 3300005336 Ga0070680_100845984 Ga0070680_1008459842 119
374 3300005336 Ga0070680_101283894 Ga0070680_1012838941 119
375 3300005337 Ga0070682_100006148 Ga0070682_1000061484 119
376 3300005337 Ga0070682_100021462 Ga0070682_1000214623 119
377 3300005337 Ga0070682_100035542 Ga0070682_1000355424 119
378 3300005338 Ga0068868_100060498 Ga0068868_1000604984 119
379 3300005338 Ga0068868_100178953 Ga0068868_1001789532 119
380 3300005338 Ga0068868_100428962 Ga0068868_1004289623 119
381 3300005338 Ga0068868_100600651 Ga0068868_1006006512 119
382 3300005338 Ga0068868_101069541 Ga0068868_1010695412 119
383 3300005338 Ga0068868_101700796 Ga0068868_1017007961 119
384 3300005339 Ga0070660_100000511 Ga0070660_10000051122 119
385 3300005339 Ga0070660_100001552 Ga0070660_10000155214 119
386 3300005339 Ga0070660_100002966 Ga0070660_1000029662 119
387 3300005339 Ga0070660_100017677 Ga0070660_1000176774 119
388 3300005339 Ga0070660_100108812 Ga0070660_1001088123 119
389 3300005339 Ga0070660_100121414 Ga0070660_1001214143 119
390 3300005339 Ga0070660_100123766 Ga0070660_1001237662 119
391 3300005339 Ga0070660_100136585 Ga0070660_1001365853 119
392 3300005339 Ga0070660_100139168 Ga0070660_1001391682 119
393 3300005339 Ga0070660_100242634 Ga0070660_1002426343 119
394 3300005339 Ga0070660_100284060 Ga0070660_1002840602 119
395 3300005339 Ga0070660_100493391 Ga0070660_1004933912 119
396 3300005339 Ga0070660_100944709 Ga0070660_1009447091 119
397 3300005339 Ga0070660_101544103 Ga0070660_1015441031 119
398 3300005341 Ga0070691_10028952 Ga0070691_100289522 119
399 3300005341 Ga0070691_10803824 Ga0070691_108038241 119
400 3300005343 Ga0070687_100100616 Ga0070687_1001006162 119
401 3300005344 Ga0070661_100000674 Ga0070661_10000067424 119
402 3300005344 Ga0070661_100066619 Ga0070661_1000666193 119
403 3300005344 Ga0070661_100136456 Ga0070661_1001364562 119
404 3300005344 Ga0070661_100235952 Ga0070661_1002359523 119
405 3300005344 Ga0070661_100243539 Ga0070661_1002435393 119
406 3300005344 Ga0070661_100247433 Ga0070661_1002474332 119
407 3300005344 Ga0070661_100282296 Ga0070661_1002822963 119
408 3300005344 Ga0070661_100412327 Ga0070661_1004123271 119
409 3300005344 Ga0070661_100414830 Ga0070661_1004148302 119
410 3300005344 Ga0070661_100419222 Ga0070661_1004192222 119
411 3300005345 Ga0070692_10007183 Ga0070692_100071834 119
412 3300005345 Ga0070692_10076955 Ga0070692_100769552 119
413 3300005347 Ga0070668_100059315 Ga0070668_1000593153 119
414 3300005347 Ga0070668_100409030 Ga0070668_1004090302 119
415 3300005347 Ga0070668_100685448 Ga0070668_1006854482 119
416 3300005347 Ga0070668_101127535 Ga0070668_1011275352 119
417 3300005353 Ga0070669_100016538 Ga0070669_1000165383 119
418 3300005353 Ga0070669_100034942 Ga0070669_1000349423 119
419 3300005353 Ga0070669_100089879 Ga0070669_1000898792 119
420 3300005353 Ga0070669_100099311 Ga0070669_1000993112 119
421 3300005353 Ga0070669_100281490 Ga0070669_1002814903 119
422 3300005353 Ga0070669_100586409 Ga0070669_1005864091 119
423 3300005353 Ga0070669_101251603 Ga0070669_1012516032 119
424 3300005354 Ga0070675_100009019 Ga0070675_1000090197 119
425 3300005354 Ga0070675_100015862 Ga0070675_1000158623 119
426 3300005354 Ga0070675_100030350 Ga0070675_1000303503 119
427 3300005354 Ga0070675_100061581 Ga0070675_1000615813 119
428 3300005354 Ga0070675_100885340 Ga0070675_1008853402 119
429 3300005355 Ga0070671_100000051 Ga0070671_10000005120 119
430 3300005355 Ga0070671_100005658 Ga0070671_1000056583 119
431 3300005355 Ga0070671_100010593 Ga0070671_1000105933 119
432 3300005355 Ga0070671_100023390 Ga0070671_1000233905 119
433 3300005355 Ga0070671_100059547 Ga0070671_1000595474 119
434 3300005355 Ga0070671_100060504 Ga0070671_1000605043 119
435 3300005355 Ga0070671_100061989 Ga0070671_1000619893 119
436 3300005355 Ga0070671_100075750 Ga0070671_1000757503 119
437 3300005355 Ga0070671_100142662 Ga0070671_1001426622 119
438 3300005355 Ga0070671_100313498 Ga0070671_1003134982 119
439 3300005355 Ga0070671_100421357 Ga0070671_1004213573 119
440 3300005356 Ga0070674_100048184 Ga0070674_1000481842 119
441 3300005356 Ga0070674_100090846 Ga0070674_1000908463 119
442 3300005356 Ga0070674_100194112 Ga0070674_1001941123 119
443 3300005364 Ga0070673_100013891 Ga0070673_1000138914 119
444 3300005364 Ga0070673_100016122 Ga0070673_1000161226 119
445 3300005364 Ga0070673_100078110 Ga0070673_1000781103 119
446 3300005364 Ga0070673_100122432 Ga0070673_1001224323 119
447 3300005364 Ga0070673_100339719 Ga0070673_1003397192 119
448 3300005364 Ga0070673_102075544 Ga0070673_1020755441 119
449 3300005366 Ga0070659_100000005 Ga0070659_100000005157 119
450 3300005366 Ga0070659_100002531 Ga0070659_1000025314 119
451 3300005366 Ga0070659_100007798 Ga0070659_1000077983 119
452 3300005366 Ga0070659_100047283 Ga0070659_1000472833 119
453 3300005366 Ga0070659_100117997 Ga0070659_1001179973 119
454 3300005366 Ga0070659_100138163 Ga0070659_1001381632 119
455 3300005366 Ga0070659_100139330 Ga0070659_1001393303 119
456 3300005366 Ga0070659_100145091 Ga0070659_1001450913 119
457 3300005366 Ga0070659_100331117 Ga0070659_1003311173 119
458 3300005366 Ga0070659_100437956 Ga0070659_1004379563 119
459 3300005366 Ga0070659_100507063 Ga0070659_1005070632 119
460 3300005366 Ga0070659_101490564 Ga0070659_1014905641 119
461 3300005367 Ga0070667_100004843 Ga0070667_1000048437 119
462 3300005367 Ga0070667_100018227 Ga0070667_1000182273 119
463 3300005367 Ga0070667_100022426 Ga0070667_1000224261 119
464 3300005367 Ga0070667_100023656 Ga0070667_1000236563 119
465 3300005367 Ga0070667_100047347 Ga0070667_1000473473 119
466 3300005367 Ga0070667_100109274 Ga0070667_1001092742 119
467 3300005367 Ga0070667_100268307 Ga0070667_1002683072 119
468 3300005367 Ga0070667_100322795 Ga0070667_1003227952 119
469 3300005367 Ga0070667_100468995 Ga0070667_1004689952 119
470 3300005367 Ga0070667_101133096 Ga0070667_1011330961 119
471 3300005435 Ga0070714_100056146 Ga0070714_1000561464 119
472 3300005435 Ga0070714_100144450 Ga0070714_1001444503 119
473 3300005435 Ga0070714_100882373 Ga0070714_1008823732 119
474 3300005435 Ga0070714_101952601 Ga0070714_1019526011 119
475 3300005436 Ga0070713_101568755 Ga0070713_1015687551 119
476 3300005440 Ga0070705_100404276 Ga0070705_1004042762 119
477 3300005440 Ga0070705_101218745 Ga0070705_1012187451 119
478 3300005444 Ga0070694_100043437 Ga0070694_1000434372 119
479 3300005455 Ga0070663_100000754 Ga0070663_10000075417 119
480 3300005455 Ga0070663_100017308 Ga0070663_1000173084 119
481 3300005455 Ga0070663_100072370 Ga0070663_1000723702 119
482 3300005455 Ga0070663_100113475 Ga0070663_1001134753 119
483 3300005455 Ga0070663_100150775 Ga0070663_1001507752 119
484 3300005455 Ga0070663_101121099 Ga0070663_1011210992 119
485 3300005455 Ga0070663_101691598 Ga0070663_1016915981 119
486 3300005456 Ga0070678_100003226 Ga0070678_1000032262 119
487 3300005456 Ga0070678_100006559 Ga0070678_1000065597 119
488 3300005456 Ga0070678_100008022 Ga0070678_1000080224 119
489 3300005456 Ga0070678_100152992 Ga0070678_1001529922 119
490 3300005456 Ga0070678_100666419 Ga0070678_1006664192 119
491 3300005457 Ga0070662_100000012 Ga0070662_10000001254 119
492 3300005457 Ga0070662_100003219 Ga0070662_10000321912 119
493 3300005457 Ga0070662_100005921 Ga0070662_1000059214 119
494 3300005457 Ga0070662_100038748 Ga0070662_1000387484 119
495 3300005457 Ga0070662_100076065 Ga0070662_1000760653 119
496 3300005457 Ga0070662_100078627 Ga0070662_1000786273 119
497 3300005457 Ga0070662_100644255 Ga0070662_1006442552 119
498 3300005458 Ga0070681_10030431 Ga0070681_100304313 119
499 3300005458 Ga0070681_10045447 Ga0070681_100454471 119
500 3300005458 Ga0070681_10176040 Ga0070681_101760403 119
501 3300005458 Ga0070681_10249998 Ga0070681_102499982 119
502 3300005459 Ga0068867_100007760 Ga0068867_1000077607 119
503 3300005459 Ga0068867_100012286 Ga0068867_1000122863 119
504 3300005459 Ga0068867_100024893 Ga0068867_1000248933 119
505 3300005459 Ga0068867_100133078 Ga0068867_1001330782 119
506 3300005459 Ga0068867_100569035 Ga0068867_1005690352 119
507 3300005466 Ga0070685_10633358 Ga0070685_106333582 119
508 3300005467 Ga0070706_100725602 Ga0070706_1007256022 119
509 3300005518 Ga0070699_101079877 Ga0070699_1010798771 119
510 3300005530 Ga0070679_100000001 Ga0070679_100000001138 119
511 3300005530 Ga0070679_100151048 Ga0070679_1001510482 119
512 3300005530 Ga0070679_100309175 Ga0070679_1003091752 119
513 3300005530 Ga0070679_100757748 Ga0070679_1007577482 119
514 3300005535 Ga0070684_100220175 Ga0070684_1002201753 119
515 3300005535 Ga0070684_100604714 Ga0070684_1006047142 119
516 3300005536 Ga0070697_101290798 Ga0070697_1012907982 119
517 3300005539 Ga0068853_100000032 Ga0068853_10000003271 119
518 3300005539 Ga0068853_100036300 Ga0068853_1000363004 119
519 3300005539 Ga0068853_100197152 Ga0068853_1001971523 119
520 3300005539 Ga0068853_100400905 Ga0068853_1004009051 119
521 3300005539 Ga0068853_100616975 Ga0068853_1006169752 119
522 3300005539 Ga0068853_102143905 Ga0068853_1021439051 119
523 3300005543 Ga0070672_100003732 Ga0070672_1000037324 119
524 3300005543 Ga0070672_100034628 Ga0070672_1000346284 119
525 3300005543 Ga0070672_100486808 Ga0070672_1004868082 119
526 3300005543 Ga0070672_100663382 Ga0070672_1006633822 119
527 3300005543 Ga0070672_100884069 Ga0070672_1008840692 119
528 3300005543 Ga0070672_101551620 Ga0070672_1015516201 119
529 3300005545 Ga0070695_100066652 Ga0070695_1000666523 119
530 3300005546 Ga0070696_100014446 Ga0070696_1000144462 119
531 3300005546 Ga0070696_100041111 Ga0070696_1000411113 119
532 3300005547 Ga0070693_100010001 Ga0070693_1000100013 119
533 3300005547 Ga0070693_100010933 Ga0070693_1000109335 119
534 3300005547 Ga0070693_100028510 Ga0070693_1000285102 119
535 3300005547 Ga0070693_100028546 Ga0070693_1000285463 119
536 3300005547 Ga0070693_100259115 Ga0070693_1002591153 119
537 3300005547 Ga0070693_101117695 Ga0070693_1011176951 119
538 3300005548 Ga0070665_100042403 Ga0070665_1000424035 119
539 3300005548 Ga0070665_100055724 Ga0070665_1000557243 119
540 3300005548 Ga0070665_100550608 Ga0070665_1005506082 119
541 3300005548 Ga0070665_100777130 Ga0070665_1007771303 119
542 3300005548 Ga0070665_101132116 Ga0070665_1011321162 119
543 3300005548 Ga0070665_101240828 Ga0070665_1012408282 119
544 3300005548 Ga0070665_101891610 Ga0070665_1018916102 119
545 3300005563 Ga0068855_100000591 Ga0068855_10000059127 119
546 3300005563 Ga0068855_100026106 Ga0068855_1000261063 119
547 3300005563 Ga0068855_100044189 Ga0068855_1000441895 119
548 3300005563 Ga0068855_100104982 Ga0068855_1001049824 119
549 3300005563 Ga0068855_100108713 Ga0068855_1001087133 119
550 3300005563 Ga0068855_100315802 Ga0068855_1003158022 119
551 3300005563 Ga0068855_100338044 Ga0068855_1003380444 119
552 3300005563 Ga0068855_100831374 Ga0068855_1008313742 119
553 3300005564 Ga0070664_100000187 Ga0070664_10000018742 119
554 3300005564 Ga0070664_100003691 Ga0070664_1000036914 119
555 3300005564 Ga0070664_100014495 Ga0070664_1000144956 119
556 3300005564 Ga0070664_100026954 Ga0070664_1000269546 119
557 3300005564 Ga0070664_100124949 Ga0070664_1001249493 119
558 3300005564 Ga0070664_100157203 Ga0070664_1001572032 119
559 3300005564 Ga0070664_100231486 Ga0070664_1002314863 119
560 3300005564 Ga0070664_100244720 Ga0070664_1002447203 119
561 3300005564 Ga0070664_100414152 Ga0070664_1004141522 119
562 3300005564 Ga0070664_100466364 Ga0070664_1004663643 119
563 3300005564 Ga0070664_100814300 Ga0070664_1008143002 119
564 3300005564 Ga0070664_100921563 Ga0070664_1009215632 119
565 3300005577 Ga0068857_100011078 Ga0068857_1000110786 119
566 3300005577 Ga0068857_100012932 Ga0068857_1000129328 119
567 3300005577 Ga0068857_100040491 Ga0068857_1000404913 119
568 3300005577 Ga0068857_100124515 Ga0068857_1001245153 119
569 3300005577 Ga0068857_100207602 Ga0068857_1002076022 119
570 3300005577 Ga0068857_101810204 Ga0068857_1018102042 119
571 3300005578 Ga0068854_100002329 Ga0068854_1000023292 119
572 3300005578 Ga0068854_100058080 Ga0068854_1000580803 119
573 3300005578 Ga0068854_100066578 Ga0068854_1000665783 119
574 3300005578 Ga0068854_100461831 Ga0068854_1004618311 119
575 3300005578 Ga0068854_100806321 Ga0068854_1008063212 119
576 3300005578 Ga0068854_100852342 Ga0068854_1008523422 119
577 3300005578 Ga0068854_101211538 Ga0068854_1012115382 119
578 3300005614 Ga0068856_100000291 Ga0068856_10000029151 119
579 3300005614 Ga0068856_100037313 Ga0068856_1000373133 119
580 3300005614 Ga0068856_100039087 Ga0068856_1000390874 119
581 3300005614 Ga0068856_100047342 Ga0068856_1000473425 119
582 3300005614 Ga0068856_100075467 Ga0068856_1000754673 119
583 3300005614 Ga0068856_100087145 Ga0068856_1000871452 119
584 3300005614 Ga0068856_100164644 Ga0068856_1001646443 119
585 3300005614 Ga0068856_100228325 Ga0068856_1002283251 119
586 3300005614 Ga0068856_100277447 Ga0068856_1002774473 119
587 3300005614 Ga0068856_100341105 Ga0068856_1003411051 119
588 3300005616 Ga0068852_100000395 Ga0068852_10000039530 119
589 3300005616 Ga0068852_100014616 Ga0068852_1000146164 119
590 3300005616 Ga0068852_100017959 Ga0068852_1000179596 119
591 3300005616 Ga0068852_100060821 Ga0068852_1000608213 119
592 3300005616 Ga0068852_100086976 Ga0068852_1000869762 119
593 3300005616 Ga0068852_100095204 Ga0068852_1000952043 119
594 3300005616 Ga0068852_100120505 Ga0068852_1001205052 119
595 3300005616 Ga0068852_100143197 Ga0068852_1001431973 119
596 3300005616 Ga0068852_100250618 Ga0068852_1002506183 119
597 3300005616 Ga0068852_100882398 Ga0068852_1008823982 119
598 3300005616 Ga0068852_101905487 Ga0068852_1019054871 119
599 3300005616 Ga0068852_102342976 Ga0068852_1023429762 119
600 3300005617 Ga0068859_100000685 Ga0068859_1000006854 119
601 3300005617 Ga0068859_100009717 Ga0068859_10000971711 119
602 3300005617 Ga0068859_100032301 Ga0068859_1000323017 119
603 3300005617 Ga0068859_100075823 Ga0068859_1000758233 119
604 3300005617 Ga0068859_100187836 Ga0068859_1001878362 119
605 3300005617 Ga0068859_100216981 Ga0068859_1002169812 119
606 3300005617 Ga0068859_100365273 Ga0068859_1003652731 119
607 3300005617 Ga0068859_100797164 Ga0068859_1007971643 119
608 3300005617 Ga0068859_102354761 Ga0068859_1023547612 119
609 3300005618 Ga0068864_100000847 Ga0068864_1000008477 119
610 3300005618 Ga0068864_100012590 Ga0068864_1000125906 119
611 3300005618 Ga0068864_100020538 Ga0068864_1000205387 119
612 3300005618 Ga0068864_100038673 Ga0068864_1000386734 119
613 3300005618 Ga0068864_100039809 Ga0068864_1000398093 119
614 3300005618 Ga0068864_100453914 Ga0068864_1004539142 119
615 3300005718 Ga0068866_10032261 Ga0068866_100322614 119
616 3300005718 Ga0068866_10033649 Ga0068866_100336493 119
617 3300005719 Ga0068861_100568903 Ga0068861_1005689033 119
618 3300005834 Ga0068851_10021868 Ga0068851_100218683 119
619 3300005834 Ga0068851_10034066 Ga0068851_100340664 119
620 3300005834 Ga0068851_10069396 Ga0068851_100693962 119
621 3300005834 Ga0068851_10150033 Ga0068851_101500332 119
622 3300005834 Ga0068851_10151286 Ga0068851_101512863 119
623 3300005834 Ga0068851_10159612 Ga0068851_101596123 119
624 3300005841 Ga0068863_100009665 Ga0068863_1000096656 119
625 3300005841 Ga0068863_100026373 Ga0068863_1000263737 119
626 3300005841 Ga0068863_100037237 Ga0068863_1000372374 119
627 3300005841 Ga0068863_100048549 Ga0068863_1000485496 119
628 3300005841 Ga0068863_100048789 Ga0068863_1000487894 119
629 3300005841 Ga0068863_100149896 Ga0068863_1001498963 119
630 3300005841 Ga0068863_100154479 Ga0068863_1001544792 119
631 3300005842 Ga0068858_100000655 Ga0068858_1000006557 119
632 3300005842 Ga0068858_100006494 Ga0068858_1000064945 119
633 3300005842 Ga0068858_100022867 Ga0068858_1000228676 119
634 3300005842 Ga0068858_100027855 Ga0068858_1000278553 119
635 3300005842 Ga0068858_100037166 Ga0068858_1000371664 119
636 3300005842 Ga0068858_100181873 Ga0068858_1001818733 119
637 3300005842 Ga0068858_100331762 Ga0068858_1003317622 119
638 3300005843 Ga0068860_100066251 Ga0068860_1000662513 119
639 3300005843 Ga0068860_100081612 Ga0068860_1000816124 119
640 3300005843 Ga0068860_100112868 Ga0068860_1001128683 119
641 3300005843 Ga0068860_100167202 Ga0068860_1001672024 119
642 3300005844 Ga0068862_100003662 Ga0068862_1000036623 119
643 3300005844 Ga0068862_100042308 Ga0068862_1000423084 119
644 3300005844 Ga0068862_100056241 Ga0068862_1000562414 119
645 3300005844 Ga0068862_100103999 Ga0068862_1001039994 119
646 3300005844 Ga0068862_100435915 Ga0068862_1004359153 119
647 3300005985 Ga0081539_10012387 Ga0081539_100123878 119
648 3300006028 Ga0070717_11235694 Ga0070717_112356941 119
649 3300006195 Ga0075366_10300596 Ga0075366_103005963 119
650 3300006237 Ga0097621_100013809 Ga0097621_1000138094 119
651 3300006237 Ga0097621_100030354 Ga0097621_1000303544 119
652 3300006237 Ga0097621_100097142 Ga0097621_1000971423 119
653 3300006237 Ga0097621_100172693 Ga0097621_1001726933 119
654 3300006237 Ga0097621_101000936 Ga0097621_1010009362 119
655 3300006237 Ga0097621_101196018 Ga0097621_1011960182 119
656 3300006237 Ga0097621_101639201 Ga0097621_1016392012 119
657 3300006237 Ga0097621_102058604 Ga0097621_1020586042 119
658 3300006358 Ga0068871_100011802 Ga0068871_1000118028 119
659 3300006358 Ga0068871_100019859 Ga0068871_1000198594 119
660 3300006358 Ga0068871_100073340 Ga0068871_1000733404 119
661 3300006358 Ga0068871_100429466 Ga0068871_1004294663 119
662 3300006358 Ga0068871_100499049 Ga0068871_1004990492 119
663 3300006358 Ga0068871_100788857 Ga0068871_1007888572 119
664 3300006844 Ga0075428_102082338 Ga0075428_1020823382 119
665 3300006881 Ga0068865_100071228 Ga0068865_1000712282 119
666 3300006931 Ga0097620_100000685 Ga0097620_10000068529 119
667 3300006931 Ga0097620_100009717 Ga0097620_10000971711 119
668 3300006931 Ga0097620_100032302 Ga0097620_1000323022 119
669 3300006931 Ga0097620_100075824 Ga0097620_1000758243 119
670 3300006931 Ga0097620_100187838 Ga0097620_1001878382 119
671 3300006931 Ga0097620_100216980 Ga0097620_1002169802 119
672 3300006931 Ga0097620_100365287 Ga0097620_1003652871 119
673 3300006931 Ga0097620_100797221 Ga0097620_1007972213 119
674 3300006931 Ga0097620_102354698 Ga0097620_1023546982 119
675 3300009092 Ga0105250_10008687 Ga0105250_100086874 119
676 3300009093 Ga0105240_10059959 Ga0105240_100599593 119
677 3300009093 Ga0105240_10096990 Ga0105240_100969904 119
678 3300009093 Ga0105240_10126571 Ga0105240_101265713 119
679 3300009093 Ga0105240_10641684 Ga0105240_106416843 119
680 3300009094 Ga0111539_10054965 Ga0111539_100549654 119
681 3300009094 Ga0111539_10305768 Ga0111539_103057682 119
682 3300009098 Ga0105245_10013595 Ga0105245_100135953 119
683 3300009147 Ga0114129_11187441 Ga0114129_111874412 119
684 3300009148 Ga0105243_10521820 Ga0105243_105218201 119
685 3300009148 Ga0105243_11160150 Ga0105243_111601502 119
686 3300009148 Ga0105243_11222811 Ga0105243_112228111 119
687 3300009174 Ga0105241_10013377 Ga0105241_100133773 119
688 3300009174 Ga0105241_10406081 Ga0105241_104060812 119
689 3300009174 Ga0105241_10615941 Ga0105241_106159411 119
690 3300009174 Ga0105241_11027947 Ga0105241_110279471 119
691 3300009174 Ga0105241_12529510 Ga0105241_125295102 119
692 3300009176 Ga0105242_10022015 Ga0105242_100220154 119
693 3300009176 Ga0105242_10115602 Ga0105242_101156023 119
694 3300009177 Ga0105248_10000083 Ga0105248_1000008366 119
695 3300009177 Ga0105248_10002811 Ga0105248_100028117 119
696 3300009177 Ga0105248_10011642 Ga0105248_100116427 119
697 3300009177 Ga0105248_10036474 Ga0105248_100364743 119
698 3300009177 Ga0105248_10058400 Ga0105248_100584002 119
699 3300009177 Ga0105248_10095943 Ga0105248_100959434 119
700 3300009177 Ga0105248_10587454 Ga0105248_105874543 119
701 3300009177 Ga0105248_12218952 Ga0105248_122189521 119
702 3300009545 Ga0105237_10036508 Ga0105237_100365085 119
703 3300009545 Ga0105237_10056171 Ga0105237_100561714 119
704 3300009545 Ga0105237_10246047 Ga0105237_102460472 119
705 3300009545 Ga0105237_10935408 Ga0105237_109354082 119
706 3300009551 Ga0105238_10022113 Ga0105238_100221132 119
707 3300009551 Ga0105238_10043379 Ga0105238_100433793 119
708 3300009551 Ga0105238_10047590 Ga0105238_100475905 119
709 3300009551 Ga0105238_10064726 Ga0105238_100647263 119
710 3300009551 Ga0105238_10267660 Ga0105238_102676602 119
711 3300009551 Ga0105238_10515315 Ga0105238_105153153 119
712 3300009553 Ga0105249_10040279 Ga0105249_100402792 119
713 3300009553 Ga0105249_10089432 Ga0105249_100894322 119
714 3300009553 Ga0105249_10498392 Ga0105249_104983923 119
715 3300009553 Ga0105249_10507431 Ga0105249_105074312 119
716 3300010375 Ga0105239_10031979 Ga0105239_100319796 119
717 3300011119 Ga0105246_10168820 Ga0105246_101688202 119
718 3300011119 Ga0105246_10209812 Ga0105246_102098123 119
719 3300013100 Ga0157373_10035314 Ga0157373_100353143 119
720 3300013100 Ga0157373_10038318 Ga0157373_100383183 119
721 3300013100 Ga0157373_10066079 Ga0157373_100660792 119
722 3300013100 Ga0157373_10101919 Ga0157373_101019193 119
723 3300013100 Ga0157373_10113129 Ga0157373_101131292 119
724 3300013100 Ga0157373_10161573 Ga0157373_101615732 119
725 3300013100 Ga0157373_10177613 Ga0157373_101776133 119
726 3300013100 Ga0157373_10975130 Ga0157373_109751302 119
727 3300013100 Ga0157373_11038457 Ga0157373_110384572 119
728 3300013100 Ga0157373_11488734 Ga0157373_114887341 119
729 3300013102 Ga0157371_10005575 Ga0157371_1000557513 119
730 3300013102 Ga0157371_10006691 Ga0157371_100066913 119
731 3300013102 Ga0157371_10075118 Ga0157371_100751184 119
732 3300013102 Ga0157371_10134492 Ga0157371_101344922 119
733 3300013102 Ga0157371_10156983 Ga0157371_101569833 119
734 3300013102 Ga0157371_10268596 Ga0157371_102685963 119
735 3300013102 Ga0157371_10614735 Ga0157371_106147352 119
736 3300013102 Ga0157371_10906623 Ga0157371_109066232 119
737 3300013102 Ga0157371_11605491 Ga0157371_116054911 119
738 3300013104 Ga0157370_10109271 Ga0157370_101092713 119
739 3300013104 Ga0157370_10158100 Ga0157370_101581003 119
740 3300013104 Ga0157370_10201061 Ga0157370_102010613 119
741 3300013104 Ga0157370_10201109 Ga0157370_102011094 119
742 3300013104 Ga0157370_10328849 Ga0157370_103288493 119
743 3300013105 Ga0157369_10018842 Ga0157369_100188428 119
744 3300013105 Ga0157369_10092040 Ga0157369_100920403 119
745 3300013105 Ga0157369_10105650 Ga0157369_101056504 119
746 3300013105 Ga0157369_10121141 Ga0157369_101211415 119
747 3300013105 Ga0157369_10221541 Ga0157369_102215412 119
748 3300013105 Ga0157369_10334469 Ga0157369_103344693 119
749 3300013105 Ga0157369_10337966 Ga0157369_103379662 119
750 3300013105 Ga0157369_10660825 Ga0157369_106608251 119
751 3300013105 Ga0157369_10752581 Ga0157369_107525813 119
752 3300013105 Ga0157369_11772423 Ga0157369_117724232 119
753 3300013296 Ga0157374_10011026 Ga0157374_100110262 119
754 3300013296 Ga0157374_10051583 Ga0157374_100515834 119
755 3300013296 Ga0157374_10070953 Ga0157374_100709533 119
756 3300013296 Ga0157374_10480792 Ga0157374_104807923 119
757 3300013296 Ga0157374_10490380 Ga0157374_104903803 119
758 3300013296 Ga0157374_11673603 Ga0157374_116736031 119
759 3300013297 Ga0157378_10038607 Ga0157378_100386074 119
760 3300013297 Ga0157378_10069268 Ga0157378_100692684 119
761 3300013297 Ga0157378_10280770 Ga0157378_102807703 119
762 3300013306 Ga0163162_10008489 Ga0163162_1000848912 119
763 3300013306 Ga0163162_10009361 Ga0163162_1000936111 119
764 3300013306 Ga0163162_10027725 Ga0163162_100277253 119
765 3300013306 Ga0163162_10053795 Ga0163162_100537954 119
766 3300013306 Ga0163162_10585853 Ga0163162_105858532 119
767 3300013307 Ga0157372_10007664 Ga0157372_1000766414 119
768 3300013307 Ga0157372_10129321 Ga0157372_101293213 119
769 3300013307 Ga0157372_10379538 Ga0157372_103795383 119
770 3300013307 Ga0157372_10509700 Ga0157372_105097003 119
771 3300013308 Ga0157375_10009672 Ga0157375_100096728 119
772 3300013308 Ga0157375_10079159 Ga0157375_100791594 119
773 3300013308 Ga0157375_11045413 Ga0157375_110454132 119
774 3300013308 Ga0157375_11050080 Ga0157375_110500802 119
775 3300013308 Ga0157375_11054366 Ga0157375_110543662 119
776 3300013308 Ga0157375_11102121 Ga0157375_111021212 119
777 3300014325 Ga0163163_10000307 Ga0163163_1000030726 119
778 3300014325 Ga0163163_10001064 Ga0163163_1000106424 119
779 3300014325 Ga0163163_10003869 Ga0163163_100038693 119
780 3300014325 Ga0163163_10017657 Ga0163163_100176573 119
781 3300014325 Ga0163163_10108867 Ga0163163_101088673 119
782 3300014325 Ga0163163_10209337 Ga0163163_102093373 119
783 3300014325 Ga0163163_12807349 Ga0163163_128073492 119
784 3300014326 Ga0157380_10512868 Ga0157380_105128682 119
785 3300014326 Ga0157380_11437355 Ga0157380_114373551 119
786 3300014326 Ga0157380_13495762 Ga0157380_134957622 119
787 3300014497 Ga0182008_10059559 Ga0182008_100595592 119
788 3300014745 Ga0157377_10023993 Ga0157377_100239933 119
789 3300014745 Ga0157377_10291349 Ga0157377_102913492 119
790 3300014968 Ga0157379_10011314 Ga0157379_100113147 119
791 3300014968 Ga0157379_10017522 Ga0157379_100175224 119
792 3300014968 Ga0157379_10035281 Ga0157379_100352813 119
793 3300014968 Ga0157379_10116796 Ga0157379_101167964 119
794 3300014968 Ga0157379_10262250 Ga0157379_102622502 119
795 3300014968 Ga0157379_11674301 Ga0157379_116743011 119
796 3300014969 Ga0157376_10023310 Ga0157376_100233103 119
797 3300017792 Ga0163161_10030144 Ga0163161_100301441 119
798 3300020070 Ga0206356_11100275 Ga0206356_111002751 119
799 3300020081 Ga0206354_10468483 Ga0206354_104684832 119
800 3300020081 Ga0206354_11000346 Ga0206354_110003462 119
801 3300020082 Ga0206353_10450254 Ga0206353_104502541 119
802 3300021358 Ga0213873_10000026 Ga0213873_1000002673 119
803 3300021384 Ga0213876_10000149 Ga0213876_100001493 119
804 3300025229 Ga0209147_101097 Ga0209147_10109710 119
805 3300025315 Ga0207697_10012170 Ga0207697_100121703 119
806 3300025315 Ga0207697_10039440 Ga0207697_100394403 119
807 3300025315 Ga0207697_10051789 Ga0207697_100517893 119
808 3300025315 Ga0207697_10159899 Ga0207697_101598992 119
809 3300025315 Ga0207697_10180997 Ga0207697_101809972 119
810 3300025315 Ga0207697_10185626 Ga0207697_101856262 119
811 3300025321 Ga0207656_10008586 Ga0207656_100085864 119
812 3300025321 Ga0207656_10014077 Ga0207656_100140773 119
813 3300025321 Ga0207656_10015639 Ga0207656_100156393 119
814 3300025321 Ga0207656_10092980 Ga0207656_100929803 119
815 3300025321 Ga0207656_10154202 Ga0207656_101542023 119
816 3300025321 Ga0207656_10364980 Ga0207656_103649802 119
817 3300025711 Ga0207696_1020379 Ga0207696_10203794 119
818 3300025893 Ga0207682_10001448 Ga0207682_100014483 119
819 3300025893 Ga0207682_10204840 Ga0207682_102048402 119
820 3300025899 Ga0207642_10039484 Ga0207642_100394843 119
821 3300025901 Ga0207688_10064945 Ga0207688_100649453 119
822 3300025901 Ga0207688_10087959 Ga0207688_100879593 119
823 3300025901 Ga0207688_10166899 Ga0207688_101668993 119
824 3300025901 Ga0207688_10421776 Ga0207688_104217762 119
825 3300025903 Ga0207680_10092781 Ga0207680_100927812 119
826 3300025903 Ga0207680_10133912 Ga0207680_101339123 119
827 3300025903 Ga0207680_10174584 Ga0207680_101745843 119
828 3300025903 Ga0207680_10739742 Ga0207680_107397422 119
829 3300025904 Ga0207647_10007320 Ga0207647_100073208 119
830 3300025904 Ga0207647_10014010 Ga0207647_100140104 119
831 3300025904 Ga0207647_10014102 Ga0207647_100141023 119
832 3300025904 Ga0207647_10032914 Ga0207647_100329144 119
833 3300025904 Ga0207647_10062117 Ga0207647_100621174 119
834 3300025904 Ga0207647_10091279 Ga0207647_100912793 119
835 3300025907 Ga0207645_10061671 Ga0207645_100616712 119
836 3300025907 Ga0207645_10132562 Ga0207645_101325622 119
837 3300025907 Ga0207645_10269655 Ga0207645_102696552 119
838 3300025907 Ga0207645_10353349 Ga0207645_103533492 119
839 3300025907 Ga0207645_10586242 Ga0207645_105862422 119
840 3300025908 Ga0207643_10339825 Ga0207643_103398252 119
841 3300025909 Ga0207705_10000072 Ga0207705_1000007271 119
842 3300025909 Ga0207705_10014792 Ga0207705_100147926 119
843 3300025909 Ga0207705_10037858 Ga0207705_100378583 119
844 3300025909 Ga0207705_10042434 Ga0207705_100424343 119
845 3300025909 Ga0207705_10053086 Ga0207705_100530863 119
846 3300025909 Ga0207705_10053709 Ga0207705_100537094 119
847 3300025909 Ga0207705_10055414 Ga0207705_100554144 119
848 3300025909 Ga0207705_10056182 Ga0207705_100561824 119
849 3300025909 Ga0207705_10103080 Ga0207705_101030804 119
850 3300025909 Ga0207705_10109429 Ga0207705_101094293 119
851 3300025909 Ga0207705_10132108 Ga0207705_101321083 119
852 3300025909 Ga0207705_10134072 Ga0207705_101340722 119
853 3300025909 Ga0207705_10220929 Ga0207705_102209293 119
854 3300025909 Ga0207705_10380385 Ga0207705_103803853 119
855 3300025909 Ga0207705_10399328 Ga0207705_103993282 119
856 3300025909 Ga0207705_10415304 Ga0207705_104153042 119
857 3300025909 Ga0207705_11142453 Ga0207705_111424532 119
858 3300025909 Ga0207705_11292949 Ga0207705_112929491 119
859 3300025911 Ga0207654_10318538 Ga0207654_103185382 119
860 3300025911 Ga0207654_10763533 Ga0207654_107635332 119
861 3300025911 Ga0207654_11000936 Ga0207654_110009362 119
862 3300025911 Ga0207654_11269289 Ga0207654_112692891 119
863 3300025912 Ga0207707_10026465 Ga0207707_100264653 119
864 3300025912 Ga0207707_10234808 Ga0207707_102348083 119
865 3300025913 Ga0207695_10008696 Ga0207695_100086962 119
866 3300025913 Ga0207695_10022931 Ga0207695_100229319 119
867 3300025913 Ga0207695_10119471 Ga0207695_101194711 119
868 3300025913 Ga0207695_10451916 Ga0207695_104519162 119
869 3300025914 Ga0207671_10637791 Ga0207671_106377912 119
870 3300025914 Ga0207671_10642493 Ga0207671_106424932 119
871 3300025917 Ga0207660_10000438 Ga0207660_1000043821 119
872 3300025917 Ga0207660_10000972 Ga0207660_1000097219 119
873 3300025917 Ga0207660_10040305 Ga0207660_100403052 119
874 3300025917 Ga0207660_10249013 Ga0207660_102490132 119
875 3300025917 Ga0207660_10280053 Ga0207660_102800532 119
876 3300025917 Ga0207660_10288381 Ga0207660_102883812 119
877 3300025917 Ga0207660_11150229 Ga0207660_111502292 119
878 3300025918 Ga0207662_10089629 Ga0207662_100896293 119
879 3300025918 Ga0207662_11040872 Ga0207662_110408722 119
880 3300025919 Ga0207657_10000176 Ga0207657_1000017654 119
881 3300025919 Ga0207657_10000434 Ga0207657_1000043444 119
882 3300025919 Ga0207657_10001735 Ga0207657_1000173522 119
883 3300025919 Ga0207657_10006672 Ga0207657_100066722 119
884 3300025919 Ga0207657_10008822 Ga0207657_100088224 119
885 3300025919 Ga0207657_10014835 Ga0207657_100148359 119
886 3300025919 Ga0207657_10022935 Ga0207657_100229356 119
887 3300025919 Ga0207657_10023453 Ga0207657_100234533 119
888 3300025919 Ga0207657_10027079 Ga0207657_100270793 119
889 3300025919 Ga0207657_10039308 Ga0207657_100393082 119
890 3300025919 Ga0207657_10100863 Ga0207657_101008634 119
891 3300025919 Ga0207657_10111096 Ga0207657_101110963 119
892 3300025919 Ga0207657_10137044 Ga0207657_101370442 119
893 3300025919 Ga0207657_10328487 Ga0207657_103284871 119
894 3300025919 Ga0207657_10349583 Ga0207657_103495833 119
895 3300025919 Ga0207657_10667509 Ga0207657_106675091 119
896 3300025919 Ga0207657_10695177 Ga0207657_106951772 119
897 3300025919 Ga0207657_11410998 Ga0207657_114109981 119
898 3300025920 Ga0207649_10000158 Ga0207649_1000015854 119
899 3300025920 Ga0207649_10006454 Ga0207649_100064546 119
900 3300025920 Ga0207649_10010472 Ga0207649_100104722 119
901 3300025920 Ga0207649_10037336 Ga0207649_100373364 119
902 3300025920 Ga0207649_10133304 Ga0207649_101333043 119
903 3300025920 Ga0207649_10134267 Ga0207649_101342674 119
904 3300025920 Ga0207649_10191608 Ga0207649_101916082 119
905 3300025920 Ga0207649_10237251 Ga0207649_102372511 119
906 3300025920 Ga0207649_10258656 Ga0207649_102586563 119
907 3300025920 Ga0207649_10358224 Ga0207649_103582242 119
908 3300025920 Ga0207649_10408676 Ga0207649_104086762 119
909 3300025920 Ga0207649_10808297 Ga0207649_108082972 119
910 3300025921 Ga0207652_10000002 Ga0207652_10000002699 119
911 3300025921 Ga0207652_10070871 Ga0207652_100708714 119
912 3300025921 Ga0207652_10079314 Ga0207652_100793143 119
913 3300025921 Ga0207652_10559603 Ga0207652_105596032 119
914 3300025921 Ga0207652_10794927 Ga0207652_107949272 119
915 3300025921 Ga0207652_10878951 Ga0207652_108789512 119
916 3300025921 Ga0207652_11405599 Ga0207652_114055992 119
917 3300025923 Ga0207681_10021994 Ga0207681_100219943 119
918 3300025923 Ga0207681_10057474 Ga0207681_100574746 119
919 3300025923 Ga0207681_10088614 Ga0207681_100886142 119
920 3300025923 Ga0207681_10408982 Ga0207681_104089821 119
921 3300025923 Ga0207681_10859533 Ga0207681_108595332 119
922 3300025923 Ga0207681_10948358 Ga0207681_109483582 119
923 3300025923 Ga0207681_10971770 Ga0207681_109717702 119
924 3300025924 Ga0207694_10030113 Ga0207694_100301133 119
925 3300025924 Ga0207694_10105179 Ga0207694_101051793 119
926 3300025924 Ga0207694_10159490 Ga0207694_101594903 119
927 3300025924 Ga0207694_10387824 Ga0207694_103878242 119
928 3300025925 Ga0207650_10001533 Ga0207650_1000153310 119
929 3300025925 Ga0207650_10042351 Ga0207650_100423513 119
930 3300025925 Ga0207650_10078015 Ga0207650_100780153 119
931 3300025925 Ga0207650_10229942 Ga0207650_102299421 119
932 3300025925 Ga0207650_10369629 Ga0207650_103696292 119
933 3300025926 Ga0207659_10004323 Ga0207659_100043234 119
934 3300025926 Ga0207659_10100135 Ga0207659_101001354 119
935 3300025926 Ga0207659_10225636 Ga0207659_102256363 119
936 3300025926 Ga0207659_10427393 Ga0207659_104273932 119
937 3300025926 Ga0207659_10713323 Ga0207659_107133232 119
938 3300025927 Ga0207687_10067528 Ga0207687_100675281 119
939 3300025927 Ga0207687_10136468 Ga0207687_101364683 119
940 3300025929 Ga0207664_10041938 Ga0207664_100419383 119
941 3300025929 Ga0207664_10125950 Ga0207664_101259503 119
942 3300025929 Ga0207664_10312583 Ga0207664_103125832 119
943 3300025931 Ga0207644_10000243 Ga0207644_1000024337 119
944 3300025931 Ga0207644_10003062 Ga0207644_1000306215 119
945 3300025931 Ga0207644_10005874 Ga0207644_100058743 119
946 3300025931 Ga0207644_10013892 Ga0207644_100138925 119
947 3300025931 Ga0207644_10039361 Ga0207644_100393611 119
948 3300025931 Ga0207644_10066054 Ga0207644_100660543 119
949 3300025931 Ga0207644_10147891 Ga0207644_101478914 119
950 3300025932 Ga0207690_10000002 Ga0207690_10000002802 119
951 3300025932 Ga0207690_10000245 Ga0207690_1000024535 119
952 3300025932 Ga0207690_10005651 Ga0207690_100056517 119
953 3300025932 Ga0207690_10008203 Ga0207690_100082033 119
954 3300025932 Ga0207690_10018027 Ga0207690_100180274 119
955 3300025932 Ga0207690_10077147 Ga0207690_100771473 119
956 3300025932 Ga0207690_10205867 Ga0207690_102058672 119
957 3300025932 Ga0207690_10225476 Ga0207690_102254763 119
958 3300025932 Ga0207690_10236651 Ga0207690_102366511 119
959 3300025932 Ga0207690_10246034 Ga0207690_102460343 119
960 3300025932 Ga0207690_10574596 Ga0207690_105745963 119
961 3300025933 Ga0207706_10000041 Ga0207706_1000004172 119
962 3300025933 Ga0207706_10000614 Ga0207706_100006143 119
963 3300025933 Ga0207706_10009249 Ga0207706_100092494 119
964 3300025933 Ga0207706_10012750 Ga0207706_100127506 119
965 3300025933 Ga0207706_10029145 Ga0207706_100291453 119
966 3300025933 Ga0207706_10044628 Ga0207706_100446283 119
967 3300025933 Ga0207706_10095359 Ga0207706_100953593 119
968 3300025933 Ga0207706_10125700 Ga0207706_101257003 119
969 3300025933 Ga0207706_10150264 Ga0207706_101502641 119
970 3300025933 Ga0207706_10305200 Ga0207706_103052003 119
971 3300025933 Ga0207706_10695441 Ga0207706_106954411 119
972 3300025933 Ga0207706_11149092 Ga0207706_111490922 119
973 3300025933 Ga0207706_11268298 Ga0207706_112682982 119
974 3300025934 Ga0207686_10116564 Ga0207686_101165643 119
975 3300025934 Ga0207686_11086529 Ga0207686_110865292 119
976 3300025936 Ga0207670_10977185 Ga0207670_109771851 119
977 3300025937 Ga0207669_10033953 Ga0207669_100339534 119
978 3300025937 Ga0207669_10035772 Ga0207669_100357723 119
979 3300025937 Ga0207669_10132512 Ga0207669_101325123 119
980 3300025937 Ga0207669_10319815 Ga0207669_103198153 119
981 3300025937 Ga0207669_10927083 Ga0207669_109270832 119
982 3300025938 Ga0207704_10022279 Ga0207704_100222793 119
983 3300025940 Ga0207691_10000765 Ga0207691_1000076524 119
984 3300025940 Ga0207691_10008543 Ga0207691_100085437 119
985 3300025940 Ga0207691_10026627 Ga0207691_100266274 119
986 3300025940 Ga0207691_10135850 Ga0207691_101358502 119
987 3300025940 Ga0207691_10350456 Ga0207691_103504563 119
988 3300025940 Ga0207691_11104851 Ga0207691_111048512 119
989 3300025941 Ga0207711_10001243 Ga0207711_1000124325 119
990 3300025941 Ga0207711_10004361 Ga0207711_1000436114 119
991 3300025941 Ga0207711_10009998 Ga0207711_100099988 119
992 3300025941 Ga0207711_10039055 Ga0207711_100390554 119
993 3300025941 Ga0207711_10062568 Ga0207711_100625683 119
994 3300025941 Ga0207711_10110682 Ga0207711_101106824 119
995 3300025941 Ga0207711_10173099 Ga0207711_101730992 119
996 3300025941 Ga0207711_10198552 Ga0207711_101985523 119
997 3300025942 Ga0207689_10019180 Ga0207689_100191802 119
998 3300025942 Ga0207689_10050354 Ga0207689_100503543 119
999 3300025944 Ga0207661_10006910 Ga0207661_100069102 119
1000 3300025944 Ga0207661_10321377 Ga0207661_103213773 119
1001 3300025944 Ga0207661_10515227 Ga0207661_105152272 119
1002 3300025944 Ga0207661_10530837 Ga0207661_105308373 119
1003 3300025944 Ga0207661_10595878 Ga0207661_105958783 119
1004 3300025944 Ga0207661_10712240 Ga0207661_107122402 119
1005 3300025944 Ga0207661_11289405 Ga0207661_112894051 119
1006 3300025945 Ga0207679_10000243 Ga0207679_1000024314 119
1007 3300025945 Ga0207679_10004033 Ga0207679_1000403312 119
1008 3300025945 Ga0207679_10037237 Ga0207679_100372376 119
1009 3300025945 Ga0207679_10043581 Ga0207679_100435813 119
1010 3300025945 Ga0207679_10108555 Ga0207679_101085553 119
1011 3300025945 Ga0207679_10128221 Ga0207679_101282212 119
1012 3300025945 Ga0207679_10183284 Ga0207679_101832843 119
1013 3300025945 Ga0207679_10472738 Ga0207679_104727383 119
1014 3300025945 Ga0207679_10552654 Ga0207679_105526542 119
1015 3300025945 Ga0207679_10767099 Ga0207679_107670992 119
1016 3300025945 Ga0207679_11572655 Ga0207679_115726552 119
1017 3300025949 Ga0207667_10002008 Ga0207667_100020088 119
1018 3300025949 Ga0207667_10007585 Ga0207667_100075859 119
1019 3300025949 Ga0207667_10167647 Ga0207667_101676475 119
1020 3300025949 Ga0207667_10187096 Ga0207667_101870963 119
1021 3300025949 Ga0207667_10253451 Ga0207667_102534512 119
1022 3300025949 Ga0207667_10272508 Ga0207667_102725084 119
1023 3300025949 Ga0207667_10444962 Ga0207667_104449622 119
1024 3300025949 Ga0207667_10456546 Ga0207667_104565463 119
1025 3300025949 Ga0207667_10575269 Ga0207667_105752692 119
1026 3300025949 Ga0207667_10714524 Ga0207667_107145243 119
1027 3300025949 Ga0207667_11428024 Ga0207667_114280242 119
1028 3300025949 Ga0207667_11750035 Ga0207667_117500351 119
1029 3300025960 Ga0207651_10004605 Ga0207651_100046054 119
1030 3300025960 Ga0207651_10007284 Ga0207651_100072847 119
1031 3300025960 Ga0207651_10039183 Ga0207651_100391833 119
1032 3300025960 Ga0207651_10053889 Ga0207651_100538894 119
1033 3300025960 Ga0207651_10136105 Ga0207651_101361053 119
1034 3300025960 Ga0207651_10241452 Ga0207651_102414522 119
1035 3300025960 Ga0207651_11114672 Ga0207651_111146722 119
1036 3300025961 Ga0207712_10039903 Ga0207712_100399032 119
1037 3300025961 Ga0207712_10189774 Ga0207712_101897742 119
1038 3300025972 Ga0207668_10034340 Ga0207668_100343403 119
1039 3300025972 Ga0207668_10041566 Ga0207668_100415663 119
1040 3300025972 Ga0207668_10066229 Ga0207668_100662292 119
1041 3300025972 Ga0207668_10066683 Ga0207668_100666833 119
1042 3300025972 Ga0207668_10159121 Ga0207668_101591213 119
1043 3300025972 Ga0207668_10194079 Ga0207668_101940792 119
1044 3300025972 Ga0207668_10290590 Ga0207668_102905903 119
1045 3300025972 Ga0207668_10594843 Ga0207668_105948432 119
1046 3300025972 Ga0207668_10734230 Ga0207668_107342301 119
1047 3300025972 Ga0207668_11090944 Ga0207668_110909442 119
1048 3300025972 Ga0207668_11188825 Ga0207668_111888251 119
1049 3300025981 Ga0207640_10010452 Ga0207640_100104524 119
1050 3300025981 Ga0207640_10070002 Ga0207640_100700023 119
1051 3300025981 Ga0207640_10109389 Ga0207640_101093893 119
1052 3300025981 Ga0207640_10123546 Ga0207640_101235463 119
1053 3300025981 Ga0207640_10144294 Ga0207640_101442943 119
1054 3300025981 Ga0207640_10177882 Ga0207640_101778823 119
1055 3300025981 Ga0207640_10180084 Ga0207640_101800843 119
1056 3300025981 Ga0207640_10417352 Ga0207640_104173523 119
1057 3300025981 Ga0207640_10941777 Ga0207640_109417772 119
1058 3300025981 Ga0207640_10967998 Ga0207640_109679982 119
1059 3300025986 Ga0207658_10008745 Ga0207658_100087457 119
1060 3300025986 Ga0207658_10010095 Ga0207658_100100955 119
1061 3300025986 Ga0207658_10010272 Ga0207658_100102724 119
1062 3300025986 Ga0207658_10012485 Ga0207658_100124853 119
1063 3300025986 Ga0207658_10022779 Ga0207658_100227793 119
1064 3300025986 Ga0207658_10157388 Ga0207658_101573882 119
1065 3300025986 Ga0207658_10210966 Ga0207658_102109663 119
1066 3300025986 Ga0207658_10623316 Ga0207658_106233161 119
1067 3300026023 Ga0207677_10000529 Ga0207677_100005293 119
1068 3300026023 Ga0207677_10109180 Ga0207677_101091802 119
1069 3300026023 Ga0207677_10219322 Ga0207677_102193223 119
1070 3300026023 Ga0207677_10272603 Ga0207677_102726033 119
1071 3300026023 Ga0207677_10324075 Ga0207677_103240752 119
1072 3300026023 Ga0207677_10467951 Ga0207677_104679513 119
1073 3300026023 Ga0207677_10562093 Ga0207677_105620932 119
1074 3300026023 Ga0207677_11032086 Ga0207677_110320861 119
1075 3300026035 Ga0207703_10012417 Ga0207703_100124173 119
1076 3300026035 Ga0207703_10014764 Ga0207703_100147647 119
1077 3300026035 Ga0207703_10015617 Ga0207703_100156177 119
1078 3300026035 Ga0207703_10112765 Ga0207703_101127654 119
1079 3300026035 Ga0207703_10251054 Ga0207703_102510542 119
1080 3300026035 Ga0207703_10478489 Ga0207703_104784893 119
1081 3300026041 Ga0207639_10000074 Ga0207639_1000007462 119
1082 3300026041 Ga0207639_10000850 Ga0207639_1000085010 119
1083 3300026041 Ga0207639_10006339 Ga0207639_100063394 119
1084 3300026041 Ga0207639_10110332 Ga0207639_101103322 119
1085 3300026041 Ga0207639_10167706 Ga0207639_101677062 119
1086 3300026041 Ga0207639_10319993 Ga0207639_103199933 119
1087 3300026041 Ga0207639_10330178 Ga0207639_103301783 119
1088 3300026041 Ga0207639_10437170 Ga0207639_104371703 119
1089 3300026041 Ga0207639_10558906 Ga0207639_105589063 119
1090 3300026041 Ga0207639_10824661 Ga0207639_108246612 119
1091 3300026041 Ga0207639_11728536 Ga0207639_117285361 119
1092 3300026067 Ga0207678_10007788 Ga0207678_100077886 119
1093 3300026067 Ga0207678_10012837 Ga0207678_100128373 119
1094 3300026067 Ga0207678_10016026 Ga0207678_100160266 119
1095 3300026067 Ga0207678_10042935 Ga0207678_100429353 119
1096 3300026067 Ga0207678_10097907 Ga0207678_100979073 119
1097 3300026067 Ga0207678_10149292 Ga0207678_101492923 119
1098 3300026067 Ga0207678_10184195 Ga0207678_101841953 119
1099 3300026078 Ga0207702_10000074 Ga0207702_100000748 119
1100 3300026078 Ga0207702_10004609 Ga0207702_1000460916 119
1101 3300026078 Ga0207702_10030325 Ga0207702_100303254 119
1102 3300026078 Ga0207702_10033258 Ga0207702_100332583 119
1103 3300026078 Ga0207702_10091866 Ga0207702_100918663 119
1104 3300026078 Ga0207702_10147162 Ga0207702_101471622 119
1105 3300026078 Ga0207702_10152516 Ga0207702_101525163 119
1106 3300026078 Ga0207702_10210354 Ga0207702_102103543 119
1107 3300026078 Ga0207702_10885324 Ga0207702_108853242 119
1108 3300026078 Ga0207702_11726740 Ga0207702_117267402 119
1109 3300026088 Ga0207641_10000502 Ga0207641_1000050223 119
1110 3300026088 Ga0207641_10027657 Ga0207641_100276574 119
1111 3300026088 Ga0207641_10084618 Ga0207641_100846182 119
1112 3300026088 Ga0207641_10104078 Ga0207641_101040784 119
1113 3300026088 Ga0207641_10126635 Ga0207641_101266352 119
1114 3300026088 Ga0207641_10325003 Ga0207641_103250033 119
1115 3300026088 Ga0207641_10593662 Ga0207641_105936623 119
1116 3300026088 Ga0207641_10608571 Ga0207641_106085711 119
1117 3300026088 Ga0207641_10909883 Ga0207641_109098832 119
1118 3300026089 Ga0207648_10008755 Ga0207648_100087555 119
1119 3300026089 Ga0207648_10011459 Ga0207648_100114598 119
1120 3300026089 Ga0207648_10015863 Ga0207648_100158637 119
1121 3300026089 Ga0207648_10068610 Ga0207648_100686102 119
1122 3300026089 Ga0207648_10206529 Ga0207648_102065292 119
1123 3300026089 Ga0207648_10566111 Ga0207648_105661112 119
1124 3300026095 Ga0207676_10000694 Ga0207676_1000069429 119
1125 3300026095 Ga0207676_10002166 Ga0207676_100021664 119
1126 3300026095 Ga0207676_10011661 Ga0207676_100116618 119
1127 3300026095 Ga0207676_10045412 Ga0207676_100454123 119
1128 3300026095 Ga0207676_10454236 Ga0207676_104542361 119
1129 3300026095 Ga0207676_11441305 Ga0207676_114413052 119
1130 3300026095 Ga0207676_11507555 Ga0207676_115075551 119
1131 3300026095 Ga0207676_11568361 Ga0207676_115683612 119
1132 3300026095 Ga0207676_11720448 Ga0207676_117204482 119
1133 3300026116 Ga0207674_10001687 Ga0207674_1000168715 119
1134 3300026116 Ga0207674_10002589 Ga0207674_100025895 119
1135 3300026116 Ga0207674_10005845 Ga0207674_1000584514 119
1136 3300026116 Ga0207674_10029572 Ga0207674_100295727 119
1137 3300026116 Ga0207674_10031516 Ga0207674_100315165 119
1138 3300026116 Ga0207674_10045876 Ga0207674_100458767 119
1139 3300026116 Ga0207674_10289515 Ga0207674_102895152 119
1140 3300026116 Ga0207674_11392015 Ga0207674_113920151 119
1141 3300026116 Ga0207674_11984069 Ga0207674_119840692 119
1142 3300026118 Ga0207675_100088082 Ga0207675_1000880823 119
1143 3300026121 Ga0207683_10000846 Ga0207683_1000084627 119
1144 3300026121 Ga0207683_10003293 Ga0207683_100032936 119
1145 3300026121 Ga0207683_10004238 Ga0207683_100042385 119
1146 3300026121 Ga0207683_10005095 Ga0207683_1000509512 119
1147 3300026121 Ga0207683_10188073 Ga0207683_101880732 119
1148 3300026121 Ga0207683_10558819 Ga0207683_105588193 119
1149 3300026142 Ga0207698_10003349 Ga0207698_100033491 119
1150 3300026142 Ga0207698_10005133 Ga0207698_100051339 119
1151 3300026142 Ga0207698_10012096 Ga0207698_100120964 119
1152 3300026142 Ga0207698_10042442 Ga0207698_100424424 119
1153 3300026142 Ga0207698_10067653 Ga0207698_100676532 119
1154 3300026142 Ga0207698_10083046 Ga0207698_100830463 119
1155 3300026142 Ga0207698_10098838 Ga0207698_100988383 119
1156 3300026142 Ga0207698_10276171 Ga0207698_102761711 119
1157 3300026142 Ga0207698_10360641 Ga0207698_103606411 119
1158 3300026142 Ga0207698_10727760 Ga0207698_107277602 119
1159 3300026142 Ga0207698_12173106 Ga0207698_121731062 119
1160 3300027364 Ga0209967_1042469 Ga0209967_10424691 119
1161 3300027614 Ga0209970_1020228 Ga0209970_10202282 119
1162 3300027907 Ga0207428_10176052 Ga0207428_101760522 119
1163 3300028379 Ga0268266_10012072 Ga0268266_100120725 119
1164 3300028379 Ga0268266_10012623 Ga0268266_100126235 119
1165 3300028379 Ga0268266_10032066 Ga0268266_100320664 119
1166 3300028379 Ga0268266_10085215 Ga0268266_100852154 119
1167 3300028379 Ga0268266_10307181 Ga0268266_103071811 119
1168 3300028379 Ga0268266_10562702 Ga0268266_105627022 119
1169 3300028379 Ga0268266_10570947 Ga0268266_105709473 119
1170 3300028379 Ga0268266_11298270 Ga0268266_112982702 119
1171 3300028379 Ga0268266_11417181 Ga0268266_114171812 119
1172 3300028379 Ga0268266_12382684 Ga0268266_123826841 119
1173 3300028380 Ga0268265_10003659 Ga0268265_1000365912 119
1174 3300028380 Ga0268265_10011100 Ga0268265_100111005 119
1175 3300028380 Ga0268265_10018499 Ga0268265_100184997 119
1176 3300028380 Ga0268265_10046757 Ga0268265_100467572 119
1177 3300028380 Ga0268265_10247232 Ga0268265_102472322 119
1178 3300028380 Ga0268265_10630034 Ga0268265_106300343 119
1179 3300028381 Ga0268264_10000410 Ga0268264_1000041035 119
1180 3300028381 Ga0268264_10000418 Ga0268264_1000041829 119
1181 3300028381 Ga0268264_10070538 Ga0268264_100705383 119
1182 3300028381 Ga0268264_10199932 Ga0268264_101999322 119
1183 3300028381 Ga0268264_10420368 Ga0268264_104203681 119
1184 3300028381 Ga0268264_10652944 Ga0268264_106529443 119
1185 3300030731 Ga0316177_1154915 Ga0316177_11549153 119
1186 3300030745 Ga0316182_1092649 Ga0316182_10926491 119
1187 3300031548 Ga0307408_100001159 Ga0307408_10000115911 119
1188 3300031548 Ga0307408_100094196 Ga0307408_1000941962 119
1189 3300031548 Ga0307408_100122210 Ga0307408_1001222103 119
1190 3300031548 Ga0307408_100525978 Ga0307408_1005259783 119
1191 3300031548 Ga0307408_100894390 Ga0307408_1008943901 119
1192 3300031731 Ga0307405_10000240 Ga0307405_1000024014 119
1193 3300031731 Ga0307405_10200219 Ga0307405_102002191 119
1194 3300031731 Ga0307405_10272613 Ga0307405_102726132 119
1195 3300031731 Ga0307405_10282073 Ga0307405_102820732 119
1196 3300031731 Ga0307405_10288778 Ga0307405_102887781 119
1197 3300031731 Ga0307405_10504487 Ga0307405_105044873 119
1198 3300031731 Ga0307405_10522425 Ga0307405_105224252 119
1199 3300031731 Ga0307405_10679536 Ga0307405_106795362 119
1200 3300031731 Ga0307405_11518406 Ga0307405_115184061 119
1201 3300031824 Ga0307413_10000456 Ga0307413_1000045614 119
1202 3300031824 Ga0307413_10000616 Ga0307413_100006169 119
1203 3300031824 Ga0307413_10002633 Ga0307413_100026338 119
1204 3300031824 Ga0307413_10057194 Ga0307413_100571943 119
1205 3300031824 Ga0307413_10158825 Ga0307413_101588252 119
1206 3300031824 Ga0307413_10259832 Ga0307413_102598323 119
1207 3300031824 Ga0307413_10311972 Ga0307413_103119722 119
1208 3300031824 Ga0307413_10455385 Ga0307413_104553852 119
1209 3300031824 Ga0307413_11849956 Ga0307413_118499562 119
1210 3300031852 Ga0307410_10000393 Ga0307410_100003938 119
1211 3300031852 Ga0307410_10006997 Ga0307410_100069974 119
1212 3300031852 Ga0307410_10029803 Ga0307410_100298032 119
1213 3300031852 Ga0307410_10167664 Ga0307410_101676642 119
1214 3300031852 Ga0307410_10403784 Ga0307410_104037841 119
1215 3300031852 Ga0307410_10623002 Ga0307410_106230022 119
1216 3300031901 Ga0307406_10011286 Ga0307406_100112866 119
1217 3300031901 Ga0307406_10039192 Ga0307406_100391924 119
1218 3300031901 Ga0307406_10090168 Ga0307406_100901683 119
1219 3300031901 Ga0307406_10167231 Ga0307406_101672313 119
1220 3300031901 Ga0307406_10225324 Ga0307406_102253242 119
1221 3300031901 Ga0307406_10454337 Ga0307406_104543373 119
1222 3300031901 Ga0307406_10462780 Ga0307406_104627802 119
1223 3300031901 Ga0307406_11277197 Ga0307406_112771971 119
1224 3300031903 Ga0307407_10000541 Ga0307407_1000054113 119
1225 3300031903 Ga0307407_10007325 Ga0307407_100073254 119
1226 3300031903 Ga0307407_10017174 Ga0307407_100171745 119
1227 3300031903 Ga0307407_10019151 Ga0307407_100191514 119
1228 3300031903 Ga0307407_10330013 Ga0307407_103300132 119
1229 3300031903 Ga0307407_10759949 Ga0307407_107599492 119
1230 3300031903 Ga0307407_11581411 Ga0307407_115814112 119
1231 3300031911 Ga0307412_10000248 Ga0307412_1000024813 119
1232 3300031911 Ga0307412_10073640 Ga0307412_100736403 119
1233 3300031911 Ga0307412_10180953 Ga0307412_101809532 119
1234 3300031911 Ga0307412_10489124 Ga0307412_104891242 119
1235 3300031911 Ga0307412_10572932 Ga0307412_105729322 119
1236 3300031995 Ga0307409_100000418 Ga0307409_1000004185 119
1237 3300031995 Ga0307409_100004995 Ga0307409_1000049958 119
1238 3300031995 Ga0307409_100006369 Ga0307409_1000063694 119
1239 3300031995 Ga0307409_100089672 Ga0307409_1000896723 119
1240 3300031995 Ga0307409_100507706 Ga0307409_1005077063 119
1241 3300031995 Ga0307409_100923504 Ga0307409_1009235041 119
1242 3300031995 Ga0307409_101377052 Ga0307409_1013770522 119
1243 3300031995 Ga0307409_102390185 Ga0307409_1023901852 119
1244 3300032002 Ga0307416_100001974 Ga0307416_1000019745 119
1245 3300032002 Ga0307416_100010790 Ga0307416_1000107907 119
1246 3300032002 Ga0307416_100086559 Ga0307416_1000865594 119
1247 3300032002 Ga0307416_100102321 Ga0307416_1001023211 119
1248 3300032002 Ga0307416_100246439 Ga0307416_1002464393 119
1249 3300032002 Ga0307416_100576432 Ga0307416_1005764322 119
1250 3300032002 Ga0307416_100606313 Ga0307416_1006063132 119
1251 3300032002 Ga0307416_100771578 Ga0307416_1007715782 119
1252 3300032002 Ga0307416_101097374 Ga0307416_1010973741 119
1253 3300032002 Ga0307416_101751942 Ga0307416_1017519421 119
1254 3300032002 Ga0307416_102323092 Ga0307416_1023230921 119
1255 3300032004 Ga0307414_10006871 Ga0307414_100068715 119
1256 3300032004 Ga0307414_10008907 Ga0307414_100089077 119
1257 3300032004 Ga0307414_10024082 Ga0307414_100240824 119
1258 3300032004 Ga0307414_10105995 Ga0307414_101059954 119
1259 3300032004 Ga0307414_10129419 Ga0307414_101294193 119
1260 3300032004 Ga0307414_10184543 Ga0307414_101845433 119
1261 3300032004 Ga0307414_10378487 Ga0307414_103784872 119
1262 3300032004 Ga0307414_11431910 Ga0307414_114319102 119
1263 3300032005 Ga0307411_10001520 Ga0307411_100015209 119
1264 3300032005 Ga0307411_10006005 Ga0307411_100060055 119
1265 3300032005 Ga0307411_10010793 Ga0307411_100107934 119
1266 3300032005 Ga0307411_10015612 Ga0307411_100156123 119
1267 3300032005 Ga0307411_10026563 Ga0307411_100265633 119
1268 3300032005 Ga0307411_10485176 Ga0307411_104851762 119
1269 3300032005 Ga0307411_11464456 Ga0307411_114644562 119
1270 3300032005 Ga0307411_11505769 Ga0307411_115057692 119
1271 3300032005 Ga0307411_11992118 Ga0307411_119921181 119
1272 3300032126 Ga0307415_100012547 Ga0307415_1000125473 119
1273 3300032126 Ga0307415_100014987 Ga0307415_1000149874 119
1274 3300034820 Ga0373959_0026237 Ga0373959_0026237_755_1114 119
1275 3300034957 Ga0373938_0132885 Ga0373938_0132885_204_563 119
1276 3300035085 Ga0373929_0033403 Ga0373929_0033403_700_1059 119
1277 3300035085 Ga0373929_0110729 Ga0373929_0110729_268_627 119
1278 3300035112 Ga0373932_0384512 Ga0373932_0384512_138_497 119
1279 3300035114 Ga0373939_0544239 Ga0373939_0544239_14_373 119
1280 3300035207 Ga0373942_0099642 Ga0373942_0099642_211_570 119
1281 3300035241 Ga0373961_0304910 Ga0373961_0304910_103_462 119
1282 3300035242 Ga0373962_0024104 Ga0373962_0024104_662_1021 119
1283 3300035691 Ga0373931_0054399 Ga0373931_0054399_1604_1963 119
1284 3300035691 Ga0373931_0065502 Ga0373931_0065502_547_906 119
1285 3300035691 Ga0373931_0490898 Ga0373931_0490898_80_439 119
1286 3300037312 Ga0395899_0079177 Ga0395899_0079177_1999_2358 119
1287 3300037312 Ga0395899_0116947 Ga0395899_0116947_156_515 119
1288 3300037312 Ga0395899_0171669 Ga0395899_0171669_228_587 119
1289 3300037312 Ga0395899_0174573 Ga0395899_0174573_1133_1492 119
1290 3300037312 Ga0395899_0285502 Ga0395899_0285502_66_425 119
1291 3300037312 Ga0395899_0295389 Ga0395899_0295389_110_469 119
1292 3300037312 Ga0395899_0491389 Ga0395899_0491389_411_770 119
1293 3300037312 Ga0395899_0520463 Ga0395899_0520463_63_422 119
1294 3300037312 Ga0395899_0713983 Ga0395899_0713983_34_393 119
1295 3300037312 Ga0395899_0890547 Ga0395899_0890547_31_390 119
1296 3300037418 Ga0395900_0005528 Ga0395900_0005528_10723_11082 119
1297 3300037418 Ga0395900_0017256 Ga0395900_0017256_2400_2759 119
1298 3300037418 Ga0395900_0023430 Ga0395900_0023430_901_1260 119
1299 3300037418 Ga0395900_0024977 Ga0395900_0024977_5238_5597 119
1300 3300037418 Ga0395900_0046853 Ga0395900_0046853_3237_3596 119
1301 3300037418 Ga0395900_0102787 Ga0395900_0102787_543_902 119
1302 3300037418 Ga0395900_0121687 Ga0395900_0121687_1341_1700 119
1303 3300037418 Ga0395900_0176896 Ga0395900_0176896_1099_1458 119
1304 3300037418 Ga0395900_0236266 Ga0395900_0236266_1456_1815 119
1305 3300037418 Ga0395900_0252276 Ga0395900_0252276_849_1208 119
1306 3300037418 Ga0395900_0267452 Ga0395900_0267452_573_932 119
1307 3300037418 Ga0395900_0277811 Ga0395900_0277811_102_461 119
1308 3300037418 Ga0395900_0316968 Ga0395900_0316968_66_449 119
1309 3300037418 Ga0395900_0405581 Ga0395900_0405581_68_427 119
1310 3300037418 Ga0395900_0511995 Ga0395900_0511995_690_1049 119
1311 3300037418 Ga0395900_0529378 Ga0395900_0529378_373_732 119
1312 3300037418 Ga0395900_0833817 Ga0395900_0833817_297_656 119
1313 3300037418 Ga0395900_0911049 Ga0395900_0911049_96_455 119
1314 3300037418 Ga0395900_1069649 Ga0395900_1069649_340_699 119
1315 3300037418 Ga0395900_1226560 Ga0395900_1226560_180_539 119
1316 3300037418 Ga0395900_1498913 Ga0395900_1498913_116_475 119
1317 3300037418 Ga0395900_1892307 Ga0395900_1892307_95_454 119
1318 3300037466 Ga0395898_0037311 Ga0395898_0037311_2913_3272 119
1319 3300037466 Ga0395898_0105080 Ga0395898_0105080_803_1162 119
1320 3300037466 Ga0395898_0106663 Ga0395898_0106663_1703_2062 119
1321 3300037466 Ga0395898_0225961 Ga0395898_0225961_669_1028 119
1322 3300037466 Ga0395898_0418874 Ga0395898_0418874_667_1026 119
1323 3300037466 Ga0395898_0554735 Ga0395898_0554735_94_453 119
1324 3300037466 Ga0395898_0991383 Ga0395898_0991383_403_762 119
1325 3300037471 Ga0395905_0000500 Ga0395905_0000500_29776_30135 119
1326 3300037471 Ga0395905_0002055 Ga0395905_0002055_810_1169 119
1327 3300037471 Ga0395905_0005143 Ga0395905_0005143_12202_12561 119
1328 3300037471 Ga0395905_0013259 Ga0395905_0013259_1321_1680 119
1329 3300037471 Ga0395905_0031061 Ga0395905_0031061_1846_2205 119
1330 3300037471 Ga0395905_0043361 Ga0395905_0043361_2074_2433 119
1331 3300037471 Ga0395905_0088944 Ga0395905_0088944_631_990 119
1332 3300037471 Ga0395905_0098036 Ga0395905_0098036_191_550 119
1333 3300037471 Ga0395905_0135174 Ga0395905_0135174_569_928 119
1334 3300037471 Ga0395905_0165338 Ga0395905_0165338_1054_1413 119
1335 3300037471 Ga0395905_0231025 Ga0395905_0231025_1342_1701 119
1336 3300037471 Ga0395905_0283815 Ga0395905_0283815_408_767 119
1337 3300037471 Ga0395905_0402671 Ga0395905_0402671_841_1200 119
1338 3300037471 Ga0395905_0406546 Ga0395905_0406546_72_431 119
1339 3300037471 Ga0395905_0426613 Ga0395905_0426613_450_809 119
1340 3300037471 Ga0395905_0678969 Ga0395905_0678969_215_574 119
1341 3300037471 Ga0395905_0701517 Ga0395905_0701517_109_468 119
1342 3300037471 Ga0395905_0856736 Ga0395905_0856736_418_801 119
1343 3300037471 Ga0395905_1079747 Ga0395905_1079747_299_658 119
1344 3300038443 Ga0395901_0000181 Ga0395901_0000181_30738_31097 119
1345 3300038443 Ga0395901_0022448 Ga0395901_0022448_4761_5120 119
1346 3300038443 Ga0395901_0063228 Ga0395901_0063228_3295_3654 119
1347 3300038443 Ga0395901_0246812 Ga0395901_0246812_193_552 119
1348 3300038443 Ga0395901_0296884 Ga0395901_0296884_1299_1658 119
1349 3300038443 Ga0395901_0393462 Ga0395901_0393462_890_1249 119
1350 3300038443 Ga0395901_0446961 Ga0395901_0446961_868_1227 119
1351 3300038443 Ga0395901_0513390 Ga0395901_0513390_121_480 119
1352 3300038443 Ga0395901_0561561 Ga0395901_0561561_550_909 119
1353 3300038443 Ga0395901_0582346 Ga0395901_0582346_146_505 119
1354 3300038443 Ga0395901_0672947 Ga0395901_0672947_589_948 119
1355 3300038443 Ga0395901_1211334 Ga0395901_1211334_24_383 119
1356 3300038443 Ga0395901_1558123 Ga0395901_1558123_238_597 119
1357 3300038443 Ga0395901_2130677 Ga0395901_2130677_33_392 119
1358 3300039437 Ga0436365_1025078 Ga0436365_1025078_31087_31479 119
1359 3300039453 Ga0436362_0376260 Ga0436362_0376260_72456_72848 119
1360 3300039453 Ga0436362_1278918 Ga0436362_1278918_213_575 119
1361 3300041460 Ga0451802_1859926 Ga0451802_1859926_147_506 119
1362 3300041494 Ga0451837_1278723 Ga0451837_1278723_1645_2022 119
1363 3300041505 Ga0451849_1584927 Ga0451849_1584927_91_450 119
1364 3300042004 Ga0439445_0193063 Ga0439445_0193063_136_495 119
1365 3300042006 Ga0439432_157005 Ga0439432_157005_155_517 119
1366 3300042122 Ga0450920_037897 Ga0450920_037897_65_424 119
1367 3300042127 Ga0450890_034774 Ga0450890_034774_45_404 119
1368 3300042139 Ga0450904_008362 Ga0450904_008362_348_716 119
1369 3300042142 Ga0450905_008711 Ga0450905_008711_459_818 119
1370 3300042144 Ga0450889_000026 Ga0450889_000026_221_580 119
1371 3300042439 Ga0439464_0008150 Ga0439464_0008150_1770_2129 119
1372 3300042439 Ga0439464_0072308 Ga0439464_0072308_349_708 119
1373 3300044656 Ga0466969_0001727 Ga0466969_0001727_8710_9069 119
1374 3300044658 Ga0466972_0219599 Ga0466972_0219599_270_629 119
1375 3300044684 Ga0466966_0045000 Ga0466966_0045000_1934_2293 119
1376 3300044684 Ga0466966_0054338 Ga0466966_0054338_505_864 119
1377 3300044684 Ga0466966_0116457 Ga0466966_0116457_978_1337 119
1378 3300044684 Ga0466966_0306706 Ga0466966_0306706_486_845 119
1379 3300044693 Ga0466961_0035670 Ga0466961_0035670_1922_2281 119
1380 3300044693 Ga0466961_0095871 Ga0466961_0095871_1347_1706 119
1381 3300044693 Ga0466961_0138979 Ga0466961_0138979_505_864 119
1382 3300044694 Ga0466963_0044224 Ga0466963_0044224_918_1277 119
1383 3300044694 Ga0466963_0047053 Ga0466963_0047053_892_1251 119
1384 3300044694 Ga0466963_0089857 Ga0466963_0089857_1472_1831 119
1385 3300044694 Ga0466963_0880903 Ga0466963_0880903_98_457 119
1386 3300044706 Ga0466964_0054588 Ga0466964_0054588_916_1275 119
1387 3300044719 Ga0466971_0020418 Ga0466971_0020418_1107_1466 119
1388 3300044719 Ga0466971_0251980 Ga0466971_0251980_394_753 119
1389 3300044765 Ga0466970_0032272 Ga0466970_0032272_1932_2291 119
1390 3300044765 Ga0466970_0051723 Ga0466970_0051723_842_1201 119
1391 3300044765 Ga0466970_0106639 Ga0466970_0106639_658_1017 119
1392 3300044842 Ga0466957_0019583 Ga0466957_0019583_568_927 119
1393 3300044842 Ga0466957_0037997 Ga0466957_0037997_114_473 119
1394 3300044842 Ga0466957_0092909 Ga0466957_0092909_1004_1363 119
1395 3300044842 Ga0466957_0260444 Ga0466957_0260444_570_929 119
1396 3300044842 Ga0466957_0499067 Ga0466957_0499067_372_731 119
1397 3300044842 Ga0466957_0621521 Ga0466957_0621521_317_676 119
1398 3300044842 Ga0466957_0800070 Ga0466957_0800070_153_515 119
1399 3300045049 Ga0466959_0024051 Ga0466959_0024051_1215_1574 119
1400 3300045049 Ga0466959_0068301 Ga0466959_0068301_2020_2379 119
1401 3300045049 Ga0466959_0076144 Ga0466959_0076144_1796_2155 119
1402 3300045049 Ga0466959_0184898 Ga0466959_0184898_225_584 119
1403 3300045836 Ga0466958_0125675 Ga0466958_0125675_872_1231 119
1404 3300045836 Ga0466958_0155521 Ga0466958_0155521_471_830 119
1405 3300045836 Ga0466958_0715644 Ga0466958_0715644_98_457 119
1406 3300045976 Ga0466967_0102570 Ga0466967_0102570_2186_2545 119
1407 3300045976 Ga0466967_0126481 Ga0466967_0126481_1126_1485 119
1408 3300045976 Ga0466967_0335837 Ga0466967_0335837_145_504 119
1409 3300045976 Ga0466967_0510384 Ga0466967_0510384_281_640 119
1410 3300045976 Ga0466967_1091947 Ga0466967_1091947_18_377 119
1411 3300045976 Ga0466967_1578699 Ga0466967_1578699_225_584 119
1412 3300045976 Ga0466967_1991209 Ga0466967_1991209_76_435 119
1413 3300045976 Ga0466967_2459887 Ga0466967_2459887_103_462 119
1414 3300046459 Ga0495629_0352914 Ga0495629_0352914_268_627 119
1415 3300046492 Ga0495585_0505363 Ga0495585_0505363_114_473 119
1416 3300046500 Ga0495596_0001017 Ga0495596_0001017_11300_11680 119
1417 3300046512 Ga0495610_0012788 Ga0495610_0012788_139_519 119
1418 3300046512 Ga0495610_0178695 Ga0495610_0178695_302_664 119
1419 3300046525 Ga0495663_0015380 Ga0495663_0015380_1366_1725 119
1420 3300046525 Ga0495663_0390648 Ga0495663_0390648_129_488 119
1421 3300046530 Ga0495654_0091422 Ga0495654_0091422_62_421 119
1422 3300046539 Ga0495621_0071079 Ga0495621_0071079_661_1020 119
1423 3300046539 Ga0495621_0268782 Ga0495621_0268782_122_481 119
1424 3300046558 Ga0495633_0071686 Ga0495633_0071686_952_1311 119
1425 3300046558 Ga0495633_0163693 Ga0495633_0163693_113_475 119
1426 3300046558 Ga0495633_0239768 Ga0495633_0239768_385_744 119
1427 3300046616 Ga0495668_0111600 Ga0495668_0111600_117_476 119
1428 3300046616 Ga0495668_0418844 Ga0495668_0418844_260_640 119
1429 3300046660 Ga0495625_0253728 Ga0495625_0253728_21_380 119
1430 3300046664 Ga0495659_0101748 Ga0495659_0101748_454_813 119
1431 3300046684 Ga0495669_0000089 Ga0495669_0000089_16410_16769 119
1432 3300046684 Ga0495669_0010286 Ga0495669_0010286_388_747 119
1433 3300046684 Ga0495669_0020371 Ga0495669_0020371_2322_2681 119
1434 3300046684 Ga0495669_0045621 Ga0495669_0045621_1153_1512 119
1435 3300046684 Ga0495669_0183643 Ga0495669_0183643_299_658 119
1436 3300046684 Ga0495669_0459097 Ga0495669_0459097_41_400 119
1437 3300046684 Ga0495669_0557769 Ga0495669_0557769_161_520 119
1438 3300046691 Ga0495670_0163845 Ga0495670_0163845_166_525 119
1439 3300046691 Ga0495670_0173271 Ga0495670_0173271_504_863 119
1440 3300046691 Ga0495670_0176927 Ga0495670_0176927_225_584 119
1441 3300046691 Ga0495670_0215970 Ga0495670_0215970_294_653 119
1442 3300046692 Ga0495671_0005306 Ga0495671_0005306_3157_3519 119
1443 3300047318 Ga0495636_0182038 Ga0495636_0182038_131_490 119
1444 3300047445 Ga0495677_0027213 Ga0495677_0027213_778_1137 119
1445 3300047445 Ga0495677_0196253 Ga0495677_0196253_139_498 119
1446 3300047447 Ga0495685_096162 Ga0495685_096162_543_902 119
1447 3300047447 Ga0495685_196185 Ga0495685_196185_34_393 119
1448 3300047472 Ga0495686_0026771 Ga0495686_0026771_1694_2056 119
1449 3300048091 Ga0495626_0001180 Ga0495626_0001180_5521_5901 119
1450 3300048903 Ga0496100_0000774 Ga0496100_0000774_11566_11925 119
1451 3300048903 Ga0496100_0012042 Ga0496100_0012042_3182_3541 119
1452 3300048903 Ga0496100_1688035 Ga0496100_1688035_53_412 119
1453 3300048904 Ga0496101_0000256 Ga0496101_0000256_2514_2873 119
1454 3300048904 Ga0496101_0009833 Ga0496101_0009833_1239_1598 119
1455 3300048904 Ga0496101_0436000 Ga0496101_0436000_439_798 119
1456 3300048905 Ga0496102_0019099 Ga0496102_0019099_4050_4409 119
1457 3300048905 Ga0496102_0095370 Ga0496102_0095370_2206_2565 119
1458 3300048905 Ga0496102_0416986 Ga0496102_0416986_202_564 119
1459 3300048905 Ga0496102_0575392 Ga0496102_0575392_553_912 119
1460 3300048906 Ga0496103_0006781 Ga0496103_0006781_1273_1632 119
1461 3300048906 Ga0496103_0044873 Ga0496103_0044873_1178_1537 119
1462 3300048906 Ga0496103_0150287 Ga0496103_0150287_1066_1425 119
1463 3300048907 Ga0496104_0816852 Ga0496104_0816852_317_676 119
1464 3300048908 Ga0496105_0041939 Ga0496105_0041939_1502_1861 119
1465 3300048909 Ga0496106_0053723 Ga0496106_0053723_1374_1733 119
1466 3300048909 Ga0496106_0252532 Ga0496106_0252532_141_500 119
1467 3300048909 Ga0496106_1080466 Ga0496106_1080466_166_525 119
1468 3300048910 Ga0496107_0001584 Ga0496107_0001584_12156_12515 119
1469 3300048910 Ga0496107_0213645 Ga0496107_0213645_846_1205 119
1470 3300048910 Ga0496107_0232874 Ga0496107_0232874_271_630 119
1471 3300048910 Ga0496107_0682475 Ga0496107_0682475_300_659 119
1472 3300048910 Ga0496107_1060673 Ga0496107_1060673_153_512 119
1473 3300048911 Ga0496108_0001376 Ga0496108_0001376_14678_15037 119
1474 3300048911 Ga0496108_0004508 Ga0496108_0004508_696_1055 119
1475 3300048911 Ga0496108_0005703 Ga0496108_0005703_9154_9513 119
1476 3300048911 Ga0496108_0077874 Ga0496108_0077874_2395_2754 119
1477 3300048912 Ga0496109_0005202 Ga0496109_0005202_8001_8360 119
1478 3300048912 Ga0496109_0016785 Ga0496109_0016785_3336_3695 119
1479 3300048912 Ga0496109_0022324 Ga0496109_0022324_1573_1932 119
1480 3300048913 Ga0496110_0001683 Ga0496110_0001683_2398_2757 119
1481 3300048913 Ga0496110_0009451 Ga0496110_0009451_2998_3357 119
1482 3300048913 Ga0496110_0026844 Ga0496110_0026844_3878_4237 119
1483 3300048913 Ga0496110_0149650 Ga0496110_0149650_660_1019 119
1484 3300048913 Ga0496110_0347040 Ga0496110_0347040_215_574 119
1485 3300048913 Ga0496110_0498378 Ga0496110_0498378_162_521 119
1486 3300048914 Ga0496111_0000420 Ga0496111_0000420_19320_19679 119
1487 3300048914 Ga0496111_0042371 Ga0496111_0042371_1977_2336 119
1488 3300048914 Ga0496111_0045914 Ga0496111_0045914_643_1002 119
1489 3300048914 Ga0496111_0420396 Ga0496111_0420396_510_869 119
1490 3300048915 Ga0496112_0061448 Ga0496112_0061448_1223_1582 119
1491 3300048915 Ga0496112_0084881 Ga0496112_0084881_366_725 119
1492 3300048915 Ga0496112_0301567 Ga0496112_0301567_870_1229 119
1493 3300048915 Ga0496112_0341434 Ga0496112_0341434_53_412 119
1494 3300048916 Ga0496113_0000242 Ga0496113_0000242_21691_22050 119
1495 3300048916 Ga0496113_0044373 Ga0496113_0044373_83_442 119
1496 3300048916 Ga0496113_0188974 Ga0496113_0188974_852_1211 119
1497 3300048916 Ga0496113_0217111 Ga0496113_0217111_146_505 119
1498 3300048916 Ga0496113_0546028 Ga0496113_0546028_214_573 119
1499 3300048917 Ga0496114_0000016 Ga0496114_0000016_209829_210188 119
1500 3300048917 Ga0496114_0032733 Ga0496114_0032733_2684_3043 119
1501 3300048918 Ga0496115_0069416 Ga0496115_0069416_253_612 119
1502 3300048919 Ga0496116_0023996 Ga0496116_0023996_1526_1885 119
1503 3300048920 Ga0496117_0525201 Ga0496117_0525201_136_495 119
1504 3300048921 Ga0496118_0312380 Ga0496118_0312380_226_585 119
1505 3300048924 Ga0496121_0000997 Ga0496121_0000997_26079_26438 119
1506 3300048925 Ga0496122_0286055 Ga0496122_0286055_310_669 119
1507 3300048926 Ga0496123_0302957 Ga0496123_0302957_147_506 119
1508 3300048927 Ga0496124_0066652 Ga0496124_0066652_290_649 119
1509 3300048927 Ga0496124_0089483 Ga0496124_0089483_822_1181 119
1510 3300048927 Ga0496124_0269391 Ga0496124_0269391_423_794 119
1511 3300048928 Ga0496125_0028356 Ga0496125_0028356_3155_3514 119
1512 3300048928 Ga0496125_0038468 Ga0496125_0038468_1576_1938 119
1513 3300048929 Ga0496126_0252234 Ga0496126_0252234_1100_1459 119
1514 3300049460 Ga0495682_0083275 Ga0495682_0083275_403_768 119
1515 3300049577 Ga0501041_1024997 Ga0501041_1024997_134_493 119
1516 3300049583 Ga0501067_0021297 Ga0501067_0021297_1265_1624 119
1517 3300049585 Ga0501069_0623809 Ga0501069_0623809_232_591 119
1518 3300049587 Ga0501071_0944067 Ga0501071_0944067_73_432 119
1519 3300049663 Ga0501223_000706 Ga0501223_000706_4932_5291 119
1520 3300049664 Ga0501224_000027 Ga0501224_000027_25784_26143 119
1521 3300049668 Ga0501233_000213 Ga0501233_000213_14_373 119
1522 3300049669 Ga0501235_012419 Ga0501235_012419_1456_1815 119
1523 3300049674 Ga0501242_062022 Ga0501242_062022_18_377 119
1524 3300049679 Ga0501249_013906 Ga0501249_013906_1241_1600 119
1525 3300049686 Ga0501257_014790 Ga0501257_014790_414_773 119
1526 3300049687 Ga0501258_013324 Ga0501258_013324_36_395 119
1527 3300049705 Ga0501225_0000057 Ga0501225_0000057_27449_27808 119
1528 3300049707 Ga0501234_001997 Ga0501234_001997_41_400 119
1529 3300049760 Ga0501263_011039 Ga0501263_011039_357_716 119
1530 3300049765 Ga0501268_005019 Ga0501268_005019_1501_1860 119
1531 3300049769 Ga0501272_026557 Ga0501272_026557_312_671 119
1532 3300049853 Ga0501226_000068 Ga0501226_000068_27452_27811 119
1533 3300050511 nmdc:mga08y16_215338_c1 nmdc:mga08y16_215338_c1_1137_1496 119
1534 3300050511 nmdc:mga08y16_231553_c1 nmdc:mga08y16_231553_c1_597_956 119
1535 3300050514 nmdc:mga08x19_1258411_c1 nmdc:mga08x19_1258411_c1_104_463 119
1536 3300050516 nmdc:mga0sz30_71784_c1 nmdc:mga0sz30_71784_c1_322_702 119
1537 3300053087 Ga0500643_004345 Ga0500643_004345_5856_6218 119
1538 3300053098 Ga0500650_0471895 Ga0500650_0471895_149_523 119
1539 3300053118 Ga0500594_0048960 Ga0500594_0048960_400_762 119
1540 3300053158 Ga0500627_0305300 Ga0500627_0305300_17_376 119
1541 3300059645 Ga0587076_205535 Ga0587076_205535_88_447 119
1542 3300061719 Ga0466962_0019719 Ga0466962_0019719_1214_1573 119
1543 3300061719 Ga0466962_0061883 Ga0466962_0061883_720_1079 119
1544 3300061719 Ga0466962_0262286 Ga0466962_0262286_273_632 119
1545 3300061719 Ga0466962_0311338 Ga0466962_0311338_20_379 119

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01521

Fe-S_biosyn

Iron-sulphur cluster biosynthesis

35

138

0.93

Structural Annotation

Top 5 Hits

ID Description Score Start End
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.843 14 107
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.7632 13 108
1r94-assembly1.cif.gz_A crystal structure of isca (mercury derivative) 0.744 13 108
2d2a-assembly2.cif.gz_B-2 crystal structure of escherichia coli sufa involved in biosynthesis of iron-sulfur clusters 0.7419 14 107
1s98-assembly1.cif.gz_A e.coli isca crystal structure to 2.3 a 0.7277 14 109
ID Description Score Start End Superfamily
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.843 14 107 2.60.300.12
2d2aB01 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.8269 14 107 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.7896 13 119 2.60.300.12
af_A0A0R0F1L8_21_105_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.7885 13 97 2.60.300.12
af_I3ITR1_24_129_2.60.300.12 Mainly Beta;Sandwich;Hypothetical Protein Aq_1857; Chain: A;;HesB-like domain 0.7831 13 119 2.60.300.12
ID Description Score Start End GO Terms
AF-A0A432EJZ2-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8711 14 113 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A4R7DFF5-F1-model_v4 deleted 0.8639 1 119
AF-A0A102DAZ7-F1-model_v4 HesB/YadR/YfhF 0.8552 1 119 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A6I5WYV8-F1-model_v4 Iron-sulfur cluster assembly accessory protein 0.8521 1 119 GO:0005737
GO:0016226
GO:0051537
GO:0097428
AF-A0A4R7DFF5-F1-model_v4 deleted 0.8501 1 119

Feature Viewer

pLDDT pTM Quality
82.11 0.74 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map