F494646

General Info

Members Datasets Scaffolds Average Seq Length
1539 431 1523 65

Family's Representative Sequence

Representative Sequence 3300005347|Ga0070668_100330904|Ga0070668_1003309042
Length 75
Sequence LGRPGATDMAADNASAAAVVTVKPADLPVFCPNPAMPLWSSHPRVFLDIADTGSAMCPYCGTQYRLEGGPARAGH

Samples

Sample ID Description Type Environment
1 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
2 2643221638 Duganella sp. Root336D2 Isolate Unclassified
3 2643221645 Massilia sp. Root351 Isolate Unclassified
4 2738541280 Massilia sp. GV090 Isolate Unclassified
5 2738541297 Duganella sp. GV083 Isolate Unclassified
6 2738541300 Massilia sp. GV016 Isolate Unclassified
7 2738541357 Duganella sp. GV053 Isolate Unclassified
8 2738543003 Duganella sp. GV066 Isolate Unclassified
9 2738543018 Massilia sp. GV045 Isolate Unclassified
10 2738543026 Duganella sp. GV089 Isolate Unclassified
11 2738543029 Duganella sp. GV039 Isolate Unclassified
12 2738543030 Massilia sp. GV097 Isolate Unclassified
13 2842711865 Duganella sp. R-73148 Isolate Unclassified
14 2857553236 Duganella sp. R-74557 Isolate Unclassified
15 2857558681 Duganella sp. R-74565 Isolate Unclassified
16 2919476304 Duganella sp. 3397 Isolate Unclassified
17 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
18 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
19 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
20 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
23 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
24 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
25 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
26 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
27 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
28 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
29 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
30 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
31 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
32 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
33 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
34 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
35 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
36 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
37 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
40 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
41 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
42 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
43 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
44 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
45 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
46 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
47 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
48 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
49 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
50 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
51 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
52 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
53 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
54 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
55 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
56 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
57 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
58 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
59 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
60 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
61 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
62 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
63 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
64 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
65 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
66 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
67 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
68 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
69 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
70 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
71 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
72 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
73 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
74 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
75 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
76 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
77 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
78 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
79 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
80 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
81 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
82 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
83 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
84 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
85 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
86 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
87 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
88 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
89 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
90 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
91 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
92 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
100 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
101 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
102 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
103 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
104 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
120 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
121 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
122 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
123 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
124 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
125 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
126 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
127 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
128 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
129 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
130 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
135 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
136 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
137 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
138 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
139 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
141 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
143 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
144 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
146 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
147 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
148 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
149 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
150 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
151 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
152 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
153 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
154 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
216 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
218 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
219 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
220 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
221 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
222 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
227 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
228 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
229 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
230 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
231 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
232 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
233 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
234 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
235 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
236 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
237 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
238 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
239 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
240 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
243 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
246 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
247 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
248 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
249 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
250 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
251 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
252 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
253 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
254 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
255 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
256 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
257 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
258 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
259 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
262 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
263 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
264 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
265 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
268 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
269 3300044669 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2E Metagenome Unclassified
270 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
271 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
287 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
288 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
289 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
290 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
291 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
292 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
293 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
294 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
295 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
300 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
301 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
302 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
303 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
306 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
307 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
308 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
309 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
310 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
311 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
312 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
313 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
314 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
315 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
321 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
322 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
323 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
324 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
325 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
326 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
327 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
328 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
329 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
330 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
331 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
332 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
333 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
334 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
335 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
336 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
337 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
338 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
339 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
340 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
341 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
342 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
343 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
344 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
345 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
352 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
353 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
354 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
355 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
356 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
357 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
358 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
359 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
360 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
361 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
362 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
363 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
364 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
365 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
366 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
367 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
368 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
369 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
370 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
371 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
372 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
373 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
374 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
375 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
376 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
377 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
378 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
379 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
380 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
381 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
382 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
383 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
384 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
385 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
386 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
387 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
388 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
389 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
390 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
391 3300049128 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
393 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
394 3300049552 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_A_7_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
398 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
399 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
400 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
402 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
403 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
404 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
405 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
406 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
407 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
408 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
409 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
410 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
411 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
412 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
413 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
414 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
415 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
416 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
417 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
418 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
419 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
420 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
421 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
422 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
423 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
424 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
425 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
426 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
427 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
428 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
429 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
430 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
431 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.31
Metatranscriptomes 0.65
Isolates 1.04

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.14
Nodule 0.32
Rhizoplane 3.83
Rhizosphere 90.51
Stem 0
Stem Tuber 0
Unclassified 3.18

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25159J45721_1002873 3300002987 Bacteria 6310
2 JGI25153J46596_10009071 3300003215 Bacteria 4671
3 rootL2_10086410 3300003322 Bacteria 4413
4 Ga0055525_1000009 3300003759 Bacteria 596899
5 Ga0055542_1016302 3300003762 Bacteria 1173
6 Ga0055526_1000856 3300003771 Bacteria 22650
7 Ga0055526_1003371 3300003771 Bacteria 10190
8 Ga0055537_1000496 3300003773 Bacteria 23957
9 Ga0055524_1000027 3300003775 Bacteria 213655
10 Ga0055524_1015123 3300003775 Bacteria 2827
11 Ga0055534_1000583 3300003784 Bacteria 19177
12 Ga0055528_1000686 3300003790 Bacteria 24151
13 Ga0055543_1002543 3300004625 Bacteria 5951
14 Ga0065165_1000298 3300005262 Bacteria 83243
15 Ga0065165_1002921 3300005262 Bacteria 13057
16 Ga0065165_1019195 3300005262 Bacteria 2450
17 Ga0065715_10286429 3300005293 Bacteria 1073
18 Ga0065715_10489296 3300005293 Bacteria 790
19 Ga0070658_10022463 3300005327 Bacteria 5062
20 Ga0070658_10971624 3300005327 Bacteria 739
21 Ga0070658_11119261 3300005327 Bacteria 685
22 Ga0070676_10007021 3300005328 Bacteria 6029
23 Ga0070676_10075272 3300005328 Bacteria 2035
24 Ga0070676_10927898 3300005328 Bacteria 650
25 Ga0070683_102088025 3300005329 Bacteria 544
26 Ga0070690_100254242 3300005330 Bacteria 1244
27 Ga0070670_100044483 3300005331 Bacteria 3818
28 Ga0070670_100109526 3300005331 Bacteria 2380
29 Ga0070670_100238035 3300005331 Bacteria 1585
30 Ga0070670_100267604 3300005331 Bacteria 1491
31 Ga0070670_100324184 3300005331 Bacteria 1350
32 Ga0070670_100708172 3300005331 Bacteria 906
33 Ga0070677_10000892 3300005333 Bacteria 9819
34 Ga0070677_10059181 3300005333 Bacteria 1575
35 Ga0070677_10223564 3300005333 Bacteria 921
36 Ga0068869_100011201 3300005334 Bacteria 5875
37 Ga0068869_100873363 3300005334 Bacteria 777
38 Ga0068869_101547310 3300005334 Bacteria 590
39 Ga0068869_101618602 3300005334 Bacteria 577
40 Ga0070666_10004003 3300005335 Bacteria 8943
41 Ga0070666_10010423 3300005335 Bacteria 5814
42 Ga0070666_10414163 3300005335 Bacteria 970
43 Ga0070666_10534339 3300005335 Bacteria 852
44 Ga0070680_100246895 3300005336 Bacteria 1509
45 Ga0070680_100636766 3300005336 Bacteria 916
46 Ga0070680_100738020 3300005336 Unclassified 848
47 Ga0070680_100987645 3300005336 Bacteria 727
48 Ga0070680_101151835 3300005336 Bacteria 670
49 Ga0070680_101573786 3300005336 Bacteria 569
50 Ga0070682_100310125 3300005337 Bacteria 1161
51 Ga0068868_100103841 3300005338 Bacteria 2303
52 Ga0068868_100590742 3300005338 Bacteria 983
53 Ga0068868_100855323 3300005338 Bacteria 824
54 Ga0068868_101284117 3300005338 Bacteria 679
55 Ga0068868_101379636 3300005338 Bacteria 657
56 Ga0068868_101617968 3300005338 Bacteria 609
57 Ga0070660_100093006 3300005339 Bacteria 2380
58 Ga0070660_100202965 3300005339 Bacteria 1608
59 Ga0070660_100469114 3300005339 Bacteria 1045
60 Ga0070660_100727981 3300005339 Bacteria 832
61 Ga0070660_100762662 3300005339 Bacteria 813
62 Ga0070660_101293982 3300005339 Bacteria 619
63 Ga0070689_100528275 3300005340 Bacteria 1014
64 Ga0070689_100641913 3300005340 Bacteria 923
65 Ga0070689_100749064 3300005340 Bacteria 856
66 Ga0070691_10791207 3300005341 Bacteria 577
67 Ga0070661_100006065 3300005344 Bacteria 8316
68 Ga0070661_100012593 3300005344 Bacteria 5920
69 Ga0070661_100104081 3300005344 Bacteria 2114
70 Ga0070661_100381808 3300005344 Bacteria 1111
71 Ga0070661_100429083 3300005344 Bacteria 1049
72 Ga0070661_100446000 3300005344 Bacteria 1029
73 Ga0070661_100485472 3300005344 Unclassified 987
74 Ga0070661_100670826 3300005344 Bacteria 843
75 Ga0070661_100682501 3300005344 Bacteria 836
76 Ga0070661_100996533 3300005344 Bacteria 695
77 Ga0070668_100004304 3300005347 Bacteria 10566
78 Ga0070668_100038060 3300005347 Bacteria 3675
79 Ga0070668_100046330 3300005347 Bacteria 3338
80 Ga0070668_100064293 3300005347 Bacteria 2844
81 Ga0070668_100248915 3300005347 Bacteria 1475
82 Ga0070668_100330904 3300005347 Bacteria 1285
83 Ga0070668_100768448 3300005347 Bacteria 854
84 Ga0070668_101783836 3300005347 Bacteria 566
85 Ga0070669_100598822 3300005353 Bacteria 923
86 Ga0070669_100689262 3300005353 Bacteria 862
87 Ga0070675_100012175 3300005354 Bacteria 6744
88 Ga0070675_100023439 3300005354 Bacteria 4936
89 Ga0070675_100203050 3300005354 Bacteria 1721
90 Ga0070675_100220892 3300005354 Bacteria 1650
91 Ga0070675_100447531 3300005354 Bacteria 1158
92 Ga0070675_101455532 3300005354 Bacteria 632
93 Ga0070675_102098177 3300005354 Unclassified 521
94 Ga0070671_100024028 3300005355 Bacteria 4988
95 Ga0070671_100046161 3300005355 Bacteria 3622
96 Ga0070671_100127720 3300005355 Bacteria 2141
97 Ga0070671_100433137 3300005355 Bacteria 1127
98 Ga0070671_100448569 3300005355 Bacteria 1107
99 Ga0070671_100748475 3300005355 Bacteria 849
100 Ga0070674_100012729 3300005356 Bacteria 5175
101 Ga0070674_100022171 3300005356 Bacteria 4092
102 Ga0070674_100306077 3300005356 Bacteria 1269
103 Ga0070674_100435854 3300005356 Bacteria 1079
104 Ga0070674_101035637 3300005356 Bacteria 722
105 Ga0070673_100013874 3300005364 Bacteria 5593
106 Ga0070673_100043093 3300005364 Bacteria 3484
107 Ga0070673_100835315 3300005364 Bacteria 852
108 Ga0070673_100991953 3300005364 Bacteria 782
109 Ga0070673_101025308 3300005364 Bacteria 769
110 Ga0070673_101281300 3300005364 Bacteria 688
111 Ga0070688_101573172 3300005365 Bacteria 536
112 Ga0070659_100156241 3300005366 Bacteria 1863
113 Ga0070659_100241602 3300005366 Bacteria 1495
114 Ga0070659_100286746 3300005366 Bacteria 1370
115 Ga0070659_100600687 3300005366 Bacteria 946
116 Ga0070667_100035038 3300005367 Bacteria 4204
117 Ga0070667_100045561 3300005367 Bacteria 3688
118 Ga0070667_100075567 3300005367 Bacteria 2876
119 Ga0070667_100175495 3300005367 Bacteria 1894
120 Ga0070667_101376825 3300005367 Bacteria 662
121 Ga0070713_100000059 3300005436 Bacteria 69993
122 Ga0070710_10097756 3300005437 Bacteria 1743
123 Ga0070711_102033469 3300005439 Bacteria 505
124 Ga0070705_100055248 3300005440 Bacteria 2333
125 Ga0070705_101059937 3300005440 Bacteria 661
126 Ga0070700_100205951 3300005441 Bacteria 1385
127 Ga0070700_100727733 3300005441 Bacteria 792
128 Ga0070694_101667444 3300005444 Bacteria 542
129 Ga0070708_100000133 3300005445 Bacteria 50894
130 Ga0070663_100042161 3300005455 Bacteria 3206
131 Ga0070663_100081595 3300005455 Bacteria 2378
132 Ga0070663_100860423 3300005455 Bacteria 781
133 Ga0070663_101036835 3300005455 Bacteria 715
134 Ga0070663_101727721 3300005455 Bacteria 560
135 Ga0070663_101952830 3300005455 Bacteria 528
136 Ga0070678_100031126 3300005456 Bacteria 3676
137 Ga0070678_100270566 3300005456 Bacteria 1433
138 Ga0070678_100805880 3300005456 Bacteria 853
139 Ga0070678_101130463 3300005456 Bacteria 724
140 Ga0070678_101780228 3300005456 Bacteria 580
141 Ga0070662_100432303 3300005457 Bacteria 1090
142 Ga0070662_100599106 3300005457 Bacteria 927
143 Ga0070662_100635485 3300005457 Bacteria 900
144 Ga0070662_101625691 3300005457 Bacteria 558
145 Ga0070681_10000732 3300005458 Bacteria 27129
146 Ga0070681_10946289 3300005458 Bacteria 780
147 Ga0068867_100023621 3300005459 Bacteria 4401
148 Ga0068867_100034889 3300005459 Bacteria 3647
149 Ga0068867_100708853 3300005459 Bacteria 889
150 Ga0070685_11234918 3300005466 Bacteria 569
151 Ga0070706_100081572 3300005467 Bacteria 2995
152 Ga0070707_100443909 3300005468 Bacteria 1258
153 Ga0070699_100337949 3300005518 Unclassified 1355
154 Ga0070679_100027165 3300005530 Bacteria 5630
155 Ga0070679_100338526 3300005530 Bacteria 1453
156 Ga0070679_101430793 3300005530 Bacteria 638
157 Ga0070679_101761304 3300005530 Bacteria 568
158 Ga0070679_101889359 3300005530 Bacteria 546
159 Ga0070684_102052625 3300005535 Unclassified 540
160 Ga0068853_100073590 3300005539 Bacteria 2979
161 Ga0068853_100081768 3300005539 Bacteria 2829
162 Ga0068853_100200958 3300005539 Bacteria 1814
163 Ga0068853_101666327 3300005539 Unclassified 618
164 Ga0070672_100094012 3300005543 Bacteria 2423
165 Ga0070672_100154830 3300005543 Unclassified 1898
166 Ga0070672_100176359 3300005543 Bacteria 1779
167 Ga0070672_100237141 3300005543 Bacteria 1533
168 Ga0070672_100282391 3300005543 Bacteria 1404
169 Ga0070672_100514251 3300005543 Bacteria 1037
170 Ga0070672_101060861 3300005543 Bacteria 719
171 Ga0070672_101950935 3300005543 Bacteria 529
172 Ga0070665_100011044 3300005548 Bacteria 9127
173 Ga0070665_100090569 3300005548 Bacteria 3064
174 Ga0070665_100142966 3300005548 Bacteria 2396
175 Ga0070665_100342103 3300005548 Bacteria 1501
176 Ga0070665_100476678 3300005548 Bacteria 1258
177 Ga0070665_101263292 3300005548 Bacteria 749
178 Ga0070665_101622153 3300005548 Bacteria 655
179 Ga0070704_100676588 3300005549 Bacteria 913
180 Ga0070704_101990410 3300005549 Bacteria 539
181 Ga0068855_100050961 3300005563 Bacteria 4877
182 Ga0068855_100382107 3300005563 Bacteria 1546
183 Ga0068855_100418756 3300005563 Bacteria 1465
184 Ga0068855_100661580 3300005563 Bacteria 1121
185 Ga0068855_100946816 3300005563 Bacteria 907
186 Ga0070664_100005997 3300005564 Bacteria 9824
187 Ga0070664_100173534 3300005564 Bacteria 1913
188 Ga0070664_100258184 3300005564 Bacteria 1567
189 Ga0070664_100317296 3300005564 Bacteria 1411
190 Ga0070664_100380118 3300005564 Bacteria 1289
191 Ga0070664_100483507 3300005564 Bacteria 1140
192 Ga0070664_100534169 3300005564 Bacteria 1083
193 Ga0070664_101042049 3300005564 Bacteria 769
194 Ga0070664_101801496 3300005564 Bacteria 581
195 Ga0068857_100274151 3300005577 Bacteria 1551
196 Ga0068857_100380950 3300005577 Bacteria 1310
197 Ga0068857_100726651 3300005577 Bacteria 945
198 Ga0068857_101067587 3300005577 Bacteria 779
199 Ga0068857_101318552 3300005577 Bacteria 701
200 Ga0068854_100080480 3300005578 Bacteria 2404
201 Ga0068854_100223809 3300005578 Bacteria 1490
202 Ga0068854_100402196 3300005578 Bacteria 1133
203 Ga0068856_100024938 3300005614 Bacteria 5827
204 Ga0068856_101489452 3300005614 Bacteria 691
205 Ga0068856_101757956 3300005614 Unclassified 632
206 Ga0068852_100016562 3300005616 Bacteria 5755
207 Ga0068852_100126901 3300005616 Bacteria 2344
208 Ga0068852_100206082 3300005616 Bacteria 1863
209 Ga0068852_100547845 3300005616 Bacteria 1157
210 Ga0068852_101720545 3300005616 Bacteria 650
211 Ga0068852_102166693 3300005616 Bacteria 577
212 Ga0068859_100034422 3300005617 Bacteria 5084
213 Ga0068859_100572538 3300005617 Bacteria 1223
214 Ga0068859_102269884 3300005617 Bacteria 599
215 Ga0068859_102309756 3300005617 Bacteria 593
216 Ga0068859_102748906 3300005617 Bacteria 541
217 Ga0068859_102825347 3300005617 Bacteria 533
218 Ga0068864_100025549 3300005618 Bacteria 4976
219 Ga0068864_100045559 3300005618 Bacteria 3762
220 Ga0068864_100380281 3300005618 Bacteria 1338
221 Ga0068864_100882262 3300005618 Bacteria 883
222 Ga0068864_101720323 3300005618 Bacteria 632
223 Ga0068866_10355485 3300005718 Bacteria 932
224 Ga0068861_100008821 3300005719 Bacteria 6946
225 Ga0068861_100039895 3300005719 Bacteria 3508
226 Ga0068861_100236576 3300005719 Bacteria 1551
227 Ga0068861_100390749 3300005719 Bacteria 1232
228 Ga0068861_101332348 3300005719 Bacteria 699
229 Ga0068861_101474782 3300005719 Bacteria 667
230 Ga0068851_10003475 3300005834 Bacteria 7015
231 Ga0068851_10008417 3300005834 Bacteria 4768
232 Ga0068851_10058716 3300005834 Bacteria 1967
233 Ga0068851_10102704 3300005834 Bacteria 1518
234 Ga0068851_10175940 3300005834 Bacteria 1183
235 Ga0068870_10121168 3300005840 Bacteria 1507
236 Ga0068870_10215621 3300005840 Bacteria 1172
237 Ga0068863_100032414 3300005841 Bacteria 4981
238 Ga0068863_100065636 3300005841 Bacteria 3434
239 Ga0068863_100152835 3300005841 Bacteria 2209
240 Ga0068863_100244169 3300005841 Bacteria 1733
241 Ga0068863_101474403 3300005841 Bacteria 689
242 Ga0068858_100016937 3300005842 Bacteria 6842
243 Ga0068858_100049107 3300005842 Bacteria 3908
244 Ga0068858_100396380 3300005842 Bacteria 1326
245 Ga0068858_100511682 3300005842 Bacteria 1160
246 Ga0068858_100531518 3300005842 Bacteria 1138
247 Ga0068860_100035988 3300005843 Bacteria 4746
248 Ga0068860_100129695 3300005843 Bacteria 2419
249 Ga0068860_100152816 3300005843 Bacteria 2223
250 Ga0068860_100231923 3300005843 Bacteria 1794
251 Ga0068860_100818437 3300005843 Bacteria 945
252 Ga0068860_102001362 3300005843 Bacteria 601
253 Ga0068862_100053978 3300005844 Bacteria 3441
254 Ga0068862_100192017 3300005844 Bacteria 1838
255 Ga0068862_101288240 3300005844 Bacteria 732
256 Ga0068862_101567735 3300005844 Bacteria 665
257 Ga0081539_10076122 3300005985 Bacteria 1779
258 Ga0097621_100113760 3300006237 Bacteria 2289
259 Ga0097621_100204644 3300006237 Bacteria 1715
260 Ga0097621_101158512 3300006237 Bacteria 727
261 Ga0097621_102284412 3300006237 Bacteria 518
262 Ga0068871_100003539 3300006358 Bacteria 10743
263 Ga0068871_100062575 3300006358 Bacteria 3042
264 Ga0068871_101440378 3300006358 Bacteria 650
265 Ga0075428_100385438 3300006844 Bacteria 1503
266 Ga0075428_101664963 3300006844 Bacteria 666
267 Ga0075430_100785270 3300006846 Bacteria 785
268 Ga0075431_100580711 3300006847 Bacteria 1106
269 Ga0075434_100079491 3300006871 Bacteria 3276
270 Ga0075434_100295497 3300006871 Bacteria 1640
271 Ga0068865_100063942 3300006881 Bacteria 2588
272 Ga0068865_100105285 3300006881 Bacteria 2072
273 Ga0068865_100151128 3300006881 Bacteria 1762
274 Ga0068865_100184960 3300006881 Bacteria 1607
275 Ga0097620_100034419 3300006931 Bacteria 5084
276 Ga0097620_100572465 3300006931 Bacteria 1223
277 Ga0097620_102269903 3300006931 Bacteria 599
278 Ga0097620_102310119 3300006931 Bacteria 593
279 Ga0097620_102748872 3300006931 Bacteria 541
280 Ga0097620_102825148 3300006931 Bacteria 533
281 Ga0079104_1011335 3300006946 Bacteria 2872
282 Ga0099826_10000003 3300006948 Bacteria 1067817
283 Ga0105251_10067213 3300009011 Bacteria 1674
284 Ga0105244_10046293 3300009036 Bacteria 2235
285 Ga0105244_10328141 3300009036 Bacteria 706
286 Ga0105240_10457373 3300009093 Bacteria 1427
287 Ga0111539_11515077 3300009094 Bacteria 778
288 Ga0105245_11785741 3300009098 Bacteria 668
289 Ga0105247_10015325 3300009101 Bacteria 4592
290 Ga0105247_10830563 3300009101 Bacteria 707
291 Ga0114129_10238463 3300009147 Bacteria 2446
292 Ga0114129_10612786 3300009147 Bacteria 1409
293 Ga0105243_10125495 3300009148 Bacteria 2170
294 Ga0105243_10713487 3300009148 Bacteria 979
295 Ga0105243_11123056 3300009148 Bacteria 795
296 Ga0105243_11558536 3300009148 Bacteria 686
297 Ga0105241_10033689 3300009174 Bacteria 3846
298 Ga0105241_10079364 3300009174 Bacteria 2566
299 Ga0105241_11123245 3300009174 Bacteria 741
300 Ga0105241_11249007 3300009174 Unclassified 705
301 Ga0105242_10031663 3300009176 Bacteria 4227
302 Ga0105248_10018374 3300009177 Bacteria 7723
303 Ga0105248_10230519 3300009177 Bacteria 2085
304 Ga0105248_10349308 3300009177 Bacteria 1665
305 Ga0105248_10537816 3300009177 Bacteria 1318
306 Ga0105248_11255955 3300009177 Bacteria 838
307 Ga0105248_12219715 3300009177 Unclassified 625
308 Ga0105248_12572172 3300009177 Bacteria 580
309 Ga0105237_10048709 3300009545 Bacteria 4259
310 Ga0105238_10642008 3300009551 Bacteria 1071
311 Ga0105238_11668142 3300009551 Bacteria 668
312 Ga0105238_12506712 3300009551 Bacteria 552
313 Ga0105249_10057399 3300009553 Bacteria 3566
314 Ga0105239_11133507 3300010375 Bacteria 901
315 Ga0105246_12018409 3300011119 Unclassified 557
316 Ga0157373_10006600 3300013100 Bacteria 8655
317 Ga0157373_10045628 3300013100 Bacteria 3128
318 Ga0157373_11169062 3300013100 Bacteria 579
319 Ga0157371_10000399 3300013102 Bacteria 54380
320 Ga0157371_10370695 3300013102 Bacteria 1044
321 Ga0157371_10535771 3300013102 Bacteria 867
322 Ga0157371_11286349 3300013102 Bacteria 565
323 Ga0157370_10098882 3300013104 Bacteria 2735
324 Ga0157370_10705462 3300013104 Bacteria 921
325 Ga0157370_10837359 3300013104 Bacteria 836
326 Ga0157369_10808246 3300013105 Bacteria 963
327 Ga0157369_10868506 3300013105 Bacteria 926
328 Ga0157369_11084540 3300013105 Bacteria 819
329 Ga0157374_10168397 3300013296 Bacteria 2136
330 Ga0157374_10337908 3300013296 Bacteria 1495
331 Ga0157374_10422569 3300013296 Bacteria 1332
332 Ga0157374_11355355 3300013296 Bacteria 734
333 Ga0157374_11575314 3300013296 Bacteria 681
334 Ga0157378_10024227 3300013297 Bacteria 5337
335 Ga0157378_10182581 3300013297 Bacteria 1974
336 Ga0157378_10437287 3300013297 Bacteria 1296
337 Ga0157378_11327644 3300013297 Bacteria 761
338 Ga0157378_11729837 3300013297 Bacteria 673
339 Ga0163162_10068518 3300013306 Bacteria 3600
340 Ga0163162_10225298 3300013306 Bacteria 2004
341 Ga0163162_10745223 3300013306 Bacteria 1099
342 Ga0163162_11534257 3300013306 Bacteria 759
343 Ga0163162_12879765 3300013306 Bacteria 554
344 Ga0157372_10010615 3300013307 Bacteria 9799
345 Ga0157372_10222379 3300013307 Bacteria 2188
346 Ga0157372_10268210 3300013307 Bacteria 1983
347 Ga0157372_10334231 3300013307 Bacteria 1765
348 Ga0157372_10798005 3300013307 Bacteria 1097
349 Ga0157372_10838602 3300013307 Bacteria 1067
350 Ga0157372_12067318 3300013307 Bacteria 654
351 Ga0157372_12439620 3300013307 Bacteria 600
352 Ga0157372_12773552 3300013307 Bacteria 562
353 Ga0157375_10213714 3300013308 Bacteria 2086
354 Ga0157375_10489177 3300013308 Bacteria 1395
355 Ga0157375_10549912 3300013308 Bacteria 1316
356 Ga0157375_10726496 3300013308 Bacteria 1145
357 Ga0157375_10742023 3300013308 Bacteria 1134
358 Ga0157375_11050558 3300013308 Bacteria 952
359 Ga0163163_10059545 3300014325 Bacteria 3778
360 Ga0163163_10193532 3300014325 Bacteria 2082
361 Ga0163163_10214218 3300014325 Bacteria 1975
362 Ga0163163_12014976 3300014325 Bacteria 637
363 Ga0163163_12826689 3300014325 Bacteria 542
364 Ga0157380_10717171 3300014326 Unclassified 1007
365 Ga0157380_10753047 3300014326 Bacteria 986
366 Ga0157380_12834519 3300014326 Bacteria 551
367 Ga0182008_10171922 3300014497 Bacteria 1094
368 Ga0182008_10634246 3300014497 Bacteria 603
369 Ga0182008_10694490 3300014497 Bacteria 581
370 Ga0157377_10869744 3300014745 Bacteria 671
371 Ga0157379_10004686 3300014968 Bacteria 11736
372 Ga0157379_10113285 3300014968 Bacteria 2438
373 Ga0157376_10064276 3300014969 Bacteria 3094
374 Ga0157376_10344263 3300014969 Bacteria 1425
375 Ga0157376_11633773 3300014969 Bacteria 679
376 Ga0182006_1000055 3300015261 Bacteria 173139
377 Ga0182006_1022308 3300015261 Bacteria 2633
378 Ga0182007_10049382 3300015262 Bacteria 1390
379 Ga0182007_10198265 3300015262 Bacteria 701
380 Ga0182005_1000003 3300015265 Bacteria 683269
381 Ga0163161_10081332 3300017792 Bacteria 2385
382 Ga0163161_10853066 3300017792 Bacteria 769
383 Ga0163161_11010145 3300017792 Bacteria 710
384 Ga0213872_10266511 3300021361 Bacteria 718
385 Ga0224712_10693215 3300022467 Bacteria 501
386 Ga0209436_109615 3300025208 Bacteria 1826
387 Ga0209563_100015 3300025230 Bacteria 879901
388 Ga0207425_1001644 3300025245 Bacteria 8998
389 Ga0209026_1016232 3300025250 Unclassified 1208
390 Ga0209677_107904 3300025253 Bacteria 2158
391 Ga0209148_1000272 3300025254 Bacteria 81330
392 Ga0209565_1000006 3300025263 Bacteria 897294
393 Ga0209565_1024423 3300025263 Bacteria 1230
394 Ga0209565_1042407 3300025263 Bacteria 843
395 Ga0209673_1000004 3300025273 Bacteria 896155
396 Ga0209130_1000067 3300025284 Bacteria 184277
397 Ga0209675_1000006 3300025291 Bacteria 732267
398 Ga0209025_1006507 3300025294 Bacteria 9037
399 Ga0209564_1000026 3300025295 Bacteria 519154
400 Ga0209564_1000102 3300025295 Bacteria 222597
401 Ga0209758_1000314 3300025297 Bacteria 93818
402 Ga0209256_1000013 3300025299 Bacteria 689442
403 Ga0209256_1000037 3300025299 Bacteria 377661
404 Ga0207697_10098252 3300025315 Bacteria 1246
405 Ga0207656_10021063 3300025321 Bacteria 2599
406 Ga0207656_10107968 3300025321 Bacteria 1283
407 Ga0207656_10411906 3300025321 Bacteria 680
408 Ga0207696_1175319 3300025711 Bacteria 567
409 Ga0207713_1209093 3300025735 Unclassified 594
410 Ga0207682_10001543 3300025893 Bacteria 10582
411 Ga0207682_10088790 3300025893 Bacteria 1337
412 Ga0207682_10116098 3300025893 Bacteria 1183
413 Ga0207692_10203011 3300025898 Bacteria 1166
414 Ga0207710_10032167 3300025900 Bacteria 2298
415 Ga0207688_10315124 3300025901 Bacteria 959
416 Ga0207688_10370002 3300025901 Bacteria 885
417 Ga0207680_10129237 3300025903 Bacteria 1663
418 Ga0207680_10260380 3300025903 Bacteria 1200
419 Ga0207680_10262336 3300025903 Bacteria 1196
420 Ga0207680_10490789 3300025903 Bacteria 874
421 Ga0207680_10507510 3300025903 Bacteria 859
422 Ga0207680_11114922 3300025903 Bacteria 564
423 Ga0207645_10000368 3300025907 Bacteria 37407
424 Ga0207645_10029705 3300025907 Bacteria 3523
425 Ga0207645_10038810 3300025907 Bacteria 3052
426 Ga0207643_10019972 3300025908 Bacteria 3675
427 Ga0207643_10040959 3300025908 Bacteria 2609
428 Ga0207705_10003612 3300025909 Bacteria 11782
429 Ga0207705_10219637 3300025909 Bacteria 1443
430 Ga0207705_10625432 3300025909 Bacteria 837
431 Ga0207705_10797712 3300025909 Bacteria 733
432 Ga0207705_10833828 3300025909 Unclassified 715
433 Ga0207705_10854721 3300025909 Bacteria 705
434 Ga0207684_10068001 3300025910 Bacteria 3028
435 Ga0207654_10013588 3300025911 Bacteria 4190
436 Ga0207654_10644104 3300025911 Unclassified 758
437 Ga0207707_10012370 3300025912 Bacteria 7417
438 Ga0207707_11183761 3300025912 Bacteria 619
439 Ga0207695_10618639 3300025913 Bacteria 964
440 Ga0207671_10103323 3300025914 Bacteria 2161
441 Ga0207693_10276442 3300025915 Bacteria 1316
442 Ga0207663_11619838 3300025916 Bacteria 521
443 Ga0207660_10187555 3300025917 Bacteria 1609
444 Ga0207660_10402231 3300025917 Bacteria 1103
445 Ga0207660_10749542 3300025917 Unclassified 797
446 Ga0207660_11340601 3300025917 Bacteria 581
447 Ga0207662_11373708 3300025918 Bacteria 502
448 Ga0207657_10065714 3300025919 Bacteria 3091
449 Ga0207657_10144069 3300025919 Bacteria 1944
450 Ga0207657_10366664 3300025919 Bacteria 1135
451 Ga0207657_11135535 3300025919 Bacteria 596
452 Ga0207649_10001571 3300025920 Bacteria 13320
453 Ga0207649_10097664 3300025920 Bacteria 1937
454 Ga0207649_10207781 3300025920 Bacteria 1387
455 Ga0207649_10535415 3300025920 Bacteria 894
456 Ga0207649_11597826 3300025920 Bacteria 516
457 Ga0207652_10005028 3300025921 Bacteria 10716
458 Ga0207652_10120365 3300025921 Bacteria 2335
459 Ga0207652_10459034 3300025921 Bacteria 1148
460 Ga0207652_11433260 3300025921 Bacteria 594
461 Ga0207646_10441645 3300025922 Bacteria 1174
462 Ga0207681_10128874 3300025923 Bacteria 1868
463 Ga0207681_10185637 3300025923 Bacteria 1587
464 Ga0207650_10006340 3300025925 Bacteria 8060
465 Ga0207650_10149150 3300025925 Bacteria 1844
466 Ga0207650_10214992 3300025925 Bacteria 1545
467 Ga0207650_10301466 3300025925 Bacteria 1309
468 Ga0207650_10539728 3300025925 Bacteria 977
469 Ga0207650_10675039 3300025925 Bacteria 872
470 Ga0207659_10064240 3300025926 Bacteria 2655
471 Ga0207659_10553718 3300025926 Bacteria 978
472 Ga0207659_11138108 3300025926 Bacteria 671
473 Ga0207659_11353513 3300025926 Bacteria 611
474 Ga0207659_11353677 3300025926 Bacteria 611
475 Ga0207687_10353201 3300025927 Bacteria 1198
476 Ga0207644_10029990 3300025931 Bacteria 3777
477 Ga0207644_10073521 3300025931 Bacteria 2507
478 Ga0207644_10103113 3300025931 Bacteria 2146
479 Ga0207644_10191598 3300025931 Bacteria 1608
480 Ga0207644_10396446 3300025931 Bacteria 1127
481 Ga0207644_10422742 3300025931 Bacteria 1092
482 Ga0207690_10157164 3300025932 Bacteria 1691
483 Ga0207690_10293463 3300025932 Bacteria 1270
484 Ga0207690_10509945 3300025932 Bacteria 974
485 Ga0207690_11527119 3300025932 Bacteria 558
486 Ga0207706_10063812 3300025933 Bacteria 3243
487 Ga0207706_10457026 3300025933 Bacteria 1104
488 Ga0207706_10554159 3300025933 Bacteria 990
489 Ga0207706_10615781 3300025933 Bacteria 932
490 Ga0207706_11671023 3300025933 Bacteria 514
491 Ga0207686_10001803 3300025934 Bacteria 11906
492 Ga0207686_11767895 3300025934 Bacteria 511
493 Ga0207709_10082951 3300025935 Bacteria 2071
494 Ga0207709_10532319 3300025935 Bacteria 921
495 Ga0207709_10724088 3300025935 Bacteria 798
496 Ga0207670_10271353 3300025936 Unclassified 1319
497 Ga0207670_10500182 3300025936 Bacteria 987
498 Ga0207670_11090899 3300025936 Bacteria 674
499 Ga0207669_10017906 3300025937 Bacteria 3648
500 Ga0207669_10026360 3300025937 Bacteria 3160
501 Ga0207669_10101094 3300025937 Bacteria 1906
502 Ga0207669_10460658 3300025937 Unclassified 1009
503 Ga0207704_10185449 3300025938 Bacteria 1508
504 Ga0207704_10320033 3300025938 Bacteria 1196
505 Ga0207704_10529692 3300025938 Bacteria 954
506 Ga0207704_10651686 3300025938 Bacteria 867
507 Ga0207691_10006372 3300025940 Bacteria 11401
508 Ga0207691_10012848 3300025940 Bacteria 8016
509 Ga0207691_10119991 3300025940 Bacteria 2332
510 Ga0207691_11013169 3300025940 Unclassified 693
511 Ga0207711_10020304 3300025941 Bacteria 5537
512 Ga0207711_10341617 3300025941 Bacteria 1386
513 Ga0207711_11236495 3300025941 Bacteria 689
514 Ga0207711_11401504 3300025941 Bacteria 641
515 Ga0207689_10005836 3300025942 Bacteria 10916
516 Ga0207689_11099388 3300025942 Bacteria 670
517 Ga0207661_10492556 3300025944 Bacteria 1120
518 Ga0207661_11525248 3300025944 Bacteria 612
519 Ga0207679_10030854 3300025945 Bacteria 3747
520 Ga0207679_10091484 3300025945 Bacteria 2354
521 Ga0207679_10163139 3300025945 Bacteria 1827
522 Ga0207679_10233950 3300025945 Bacteria 1553
523 Ga0207679_10361540 3300025945 Bacteria 1268
524 Ga0207679_10970334 3300025945 Bacteria 779
525 Ga0207679_11384313 3300025945 Bacteria 645
526 Ga0207679_11853047 3300025945 Bacteria 551
527 Ga0207667_10030564 3300025949 Bacteria 5826
528 Ga0207667_10151829 3300025949 Bacteria 2384
529 Ga0207667_10263976 3300025949 Bacteria 1761
530 Ga0207667_10552718 3300025949 Bacteria 1164
531 Ga0207667_11820104 3300025949 Bacteria 573
532 Ga0207651_10023058 3300025960 Bacteria 3820
533 Ga0207651_10051601 3300025960 Bacteria 2800
534 Ga0207651_10120286 3300025960 Bacteria 1990
535 Ga0207651_10348725 3300025960 Bacteria 1246
536 Ga0207651_10703746 3300025960 Bacteria 890
537 Ga0207651_10844961 3300025960 Bacteria 813
538 Ga0207651_11521131 3300025960 Unclassified 603
539 Ga0207712_10397044 3300025961 Bacteria 1158
540 Ga0207668_10022709 3300025972 Bacteria 4021
541 Ga0207668_10067696 3300025972 Bacteria 2536
542 Ga0207668_10129019 3300025972 Bacteria 1928
543 Ga0207668_10176179 3300025972 Bacteria 1682
544 Ga0207668_10209871 3300025972 Bacteria 1557
545 Ga0207668_10223605 3300025972 Bacteria 1513
546 Ga0207668_10621981 3300025972 Bacteria 942
547 Ga0207668_12073607 3300025972 Bacteria 512
548 Ga0207640_10082781 3300025981 Bacteria 2198
549 Ga0207640_10094501 3300025981 Bacteria 2079
550 Ga0207640_10110565 3300025981 Bacteria 1947
551 Ga0207640_10699991 3300025981 Bacteria 868
552 Ga0207640_11263544 3300025981 Bacteria 658
553 Ga0207658_10019638 3300025986 Bacteria 4674
554 Ga0207658_10022338 3300025986 Bacteria 4405
555 Ga0207658_10060980 3300025986 Bacteria 2816
556 Ga0207658_10082890 3300025986 Bacteria 2463
557 Ga0207658_10433285 3300025986 Bacteria 1161
558 Ga0207658_10831241 3300025986 Bacteria 839
559 Ga0207658_11001033 3300025986 Bacteria 763
560 Ga0207658_11962576 3300025986 Unclassified 533
561 Ga0207677_10088942 3300026023 Bacteria 2241
562 Ga0207677_11192209 3300026023 Bacteria 697
563 Ga0207677_11224537 3300026023 Bacteria 688
564 Ga0207703_10014225 3300026035 Bacteria 6206
565 Ga0207703_10036826 3300026035 Bacteria 3896
566 Ga0207703_10282736 3300026035 Bacteria 1507
567 Ga0207703_10440708 3300026035 Bacteria 1215
568 Ga0207703_10601445 3300026035 Bacteria 1040
569 Ga0207703_10859204 3300026035 Bacteria 868
570 Ga0207639_10039565 3300026041 Bacteria 3514
571 Ga0207639_10425974 3300026041 Bacteria 1201
572 Ga0207678_10077076 3300026067 Bacteria 2855
573 Ga0207678_10081513 3300026067 Bacteria 2770
574 Ga0207678_10264948 3300026067 Bacteria 1473
575 Ga0207678_10292521 3300026067 Bacteria 1399
576 Ga0207678_11561065 3300026067 Bacteria 582
577 Ga0207708_10261482 3300026075 Bacteria 1397
578 Ga0207702_10197665 3300026078 Bacteria 1862
579 Ga0207702_11504987 3300026078 Bacteria 666
580 Ga0207702_11988689 3300026078 Unclassified 572
581 Ga0207641_10219619 3300026088 Bacteria 1762
582 Ga0207641_10347622 3300026088 Bacteria 1413
583 Ga0207641_10411492 3300026088 Bacteria 1300
584 Ga0207641_11638720 3300026088 Bacteria 645
585 Ga0207648_10003902 3300026089 Bacteria 15550
586 Ga0207648_10024219 3300026089 Bacteria 5422
587 Ga0207648_10034231 3300026089 Bacteria 4478
588 Ga0207648_10172541 3300026089 Bacteria 1912
589 Ga0207648_10477723 3300026089 Bacteria 1138
590 Ga0207648_10849287 3300026089 Bacteria 851
591 Ga0207648_10864382 3300026089 Bacteria 844
592 Ga0207676_10066601 3300026095 Bacteria 2873
593 Ga0207676_10296095 3300026095 Bacteria 1475
594 Ga0207676_11037557 3300026095 Bacteria 809
595 Ga0207674_10039264 3300026116 Bacteria 4908
596 Ga0207674_10829827 3300026116 Bacteria 892
597 Ga0207674_11846118 3300026116 Unclassified 571
598 Ga0207675_100015978 3300026118 Bacteria 7006
599 Ga0207675_100111715 3300026118 Bacteria 2579
600 Ga0207675_100132289 3300026118 Bacteria 2365
601 Ga0207675_100153753 3300026118 Bacteria 2191
602 Ga0207675_101681530 3300026118 Bacteria 655
603 Ga0207683_10000133 3300026121 Bacteria 61157
604 Ga0207683_10006603 3300026121 Bacteria 9927
605 Ga0207683_10124932 3300026121 Bacteria 2312
606 Ga0207683_10770050 3300026121 Bacteria 893
607 Ga0207683_11016479 3300026121 Bacteria 769
608 Ga0207698_10016189 3300026142 Bacteria 5018
609 Ga0207698_10121705 3300026142 Bacteria 2210
610 Ga0207698_10151986 3300026142 Bacteria 2011
611 Ga0207698_10220574 3300026142 Bacteria 1713
612 Ga0207698_11771343 3300026142 Bacteria 633
613 Ga0207698_11886918 3300026142 Bacteria 612
614 Ga0209281_1009550 3300027111 Bacteria 2273
615 Ga0209281_1029163 3300027111 Bacteria 998
616 Ga0209995_1020790 3300027471 Bacteria 1087
617 Ga0209982_1007086 3300027552 Bacteria 1638
618 Ga0209970_1016029 3300027614 Bacteria 1249
619 Ga0209983_1001756 3300027665 Bacteria 4800
620 Ga0209282_1000002 3300027666 Bacteria 1067825
621 Ga0209971_1041737 3300027682 Bacteria 1104
622 Ga0209974_10003884 3300027876 Bacteria 5351
623 Ga0268266_10005854 3300028379 Bacteria 11375
624 Ga0268266_10045453 3300028379 Bacteria 3756
625 Ga0268266_10399109 3300028379 Bacteria 1300
626 Ga0268266_10518022 3300028379 Bacteria 1140
627 Ga0268266_10522635 3300028379 Bacteria 1135
628 Ga0268266_10832539 3300028379 Bacteria 892
629 Ga0268266_11118884 3300028379 Bacteria 762
630 Ga0268266_11211901 3300028379 Bacteria 730
631 Ga0268266_11711516 3300028379 Bacteria 604
632 Ga0268265_10025981 3300028380 Bacteria 4163
633 Ga0268265_10051917 3300028380 Bacteria 3098
634 Ga0268265_11607699 3300028380 Bacteria 655
635 Ga0268265_12151680 3300028380 Bacteria 565
636 Ga0268264_10013805 3300028381 Bacteria 6643
637 Ga0268264_10337642 3300028381 Bacteria 1430
638 Ga0268264_10337807 3300028381 Bacteria 1430
639 Ga0268264_11809884 3300028381 Bacteria 621
640 Ga0314311_1058868 3300030733 Bacteria 1483
641 Ga0316179_1043648 3300030734 Bacteria 616
642 Ga0316178_1018302 3300030735 Bacteria 1234
643 Ga0316178_1162240 3300030735 Bacteria 952
644 Ga0316180_1182415 3300030736 Bacteria 2249
645 Ga0316181_1063650 3300030744 Bacteria 731
646 Ga0316182_1040109 3300030745 Bacteria 1091
647 Ga0316182_1423195 3300030745 Bacteria 2008
648 Ga0307408_102018375 3300031548 Bacteria 555
649 Ga0307408_102161790 3300031548 Unclassified 537
650 Ga0307408_102296887 3300031548 Bacteria 522
651 Ga0307508_10869251 3300031616 Bacteria 525
652 Ga0307413_10348692 3300031824 Bacteria 1141
653 Ga0307410_10173914 3300031852 Bacteria 1625
654 Ga0307406_10692327 3300031901 Bacteria 850
655 Ga0307412_10750418 3300031911 Bacteria 842
656 Ga0307412_11957523 3300031911 Bacteria 542
657 Ga0307416_100483523 3300032002 Bacteria 1299
658 Ga0307416_100977425 3300032002 Bacteria 949
659 Ga0307416_102172070 3300032002 Bacteria 657
660 Ga0307414_10032835 3300032004 Bacteria 3422
661 Ga0307414_11579506 3300032004 Bacteria 611
662 Ga0307411_10254974 3300032005 Bacteria 1382
663 Ga0307411_12040825 3300032005 Bacteria 536
664 Ga0373939_0037009 3300035114 Bacteria 1447
665 Ga0373939_0359489 3300035114 Unclassified 595
666 Ga0373955_1038558 3300035172 Unclassified 505
667 Ga0373962_0030329 3300035242 Bacteria 1479
668 Ga0373931_0039145 3300035691 Bacteria 2484
669 Ga0373927_0016950 3300035695 Bacteria 4801
670 Ga0373947_0450463 3300035725 Bacteria 872
671 Ga0373937_2078343 3300036401 Bacteria 514
672 Ga0373925_0077420 3300037068 Bacteria 2524
673 Ga0395899_0014265 3300037312 Bacteria 6067
674 Ga0395899_0028741 3300037312 Bacteria 4183
675 Ga0395899_0125689 3300037312 Bacteria 1834
676 Ga0395899_0138615 3300037312 Bacteria 1732
677 Ga0395899_0250816 3300037312 Bacteria 1214
678 Ga0395899_0351708 3300037312 Bacteria 985
679 Ga0395899_0361322 3300037312 Bacteria 969
680 Ga0395899_0361614 3300037312 Bacteria 968
681 Ga0395899_0634879 3300037312 Bacteria 676
682 Ga0395900_0001494 3300037418 Bacteria 27808
683 Ga0395900_0021829 3300037418 Bacteria 6545
684 Ga0395900_0047752 3300037418 Bacteria 4409
685 Ga0395900_0138452 3300037418 Bacteria 2493
686 Ga0395900_0139030 3300037418 Bacteria 2487
687 Ga0395900_0161730 3300037418 Bacteria 2283
688 Ga0395900_0288207 3300037418 Bacteria 1631
689 Ga0395900_0347433 3300037418 Bacteria 1457
690 Ga0395898_0196908 3300037466 Bacteria 1924
691 Ga0395898_0198622 3300037466 Bacteria 1915
692 Ga0395898_0212010 3300037466 Bacteria 1847
693 Ga0395898_0453878 3300037466 Bacteria 1220
694 Ga0395898_1063544 3300037466 Bacteria 743
695 Ga0395898_1162943 3300037466 Bacteria 703
696 Ga0395898_1822184 3300037466 Bacteria 529
697 Ga0395898_1987891 3300037466 Bacteria 501
698 Ga0395905_0198403 3300037471 Bacteria 1881
699 Ga0395905_0256158 3300037471 Bacteria 1634
700 Ga0395905_0304423 3300037471 Bacteria 1482
701 Ga0395905_0407115 3300037471 Bacteria 1255
702 Ga0395905_0542878 3300037471 Bacteria 1063
703 Ga0395901_0000307 3300038443 Bacteria 60012
704 Ga0395901_0113663 3300038443 Bacteria 2843
705 Ga0395901_0126863 3300038443 Bacteria 2681
706 Ga0395901_0209180 3300038443 Bacteria 2042
707 Ga0395901_0270454 3300038443 Bacteria 1767
708 Ga0395901_0350961 3300038443 Bacteria 1522
709 Ga0395901_0757520 3300038443 Bacteria 963
710 Ga0436361_0594176 3300039447 Bacteria 724
711 Ga0436361_0604351 3300039447 Bacteria 1263
712 Ga0436361_0715458 3300039447 Bacteria 2223
713 Ga0439439_0109738 3300041406 Bacteria 764
714 Ga0439465_0087983 3300041413 Bacteria 1060
715 Ga0451835_0902887 3300041492 Bacteria 743
716 Ga0451839_0120065 3300041496 Bacteria 658
717 Ga0451843_0217578 3300041509 Bacteria 528
718 Ga0451853_3236455 3300041512 Bacteria 993
719 Ga0439433_0050697 3300041999 Bacteria 978
720 Ga0439448_0011757 3300042005 Bacteria 2610
721 Ga0439448_0013577 3300042005 Bacteria 2449
722 Ga0439448_0133979 3300042005 Bacteria 855
723 Ga0439449_0004853 3300042007 Bacteria 5183
724 Ga0439454_079792 3300042011 Bacteria 592
725 Ga0439455_0059997 3300042012 Bacteria 1007
726 Ga0439458_0056572 3300042157 Bacteria 974
727 Ga0439458_0064848 3300042157 Bacteria 916
728 Ga0439458_0142327 3300042157 Bacteria 639
729 Ga0466969_0040955 3300044656 Bacteria 2319
730 Ga0466969_0083497 3300044656 Bacteria 1521
731 Ga0466969_0208581 3300044656 Bacteria 890
732 Ga0466969_0247245 3300044656 Bacteria 809
733 Ga0466972_0050496 3300044658 Bacteria 2007
734 Ga0466972_0187318 3300044658 Bacteria 970
735 Ga0466972_0302413 3300044658 Bacteria 747
736 Ga0466981_0488731 3300044669 Bacteria 697
737 Ga0466982_0538337 3300044672 Bacteria 594
738 Ga0466965_0009825 3300044683 Bacteria 4450
739 Ga0466965_0026965 3300044683 Bacteria 2786
740 Ga0466965_0050771 3300044683 Bacteria 2056
741 Ga0466965_0224624 3300044683 Bacteria 1001
742 Ga0466965_0252364 3300044683 Bacteria 946
743 Ga0466965_0855735 3300044683 Bacteria 528
744 Ga0466966_0012240 3300044684 Bacteria 5683
745 Ga0466966_0078906 3300044684 Bacteria 2052
746 Ga0466966_0210961 3300044684 Bacteria 1173
747 Ga0466966_0353044 3300044684 Bacteria 883
748 Ga0466961_0083269 3300044693 Bacteria 2023
749 Ga0466961_0319201 3300044693 Bacteria 947
750 Ga0466961_0680748 3300044693 Bacteria 616
751 Ga0466963_0059622 3300044694 Bacteria 2547
752 Ga0466963_0409524 3300044694 Bacteria 956
753 Ga0466963_0418318 3300044694 Bacteria 945
754 Ga0466963_0666384 3300044694 Bacteria 734
755 Ga0466963_1147463 3300044694 Bacteria 546
756 Ga0466964_0000552 3300044706 Bacteria 11764
757 Ga0466964_0033680 3300044706 Bacteria 2041
758 Ga0466964_0384223 3300044706 Bacteria 729
759 Ga0466964_0455036 3300044706 Bacteria 679
760 Ga0466971_0052468 3300044719 Bacteria 1836
761 Ga0466971_0088068 3300044719 Bacteria 1420
762 Ga0466968_0007533 3300044735 Bacteria 4143
763 Ga0466968_0250458 3300044735 Bacteria 841
764 Ga0466970_0162276 3300044765 Bacteria 1236
765 Ga0466970_0171504 3300044765 Bacteria 1202
766 Ga0466970_0330396 3300044765 Bacteria 863
767 Ga0466970_0340968 3300044765 Bacteria 849
768 Ga0466957_0000668 3300044842 Bacteria 17441
769 Ga0466957_0051398 3300044842 Bacteria 2508
770 Ga0466957_0086804 3300044842 Bacteria 1955
771 Ga0466957_0110014 3300044842 Bacteria 1746
772 Ga0466957_0323888 3300044842 Bacteria 1040
773 Ga0466957_0708193 3300044842 Bacteria 711
774 Ga0466960_0222389 3300044901 Bacteria 1039
775 Ga0466959_0043758 3300045049 Bacteria 3299
776 Ga0466959_0047700 3300045049 Bacteria 3150
777 Ga0466959_0081465 3300045049 Bacteria 2332
778 Ga0466959_0714228 3300045049 Bacteria 671
779 Ga0466958_0046174 3300045836 Bacteria 2628
780 Ga0466958_0301047 3300045836 Bacteria 1029
781 Ga0466958_0492134 3300045836 Bacteria 795
782 Ga0466967_0009493 3300045976 Bacteria 7223
783 Ga0466967_0031395 3300045976 Bacteria 4471
784 Ga0466967_0328960 3300045976 Bacteria 1475
785 Ga0495627_000915 3300046453 Bacteria 20456
786 Ga0495627_036768 3300046453 Bacteria 1520
787 Ga0495627_155408 3300046453 Bacteria 637
788 Ga0495603_0028708 3300046455 Bacteria 3356
789 Ga0495603_0055836 3300046455 Bacteria 2339
790 Ga0495603_0315462 3300046455 Bacteria 897
791 Ga0495603_0388289 3300046455 Bacteria 800
792 Ga0495590_0008345 3300046457 Bacteria 3957
793 Ga0495590_0026698 3300046457 Bacteria 2026
794 Ga0495590_0032462 3300046457 Bacteria 1826
795 Ga0495590_0214299 3300046457 Bacteria 710
796 Ga0495591_000893 3300046458 Bacteria 20883
797 Ga0495591_011947 3300046458 Bacteria 3258
798 Ga0495591_122164 3300046458 Bacteria 635
799 Ga0495629_0124313 3300046459 Bacteria 1797
800 Ga0495629_0340118 3300046459 Bacteria 1024
801 Ga0495638_0033948 3300046460 Bacteria 3259
802 Ga0495638_0060673 3300046460 Bacteria 2338
803 Ga0495638_0078119 3300046460 Bacteria 2014
804 Ga0495638_0131803 3300046460 Bacteria 1467
805 Ga0495638_0168730 3300046460 Bacteria 1257
806 Ga0495638_0169429 3300046460 Bacteria 1254
807 Ga0495638_0218367 3300046460 Bacteria 1067
808 Ga0495638_0321762 3300046460 Bacteria 826
809 Ga0495653_0028500 3300046463 Bacteria 4464
810 Ga0495653_0058852 3300046463 Bacteria 2919
811 Ga0495653_0297967 3300046463 Bacteria 1052
812 Ga0495650_0000391 3300046471 Bacteria 74982
813 Ga0495650_0001570 3300046471 Bacteria 21478
814 Ga0495650_0002148 3300046471 Bacteria 16739
815 Ga0495650_0025108 3300046471 Bacteria 2800
816 Ga0495650_0089685 3300046471 Bacteria 1171
817 Ga0495580_0009402 3300046472 Bacteria 7689
818 Ga0495580_0264633 3300046472 Bacteria 1175
819 Ga0495580_0429849 3300046472 Bacteria 887
820 Ga0495582_0020418 3300046473 Bacteria 3626
821 Ga0495582_0051053 3300046473 Bacteria 2280
822 Ga0495582_0102349 3300046473 Bacteria 1604
823 Ga0495582_0120275 3300046473 Bacteria 1479
824 Ga0495605_0000005 3300046474 Bacteria 376973
825 Ga0495605_0000276 3300046474 Bacteria 57745
826 Ga0495605_0012653 3300046474 Bacteria 4672
827 Ga0495605_0015789 3300046474 Bacteria 4102
828 Ga0495605_0020432 3300046474 Bacteria 3519
829 Ga0495605_0038749 3300046474 Bacteria 2389
830 Ga0495605_0133776 3300046474 Bacteria 1116
831 Ga0495605_0254020 3300046474 Bacteria 751
832 Ga0495639_0297710 3300046475 Bacteria 804
833 Ga0495639_0316473 3300046475 Bacteria 780
834 Ga0495584_0000011 3300046491 Bacteria 208322
835 Ga0495584_0001422 3300046491 Bacteria 14421
836 Ga0495584_0001472 3300046491 Bacteria 14115
837 Ga0495584_0005508 3300046491 Bacteria 6703
838 Ga0495584_0005815 3300046491 Bacteria 6499
839 Ga0495584_0005912 3300046491 Bacteria 6447
840 Ga0495584_0011529 3300046491 Bacteria 4528
841 Ga0495584_0027406 3300046491 Bacteria 2887
842 Ga0495584_0031834 3300046491 Bacteria 2669
843 Ga0495584_0037508 3300046491 Bacteria 2450
844 Ga0495584_0088559 3300046491 Bacteria 1560
845 Ga0495584_0325461 3300046491 Bacteria 780
846 Ga0495584_0440124 3300046491 Bacteria 663
847 Ga0495585_0000231 3300046492 Bacteria 57572
848 Ga0495585_0000661 3300046492 Bacteria 31722
849 Ga0495585_0002388 3300046492 Bacteria 13467
850 Ga0495585_0005416 3300046492 Bacteria 8049
851 Ga0495585_0011649 3300046492 Bacteria 5201
852 Ga0495585_0016127 3300046492 Bacteria 4331
853 Ga0495585_0017357 3300046492 Bacteria 4158
854 Ga0495585_0022952 3300046492 Bacteria 3581
855 Ga0495585_0040248 3300046492 Bacteria 2624
856 Ga0495585_0043165 3300046492 Bacteria 2523
857 Ga0495585_0044484 3300046492 Bacteria 2480
858 Ga0495585_0045810 3300046492 Bacteria 2440
859 Ga0495585_0099299 3300046492 Bacteria 1558
860 Ga0495585_0169492 3300046492 Bacteria 1128
861 Ga0495585_0222060 3300046492 Bacteria 953
862 Ga0495585_0283329 3300046492 Bacteria 818
863 Ga0495585_0365608 3300046492 Bacteria 699
864 Ga0495585_0539679 3300046492 Bacteria 551
865 Ga0495594_0011833 3300046499 Bacteria 4538
866 Ga0495594_0021249 3300046499 Bacteria 3463
867 Ga0495594_0036723 3300046499 Bacteria 2672
868 Ga0495594_0051108 3300046499 Bacteria 2274
869 Ga0495594_0054367 3300046499 Bacteria 2206
870 Ga0495594_0324754 3300046499 Bacteria 876
871 Ga0495594_0338716 3300046499 Bacteria 856
872 Ga0495594_0356054 3300046499 Bacteria 833
873 Ga0495594_0382486 3300046499 Bacteria 801
874 Ga0495596_0000167 3300046500 Bacteria 46189
875 Ga0495596_0001014 3300046500 Bacteria 16692
876 Ga0495596_0001935 3300046500 Bacteria 11457
877 Ga0495596_0007949 3300046500 Bacteria 4746
878 Ga0495596_0026810 3300046500 Bacteria 2320
879 Ga0495596_0029308 3300046500 Bacteria 2207
880 Ga0495596_0031074 3300046500 Bacteria 2135
881 Ga0495596_0042041 3300046500 Bacteria 1801
882 Ga0495596_0068204 3300046500 Bacteria 1382
883 Ga0495596_0143485 3300046500 Bacteria 927
884 Ga0495596_0150353 3300046500 Bacteria 904
885 Ga0495596_0240678 3300046500 Bacteria 702
886 Ga0495596_0241420 3300046500 Bacteria 701
887 Ga0495607_0000541 3300046501 Bacteria 36992
888 Ga0495607_0002543 3300046501 Bacteria 14752
889 Ga0495607_0007152 3300046501 Bacteria 7756
890 Ga0495607_0007566 3300046501 Bacteria 7499
891 Ga0495607_0011135 3300046501 Bacteria 6005
892 Ga0495607_0013308 3300046501 Bacteria 5395
893 Ga0495607_0037147 3300046501 Bacteria 2927
894 Ga0495607_0037367 3300046501 Bacteria 2917
895 Ga0495607_0039743 3300046501 Bacteria 2807
896 Ga0495607_0075265 3300046501 Bacteria 1871
897 Ga0495607_0077343 3300046501 Bacteria 1838
898 Ga0495607_0085457 3300046501 Bacteria 1723
899 Ga0495607_0172731 3300046501 Bacteria 1090
900 Ga0495607_0186214 3300046501 Bacteria 1037
901 Ga0495607_0285720 3300046501 Bacteria 781
902 Ga0495607_0432634 3300046501 Bacteria 593
903 Ga0495583_0000973 3300046506 Bacteria 32896
904 Ga0495583_0001039 3300046506 Bacteria 31364
905 Ga0495583_0002475 3300046506 Bacteria 15701
906 Ga0495583_0003003 3300046506 Bacteria 13506
907 Ga0495583_0003424 3300046506 Bacteria 12095
908 Ga0495583_0016509 3300046506 Bacteria 3965
909 Ga0495583_0024796 3300046506 Bacteria 3007
910 Ga0495583_0040804 3300046506 Bacteria 2177
911 Ga0495583_0046883 3300046506 Bacteria 1991
912 Ga0495583_0118288 3300046506 Bacteria 1117
913 Ga0495583_0141923 3300046506 Bacteria 999
914 Ga0495583_0177964 3300046506 Bacteria 871
915 Ga0495583_0206862 3300046506 Bacteria 796
916 Ga0495583_0284704 3300046506 Bacteria 658
917 Ga0495583_0412657 3300046506 Bacteria 530
918 Ga0495606_0000044 3300046507 Bacteria 212802
919 Ga0495606_0004147 3300046507 Bacteria 14690
920 Ga0495606_0007667 3300046507 Bacteria 9571
921 Ga0495606_0117704 3300046507 Bacteria 1594
922 Ga0495606_0135869 3300046507 Bacteria 1456
923 Ga0495606_0163968 3300046507 Bacteria 1294
924 Ga0495606_0363673 3300046507 Bacteria 764
925 Ga0495610_0000021 3300046512 Bacteria 336300
926 Ga0495610_0000670 3300046512 Bacteria 33331
927 Ga0495610_0006470 3300046512 Bacteria 8053
928 Ga0495610_0290292 3300046512 Bacteria 634
929 Ga0495616_0000513 3300046513 Bacteria 29356
930 Ga0495616_0001343 3300046513 Bacteria 17155
931 Ga0495616_0014810 3300046513 Bacteria 4354
932 Ga0495616_0026160 3300046513 Bacteria 3109
933 Ga0495616_0026806 3300046513 Bacteria 3062
934 Ga0495616_0030576 3300046513 Bacteria 2828
935 Ga0495616_0033581 3300046513 Bacteria 2671
936 Ga0495616_0050386 3300046513 Bacteria 2082
937 Ga0495616_0059048 3300046513 Bacteria 1887
938 Ga0495616_0070740 3300046513 Bacteria 1688
939 Ga0495616_0111796 3300046513 Bacteria 1268
940 Ga0495616_0180477 3300046513 Bacteria 938
941 Ga0495616_0193188 3300046513 Bacteria 898
942 Ga0495628_0113774 3300046516 Bacteria 2080
943 Ga0495630_0034352 3300046517 Bacteria 3787
944 Ga0495630_0128986 3300046517 Bacteria 1920
945 Ga0495631_0001460 3300046518 Bacteria 14333
946 Ga0495631_0002828 3300046518 Bacteria 9638
947 Ga0495631_0009060 3300046518 Bacteria 4984
948 Ga0495631_0010172 3300046518 Bacteria 4667
949 Ga0495631_0016695 3300046518 Bacteria 3491
950 Ga0495631_0017704 3300046518 Bacteria 3364
951 Ga0495631_0017820 3300046518 Bacteria 3353
952 Ga0495631_0022351 3300046518 Bacteria 2940
953 Ga0495631_0039135 3300046518 Bacteria 2105
954 Ga0495631_0040628 3300046518 Bacteria 2060
955 Ga0495631_0047668 3300046518 Bacteria 1880
956 Ga0495631_0057785 3300046518 Bacteria 1687
957 Ga0495631_0060076 3300046518 Bacteria 1650
958 Ga0495631_0073921 3300046518 Bacteria 1471
959 Ga0495631_0087777 3300046518 Bacteria 1339
960 Ga0495632_0001800 3300046519 Bacteria 17287
961 Ga0495632_0002267 3300046519 Bacteria 14828
962 Ga0495632_0005326 3300046519 Bacteria 8538
963 Ga0495632_0008341 3300046519 Bacteria 6369
964 Ga0495632_0010039 3300046519 Bacteria 5642
965 Ga0495632_0038108 3300046519 Bacteria 2435
966 Ga0495632_0047193 3300046519 Bacteria 2137
967 Ga0495632_0243404 3300046519 Bacteria 808
968 Ga0495632_0246601 3300046519 Bacteria 802
969 Ga0495637_0002124 3300046520 Bacteria 11128
970 Ga0495637_0036587 3300046520 Bacteria 2137
971 Ga0495637_0112935 3300046520 Bacteria 1051
972 Ga0495637_0162171 3300046520 Bacteria 838
973 Ga0495643_0000672 3300046522 Bacteria 40238
974 Ga0495643_0009379 3300046522 Bacteria 6085
975 Ga0495643_0014488 3300046522 Bacteria 4690
976 Ga0495643_0036703 3300046522 Bacteria 2691
977 Ga0495643_0081703 3300046522 Bacteria 1680
978 Ga0495643_0089486 3300046522 Bacteria 1590
979 Ga0495643_0097179 3300046522 Bacteria 1513
980 Ga0495643_0120133 3300046522 Bacteria 1328
981 Ga0495643_0129321 3300046522 Bacteria 1269
982 Ga0495644_0011476 3300046523 Bacteria 3410
983 Ga0495644_0025470 3300046523 Bacteria 2245
984 Ga0495644_0026300 3300046523 Bacteria 2208
985 Ga0495644_0029820 3300046523 Bacteria 2060
986 Ga0495644_0105894 3300046523 Bacteria 1065
987 Ga0495644_0164353 3300046523 Bacteria 851
988 Ga0495644_0203464 3300046523 Bacteria 763
989 Ga0495644_0310720 3300046523 Bacteria 617
990 Ga0495648_0000305 3300046524 Bacteria 54610
991 Ga0495648_0001823 3300046524 Bacteria 20505
992 Ga0495648_0006047 3300046524 Bacteria 9929
993 Ga0495648_0010172 3300046524 Bacteria 7194
994 Ga0495648_0013289 3300046524 Bacteria 6096
995 Ga0495648_0028695 3300046524 Bacteria 3702
996 Ga0495648_0044607 3300046524 Bacteria 2766
997 Ga0495648_0085246 3300046524 Bacteria 1785
998 Ga0495648_0088322 3300046524 Bacteria 1743
999 Ga0495648_0154615 3300046524 Bacteria 1192
1000 Ga0495648_0252550 3300046524 Bacteria 850
1001 Ga0495663_0011840 3300046525 Bacteria 2431
1002 Ga0495663_0078783 3300046525 Bacteria 1058
1003 Ga0495663_0356533 3300046525 Bacteria 533
1004 Ga0495666_0001755 3300046526 Bacteria 10695
1005 Ga0495666_0007423 3300046526 Bacteria 5495
1006 Ga0495666_0016804 3300046526 Bacteria 3643
1007 Ga0495666_0091741 3300046526 Bacteria 1433
1008 Ga0495666_0394005 3300046526 Bacteria 622
1009 Ga0495642_0000183 3300046528 Bacteria 37080
1010 Ga0495642_0001255 3300046528 Bacteria 11589
1011 Ga0495642_0007953 3300046528 Bacteria 4056
1012 Ga0495642_0012702 3300046528 Bacteria 3249
1013 Ga0495642_0014164 3300046528 Bacteria 3090
1014 Ga0495642_0016993 3300046528 Bacteria 2840
1015 Ga0495642_0025887 3300046528 Bacteria 2327
1016 Ga0495642_0033505 3300046528 Bacteria 2065
1017 Ga0495642_0034030 3300046528 Bacteria 2050
1018 Ga0495642_0065935 3300046528 Bacteria 1508
1019 Ga0495642_0115111 3300046528 Bacteria 1151
1020 Ga0495642_0117360 3300046528 Bacteria 1140
1021 Ga0495642_0267938 3300046528 Bacteria 747
1022 Ga0495642_0494475 3300046528 Bacteria 541
1023 Ga0495652_0004868 3300046529 Bacteria 12746
1024 Ga0495652_0067329 3300046529 Bacteria 3003
1025 Ga0495654_0012134 3300046530 Bacteria 4637
1026 Ga0495654_0027865 3300046530 Bacteria 2891
1027 Ga0495654_0034900 3300046530 Bacteria 2535
1028 Ga0495654_0046888 3300046530 Bacteria 2126
1029 Ga0495654_0096931 3300046530 Bacteria 1362
1030 Ga0495654_0136419 3300046530 Bacteria 1097
1031 Ga0495654_0155184 3300046530 Bacteria 1009
1032 Ga0495665_0019946 3300046531 Bacteria 3604
1033 Ga0495665_0056383 3300046531 Bacteria 2074
1034 Ga0495665_0120444 3300046531 Bacteria 1374
1035 Ga0495640_0086504 3300046533 Bacteria 2075
1036 Ga0495586_0004976 3300046535 Bacteria 7105
1037 Ga0495586_0012825 3300046535 Bacteria 4442
1038 Ga0495586_0095563 3300046535 Bacteria 1645
1039 Ga0495586_0103072 3300046535 Bacteria 1584
1040 Ga0495586_0452278 3300046535 Bacteria 740
1041 Ga0495587_0032789 3300046536 Bacteria 3137
1042 Ga0495587_0103788 3300046536 Bacteria 1636
1043 Ga0495598_0192449 3300046537 Bacteria 733
1044 Ga0495609_0005634 3300046538 Bacteria 6531
1045 Ga0495609_0006036 3300046538 Bacteria 6242
1046 Ga0495609_0008274 3300046538 Bacteria 5101
1047 Ga0495609_0018251 3300046538 Bacteria 3251
1048 Ga0495609_0039214 3300046538 Bacteria 2133
1049 Ga0495609_0039663 3300046538 Bacteria 2119
1050 Ga0495609_0044547 3300046538 Bacteria 1989
1051 Ga0495609_0079497 3300046538 Bacteria 1434
1052 Ga0495609_0266738 3300046538 Bacteria 702
1053 Ga0495597_0000750 3300046542 Bacteria 25631
1054 Ga0495597_0001696 3300046542 Bacteria 15257
1055 Ga0495597_0002408 3300046542 Bacteria 11907
1056 Ga0495597_0003492 3300046542 Bacteria 9117
1057 Ga0495597_0009047 3300046542 Bacteria 4947
1058 Ga0495597_0018655 3300046542 Bacteria 3253
1059 Ga0495597_0047011 3300046542 Bacteria 1911
1060 Ga0495597_0064538 3300046542 Bacteria 1590
1061 Ga0495597_0070070 3300046542 Bacteria 1512
1062 Ga0495597_0078307 3300046542 Bacteria 1416
1063 Ga0495597_0145064 3300046542 Bacteria 977
1064 Ga0495597_0148938 3300046542 Bacteria 961
1065 Ga0495597_0318896 3300046542 Bacteria 600
1066 Ga0495645_0017268 3300046543 Bacteria 5169
1067 Ga0495622_0004031 3300046557 Bacteria 6857
1068 Ga0495622_0004396 3300046557 Bacteria 6556
1069 Ga0495622_0027134 3300046557 Bacteria 2672
1070 Ga0495622_0052977 3300046557 Bacteria 1882
1071 Ga0495622_0117707 3300046557 Bacteria 1214
1072 Ga0495622_0259833 3300046557 Bacteria 762
1073 Ga0495622_0307603 3300046557 Bacteria 690
1074 Ga0495633_0001801 3300046558 Bacteria 15811
1075 Ga0495633_0004010 3300046558 Bacteria 9527
1076 Ga0495633_0005029 3300046558 Bacteria 8241
1077 Ga0495633_0007250 3300046558 Bacteria 6417
1078 Ga0495633_0016596 3300046558 Bacteria 3791
1079 Ga0495633_0022110 3300046558 Bacteria 3170
1080 Ga0495633_0057402 3300046558 Bacteria 1828
1081 Ga0495633_0058811 3300046558 Bacteria 1804
1082 Ga0495633_0106076 3300046558 Bacteria 1303
1083 Ga0495633_0109078 3300046558 Bacteria 1283
1084 Ga0495633_0126302 3300046558 Bacteria 1183
1085 Ga0495633_0195211 3300046558 Bacteria 930
1086 Ga0495633_0423340 3300046558 Bacteria 602
1087 Ga0495633_0513054 3300046558 Bacteria 540
1088 Ga0495667_0161036 3300046559 Bacteria 1443
1089 Ga0495667_0771660 3300046559 Bacteria 594
1090 Ga0495656_0001534 3300046615 Bacteria 7545
1091 Ga0495656_0009091 3300046615 Bacteria 3566
1092 Ga0495656_0034549 3300046615 Bacteria 2071
1093 Ga0495656_0072976 3300046615 Bacteria 1529
1094 Ga0495656_0079357 3300046615 Bacteria 1477
1095 Ga0495656_0575212 3300046615 Bacteria 602
1096 Ga0495656_0721638 3300046615 Bacteria 537
1097 Ga0495668_0000008 3300046616 Bacteria 498364
1098 Ga0495668_0000147 3300046616 Bacteria 106018
1099 Ga0495668_0002087 3300046616 Bacteria 17292
1100 Ga0495668_0002663 3300046616 Bacteria 14338
1101 Ga0495668_0006725 3300046616 Bacteria 7485
1102 Ga0495668_0007013 3300046616 Bacteria 7275
1103 Ga0495668_0011308 3300046616 Bacteria 5353
1104 Ga0495668_0018876 3300046616 Bacteria 3983
1105 Ga0495668_0026166 3300046616 Bacteria 3312
1106 Ga0495668_0038446 3300046616 Bacteria 2673
1107 Ga0495668_0040587 3300046616 Bacteria 2595
1108 Ga0495668_0049125 3300046616 Bacteria 2339
1109 Ga0495668_0107267 3300046616 Bacteria 1527
1110 Ga0495668_0124011 3300046616 Bacteria 1413
1111 Ga0495668_0257876 3300046616 Bacteria 954
1112 Ga0495668_0626220 3300046616 Bacteria 594
1113 Ga0495634_0071133 3300046642 Bacteria 2291
1114 Ga0495634_0382547 3300046642 Bacteria 838
1115 Ga0495634_0414708 3300046642 Bacteria 798
1116 Ga0495611_0004165 3300046648 Bacteria 6293
1117 Ga0495611_0008787 3300046648 Bacteria 4272
1118 Ga0495611_0013099 3300046648 Bacteria 3526
1119 Ga0495611_0018491 3300046648 Bacteria 2988
1120 Ga0495611_0027894 3300046648 Bacteria 2471
1121 Ga0495611_0037430 3300046648 Bacteria 2156
1122 Ga0495611_0061736 3300046648 Bacteria 1703
1123 Ga0495611_0377273 3300046648 Bacteria 649
1124 Ga0495625_0004860 3300046660 Bacteria 12532
1125 Ga0495625_0006363 3300046660 Bacteria 10542
1126 Ga0495625_0009751 3300046660 Bacteria 7993
1127 Ga0495625_0071803 3300046660 Bacteria 2428
1128 Ga0495625_0120141 3300046660 Bacteria 1789
1129 Ga0495625_0165047 3300046660 Bacteria 1481
1130 Ga0495625_0374666 3300046660 Bacteria 894
1131 Ga0495635_0061833 3300046663 Bacteria 2571
1132 Ga0495635_0253179 3300046663 Bacteria 1187
1133 Ga0495659_0006683 3300046664 Bacteria 3644
1134 Ga0495659_0063289 3300046664 Bacteria 1371
1135 Ga0495659_0096027 3300046664 Bacteria 1143
1136 Ga0495661_0002137 3300046665 Bacteria 15482
1137 Ga0495661_0007102 3300046665 Bacteria 7819
1138 Ga0495661_0007586 3300046665 Bacteria 7560
1139 Ga0495661_0009450 3300046665 Bacteria 6691
1140 Ga0495661_0010426 3300046665 Bacteria 6340
1141 Ga0495661_0013323 3300046665 Bacteria 5527
1142 Ga0495661_0021589 3300046665 Bacteria 4196
1143 Ga0495661_0027087 3300046665 Bacteria 3683
1144 Ga0495661_0033130 3300046665 Bacteria 3260
1145 Ga0495661_0036060 3300046665 Bacteria 3099
1146 Ga0495661_0039437 3300046665 Bacteria 2935
1147 Ga0495661_0044737 3300046665 Bacteria 2711
1148 Ga0495661_0047611 3300046665 Bacteria 2610
1149 Ga0495661_0051913 3300046665 Bacteria 2473
1150 Ga0495661_0059915 3300046665 Bacteria 2263
1151 Ga0495661_0076266 3300046665 Bacteria 1945
1152 Ga0495661_0076505 3300046665 Bacteria 1941
1153 Ga0495661_0080102 3300046665 Bacteria 1885
1154 Ga0495661_0090702 3300046665 Bacteria 1739
1155 Ga0495661_0149782 3300046665 Bacteria 1261
1156 Ga0495661_0216054 3300046665 Bacteria 995
1157 Ga0495661_0247407 3300046665 Bacteria 911
1158 Ga0495661_0445173 3300046665 Bacteria 624
1159 Ga0495661_0554911 3300046665 Bacteria 543
1160 Ga0495588_0000070 3300046674 Bacteria 227611
1161 Ga0495588_0021639 3300046674 Bacteria 3171
1162 Ga0495588_0024022 3300046674 Bacteria 3024
1163 Ga0495588_0028284 3300046674 Bacteria 2804
1164 Ga0495588_0036330 3300046674 Bacteria 2499
1165 Ga0495588_0037675 3300046674 Bacteria 2457
1166 Ga0495588_0056773 3300046674 Bacteria 2021
1167 Ga0495588_0087644 3300046674 Bacteria 1628
1168 Ga0495588_0131471 3300046674 Bacteria 1320
1169 Ga0495588_0134741 3300046674 Bacteria 1303
1170 Ga0495623_0005716 3300046679 Bacteria 8120
1171 Ga0495623_0016901 3300046679 Bacteria 4712
1172 Ga0495623_0072479 3300046679 Bacteria 2142
1173 Ga0495623_0194837 3300046679 Bacteria 1168
1174 Ga0495623_0211900 3300046679 Bacteria 1108
1175 Ga0495646_0118017 3300046680 Bacteria 1504
1176 Ga0495646_0567688 3300046680 Bacteria 578
1177 Ga0495669_0003622 3300046684 Bacteria 6361
1178 Ga0495669_0005289 3300046684 Bacteria 5377
1179 Ga0495669_0006862 3300046684 Bacteria 4767
1180 Ga0495669_0010378 3300046684 Bacteria 3934
1181 Ga0495669_0010911 3300046684 Bacteria 3845
1182 Ga0495669_0013578 3300046684 Bacteria 3473
1183 Ga0495669_0029766 3300046684 Bacteria 2395
1184 Ga0495669_0070653 3300046684 Bacteria 1590
1185 Ga0495669_0082095 3300046684 Bacteria 1480
1186 Ga0495669_0555180 3300046684 Bacteria 559
1187 Ga0495669_0566692 3300046684 Bacteria 552
1188 Ga0495613_0008593 3300046689 Bacteria 7580
1189 Ga0495613_0077562 3300046689 Bacteria 2417
1190 Ga0495613_0472519 3300046689 Bacteria 847
1191 Ga0495624_0053063 3300046690 Bacteria 2560
1192 Ga0495670_0000858 3300046691 Bacteria 14716
1193 Ga0495670_0007604 3300046691 Bacteria 5328
1194 Ga0495670_0010624 3300046691 Bacteria 4523
1195 Ga0495670_0020705 3300046691 Bacteria 3243
1196 Ga0495670_0024382 3300046691 Bacteria 2989
1197 Ga0495670_0037875 3300046691 Bacteria 2403
1198 Ga0495670_0055003 3300046691 Bacteria 1995
1199 Ga0495670_0089031 3300046691 Bacteria 1578
1200 Ga0495670_0212799 3300046691 Bacteria 1025
1201 Ga0495670_0333239 3300046691 Bacteria 815
1202 Ga0495670_0474476 3300046691 Bacteria 678
1203 Ga0495671_0000024 3300046692 Bacteria 246812
1204 Ga0495671_0001399 3300046692 Bacteria 16265
1205 Ga0495671_0001573 3300046692 Bacteria 15111
1206 Ga0495671_0010899 3300046692 Bacteria 5022
1207 Ga0495671_0031350 3300046692 Bacteria 2718
1208 Ga0495671_0077072 3300046692 Bacteria 1634
1209 Ga0495671_0105022 3300046692 Bacteria 1379
1210 Ga0495671_0114595 3300046692 Bacteria 1316
1211 Ga0495671_0147315 3300046692 Bacteria 1146
1212 Ga0495649_0001152 3300046694 Bacteria 20593
1213 Ga0495649_0001587 3300046694 Bacteria 17010
1214 Ga0495649_0005680 3300046694 Bacteria 7873
1215 Ga0495649_0023517 3300046694 Bacteria 3442
1216 Ga0495649_0070020 3300046694 Bacteria 1881
1217 Ga0495649_0070599 3300046694 Bacteria 1872
1218 Ga0495649_0083163 3300046694 Bacteria 1710
1219 Ga0495649_0212700 3300046694 Bacteria 1001
1220 Ga0495649_0241260 3300046694 Bacteria 930
1221 Ga0495649_0420604 3300046694 Bacteria 669
1222 Ga0495649_0548529 3300046694 Bacteria 572
1223 Ga0495589_0000175 3300046794 Bacteria 57368
1224 Ga0495589_0006172 3300046794 Bacteria 6326
1225 Ga0495589_0008611 3300046794 Bacteria 5319
1226 Ga0495589_0015652 3300046794 Bacteria 3899
1227 Ga0495589_0029680 3300046794 Bacteria 2757
1228 Ga0495589_0059859 3300046794 Bacteria 1871
1229 Ga0495589_0096445 3300046794 Bacteria 1433
1230 Ga0495589_0100072 3300046794 Bacteria 1403
1231 Ga0495589_0111488 3300046794 Bacteria 1320
1232 Ga0495589_0133853 3300046794 Bacteria 1189
1233 Ga0495589_0149748 3300046794 Bacteria 1114
1234 Ga0495589_0428732 3300046794 Bacteria 606
1235 Ga0495589_0509956 3300046794 Bacteria 549
1236 Ga0495600_0029364 3300046809 Bacteria 3560
1237 Ga0495600_0077432 3300046809 Bacteria 2171
1238 Ga0495660_0000113 3300046810 Bacteria 86593
1239 Ga0495660_0007231 3300046810 Bacteria 6535
1240 Ga0495660_0008596 3300046810 Bacteria 5975
1241 Ga0495660_0011822 3300046810 Bacteria 5060
1242 Ga0495660_0013074 3300046810 Bacteria 4811
1243 Ga0495660_0018065 3300046810 Bacteria 4055
1244 Ga0495660_0058835 3300046810 Bacteria 2068
1245 Ga0495660_0087344 3300046810 Bacteria 1626
1246 Ga0495660_0089041 3300046810 Bacteria 1607
1247 Ga0495660_0091058 3300046810 Bacteria 1585
1248 Ga0495660_0119957 3300046810 Bacteria 1331
1249 Ga0495660_0191455 3300046810 Bacteria 982
1250 Ga0495581_0036204 3300047315 Bacteria 2855
1251 Ga0495581_0106183 3300047315 Bacteria 1632
1252 Ga0495581_0128311 3300047315 Bacteria 1477
1253 Ga0495581_0239874 3300047315 Bacteria 1060
1254 Ga0495581_0326300 3300047315 Bacteria 896
1255 Ga0495604_0037771 3300047317 Bacteria 3801
1256 Ga0495604_0104486 3300047317 Bacteria 2075
1257 Ga0495604_0215908 3300047317 Bacteria 1323
1258 Ga0495604_0994598 3300047317 Bacteria 519
1259 Ga0495636_0002635 3300047318 Bacteria 6911
1260 Ga0495636_0024504 3300047318 Bacteria 2447
1261 Ga0495636_0024928 3300047318 Bacteria 2427
1262 Ga0495636_0094257 3300047318 Bacteria 1302
1263 Ga0495636_0459209 3300047318 Bacteria 612
1264 Ga0495674_0126304 3300047319 Bacteria 2158
1265 Ga0495674_1463061 3300047319 Bacteria 507
1266 Ga0495672_0000014 3300047320 Bacteria 505636
1267 Ga0495672_0000802 3300047320 Bacteria 33855
1268 Ga0495672_0001524 3300047320 Bacteria 22682
1269 Ga0495672_0008898 3300047320 Bacteria 7338
1270 Ga0495672_0049785 3300047320 Bacteria 2478
1271 Ga0495672_0075371 3300047320 Bacteria 1897
1272 Ga0495672_0081406 3300047320 Bacteria 1803
1273 Ga0495672_0091240 3300047320 Bacteria 1672
1274 Ga0495672_0232320 3300047320 Bacteria 904
1275 Ga0495672_0293467 3300047320 Bacteria 772
1276 Ga0495672_0371481 3300047320 Bacteria 659
1277 Ga0495676_0000635 3300047321 Bacteria 29072
1278 Ga0495676_0024556 3300047321 Bacteria 5215
1279 Ga0495680_0007985 3300047322 Bacteria 9647
1280 Ga0495680_0886271 3300047322 Bacteria 577
1281 Ga0495683_0004597 3300047323 Bacteria 7792
1282 Ga0495683_0014426 3300047323 Bacteria 4116
1283 Ga0495683_0018374 3300047323 Bacteria 3616
1284 Ga0495683_0051367 3300047323 Bacteria 2061
1285 Ga0495683_0084867 3300047323 Bacteria 1540
1286 Ga0495683_0092427 3300047323 Bacteria 1464
1287 Ga0495683_0123858 3300047323 Bacteria 1224
1288 Ga0495683_0131796 3300047323 Bacteria 1178
1289 Ga0495683_0300778 3300047323 Bacteria 689
1290 Ga0495687_000256 3300047443 Bacteria 71778
1291 Ga0495687_001662 3300047443 Bacteria 19944
1292 Ga0495687_002171 3300047443 Bacteria 16339
1293 Ga0495687_002621 3300047443 Bacteria 14113
1294 Ga0495687_012555 3300047443 Bacteria 4470
1295 Ga0495687_081327 3300047443 Bacteria 1267
1296 Ga0495675_0004484 3300047444 Bacteria 8459
1297 Ga0495675_0009446 3300047444 Bacteria 6068
1298 Ga0495675_0083856 3300047444 Bacteria 2006
1299 Ga0495675_0283877 3300047444 Bacteria 986
1300 Ga0495677_0000285 3300047445 Bacteria 22182
1301 Ga0495677_0000526 3300047445 Bacteria 16029
1302 Ga0495677_0002208 3300047445 Bacteria 7718
1303 Ga0495677_0002393 3300047445 Bacteria 7368
1304 Ga0495677_0004272 3300047445 Bacteria 5495
1305 Ga0495677_0006101 3300047445 Bacteria 4556
1306 Ga0495677_0013292 3300047445 Bacteria 2994
1307 Ga0495677_0022540 3300047445 Bacteria 2284
1308 Ga0495677_0023041 3300047445 Bacteria 2260
1309 Ga0495677_0081451 3300047445 Bacteria 1213
1310 Ga0495677_0133912 3300047445 Bacteria 949
1311 Ga0495677_0153867 3300047445 Bacteria 886
1312 Ga0495679_001976 3300047446 Bacteria 10913
1313 Ga0495679_008571 3300047446 Bacteria 4144
1314 Ga0495679_021490 3300047446 Bacteria 2226
1315 Ga0495679_038226 3300047446 Bacteria 1504
1316 Ga0495679_042065 3300047446 Bacteria 1411
1317 Ga0495679_050380 3300047446 Bacteria 1252
1318 Ga0495679_085372 3300047446 Bacteria 891
1319 Ga0495679_090044 3300047446 Bacteria 861
1320 Ga0495685_001659 3300047447 Bacteria 6859
1321 Ga0495685_017258 3300047447 Bacteria 2471
1322 Ga0495685_023277 3300047447 Bacteria 2132
1323 Ga0495685_042836 3300047447 Bacteria 1544
1324 Ga0495685_101556 3300047447 Bacteria 950
1325 Ga0495685_223931 3300047447 Bacteria 600
1326 Ga0495673_0000033 3300047469 Bacteria 354152
1327 Ga0495673_0000219 3300047469 Bacteria 84634
1328 Ga0495673_0026744 3300047469 Bacteria 2754
1329 Ga0495681_0002303 3300047470 Bacteria 13735
1330 Ga0495681_0002957 3300047470 Bacteria 11975
1331 Ga0495681_0003979 3300047470 Bacteria 10171
1332 Ga0495681_0004255 3300047470 Bacteria 9819
1333 Ga0495681_0009090 3300047470 Bacteria 6157
1334 Ga0495681_0016882 3300047470 Bacteria 4072
1335 Ga0495681_0016966 3300047470 Bacteria 4060
1336 Ga0495681_0026169 3300047470 Bacteria 3042
1337 Ga0495681_0045254 3300047470 Bacteria 2107
1338 Ga0495681_0046523 3300047470 Bacteria 2068
1339 Ga0495681_0087970 3300047470 Bacteria 1376
1340 Ga0495681_0116679 3300047470 Bacteria 1150
1341 Ga0495681_0149333 3300047470 Bacteria 981
1342 Ga0495681_0166863 3300047470 Bacteria 913
1343 Ga0495681_0224552 3300047470 Bacteria 752
1344 Ga0495681_0233152 3300047470 Bacteria 733
1345 Ga0495686_0000612 3300047472 Bacteria 49335
1346 Ga0495686_0007392 3300047472 Bacteria 8242
1347 Ga0495686_0007517 3300047472 Bacteria 8161
1348 Ga0495686_0026052 3300047472 Bacteria 3827
1349 Ga0495686_0040407 3300047472 Bacteria 2975
1350 Ga0495686_0052739 3300047472 Bacteria 2549
1351 Ga0495686_0057652 3300047472 Bacteria 2424
1352 Ga0495593_0065585 3300047673 Bacteria 1893
1353 Ga0495593_0090787 3300047673 Bacteria 1573
1354 Ga0495593_0191581 3300047673 Bacteria 1028
1355 Ga0495593_0199628 3300047673 Bacteria 1005
1356 Ga0495593_0240489 3300047673 Bacteria 907
1357 Ga0495602_0006516 3300048088 Bacteria 12245
1358 Ga0495602_0129568 3300048088 Bacteria 2014
1359 Ga0495614_0010297 3300048089 Bacteria 4123
1360 Ga0495614_0034116 3300048089 Bacteria 2188
1361 Ga0495614_0078450 3300048089 Bacteria 1429
1362 Ga0495615_0277052 3300048090 Bacteria 538
1363 Ga0495626_0000030 3300048091 Bacteria 202562
1364 Ga0495626_0001112 3300048091 Bacteria 22702
1365 Ga0495626_0003446 3300048091 Bacteria 10138
1366 Ga0495626_0008158 3300048091 Bacteria 5770
1367 Ga0495626_0013319 3300048091 Bacteria 4274
1368 Ga0495626_0017773 3300048091 Bacteria 3585
1369 Ga0495626_0019121 3300048091 Bacteria 3428
1370 Ga0495626_0037898 3300048091 Bacteria 2288
1371 Ga0495626_0050532 3300048091 Bacteria 1920
1372 Ga0495626_0069697 3300048091 Bacteria 1583
1373 Ga0495626_0118822 3300048091 Bacteria 1138
1374 Ga0495626_0129870 3300048091 Bacteria 1076
1375 Ga0495626_0147652 3300048091 Bacteria 993
1376 Ga0495626_0182393 3300048091 Bacteria 869
1377 Ga0496100_0015402 3300048903 Bacteria 4465
1378 Ga0496100_0522339 3300048903 Bacteria 916
1379 Ga0496100_0731895 3300048903 Bacteria 773
1380 Ga0496100_0748557 3300048903 Bacteria 764
1381 Ga0496100_0775748 3300048903 Bacteria 750
1382 Ga0496101_0022303 3300048904 Bacteria 4357
1383 Ga0496101_1151843 3300048904 Bacteria 608
1384 Ga0496102_0000107 3300048905 Bacteria 118250
1385 Ga0496102_0002399 3300048905 Bacteria 15993
1386 Ga0496102_0131601 3300048905 Bacteria 2342
1387 Ga0496102_0154892 3300048905 Bacteria 2154
1388 Ga0496102_0281805 3300048905 Bacteria 1567
1389 Ga0496102_0360849 3300048905 Bacteria 1368
1390 Ga0496102_0471576 3300048905 Bacteria 1176
1391 Ga0496102_0905887 3300048905 Bacteria 803
1392 Ga0496103_0013925 3300048906 Bacteria 4774
1393 Ga0496103_0024228 3300048906 Bacteria 3661
1394 Ga0496103_0027712 3300048906 Bacteria 3435
1395 Ga0496103_0114725 3300048906 Bacteria 1713
1396 Ga0496103_0272794 3300048906 Bacteria 1088
1397 Ga0496103_0459573 3300048906 Bacteria 816
1398 Ga0496103_0547058 3300048906 Bacteria 739
1399 Ga0496104_0514006 3300048907 Bacteria 1109
1400 Ga0496104_1176458 3300048907 Bacteria 670
1401 Ga0496105_0423836 3300048908 Bacteria 1053
1402 Ga0496105_0715560 3300048908 Bacteria 767
1403 Ga0496106_0415535 3300048909 Bacteria 1081
1404 Ga0496106_1048597 3300048909 Bacteria 640
1405 Ga0496107_0045165 3300048910 Bacteria 3168
1406 Ga0496107_0089723 3300048910 Bacteria 2245
1407 Ga0496107_0131886 3300048910 Bacteria 1845
1408 Ga0496108_0041836 3300048911 Bacteria 3826
1409 Ga0496108_0173153 3300048911 Bacteria 1868
1410 Ga0496108_1079097 3300048911 Bacteria 683
1411 Ga0496109_0022473 3300048912 Bacteria 5587
1412 Ga0496109_1039118 3300048912 Bacteria 757
1413 Ga0496109_1433848 3300048912 Bacteria 626
1414 Ga0496110_0000073 3300048913 Bacteria 51301
1415 Ga0496110_0017013 3300048913 Bacteria 6078
1416 Ga0496110_0215525 3300048913 Bacteria 1746
1417 Ga0496110_0408481 3300048913 Bacteria 1238
1418 Ga0496110_0729724 3300048913 Bacteria 893
1419 Ga0496110_1500749 3300048913 Bacteria 584
1420 Ga0496110_1800402 3300048913 Bacteria 522
1421 Ga0496111_0023601 3300048914 Bacteria 4320
1422 Ga0496111_0076108 3300048914 Bacteria 2446
1423 Ga0496111_0243968 3300048914 Bacteria 1334
1424 Ga0496111_0244250 3300048914 Bacteria 1333
1425 Ga0496111_0308709 3300048914 Bacteria 1172
1426 Ga0496111_0342449 3300048914 Bacteria 1107
1427 Ga0496111_0419145 3300048914 Bacteria 989
1428 Ga0496113_0006791 3300048916 Bacteria 7293
1429 Ga0496113_0115806 3300048916 Bacteria 2091
1430 Ga0496113_0534784 3300048916 Bacteria 940
1431 Ga0496114_0819080 3300048917 Bacteria 810
1432 Ga0496115_0005153 3300048918 Bacteria 9510
1433 Ga0496115_0131387 3300048918 Bacteria 2064
1434 Ga0496115_0367281 3300048918 Bacteria 1172
1435 Ga0496115_0648522 3300048918 Bacteria 835
1436 Ga0496121_0010080 3300048924 Bacteria 10722
1437 Ga0496121_0319154 3300048924 Bacteria 1047
1438 Ga0496121_0397102 3300048924 Bacteria 904
1439 Ga0496122_0004240 3300048925 Bacteria 17984
1440 Ga0496122_0005480 3300048925 Bacteria 15100
1441 Ga0496122_0014909 3300048925 Bacteria 7481
1442 Ga0496122_0166992 3300048925 Bacteria 1333
1443 Ga0496123_0004584 3300048926 Bacteria 14394
1444 Ga0496123_0004651 3300048926 Bacteria 14248
1445 Ga0496123_0093325 3300048926 Bacteria 1778
1446 Ga0496124_0025849 3300048927 Bacteria 5307
1447 Ga0496124_0042104 3300048927 Bacteria 3934
1448 Ga0496124_0045034 3300048927 Bacteria 3783
1449 Ga0496124_0073546 3300048927 Bacteria 2828
1450 Ga0496124_0088863 3300048927 Bacteria 2524
1451 Ga0496124_0158903 3300048927 Bacteria 1764
1452 Ga0496124_0221766 3300048927 Bacteria 1421
1453 Ga0496124_0348273 3300048927 Bacteria 1049
1454 Ga0496124_0923772 3300048927 Bacteria 527
1455 Ga0496124_0989646 3300048927 Bacteria 502
1456 Ga0496125_0005966 3300048928 Bacteria 13335
1457 Ga0496125_0166028 3300048928 Bacteria 1491
1458 Ga0496125_0272016 3300048928 Bacteria 1055
1459 Ga0496126_0039407 3300048929 Bacteria 4384
1460 Ga0501308_029752 3300049128 Bacteria 727
1461 Ga0495678_000230 3300049459 Bacteria 64445
1462 Ga0495678_000523 3300049459 Bacteria 37505
1463 Ga0495678_001473 3300049459 Bacteria 18420
1464 Ga0495678_004643 3300049459 Bacteria 7881
1465 Ga0495678_011801 3300049459 Bacteria 4167
1466 Ga0495678_031893 3300049459 Bacteria 2191
1467 Ga0495678_071428 3300049459 Bacteria 1271
1468 Ga0495678_141569 3300049459 Bacteria 786
1469 Ga0495678_166213 3300049459 Bacteria 701
1470 Ga0495682_0001242 3300049460 Bacteria 14423
1471 Ga0495682_0008310 3300049460 Bacteria 4094
1472 Ga0495682_0008772 3300049460 Bacteria 3976
1473 Ga0495682_0017767 3300049460 Bacteria 2680
1474 Ga0495682_0169457 3300049460 Bacteria 777
1475 Ga0495682_0285193 3300049460 Bacteria 583
1476 Ga0501336_012305 3300049552 Bacteria 705
1477 Ga0501034_0039455 3300049571 Bacteria 4783
1478 Ga0501036_0231432 3300049572 Bacteria 1551
1479 Ga0501036_0966774 3300049572 Bacteria 698
1480 Ga0501042_0915141 3300049578 Bacteria 639
1481 Ga0501043_1185868 3300049579 Bacteria 537
1482 Ga0501047_0481759 3300049581 Bacteria 1068
1483 Ga0501047_0512813 3300049581 Bacteria 1025
1484 Ga0501048_1072039 3300049582 Bacteria 580
1485 Ga0501067_0011741 3300049583 Bacteria 4852
1486 Ga0501067_0578406 3300049583 Bacteria 629
1487 Ga0501069_0464898 3300049585 Bacteria 753
1488 Ga0501070_0022870 3300049586 Bacteria 5232
1489 Ga0501070_0734491 3300049586 Bacteria 779
1490 Ga0501072_0296063 3300049588 Bacteria 1286
1491 Ga0501072_0324694 3300049588 Bacteria 1223
1492 Ga0501073_0036699 3300049589 Bacteria 3481
1493 Ga0501076_1489561 3300049592 Bacteria 556
1494 Ga0501238_005850 3300049671 Bacteria 1573
1495 Ga0501240_087372 3300049673 Bacteria 585
1496 Ga0501249_081265 3300049679 Bacteria 763
1497 Ga0501079_0396811 3300049741 Bacteria 1082
1498 Ga0501080_0020160 3300049742 Bacteria 6171
1499 Ga0501080_0332827 3300049742 Bacteria 1373
1500 Ga0501083_0083255 3300049744 Bacteria 2119
1501 Ga0501263_050956 3300049760 Bacteria 630
1502 Ga0501035_0024716 3300049822 Bacteria 5507
1503 Ga0501044_0484661 3300049823 Bacteria 1139
1504 nmdc:mga0k408_690643_c1 3300050493 Bacteria 598
1505 nmdc:mga05p37_1300868_c1 3300050507 Bacteria 741
1506 nmdc:mga05p37_2069381_c1 3300050507 Bacteria 535
1507 nmdc:mga06r32_1483801_c1 3300050510 Unclassified 618
1508 nmdc:mga08y16_1491405_c1 3300050511 Bacteria 637
1509 nmdc:mga0n895_143557_c1 3300050512 Bacteria 2416
1510 nmdc:mga0n895_148088_c1 3300050512 Bacteria 2377
1511 nmdc:mga0rr50_46757_c1 3300050513 Bacteria 3187
1512 nmdc:mga0a205_241953_c1 3300050515 Bacteria 1685
1513 Ga0587070_108964 3300059491 Bacteria 648
1514 Ga0587083_0063905 3300059505 Bacteria 837
1515 Ga0587088_084515 3300059508 Bacteria 685
1516 Ga0587091_144887 3300059511 Bacteria 598
1517 Ga0587098_051426 3300059604 Bacteria 626
1518 Ga0587101_092632 3300059623 Bacteria 590
1519 Ga0587079_051086 3300059647 Bacteria 868
1520 Ga0501082_0631383 3300060353 Bacteria 937
1521 Ga0466962_0090693 3300061719 Bacteria 1464
1522 Ga0466962_0099875 3300061719 Bacteria 1393
1523 Ga0466962_0119251 3300061719 Bacteria 1272

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005539 Ga0068853_100073590 Ga0068853_1000735901 56
2 3300005618 Ga0068864_100045559 Ga0068864_1000455594 56
3 3300025931 Ga0207644_10396446 Ga0207644_103964462 56
4 3300025940 Ga0207691_10006372 Ga0207691_100063725 56
5 3300025960 Ga0207651_11521131 Ga0207651_115211312 56
6 3300025986 Ga0207658_10060980 Ga0207658_100609803 56
7 3300026142 Ga0207698_10016189 Ga0207698_100161893 56
8 iso_pu_bacteria 2738541297 2738825740 57
9 iso_pu_bacteria 2738541357 2739149537 57
10 iso_pu_bacteria 2738543003 2739191456 57
11 iso_pu_bacteria 2738543026 2739317933 57
12 iso_pu_bacteria 2738543029 2739336174 57
13 iso_pu_bacteria 2857553236 2857554895 57
14 3300005328 Ga0070676_10927898 Ga0070676_109278982 58
15 3300005333 Ga0070677_10059181 Ga0070677_100591812 58
16 3300005335 Ga0070666_10010423 Ga0070666_100104233 58
17 3300005338 Ga0068868_100855323 Ga0068868_1008553232 58
18 3300005347 Ga0070668_100038060 Ga0070668_1000380602 58
19 3300005356 Ga0070674_100012729 Ga0070674_1000127296 58
20 3300005364 Ga0070673_101281300 Ga0070673_1012813002 58
21 3300005367 Ga0070667_100045561 Ga0070667_1000455612 58
22 3300005456 Ga0070678_101780228 Ga0070678_1017802282 58
23 3300005466 Ga0070685_11234918 Ga0070685_112349181 58
24 3300005548 Ga0070665_100011044 Ga0070665_1000110446 58
25 3300005719 Ga0068861_101332348 Ga0068861_1013323482 58
26 3300005841 Ga0068863_100032414 Ga0068863_1000324145 58
27 3300006237 Ga0097621_100204644 Ga0097621_1002046442 58
28 3300006358 Ga0068871_100062575 Ga0068871_1000625755 58
29 3300006881 Ga0068865_100105285 Ga0068865_1001052853 58
30 3300013296 Ga0157374_11575314 Ga0157374_115753142 58
31 3300013306 Ga0163162_11534257 Ga0163162_115342572 58
32 3300013308 Ga0157375_10726496 Ga0157375_107264962 58
33 3300025893 Ga0207682_10088790 Ga0207682_100887902 58
34 3300025903 Ga0207680_10490789 Ga0207680_104907892 58
35 3300025931 Ga0207644_10073521 Ga0207644_100735212 58
36 3300025937 Ga0207669_10017906 Ga0207669_100179062 58
37 3300025938 Ga0207704_10320033 Ga0207704_103200332 58
38 3300025960 Ga0207651_10844961 Ga0207651_108449612 58
39 3300025972 Ga0207668_10067696 Ga0207668_100676962 58
40 3300025986 Ga0207658_10019638 Ga0207658_100196384 58
41 3300026023 Ga0207677_11224537 Ga0207677_112245372 58
42 3300026121 Ga0207683_10006603 Ga0207683_100066038 58
43 3300026121 Ga0207683_10124932 Ga0207683_101249323 58
44 3300028379 Ga0268266_10005854 Ga0268266_100058545 58
45 iso_pu_bacteria 2643221554 2643790940 58
46 iso_pu_bacteria 2643221638 2644214932 58
47 iso_pu_bacteria 2643221645 2644249437 58
48 iso_pu_bacteria 2738541280 2738740854 58
49 iso_pu_bacteria 2738541300 2738845175 58
50 iso_pu_bacteria 2738543018 2739274770 58
51 iso_pu_bacteria 2738543030 2739343814 58
52 iso_pu_bacteria 2919476304 2919479016 58
53 3300005329 Ga0070683_102088025 Ga0070683_1020880252 59
54 3300005331 Ga0070670_100238035 Ga0070670_1002380352 59
55 3300005337 Ga0070682_100310125 Ga0070682_1003101251 59
56 3300005339 Ga0070660_100762662 Ga0070660_1007626622 59
57 3300005344 Ga0070661_100012593 Ga0070661_1000125936 59
58 3300005347 Ga0070668_101783836 Ga0070668_1017838362 59
59 3300005355 Ga0070671_100448569 Ga0070671_1004485692 59
60 3300005356 Ga0070674_101035637 Ga0070674_1010356372 59
61 3300005366 Ga0070659_100156241 Ga0070659_1001562412 59
62 3300005439 Ga0070711_102033469 Ga0070711_1020334692 59
63 3300005440 Ga0070705_101059937 Ga0070705_1010599372 59
64 3300005445 Ga0070708_100000133 Ga0070708_10000013311 59
65 3300005455 Ga0070663_100081595 Ga0070663_1000815953 59
66 3300005456 Ga0070678_100805880 Ga0070678_1008058801 59
67 3300005543 Ga0070672_100514251 Ga0070672_1005142512 59
68 3300005543 Ga0070672_101060861 Ga0070672_1010608612 59
69 3300005549 Ga0070704_100676588 Ga0070704_1006765882 59
70 3300005564 Ga0070664_100005997 Ga0070664_1000059974 59
71 3300005577 Ga0068857_100380950 Ga0068857_1003809502 59
72 3300005616 Ga0068852_100206082 Ga0068852_1002060822 59
73 3300005617 Ga0068859_102748906 Ga0068859_1027489062 59
74 3300005617 Ga0068859_102825347 Ga0068859_1028253472 59
75 3300005719 Ga0068861_101474782 Ga0068861_1014747821 59
76 3300005834 Ga0068851_10003475 Ga0068851_100034754 59
77 3300005842 Ga0068858_100511682 Ga0068858_1005116822 59
78 3300006237 Ga0097621_102284412 Ga0097621_1022844122 59
79 3300006844 Ga0075428_100385438 Ga0075428_1003854382 59
80 3300006931 Ga0097620_102748872 Ga0097620_1027488722 59
81 3300006931 Ga0097620_102825148 Ga0097620_1028251481 59
82 3300009177 Ga0105248_12572172 Ga0105248_125721722 59
83 3300013102 Ga0157371_10370695 Ga0157371_103706952 59
84 3300013105 Ga0157369_10868506 Ga0157369_108685062 59
85 3300013296 Ga0157374_10422569 Ga0157374_104225692 59
86 3300013297 Ga0157378_11729837 Ga0157378_117298372 59
87 3300013307 Ga0157372_10838602 Ga0157372_108386022 59
88 3300014326 Ga0157380_12834519 Ga0157380_128345191 59
89 3300014969 Ga0157376_11633773 Ga0157376_116337732 59
90 3300025321 Ga0207656_10107968 Ga0207656_101079682 59
91 3300025903 Ga0207680_11114922 Ga0207680_111149221 59
92 3300025909 Ga0207705_10833828 Ga0207705_108338282 59
93 3300025916 Ga0207663_11619838 Ga0207663_116198382 59
94 3300025919 Ga0207657_10144069 Ga0207657_101440692 59
95 3300025920 Ga0207649_10097664 Ga0207649_100976642 59
96 3300025925 Ga0207650_10006340 Ga0207650_100063402 59
97 3300025931 Ga0207644_10191598 Ga0207644_101915982 59
98 3300025944 Ga0207661_11525248 Ga0207661_115252481 59
99 3300025945 Ga0207679_10030854 Ga0207679_100308542 59
100 3300025945 Ga0207679_11853047 Ga0207679_118530472 59
101 3300025949 Ga0207667_11820104 Ga0207667_118201042 59
102 3300025960 Ga0207651_10348725 Ga0207651_103487252 59
103 3300025981 Ga0207640_10094501 Ga0207640_100945012 59
104 3300025986 Ga0207658_11962576 Ga0207658_119625762 59
105 3300026023 Ga0207677_11192209 Ga0207677_111922092 59
106 3300026035 Ga0207703_10601445 Ga0207703_106014452 59
107 3300026035 Ga0207703_10859204 Ga0207703_108592042 59
108 3300026067 Ga0207678_10081513 Ga0207678_100815133 59
109 3300026095 Ga0207676_11037557 Ga0207676_110375572 59
110 3300026116 Ga0207674_11846118 Ga0207674_118461182 59
111 3300026121 Ga0207683_10770050 Ga0207683_107700501 59
112 3300026142 Ga0207698_10220574 Ga0207698_102205742 59
113 3300035172 Ga0373955_1038558 Ga0373955_1038558_277_474 59
114 3300036401 Ga0373937_2078343 Ga0373937_2078343_266_463 59
115 3300041492 Ga0451835_0902887 Ga0451835_0902887_202_399 59
116 3300046492 Ga0495585_0365608 Ga0495585_0365608_189_386 59
117 3300048918 Ga0496115_0131387 Ga0496115_0131387_777_974 59
118 3300050510 nmdc:mga06r32_1483801_c1 nmdc:mga06r32_1483801_c1_22_237 59
119 iso_pu_bacteria 2842711865 2842713761 59
120 iso_pu_bacteria 2857558681 2857562271 59
121 3300003215 JGI25153J46596_10009071 JGI25153J46596_100090715 60
122 3300003771 Ga0055526_1003371 Ga0055526_10033717 60
123 3300005331 Ga0070670_100044483 Ga0070670_1000444832 60
124 3300005335 Ga0070666_10534339 Ga0070666_105343392 60
125 3300005336 Ga0070680_101151835 Ga0070680_1011518352 60
126 3300005338 Ga0068868_101617968 Ga0068868_1016179682 60
127 3300005340 Ga0070689_100528275 Ga0070689_1005282752 60
128 3300005341 Ga0070691_10791207 Ga0070691_107912072 60
129 3300005344 Ga0070661_100381808 Ga0070661_1003818081 60
130 3300005344 Ga0070661_100996533 Ga0070661_1009965332 60
131 3300005347 Ga0070668_100046330 Ga0070668_1000463304 60
132 3300005354 Ga0070675_100220892 Ga0070675_1002208923 60
133 3300005355 Ga0070671_100024028 Ga0070671_1000240284 60
134 3300005355 Ga0070671_100127720 Ga0070671_1001277202 60
135 3300005356 Ga0070674_100306077 Ga0070674_1003060772 60
136 3300005364 Ga0070673_100991953 Ga0070673_1009919531 60
137 3300005366 Ga0070659_100241602 Ga0070659_1002416022 60
138 3300005441 Ga0070700_100727733 Ga0070700_1007277332 60
139 3300005455 Ga0070663_101952830 Ga0070663_1019528301 60
140 3300005456 Ga0070678_100270566 Ga0070678_1002705662 60
141 3300005543 Ga0070672_100176359 Ga0070672_1001763592 60
142 3300005548 Ga0070665_100142966 Ga0070665_1001429664 60
143 3300005548 Ga0070665_101263292 Ga0070665_1012632921 60
144 3300005563 Ga0068855_100661580 Ga0068855_1006615802 60
145 3300005564 Ga0070664_100380118 Ga0070664_1003801182 60
146 3300005564 Ga0070664_101801496 Ga0070664_1018014961 60
147 3300005577 Ga0068857_100274151 Ga0068857_1002741512 60
148 3300005578 Ga0068854_100223809 Ga0068854_1002238093 60
149 3300005616 Ga0068852_100126901 Ga0068852_1001269014 60
150 3300005617 Ga0068859_102269884 Ga0068859_1022698842 60
151 3300005617 Ga0068859_102309756 Ga0068859_1023097562 60
152 3300005618 Ga0068864_101720323 Ga0068864_1017203232 60
153 3300005719 Ga0068861_100039895 Ga0068861_1000398951 60
154 3300005834 Ga0068851_10058716 Ga0068851_100587162 60
155 3300005841 Ga0068863_100152835 Ga0068863_1001528352 60
156 3300005842 Ga0068858_100016937 Ga0068858_1000169374 60
157 3300005842 Ga0068858_100531518 Ga0068858_1005315182 60
158 3300005843 Ga0068860_100152816 Ga0068860_1001528163 60
159 3300005843 Ga0068860_100818437 Ga0068860_1008184371 60
160 3300005843 Ga0068860_102001362 Ga0068860_1020013622 60
161 3300005844 Ga0068862_101567735 Ga0068862_1015677352 60
162 3300005985 Ga0081539_10076122 Ga0081539_100761222 60
163 3300006931 Ga0097620_102269903 Ga0097620_1022699032 60
164 3300006931 Ga0097620_102310119 Ga0097620_1023101192 60
165 3300009148 Ga0105243_11558536 Ga0105243_115585361 60
166 3300009177 Ga0105248_10230519 Ga0105248_102305191 60
167 3300009177 Ga0105248_10537816 Ga0105248_105378162 60
168 3300009177 Ga0105248_12219715 Ga0105248_122197152 60
169 3300009551 Ga0105238_11668142 Ga0105238_116681421 60
170 3300013306 Ga0163162_10745223 Ga0163162_107452232 60
171 3300013308 Ga0157375_10742023 Ga0157375_107420232 60
172 3300014968 Ga0157379_10004686 Ga0157379_100046866 60
173 3300017792 Ga0163161_11010145 Ga0163161_110101452 60
174 3300025245 Ga0207425_1001644 Ga0207425_10016445 60
175 3300025263 Ga0209565_1024423 Ga0209565_10244233 60
176 3300025294 Ga0209025_1006507 Ga0209025_100650710 60
177 3300025295 Ga0209564_1000026 Ga0209564_1000026192 60
178 3300025297 Ga0209758_1000314 Ga0209758_100031476 60
179 3300025315 Ga0207697_10098252 Ga0207697_100982522 60
180 3300025321 Ga0207656_10411906 Ga0207656_104119061 60
181 3300025893 Ga0207682_10116098 Ga0207682_101160982 60
182 3300025901 Ga0207688_10315124 Ga0207688_103151241 60
183 3300025903 Ga0207680_10129237 Ga0207680_101292372 60
184 3300025903 Ga0207680_10260380 Ga0207680_102603802 60
185 3300025907 Ga0207645_10029705 Ga0207645_100297054 60
186 3300025915 Ga0207693_10276442 Ga0207693_102764422 60
187 3300025925 Ga0207650_10149150 Ga0207650_101491503 60
188 3300025925 Ga0207650_10301466 Ga0207650_103014662 60
189 3300025926 Ga0207659_11353677 Ga0207659_113536772 60
190 3300025931 Ga0207644_10029990 Ga0207644_100299903 60
191 3300025932 Ga0207690_10509945 Ga0207690_105099452 60
192 3300025933 Ga0207706_10457026 Ga0207706_104570263 60
193 3300025937 Ga0207669_10026360 Ga0207669_100263604 60
194 3300025940 Ga0207691_10012848 Ga0207691_100128488 60
195 3300025945 Ga0207679_10091484 Ga0207679_100914842 60
196 3300025945 Ga0207679_10361540 Ga0207679_103615402 60
197 3300025945 Ga0207679_10970334 Ga0207679_109703342 60
198 3300025949 Ga0207667_10552718 Ga0207667_105527182 60
199 3300025960 Ga0207651_10051601 Ga0207651_100516014 60
200 3300025972 Ga0207668_10129019 Ga0207668_101290192 60
201 3300025981 Ga0207640_10110565 Ga0207640_101105653 60
202 3300025986 Ga0207658_10022338 Ga0207658_100223382 60
203 3300026035 Ga0207703_10282736 Ga0207703_102827362 60
204 3300026035 Ga0207703_10440708 Ga0207703_104407082 60
205 3300026067 Ga0207678_11561065 Ga0207678_115610652 60
206 3300026088 Ga0207641_10219619 Ga0207641_102196192 60
207 3300026089 Ga0207648_10034231 Ga0207648_100342312 60
208 3300026118 Ga0207675_100111715 Ga0207675_1001117151 60
209 3300026118 Ga0207675_100153753 Ga0207675_1001537532 60
210 3300026142 Ga0207698_10151986 Ga0207698_101519862 60
211 3300028379 Ga0268266_10522635 Ga0268266_105226352 60
212 3300028379 Ga0268266_10832539 Ga0268266_108325392 60
213 3300028380 Ga0268265_11607699 Ga0268265_116076992 60
214 3300028381 Ga0268264_11809884 Ga0268264_118098842 60
215 3300031548 Ga0307408_102161790 Ga0307408_1021617902 60
216 3300032002 Ga0307416_100483523 Ga0307416_1004835232 60
217 3300035114 Ga0373939_0037009 Ga0373939_0037009_928_1119 60
218 3300035242 Ga0373962_0030329 Ga0373962_0030329_354_563 60
219 3300046460 Ga0495638_0060673 Ga0495638_0060673_186_380 60
220 3300046471 Ga0495650_0001570 Ga0495650_0001570_7444_7635 60
221 3300046471 Ga0495650_0002148 Ga0495650_0002148_13571_13765 60
222 3300046474 Ga0495605_0000005 Ga0495605_0000005_312825_313019 60
223 3300046501 Ga0495607_0007566 Ga0495607_0007566_4223_4417 60
224 3300046507 Ga0495606_0000044 Ga0495606_0000044_149385_149579 60
225 3300046512 Ga0495610_0006470 Ga0495610_0006470_6475_6669 60
226 3300046522 Ga0495643_0089486 Ga0495643_0089486_509_703 60
227 3300046558 Ga0495633_0007250 Ga0495633_0007250_3141_3335 60
228 3300046616 Ga0495668_0000147 Ga0495668_0000147_25244_25438 60
229 3300046616 Ga0495668_0007013 Ga0495668_0007013_4349_4540 60
230 3300046660 Ga0495625_0006363 Ga0495625_0006363_6907_7101 60
231 3300046694 Ga0495649_0548529 Ga0495649_0548529_350_544 60
232 3300047472 Ga0495686_0007517 Ga0495686_0007517_1815_2009 60
233 3300048910 Ga0496107_0045165 Ga0496107_0045165_1721_1912 60
234 3300048913 Ga0496110_0215525 Ga0496110_0215525_1305_1496 60
235 3300048914 Ga0496111_0342449 Ga0496111_0342449_337_528 60
236 3300048927 Ga0496124_0348273 Ga0496124_0348273_128_319 60
237 3300049578 Ga0501042_0915141 Ga0501042_0915141_71_262 60
238 3300050493 nmdc:mga0k408_690643_c1 nmdc:mga0k408_690643_c1_221_412 60
239 3300005293 Ga0065715_10286429 Ga0065715_102864291 61
240 3300005327 Ga0070658_11119261 Ga0070658_111192612 61
241 3300005328 Ga0070676_10007021 Ga0070676_100070213 61
242 3300005328 Ga0070676_10075272 Ga0070676_100752722 61
243 3300005330 Ga0070690_100254242 Ga0070690_1002542422 61
244 3300005331 Ga0070670_100109526 Ga0070670_1001095262 61
245 3300005331 Ga0070670_100267604 Ga0070670_1002676043 61
246 3300005331 Ga0070670_100324184 Ga0070670_1003241842 61
247 3300005331 Ga0070670_100708172 Ga0070670_1007081722 61
248 3300005333 Ga0070677_10000892 Ga0070677_100008924 61
249 3300005333 Ga0070677_10223564 Ga0070677_102235641 61
250 3300005334 Ga0068869_100011201 Ga0068869_1000112013 61
251 3300005334 Ga0068869_100873363 Ga0068869_1008733632 61
252 3300005334 Ga0068869_101547310 Ga0068869_1015473101 61
253 3300005334 Ga0068869_101618602 Ga0068869_1016186022 61
254 3300005335 Ga0070666_10004003 Ga0070666_100040035 61
255 3300005335 Ga0070666_10414163 Ga0070666_104141632 61
256 3300005336 Ga0070680_100636766 Ga0070680_1006367662 61
257 3300005336 Ga0070680_100738020 Ga0070680_1007380201 61
258 3300005336 Ga0070680_100987645 Ga0070680_1009876452 61
259 3300005338 Ga0068868_100103841 Ga0068868_1001038413 61
260 3300005338 Ga0068868_100590742 Ga0068868_1005907422 61
261 3300005338 Ga0068868_101379636 Ga0068868_1013796361 61
262 3300005339 Ga0070660_100727981 Ga0070660_1007279811 61
263 3300005340 Ga0070689_100641913 Ga0070689_1006419132 61
264 3300005340 Ga0070689_100749064 Ga0070689_1007490642 61
265 3300005344 Ga0070661_100104081 Ga0070661_1001040812 61
266 3300005344 Ga0070661_100446000 Ga0070661_1004460002 61
267 3300005344 Ga0070661_100485472 Ga0070661_1004854722 61
268 3300005344 Ga0070661_100670826 Ga0070661_1006708261 61
269 3300005344 Ga0070661_100682501 Ga0070661_1006825012 61
270 3300005347 Ga0070668_100004304 Ga0070668_1000043045 61
271 3300005347 Ga0070668_100064293 Ga0070668_1000642932 61
272 3300005347 Ga0070668_100248915 Ga0070668_1002489151 61
273 3300005347 Ga0070668_100330904 Ga0070668_1003309042 61
274 3300005347 Ga0070668_100768448 Ga0070668_1007684482 61
275 3300005353 Ga0070669_100598822 Ga0070669_1005988222 61
276 3300005353 Ga0070669_100689262 Ga0070669_1006892622 61
277 3300005354 Ga0070675_100012175 Ga0070675_1000121753 61
278 3300005354 Ga0070675_100023439 Ga0070675_1000234393 61
279 3300005354 Ga0070675_100203050 Ga0070675_1002030502 61
280 3300005354 Ga0070675_101455532 Ga0070675_1014555321 61
281 3300005354 Ga0070675_102098177 Ga0070675_1020981771 61
282 3300005355 Ga0070671_100046161 Ga0070671_1000461616 61
283 3300005355 Ga0070671_100433137 Ga0070671_1004331372 61
284 3300005355 Ga0070671_100748475 Ga0070671_1007484751 61
285 3300005356 Ga0070674_100022171 Ga0070674_1000221712 61
286 3300005356 Ga0070674_100435854 Ga0070674_1004358542 61
287 3300005364 Ga0070673_100013874 Ga0070673_1000138743 61
288 3300005364 Ga0070673_100043093 Ga0070673_1000430934 61
289 3300005364 Ga0070673_100835315 Ga0070673_1008353152 61
290 3300005364 Ga0070673_101025308 Ga0070673_1010253082 61
291 3300005365 Ga0070688_101573172 Ga0070688_1015731721 61
292 3300005367 Ga0070667_100035038 Ga0070667_1000350384 61
293 3300005367 Ga0070667_100075567 Ga0070667_1000755673 61
294 3300005367 Ga0070667_100175495 Ga0070667_1001754953 61
295 3300005367 Ga0070667_101376825 Ga0070667_1013768252 61
296 3300005440 Ga0070705_100055248 Ga0070705_1000552482 61
297 3300005441 Ga0070700_100205951 Ga0070700_1002059512 61
298 3300005444 Ga0070694_101667444 Ga0070694_1016674441 61
299 3300005455 Ga0070663_100042161 Ga0070663_1000421612 61
300 3300005455 Ga0070663_101036835 Ga0070663_1010368352 61
301 3300005455 Ga0070663_101727721 Ga0070663_1017277212 61
302 3300005456 Ga0070678_100031126 Ga0070678_1000311263 61
303 3300005456 Ga0070678_101130463 Ga0070678_1011304631 61
304 3300005457 Ga0070662_100599106 Ga0070662_1005991062 61
305 3300005457 Ga0070662_100635485 Ga0070662_1006354852 61
306 3300005458 Ga0070681_10946289 Ga0070681_109462891 61
307 3300005459 Ga0068867_100023621 Ga0068867_1000236216 61
308 3300005459 Ga0068867_100034889 Ga0068867_1000348895 61
309 3300005459 Ga0068867_100708853 Ga0068867_1007088532 61
310 3300005518 Ga0070699_100337949 Ga0070699_1003379491 61
311 3300005530 Ga0070679_100027165 Ga0070679_1000271652 61
312 3300005530 Ga0070679_101430793 Ga0070679_1014307931 61
313 3300005530 Ga0070679_101761304 Ga0070679_1017613042 61
314 3300005535 Ga0070684_102052625 Ga0070684_1020526252 61
315 3300005539 Ga0068853_100200958 Ga0068853_1002009582 61
316 3300005539 Ga0068853_101666327 Ga0068853_1016663271 61
317 3300005543 Ga0070672_100094012 Ga0070672_1000940123 61
318 3300005543 Ga0070672_100154830 Ga0070672_1001548301 61
319 3300005543 Ga0070672_100237141 Ga0070672_1002371412 61
320 3300005543 Ga0070672_100282391 Ga0070672_1002823911 61
321 3300005543 Ga0070672_101950935 Ga0070672_1019509352 61
322 3300005548 Ga0070665_100090569 Ga0070665_1000905693 61
323 3300005548 Ga0070665_100342103 Ga0070665_1003421032 61
324 3300005548 Ga0070665_100476678 Ga0070665_1004766782 61
325 3300005548 Ga0070665_101622153 Ga0070665_1016221532 61
326 3300005549 Ga0070704_101990410 Ga0070704_1019904102 61
327 3300005563 Ga0068855_100050961 Ga0068855_1000509616 61
328 3300005563 Ga0068855_100382107 Ga0068855_1003821072 61
329 3300005564 Ga0070664_100258184 Ga0070664_1002581841 61
330 3300005564 Ga0070664_100483507 Ga0070664_1004835072 61
331 3300005564 Ga0070664_101042049 Ga0070664_1010420492 61
332 3300005577 Ga0068857_101067587 Ga0068857_1010675871 61
333 3300005577 Ga0068857_101318552 Ga0068857_1013185522 61
334 3300005578 Ga0068854_100080480 Ga0068854_1000804802 61
335 3300005614 Ga0068856_100024938 Ga0068856_1000249387 61
336 3300005614 Ga0068856_101757956 Ga0068856_1017579562 61
337 3300005616 Ga0068852_100016562 Ga0068852_1000165623 61
338 3300005616 Ga0068852_100547845 Ga0068852_1005478451 61
339 3300005616 Ga0068852_101720545 Ga0068852_1017205452 61
340 3300005617 Ga0068859_100034422 Ga0068859_1000344225 61
341 3300005617 Ga0068859_100572538 Ga0068859_1005725382 61
342 3300005618 Ga0068864_100025549 Ga0068864_1000255495 61
343 3300005618 Ga0068864_100380281 Ga0068864_1003802812 61
344 3300005618 Ga0068864_100882262 Ga0068864_1008822621 61
345 3300005719 Ga0068861_100008821 Ga0068861_1000088214 61
346 3300005719 Ga0068861_100236576 Ga0068861_1002365762 61
347 3300005719 Ga0068861_100390749 Ga0068861_1003907492 61
348 3300005834 Ga0068851_10008417 Ga0068851_100084173 61
349 3300005834 Ga0068851_10102704 Ga0068851_101027042 61
350 3300005834 Ga0068851_10175940 Ga0068851_101759402 61
351 3300005840 Ga0068870_10121168 Ga0068870_101211682 61
352 3300005840 Ga0068870_10215621 Ga0068870_102156212 61
353 3300005841 Ga0068863_100065636 Ga0068863_1000656363 61
354 3300005841 Ga0068863_100244169 Ga0068863_1002441693 61
355 3300005841 Ga0068863_101474403 Ga0068863_1014744032 61
356 3300005842 Ga0068858_100049107 Ga0068858_1000491072 61
357 3300005842 Ga0068858_100396380 Ga0068858_1003963802 61
358 3300005843 Ga0068860_100035988 Ga0068860_1000359887 61
359 3300005843 Ga0068860_100129695 Ga0068860_1001296952 61
360 3300005843 Ga0068860_100231923 Ga0068860_1002319232 61
361 3300005844 Ga0068862_100053978 Ga0068862_1000539784 61
362 3300005844 Ga0068862_100192017 Ga0068862_1001920173 61
363 3300006237 Ga0097621_100113760 Ga0097621_1001137603 61
364 3300006237 Ga0097621_101158512 Ga0097621_1011585121 61
365 3300006358 Ga0068871_100003539 Ga0068871_1000035395 61
366 3300006358 Ga0068871_101440378 Ga0068871_1014403781 61
367 3300006844 Ga0075428_101664963 Ga0075428_1016649631 61
368 3300006846 Ga0075430_100785270 Ga0075430_1007852702 61
369 3300006847 Ga0075431_100580711 Ga0075431_1005807112 61
370 3300006871 Ga0075434_100079491 Ga0075434_1000794912 61
371 3300006871 Ga0075434_100295497 Ga0075434_1002954972 61
372 3300006881 Ga0068865_100151128 Ga0068865_1001511282 61
373 3300006881 Ga0068865_100184960 Ga0068865_1001849602 61
374 3300006931 Ga0097620_100034419 Ga0097620_1000344195 61
375 3300006931 Ga0097620_100572465 Ga0097620_1005724652 61
376 3300009011 Ga0105251_10067213 Ga0105251_100672132 61
377 3300009094 Ga0111539_11515077 Ga0111539_115150772 61
378 3300009101 Ga0105247_10015325 Ga0105247_100153255 61
379 3300009101 Ga0105247_10830563 Ga0105247_108305632 61
380 3300009148 Ga0105243_10713487 Ga0105243_107134872 61
381 3300009148 Ga0105243_11123056 Ga0105243_111230562 61
382 3300009174 Ga0105241_11249007 Ga0105241_112490071 61
383 3300009177 Ga0105248_10018374 Ga0105248_100183744 61
384 3300009177 Ga0105248_10349308 Ga0105248_103493082 61
385 3300009177 Ga0105248_11255955 Ga0105248_112559552 61
386 3300009551 Ga0105238_12506712 Ga0105238_125067122 61
387 3300009553 Ga0105249_10057399 Ga0105249_100573992 61
388 3300011119 Ga0105246_12018409 Ga0105246_120184092 61
389 3300013102 Ga0157371_10535771 Ga0157371_105357712 61
390 3300013104 Ga0157370_10705462 Ga0157370_107054622 61
391 3300013105 Ga0157369_10808246 Ga0157369_108082462 61
392 3300013296 Ga0157374_10337908 Ga0157374_103379082 61
393 3300013296 Ga0157374_11355355 Ga0157374_113553552 61
394 3300013297 Ga0157378_10024227 Ga0157378_100242273 61
395 3300013297 Ga0157378_10182581 Ga0157378_101825813 61
396 3300013297 Ga0157378_11327644 Ga0157378_113276441 61
397 3300013306 Ga0163162_10068518 Ga0163162_100685186 61
398 3300013306 Ga0163162_10225298 Ga0163162_102252983 61
399 3300013306 Ga0163162_12879765 Ga0163162_128797652 61
400 3300013307 Ga0157372_10334231 Ga0157372_103342311 61
401 3300013307 Ga0157372_12439620 Ga0157372_124396202 61
402 3300013308 Ga0157375_10213714 Ga0157375_102137143 61
403 3300013308 Ga0157375_10489177 Ga0157375_104891772 61
404 3300013308 Ga0157375_10549912 Ga0157375_105499122 61
405 3300014325 Ga0163163_10059545 Ga0163163_100595452 61
406 3300014325 Ga0163163_10193532 Ga0163163_101935324 61
407 3300014325 Ga0163163_10214218 Ga0163163_102142182 61
408 3300014325 Ga0163163_12014976 Ga0163163_120149762 61
409 3300014325 Ga0163163_12826689 Ga0163163_128266891 61
410 3300014326 Ga0157380_10717171 Ga0157380_107171712 61
411 3300014326 Ga0157380_10753047 Ga0157380_107530472 61
412 3300014497 Ga0182008_10171922 Ga0182008_101719222 61
413 3300014745 Ga0157377_10869744 Ga0157377_108697442 61
414 3300014968 Ga0157379_10113285 Ga0157379_101132853 61
415 3300014969 Ga0157376_10064276 Ga0157376_100642762 61
416 3300014969 Ga0157376_10344263 Ga0157376_103442632 61
417 3300017792 Ga0163161_10853066 Ga0163161_108530662 61
418 3300025321 Ga0207656_10021063 Ga0207656_100210632 61
419 3300025735 Ga0207713_1209093 Ga0207713_12090932 61
420 3300025893 Ga0207682_10001543 Ga0207682_100015434 61
421 3300025900 Ga0207710_10032167 Ga0207710_100321673 61
422 3300025901 Ga0207688_10370002 Ga0207688_103700021 61
423 3300025903 Ga0207680_10262336 Ga0207680_102623362 61
424 3300025903 Ga0207680_10507510 Ga0207680_105075102 61
425 3300025907 Ga0207645_10000368 Ga0207645_1000036810 61
426 3300025907 Ga0207645_10038810 Ga0207645_100388102 61
427 3300025908 Ga0207643_10019972 Ga0207643_100199722 61
428 3300025908 Ga0207643_10040959 Ga0207643_100409592 61
429 3300025909 Ga0207705_10797712 Ga0207705_107977122 61
430 3300025909 Ga0207705_10854721 Ga0207705_108547211 61
431 3300025911 Ga0207654_10644104 Ga0207654_106441042 61
432 3300025912 Ga0207707_11183761 Ga0207707_111837611 61
433 3300025917 Ga0207660_10402231 Ga0207660_104022312 61
434 3300025917 Ga0207660_10749542 Ga0207660_107495421 61
435 3300025918 Ga0207662_11373708 Ga0207662_113737081 61
436 3300025919 Ga0207657_10366664 Ga0207657_103666642 61
437 3300025920 Ga0207649_10207781 Ga0207649_102077812 61
438 3300025920 Ga0207649_10535415 Ga0207649_105354152 61
439 3300025920 Ga0207649_11597826 Ga0207649_115978262 61
440 3300025921 Ga0207652_10120365 Ga0207652_101203652 61
441 3300025921 Ga0207652_10459034 Ga0207652_104590343 61
442 3300025921 Ga0207652_11433260 Ga0207652_114332602 61
443 3300025923 Ga0207681_10128874 Ga0207681_101288742 61
444 3300025923 Ga0207681_10185637 Ga0207681_101856372 61
445 3300025925 Ga0207650_10214992 Ga0207650_102149922 61
446 3300025925 Ga0207650_10539728 Ga0207650_105397282 61
447 3300025925 Ga0207650_10675039 Ga0207650_106750392 61
448 3300025926 Ga0207659_10064240 Ga0207659_100642402 61
449 3300025926 Ga0207659_11138108 Ga0207659_111381082 61
450 3300025926 Ga0207659_11353513 Ga0207659_113535132 61
451 3300025931 Ga0207644_10103113 Ga0207644_101031132 61
452 3300025931 Ga0207644_10422742 Ga0207644_104227422 61
453 3300025932 Ga0207690_10293463 Ga0207690_102934631 61
454 3300025933 Ga0207706_10063812 Ga0207706_100638123 61
455 3300025933 Ga0207706_10554159 Ga0207706_105541592 61
456 3300025934 Ga0207686_11767895 Ga0207686_117678952 61
457 3300025935 Ga0207709_10532319 Ga0207709_105323192 61
458 3300025935 Ga0207709_10724088 Ga0207709_107240881 61
459 3300025936 Ga0207670_10271353 Ga0207670_102713532 61
460 3300025936 Ga0207670_10500182 Ga0207670_105001822 61
461 3300025936 Ga0207670_11090899 Ga0207670_110908992 61
462 3300025937 Ga0207669_10101094 Ga0207669_101010942 61
463 3300025937 Ga0207669_10460658 Ga0207669_104606582 61
464 3300025938 Ga0207704_10529692 Ga0207704_105296922 61
465 3300025940 Ga0207691_10119991 Ga0207691_101199912 61
466 3300025940 Ga0207691_11013169 Ga0207691_110131692 61
467 3300025941 Ga0207711_10020304 Ga0207711_100203044 61
468 3300025941 Ga0207711_10341617 Ga0207711_103416172 61
469 3300025941 Ga0207711_11236495 Ga0207711_112364951 61
470 3300025941 Ga0207711_11401504 Ga0207711_114015041 61
471 3300025942 Ga0207689_10005836 Ga0207689_100058366 61
472 3300025942 Ga0207689_11099388 Ga0207689_110993882 61
473 3300025944 Ga0207661_10492556 Ga0207661_104925562 61
474 3300025949 Ga0207667_10151829 Ga0207667_101518292 61
475 3300025949 Ga0207667_10263976 Ga0207667_102639762 61
476 3300025960 Ga0207651_10023058 Ga0207651_100230583 61
477 3300025960 Ga0207651_10120286 Ga0207651_101202863 61
478 3300025960 Ga0207651_10703746 Ga0207651_107037462 61
479 3300025961 Ga0207712_10397044 Ga0207712_103970442 61
480 3300025972 Ga0207668_10022709 Ga0207668_100227092 61
481 3300025972 Ga0207668_10176179 Ga0207668_101761792 61
482 3300025972 Ga0207668_10209871 Ga0207668_102098712 61
483 3300025972 Ga0207668_10223605 Ga0207668_102236052 61
484 3300025972 Ga0207668_10621981 Ga0207668_106219812 61
485 3300025972 Ga0207668_12073607 Ga0207668_120736072 61
486 3300025981 Ga0207640_10082781 Ga0207640_100827812 61
487 3300025981 Ga0207640_11263544 Ga0207640_112635442 61
488 3300025986 Ga0207658_10082890 Ga0207658_100828903 61
489 3300025986 Ga0207658_10433285 Ga0207658_104332852 61
490 3300025986 Ga0207658_10831241 Ga0207658_108312412 61
491 3300025986 Ga0207658_11001033 Ga0207658_110010332 61
492 3300026023 Ga0207677_10088942 Ga0207677_100889423 61
493 3300026035 Ga0207703_10014225 Ga0207703_100142256 61
494 3300026035 Ga0207703_10036826 Ga0207703_100368263 61
495 3300026041 Ga0207639_10425974 Ga0207639_104259742 61
496 3300026067 Ga0207678_10077076 Ga0207678_100770762 61
497 3300026067 Ga0207678_10292521 Ga0207678_102925212 61
498 3300026075 Ga0207708_10261482 Ga0207708_102614822 61
499 3300026078 Ga0207702_10197665 Ga0207702_101976652 61
500 3300026088 Ga0207641_10347622 Ga0207641_103476222 61
501 3300026088 Ga0207641_10411492 Ga0207641_104114922 61
502 3300026088 Ga0207641_11638720 Ga0207641_116387202 61
503 3300026089 Ga0207648_10003902 Ga0207648_100039025 61
504 3300026089 Ga0207648_10024219 Ga0207648_100242197 61
505 3300026089 Ga0207648_10172541 Ga0207648_101725412 61
506 3300026089 Ga0207648_10477723 Ga0207648_104777232 61
507 3300026089 Ga0207648_10864382 Ga0207648_108643821 61
508 3300026095 Ga0207676_10066601 Ga0207676_100666012 61
509 3300026095 Ga0207676_10296095 Ga0207676_102960952 61
510 3300026116 Ga0207674_10039264 Ga0207674_100392647 61
511 3300026116 Ga0207674_10829827 Ga0207674_108298272 61
512 3300026118 Ga0207675_100015978 Ga0207675_1000159787 61
513 3300026118 Ga0207675_100132289 Ga0207675_1001322893 61
514 3300026118 Ga0207675_101681530 Ga0207675_1016815302 61
515 3300026121 Ga0207683_10000133 Ga0207683_1000013321 61
516 3300026121 Ga0207683_11016479 Ga0207683_110164791 61
517 3300026142 Ga0207698_11771343 Ga0207698_117713432 61
518 3300026142 Ga0207698_11886918 Ga0207698_118869182 61
519 3300027471 Ga0209995_1020790 Ga0209995_10207902 61
520 3300027552 Ga0209982_1007086 Ga0209982_10070863 61
521 3300027614 Ga0209970_1016029 Ga0209970_10160292 61
522 3300027665 Ga0209983_1001756 Ga0209983_10017563 61
523 3300027682 Ga0209971_1041737 Ga0209971_10417372 61
524 3300027876 Ga0209974_10003884 Ga0209974_100038846 61
525 3300028379 Ga0268266_10045453 Ga0268266_100454534 61
526 3300028379 Ga0268266_10399109 Ga0268266_103991092 61
527 3300028379 Ga0268266_10518022 Ga0268266_105180222 61
528 3300028379 Ga0268266_11118884 Ga0268266_111188842 61
529 3300028379 Ga0268266_11211901 Ga0268266_112119012 61
530 3300028379 Ga0268266_11711516 Ga0268266_117115161 61
531 3300028380 Ga0268265_10025981 Ga0268265_100259814 61
532 3300028380 Ga0268265_10051917 Ga0268265_100519172 61
533 3300028381 Ga0268264_10013805 Ga0268264_100138054 61
534 3300028381 Ga0268264_10337642 Ga0268264_103376422 61
535 3300028381 Ga0268264_10337807 Ga0268264_103378072 61
536 3300032002 Ga0307416_102172070 Ga0307416_1021720702 61
537 3300035114 Ga0373939_0359489 Ga0373939_0359489_76_285 61
538 3300035691 Ga0373931_0039145 Ga0373931_0039145_775_984 61
539 3300041512 Ga0451853_3236455 Ga0451853_3236455_766_960 61
540 3300044842 Ga0466957_0708193 Ga0466957_0708193_20_214 61
541 3300046453 Ga0495627_036768 Ga0495627_036768_1296_1505 61
542 3300046460 Ga0495638_0131803 Ga0495638_0131803_186_386 61
543 3300046471 Ga0495650_0000391 Ga0495650_0000391_8059_8259 61
544 3300046471 Ga0495650_0025108 Ga0495650_0025108_1180_1377 61
545 3300046471 Ga0495650_0089685 Ga0495650_0089685_765_956 61
546 3300046492 Ga0495585_0011649 Ga0495585_0011649_3236_3436 61
547 3300046500 Ga0495596_0001014 Ga0495596_0001014_4379_4588 61
548 3300046501 Ga0495607_0172731 Ga0495607_0172731_848_1057 61
549 3300046506 Ga0495583_0000973 Ga0495583_0000973_30021_30230 61
550 3300046506 Ga0495583_0024796 Ga0495583_0024796_876_1067 61
551 3300046506 Ga0495583_0118288 Ga0495583_0118288_445_654 61
552 3300046506 Ga0495583_0177964 Ga0495583_0177964_63_272 61
553 3300046512 Ga0495610_0000021 Ga0495610_0000021_301296_301496 61
554 3300046512 Ga0495610_0290292 Ga0495610_0290292_368_577 61
555 3300046513 Ga0495616_0026160 Ga0495616_0026160_889_1098 61
556 3300046518 Ga0495631_0040628 Ga0495631_0040628_1287_1478 61
557 3300046519 Ga0495632_0002267 Ga0495632_0002267_11511_11720 61
558 3300046522 Ga0495643_0120133 Ga0495643_0120133_1084_1284 61
559 3300046522 Ga0495643_0129321 Ga0495643_0129321_593_784 61
560 3300046524 Ga0495648_0006047 Ga0495648_0006047_4443_4643 61
561 3300046524 Ga0495648_0044607 Ga0495648_0044607_870_1070 61
562 3300046525 Ga0495663_0011840 Ga0495663_0011840_1465_1674 61
563 3300046528 Ga0495642_0012702 Ga0495642_0012702_615_824 61
564 3300046530 Ga0495654_0012134 Ga0495654_0012134_397_597 61
565 3300046542 Ga0495597_0148938 Ga0495597_0148938_356_565 61
566 3300046558 Ga0495633_0001801 Ga0495633_0001801_1957_2157 61
567 3300046558 Ga0495633_0057402 Ga0495633_0057402_1583_1792 61
568 3300046558 Ga0495633_0423340 Ga0495633_0423340_221_412 61
569 3300046615 Ga0495656_0079357 Ga0495656_0079357_262_471 61
570 3300046616 Ga0495668_0002087 Ga0495668_0002087_4481_4672 61
571 3300046616 Ga0495668_0006725 Ga0495668_0006725_7215_7415 61
572 3300046616 Ga0495668_0626220 Ga0495668_0626220_23_232 61
573 3300046665 Ga0495661_0027087 Ga0495661_0027087_1909_2109 61
574 3300046665 Ga0495661_0039437 Ga0495661_0039437_1855_2064 61
575 3300046684 Ga0495669_0005289 Ga0495669_0005289_3934_4143 61
576 3300046691 Ga0495670_0024382 Ga0495670_0024382_1067_1276 61
577 3300046692 Ga0495671_0000024 Ga0495671_0000024_175663_175863 61
578 3300046692 Ga0495671_0001399 Ga0495671_0001399_13443_13634 61
579 3300046692 Ga0495671_0001573 Ga0495671_0001573_12282_12491 61
580 3300046692 Ga0495671_0031350 Ga0495671_0031350_848_1048 61
581 3300046694 Ga0495649_0070599 Ga0495649_0070599_24_233 61
582 3300046794 Ga0495589_0133853 Ga0495589_0133853_636_836 61
583 3300046810 Ga0495660_0007231 Ga0495660_0007231_3088_3288 61
584 3300046810 Ga0495660_0008596 Ga0495660_0008596_1709_1918 61
585 3300047323 Ga0495683_0014426 Ga0495683_0014426_20_220 61
586 3300047443 Ga0495687_012555 Ga0495687_012555_1325_1534 61
587 3300047445 Ga0495677_0081451 Ga0495677_0081451_551_760 61
588 3300047446 Ga0495679_021490 Ga0495679_021490_495_695 61
589 3300047469 Ga0495673_0000033 Ga0495673_0000033_279742_279942 61
590 3300047469 Ga0495673_0000219 Ga0495673_0000219_75991_76191 61
591 3300047470 Ga0495681_0003979 Ga0495681_0003979_4938_5138 61
592 3300047470 Ga0495681_0009090 Ga0495681_0009090_3132_3341 61
593 3300047472 Ga0495686_0040407 Ga0495686_0040407_2079_2279 61
594 3300048091 Ga0495626_0182393 Ga0495626_0182393_360_569 61
595 3300048905 Ga0496102_0131601 Ga0496102_0131601_2135_2326 61
596 3300048905 Ga0496102_0281805 Ga0496102_0281805_631_822 61
597 3300048906 Ga0496103_0024228 Ga0496103_0024228_2266_2457 61
598 3300048906 Ga0496103_0114725 Ga0496103_0114725_1035_1226 61
599 3300048909 Ga0496106_0415535 Ga0496106_0415535_130_321 61
600 3300048910 Ga0496107_0089723 Ga0496107_0089723_143_334 61
601 3300048911 Ga0496108_0041836 Ga0496108_0041836_123_320 61
602 3300048913 Ga0496110_0017013 Ga0496110_0017013_2981_3172 61
603 3300048913 Ga0496110_1500749 Ga0496110_1500749_224_421 61
604 3300048914 Ga0496111_0023601 Ga0496111_0023601_1279_1470 61
605 3300048914 Ga0496111_0419145 Ga0496111_0419145_722_919 61
606 3300048917 Ga0496114_0819080 Ga0496114_0819080_578_787 61
607 3300048918 Ga0496115_0367281 Ga0496115_0367281_543_734 61
608 3300048925 Ga0496122_0166992 Ga0496122_0166992_31_231 61
609 3300048927 Ga0496124_0045034 Ga0496124_0045034_1162_1353 61
610 3300048929 Ga0496126_0039407 Ga0496126_0039407_910_1110 61
611 3300049459 Ga0495678_011801 Ga0495678_011801_826_1035 61
612 3300049459 Ga0495678_071428 Ga0495678_071428_271_471 61
613 3300049552 Ga0501336_012305 Ga0501336_012305_284_478 61
614 3300049572 Ga0501036_0966774 Ga0501036_0966774_139_345 61
615 3300049582 Ga0501048_1072039 Ga0501048_1072039_352_546 61
616 3300049585 Ga0501069_0464898 Ga0501069_0464898_201_395 61
617 3300049588 Ga0501072_0324694 Ga0501072_0324694_348_542 61
618 3300049592 Ga0501076_1489561 Ga0501076_1489561_300_512 61
619 3300050507 nmdc:mga05p37_1300868_c1 nmdc:mga05p37_1300868_c1_535_729 61
620 3300050507 nmdc:mga05p37_2069381_c1 nmdc:mga05p37_2069381_c1_275_475 61
621 3300050511 nmdc:mga08y16_1491405_c1 nmdc:mga08y16_1491405_c1_399_593 61
622 3300050512 nmdc:mga0n895_143557_c1 nmdc:mga0n895_143557_c1_666_863 61
623 3300050512 nmdc:mga0n895_148088_c1 nmdc:mga0n895_148088_c1_181_399 61
624 3300050513 nmdc:mga0rr50_46757_c1 nmdc:mga0rr50_46757_c1_2731_2949 61
625 3300050515 nmdc:mga0a205_241953_c1 nmdc:mga0a205_241953_c1_1440_1637 61
626 3300002987 JGI25159J45721_1002873 JGI25159J45721_10028734 62
627 3300003322 rootL2_10086410 rootL2_100864104 62
628 3300003759 Ga0055525_1000009 Ga0055525_1000009518 62
629 3300003762 Ga0055542_1016302 Ga0055542_10163022 62
630 3300003771 Ga0055526_1000856 Ga0055526_10008565 62
631 3300003773 Ga0055537_1000496 Ga0055537_100049623 62
632 3300003775 Ga0055524_1000027 Ga0055524_100002717 62
633 3300003775 Ga0055524_1015123 Ga0055524_10151232 62
634 3300003784 Ga0055534_1000583 Ga0055534_100058317 62
635 3300003790 Ga0055528_1000686 Ga0055528_10006866 62
636 3300004625 Ga0055543_1002543 Ga0055543_10025437 62
637 3300005262 Ga0065165_1000298 Ga0065165_100029868 62
638 3300005262 Ga0065165_1002921 Ga0065165_10029217 62
639 3300005262 Ga0065165_1019195 Ga0065165_10191953 62
640 3300005293 Ga0065715_10489296 Ga0065715_104892961 62
641 3300005327 Ga0070658_10022463 Ga0070658_100224635 62
642 3300005327 Ga0070658_10971624 Ga0070658_109716242 62
643 3300005336 Ga0070680_100246895 Ga0070680_1002468952 62
644 3300005336 Ga0070680_101573786 Ga0070680_1015737861 62
645 3300005338 Ga0068868_101284117 Ga0068868_1012841172 62
646 3300005339 Ga0070660_100093006 Ga0070660_1000930062 62
647 3300005339 Ga0070660_100202965 Ga0070660_1002029651 62
648 3300005339 Ga0070660_100469114 Ga0070660_1004691142 62
649 3300005339 Ga0070660_101293982 Ga0070660_1012939821 62
650 3300005344 Ga0070661_100006065 Ga0070661_1000060656 62
651 3300005344 Ga0070661_100429083 Ga0070661_1004290832 62
652 3300005354 Ga0070675_100447531 Ga0070675_1004475312 62
653 3300005366 Ga0070659_100286746 Ga0070659_1002867462 62
654 3300005366 Ga0070659_100600687 Ga0070659_1006006872 62
655 3300005436 Ga0070713_100000059 Ga0070713_1000000593 62
656 3300005437 Ga0070710_10097756 Ga0070710_100977562 62
657 3300005455 Ga0070663_100860423 Ga0070663_1008604232 62
658 3300005457 Ga0070662_100432303 Ga0070662_1004323032 62
659 3300005457 Ga0070662_101625691 Ga0070662_1016256912 62
660 3300005458 Ga0070681_10000732 Ga0070681_100007328 62
661 3300005467 Ga0070706_100081572 Ga0070706_1000815724 62
662 3300005468 Ga0070707_100443909 Ga0070707_1004439091 62
663 3300005530 Ga0070679_100338526 Ga0070679_1003385262 62
664 3300005530 Ga0070679_101889359 Ga0070679_1018893592 62
665 3300005539 Ga0068853_100081768 Ga0068853_1000817682 62
666 3300005563 Ga0068855_100418756 Ga0068855_1004187562 62
667 3300005563 Ga0068855_100946816 Ga0068855_1009468162 62
668 3300005564 Ga0070664_100173534 Ga0070664_1001735342 62
669 3300005564 Ga0070664_100317296 Ga0070664_1003172962 62
670 3300005564 Ga0070664_100534169 Ga0070664_1005341692 62
671 3300005577 Ga0068857_100726651 Ga0068857_1007266511 62
672 3300005578 Ga0068854_100402196 Ga0068854_1004021962 62
673 3300005614 Ga0068856_101489452 Ga0068856_1014894522 62
674 3300005616 Ga0068852_102166693 Ga0068852_1021666931 62
675 3300005718 Ga0068866_10355485 Ga0068866_103554853 62
676 3300005844 Ga0068862_101288240 Ga0068862_1012882402 62
677 3300006881 Ga0068865_100063942 Ga0068865_1000639424 62
678 3300006946 Ga0079104_1011335 Ga0079104_10113355 62
679 3300006948 Ga0099826_10000003 Ga0099826_10000003783 62
680 3300009036 Ga0105244_10046293 Ga0105244_100462933 62
681 3300009036 Ga0105244_10328141 Ga0105244_103281411 62
682 3300009093 Ga0105240_10457373 Ga0105240_104573732 62
683 3300009098 Ga0105245_11785741 Ga0105245_117857412 62
684 3300009147 Ga0114129_10238463 Ga0114129_102384631 62
685 3300009147 Ga0114129_10612786 Ga0114129_106127862 62
686 3300009148 Ga0105243_10125495 Ga0105243_101254952 62
687 3300009174 Ga0105241_10033689 Ga0105241_100336894 62
688 3300009174 Ga0105241_10079364 Ga0105241_100793642 62
689 3300009174 Ga0105241_11123245 Ga0105241_111232452 62
690 3300009176 Ga0105242_10031663 Ga0105242_100316632 62
691 3300009545 Ga0105237_10048709 Ga0105237_100487094 62
692 3300009551 Ga0105238_10642008 Ga0105238_106420082 62
693 3300010375 Ga0105239_11133507 Ga0105239_111335071 62
694 3300013100 Ga0157373_10006600 Ga0157373_100066008 62
695 3300013100 Ga0157373_10045628 Ga0157373_100456282 62
696 3300013100 Ga0157373_11169062 Ga0157373_111690622 62
697 3300013102 Ga0157371_10000399 Ga0157371_1000039921 62
698 3300013102 Ga0157371_11286349 Ga0157371_112863491 62
699 3300013104 Ga0157370_10098882 Ga0157370_100988822 62
700 3300013104 Ga0157370_10837359 Ga0157370_108373592 62
701 3300013105 Ga0157369_11084540 Ga0157369_110845402 62
702 3300013296 Ga0157374_10168397 Ga0157374_101683973 62
703 3300013297 Ga0157378_10437287 Ga0157378_104372872 62
704 3300013307 Ga0157372_10010615 Ga0157372_100106156 62
705 3300013307 Ga0157372_10222379 Ga0157372_102223792 62
706 3300013307 Ga0157372_10268210 Ga0157372_102682103 62
707 3300013307 Ga0157372_10798005 Ga0157372_107980052 62
708 3300013307 Ga0157372_12067318 Ga0157372_120673181 62
709 3300013307 Ga0157372_12773552 Ga0157372_127735522 62
710 3300013308 Ga0157375_11050558 Ga0157375_110505582 62
711 3300014497 Ga0182008_10634246 Ga0182008_106342461 62
712 3300014497 Ga0182008_10694490 Ga0182008_106944901 62
713 3300015261 Ga0182006_1000055 Ga0182006_100005532 62
714 3300015261 Ga0182006_1022308 Ga0182006_10223082 62
715 3300015262 Ga0182007_10049382 Ga0182007_100493822 62
716 3300015262 Ga0182007_10198265 Ga0182007_101982652 62
717 3300015265 Ga0182005_1000003 Ga0182005_1000003241 62
718 3300017792 Ga0163161_10081332 Ga0163161_100813322 62
719 3300021361 Ga0213872_10266511 Ga0213872_102665111 62
720 3300022467 Ga0224712_10693215 Ga0224712_106932151 62
721 3300025208 Ga0209436_109615 Ga0209436_1096153 62
722 3300025230 Ga0209563_100015 Ga0209563_100015634 62
723 3300025250 Ga0209026_1016232 Ga0209026_10162322 62
724 3300025253 Ga0209677_107904 Ga0209677_1079042 62
725 3300025254 Ga0209148_1000272 Ga0209148_100027245 62
726 3300025263 Ga0209565_1000006 Ga0209565_1000006522 62
727 3300025263 Ga0209565_1042407 Ga0209565_10424071 62
728 3300025273 Ga0209673_1000004 Ga0209673_1000004307 62
729 3300025284 Ga0209130_1000067 Ga0209130_1000067134 62
730 3300025291 Ga0209675_1000006 Ga0209675_1000006521 62
731 3300025295 Ga0209564_1000102 Ga0209564_10001026 62
732 3300025299 Ga0209256_1000013 Ga0209256_1000013397 62
733 3300025299 Ga0209256_1000037 Ga0209256_1000037150 62
734 3300025711 Ga0207696_1175319 Ga0207696_11753191 62
735 3300025898 Ga0207692_10203011 Ga0207692_102030112 62
736 3300025909 Ga0207705_10003612 Ga0207705_1000361210 62
737 3300025909 Ga0207705_10219637 Ga0207705_102196372 62
738 3300025909 Ga0207705_10625432 Ga0207705_106254322 62
739 3300025910 Ga0207684_10068001 Ga0207684_100680014 62
740 3300025911 Ga0207654_10013588 Ga0207654_100135883 62
741 3300025912 Ga0207707_10012370 Ga0207707_100123703 62
742 3300025913 Ga0207695_10618639 Ga0207695_106186391 62
743 3300025914 Ga0207671_10103323 Ga0207671_101033233 62
744 3300025917 Ga0207660_10187555 Ga0207660_101875552 62
745 3300025917 Ga0207660_11340601 Ga0207660_113406011 62
746 3300025919 Ga0207657_10065714 Ga0207657_100657141 62
747 3300025919 Ga0207657_11135535 Ga0207657_111355352 62
748 3300025920 Ga0207649_10001571 Ga0207649_100015714 62
749 3300025921 Ga0207652_10005028 Ga0207652_100050287 62
750 3300025922 Ga0207646_10441645 Ga0207646_104416452 62
751 3300025926 Ga0207659_10553718 Ga0207659_105537182 62
752 3300025927 Ga0207687_10353201 Ga0207687_103532011 62
753 3300025932 Ga0207690_10157164 Ga0207690_101571643 62
754 3300025932 Ga0207690_11527119 Ga0207690_115271191 62
755 3300025933 Ga0207706_10615781 Ga0207706_106157812 62
756 3300025933 Ga0207706_11671023 Ga0207706_116710231 62
757 3300025934 Ga0207686_10001803 Ga0207686_1000180310 62
758 3300025935 Ga0207709_10082951 Ga0207709_100829512 62
759 3300025938 Ga0207704_10185449 Ga0207704_101854493 62
760 3300025938 Ga0207704_10651686 Ga0207704_106516862 62
761 3300025945 Ga0207679_10163139 Ga0207679_101631392 62
762 3300025945 Ga0207679_10233950 Ga0207679_102339502 62
763 3300025945 Ga0207679_11384313 Ga0207679_113843132 62
764 3300025949 Ga0207667_10030564 Ga0207667_100305642 62
765 3300025981 Ga0207640_10699991 Ga0207640_106999911 62
766 3300026041 Ga0207639_10039565 Ga0207639_100395653 62
767 3300026067 Ga0207678_10264948 Ga0207678_102649482 62
768 3300026078 Ga0207702_11504987 Ga0207702_115049871 62
769 3300026078 Ga0207702_11988689 Ga0207702_119886892 62
770 3300026089 Ga0207648_10849287 Ga0207648_108492872 62
771 3300026142 Ga0207698_10121705 Ga0207698_101217052 62
772 3300027111 Ga0209281_1009550 Ga0209281_10095503 62
773 3300027111 Ga0209281_1029163 Ga0209281_10291631 62
774 3300027666 Ga0209282_1000002 Ga0209282_1000002224 62
775 3300028380 Ga0268265_12151680 Ga0268265_121516802 62
776 3300030733 Ga0314311_1058868 Ga0314311_10588682 62
777 3300030734 Ga0316179_1043648 Ga0316179_10436482 62
778 3300030735 Ga0316178_1018302 Ga0316178_10183022 62
779 3300030735 Ga0316178_1162240 Ga0316178_11622402 62
780 3300030736 Ga0316180_1182415 Ga0316180_11824152 62
781 3300030744 Ga0316181_1063650 Ga0316181_10636501 62
782 3300030745 Ga0316182_1040109 Ga0316182_10401092 62
783 3300030745 Ga0316182_1423195 Ga0316182_14231953 62
784 3300031548 Ga0307408_102018375 Ga0307408_1020183751 62
785 3300031548 Ga0307408_102296887 Ga0307408_1022968873 62
786 3300031616 Ga0307508_10869251 Ga0307508_108692512 62
787 3300031824 Ga0307413_10348692 Ga0307413_103486922 62
788 3300031852 Ga0307410_10173914 Ga0307410_101739142 62
789 3300031901 Ga0307406_10692327 Ga0307406_106923272 62
790 3300031911 Ga0307412_10750418 Ga0307412_107504182 62
791 3300031911 Ga0307412_11957523 Ga0307412_119575231 62
792 3300032002 Ga0307416_100977425 Ga0307416_1009774252 62
793 3300032004 Ga0307414_10032835 Ga0307414_100328354 62
794 3300032004 Ga0307414_11579506 Ga0307414_115795062 62
795 3300032005 Ga0307411_10254974 Ga0307411_102549741 62
796 3300032005 Ga0307411_12040825 Ga0307411_120408252 62
797 3300035695 Ga0373927_0016950 Ga0373927_0016950_3964_4164 62
798 3300035725 Ga0373947_0450463 Ga0373947_0450463_234_437 62
799 3300037068 Ga0373925_0077420 Ga0373925_0077420_1357_1557 62
800 3300037312 Ga0395899_0014265 Ga0395899_0014265_4945_5139 62
801 3300037312 Ga0395899_0028741 Ga0395899_0028741_2212_2406 62
802 3300037312 Ga0395899_0125689 Ga0395899_0125689_453_647 62
803 3300037312 Ga0395899_0138615 Ga0395899_0138615_1014_1208 62
804 3300037312 Ga0395899_0250816 Ga0395899_0250816_804_998 62
805 3300037312 Ga0395899_0351708 Ga0395899_0351708_770_964 62
806 3300037312 Ga0395899_0361322 Ga0395899_0361322_642_836 62
807 3300037312 Ga0395899_0361614 Ga0395899_0361614_151_345 62
808 3300037312 Ga0395899_0634879 Ga0395899_0634879_84_278 62
809 3300037418 Ga0395900_0001494 Ga0395900_0001494_4440_4634 62
810 3300037418 Ga0395900_0021829 Ga0395900_0021829_1182_1376 62
811 3300037418 Ga0395900_0047752 Ga0395900_0047752_203_397 62
812 3300037418 Ga0395900_0138452 Ga0395900_0138452_1674_1868 62
813 3300037418 Ga0395900_0139030 Ga0395900_0139030_1155_1349 62
814 3300037418 Ga0395900_0161730 Ga0395900_0161730_697_891 62
815 3300037418 Ga0395900_0288207 Ga0395900_0288207_317_511 62
816 3300037418 Ga0395900_0347433 Ga0395900_0347433_661_855 62
817 3300037466 Ga0395898_0196908 Ga0395898_0196908_501_695 62
818 3300037466 Ga0395898_0198622 Ga0395898_0198622_402_596 62
819 3300037466 Ga0395898_0212010 Ga0395898_0212010_983_1177 62
820 3300037466 Ga0395898_0453878 Ga0395898_0453878_242_436 62
821 3300037466 Ga0395898_1063544 Ga0395898_1063544_120_314 62
822 3300037466 Ga0395898_1162943 Ga0395898_1162943_203_397 62
823 3300037466 Ga0395898_1822184 Ga0395898_1822184_71_265 62
824 3300037466 Ga0395898_1987891 Ga0395898_1987891_55_249 62
825 3300037471 Ga0395905_0198403 Ga0395905_0198403_468_662 62
826 3300037471 Ga0395905_0256158 Ga0395905_0256158_751_945 62
827 3300037471 Ga0395905_0304423 Ga0395905_0304423_209_403 62
828 3300037471 Ga0395905_0407115 Ga0395905_0407115_39_233 62
829 3300037471 Ga0395905_0542878 Ga0395905_0542878_191_385 62
830 3300038443 Ga0395901_0000307 Ga0395901_0000307_56338_56532 62
831 3300038443 Ga0395901_0113663 Ga0395901_0113663_1207_1401 62
832 3300038443 Ga0395901_0126863 Ga0395901_0126863_1542_1736 62
833 3300038443 Ga0395901_0209180 Ga0395901_0209180_1416_1610 62
834 3300038443 Ga0395901_0270454 Ga0395901_0270454_655_849 62
835 3300038443 Ga0395901_0350961 Ga0395901_0350961_296_490 62
836 3300038443 Ga0395901_0757520 Ga0395901_0757520_756_950 62
837 3300039447 Ga0436361_0594176 Ga0436361_0594176_382_579 62
838 3300039447 Ga0436361_0604351 Ga0436361_0604351_60_260 62
839 3300039447 Ga0436361_0715458 Ga0436361_0715458_13_213 62
840 3300041406 Ga0439439_0109738 Ga0439439_0109738_118_312 62
841 3300041413 Ga0439465_0087983 Ga0439465_0087983_292_486 62
842 3300041496 Ga0451839_0120065 Ga0451839_0120065_124_318 62
843 3300041509 Ga0451843_0217578 Ga0451843_0217578_157_351 62
844 3300041999 Ga0439433_0050697 Ga0439433_0050697_56_250 62
845 3300042005 Ga0439448_0011757 Ga0439448_0011757_815_1009 62
846 3300042005 Ga0439448_0013577 Ga0439448_0013577_912_1106 62
847 3300042005 Ga0439448_0133979 Ga0439448_0133979_48_242 62
848 3300042007 Ga0439449_0004853 Ga0439449_0004853_3145_3339 62
849 3300042011 Ga0439454_079792 Ga0439454_079792_205_399 62
850 3300042012 Ga0439455_0059997 Ga0439455_0059997_751_945 62
851 3300042157 Ga0439458_0056572 Ga0439458_0056572_318_512 62
852 3300042157 Ga0439458_0064848 Ga0439458_0064848_701_895 62
853 3300042157 Ga0439458_0142327 Ga0439458_0142327_185_379 62
854 3300044656 Ga0466969_0040955 Ga0466969_0040955_1898_2092 62
855 3300044656 Ga0466969_0083497 Ga0466969_0083497_660_854 62
856 3300044656 Ga0466969_0208581 Ga0466969_0208581_526_720 62
857 3300044656 Ga0466969_0247245 Ga0466969_0247245_371_565 62
858 3300044658 Ga0466972_0050496 Ga0466972_0050496_1176_1370 62
859 3300044658 Ga0466972_0187318 Ga0466972_0187318_319_513 62
860 3300044658 Ga0466972_0302413 Ga0466972_0302413_472_666 62
861 3300044669 Ga0466981_0488731 Ga0466981_0488731_138_329 62
862 3300044672 Ga0466982_0538337 Ga0466982_0538337_56_247 62
863 3300044683 Ga0466965_0009825 Ga0466965_0009825_1996_2190 62
864 3300044683 Ga0466965_0026965 Ga0466965_0026965_870_1064 62
865 3300044683 Ga0466965_0050771 Ga0466965_0050771_1842_2036 62
866 3300044683 Ga0466965_0224624 Ga0466965_0224624_304_498 62
867 3300044683 Ga0466965_0252364 Ga0466965_0252364_114_308 62
868 3300044683 Ga0466965_0855735 Ga0466965_0855735_45_239 62
869 3300044684 Ga0466966_0012240 Ga0466966_0012240_1672_1866 62
870 3300044684 Ga0466966_0078906 Ga0466966_0078906_811_1005 62
871 3300044684 Ga0466966_0210961 Ga0466966_0210961_532_726 62
872 3300044684 Ga0466966_0353044 Ga0466966_0353044_635_829 62
873 3300044693 Ga0466961_0083269 Ga0466961_0083269_843_1037 62
874 3300044693 Ga0466961_0319201 Ga0466961_0319201_17_211 62
875 3300044693 Ga0466961_0680748 Ga0466961_0680748_312_506 62
876 3300044694 Ga0466963_0059622 Ga0466963_0059622_624_818 62
877 3300044694 Ga0466963_0409524 Ga0466963_0409524_722_916 62
878 3300044694 Ga0466963_0418318 Ga0466963_0418318_161_355 62
879 3300044694 Ga0466963_0666384 Ga0466963_0666384_324_518 62
880 3300044694 Ga0466963_1147463 Ga0466963_1147463_339_533 62
881 3300044706 Ga0466964_0000552 Ga0466964_0000552_10529_10723 62
882 3300044706 Ga0466964_0033680 Ga0466964_0033680_721_915 62
883 3300044706 Ga0466964_0384223 Ga0466964_0384223_21_215 62
884 3300044706 Ga0466964_0455036 Ga0466964_0455036_227_421 62
885 3300044719 Ga0466971_0052468 Ga0466971_0052468_626_820 62
886 3300044719 Ga0466971_0088068 Ga0466971_0088068_593_787 62
887 3300044735 Ga0466968_0007533 Ga0466968_0007533_3478_3672 62
888 3300044735 Ga0466968_0250458 Ga0466968_0250458_480_674 62
889 3300044765 Ga0466970_0162276 Ga0466970_0162276_571_765 62
890 3300044765 Ga0466970_0171504 Ga0466970_0171504_645_839 62
891 3300044765 Ga0466970_0330396 Ga0466970_0330396_147_338 62
892 3300044765 Ga0466970_0340968 Ga0466970_0340968_574_768 62
893 3300044842 Ga0466957_0000668 Ga0466957_0000668_2149_2343 62
894 3300044842 Ga0466957_0051398 Ga0466957_0051398_942_1136 62
895 3300044842 Ga0466957_0086804 Ga0466957_0086804_660_854 62
896 3300044842 Ga0466957_0110014 Ga0466957_0110014_607_801 62
897 3300044842 Ga0466957_0323888 Ga0466957_0323888_791_985 62
898 3300044901 Ga0466960_0222389 Ga0466960_0222389_132_326 62
899 3300045049 Ga0466959_0043758 Ga0466959_0043758_2115_2309 62
900 3300045049 Ga0466959_0047700 Ga0466959_0047700_1162_1356 62
901 3300045049 Ga0466959_0081465 Ga0466959_0081465_1754_1948 62
902 3300045049 Ga0466959_0714228 Ga0466959_0714228_142_336 62
903 3300045836 Ga0466958_0046174 Ga0466958_0046174_728_922 62
904 3300045836 Ga0466958_0301047 Ga0466958_0301047_499_693 62
905 3300045836 Ga0466958_0492134 Ga0466958_0492134_487_681 62
906 3300045976 Ga0466967_0009493 Ga0466967_0009493_6999_7193 62
907 3300045976 Ga0466967_0031395 Ga0466967_0031395_2561_2755 62
908 3300045976 Ga0466967_0328960 Ga0466967_0328960_39_233 62
909 3300046453 Ga0495627_000915 Ga0495627_000915_10937_11149 62
910 3300046453 Ga0495627_155408 Ga0495627_155408_392_586 62
911 3300046455 Ga0495603_0028708 Ga0495603_0028708_2802_2996 62
912 3300046455 Ga0495603_0055836 Ga0495603_0055836_496_690 62
913 3300046455 Ga0495603_0315462 Ga0495603_0315462_181_393 62
914 3300046455 Ga0495603_0388289 Ga0495603_0388289_215_409 62
915 3300046457 Ga0495590_0008345 Ga0495590_0008345_1428_1622 62
916 3300046457 Ga0495590_0026698 Ga0495590_0026698_102_296 62
917 3300046457 Ga0495590_0032462 Ga0495590_0032462_984_1178 62
918 3300046457 Ga0495590_0214299 Ga0495590_0214299_387_581 62
919 3300046458 Ga0495591_000893 Ga0495591_000893_7880_8092 62
920 3300046458 Ga0495591_011947 Ga0495591_011947_1618_1812 62
921 3300046458 Ga0495591_122164 Ga0495591_122164_279_491 62
922 3300046459 Ga0495629_0124313 Ga0495629_0124313_1135_1329 62
923 3300046459 Ga0495629_0340118 Ga0495629_0340118_505_717 62
924 3300046460 Ga0495638_0033948 Ga0495638_0033948_1782_1970 62
925 3300046460 Ga0495638_0078119 Ga0495638_0078119_28_240 62
926 3300046460 Ga0495638_0168730 Ga0495638_0168730_492_686 62
927 3300046460 Ga0495638_0169429 Ga0495638_0169429_113_307 62
928 3300046460 Ga0495638_0218367 Ga0495638_0218367_483_695 62
929 3300046460 Ga0495638_0321762 Ga0495638_0321762_541_747 62
930 3300046463 Ga0495653_0028500 Ga0495653_0028500_2064_2276 62
931 3300046463 Ga0495653_0058852 Ga0495653_0058852_1705_1899 62
932 3300046463 Ga0495653_0297967 Ga0495653_0297967_488_682 62
933 3300046472 Ga0495580_0009402 Ga0495580_0009402_1781_1975 62
934 3300046472 Ga0495580_0264633 Ga0495580_0264633_97_291 62
935 3300046472 Ga0495580_0429849 Ga0495580_0429849_369_572 62
936 3300046473 Ga0495582_0020418 Ga0495582_0020418_1717_1911 62
937 3300046473 Ga0495582_0051053 Ga0495582_0051053_739_933 62
938 3300046473 Ga0495582_0102349 Ga0495582_0102349_923_1117 62
939 3300046473 Ga0495582_0120275 Ga0495582_0120275_629_841 62
940 3300046474 Ga0495605_0000276 Ga0495605_0000276_37261_37455 62
941 3300046474 Ga0495605_0012653 Ga0495605_0012653_3600_3812 62
942 3300046474 Ga0495605_0015789 Ga0495605_0015789_808_1002 62
943 3300046474 Ga0495605_0020432 Ga0495605_0020432_1311_1505 62
944 3300046474 Ga0495605_0038749 Ga0495605_0038749_92_304 62
945 3300046474 Ga0495605_0133776 Ga0495605_0133776_70_264 62
946 3300046474 Ga0495605_0254020 Ga0495605_0254020_414_608 62
947 3300046475 Ga0495639_0297710 Ga0495639_0297710_251_463 62
948 3300046475 Ga0495639_0316473 Ga0495639_0316473_352_546 62
949 3300046491 Ga0495584_0000011 Ga0495584_0000011_193452_193646 62
950 3300046491 Ga0495584_0001422 Ga0495584_0001422_14005_14199 62
951 3300046491 Ga0495584_0001472 Ga0495584_0001472_11208_11420 62
952 3300046491 Ga0495584_0005508 Ga0495584_0005508_4065_4259 62
953 3300046491 Ga0495584_0005815 Ga0495584_0005815_1755_1949 62
954 3300046491 Ga0495584_0005912 Ga0495584_0005912_4837_5031 62
955 3300046491 Ga0495584_0011529 Ga0495584_0011529_2194_2388 62
956 3300046491 Ga0495584_0027406 Ga0495584_0027406_2618_2812 62
957 3300046491 Ga0495584_0031834 Ga0495584_0031834_766_960 62
958 3300046491 Ga0495584_0037508 Ga0495584_0037508_1042_1236 62
959 3300046491 Ga0495584_0088559 Ga0495584_0088559_1057_1269 62
960 3300046491 Ga0495584_0325461 Ga0495584_0325461_503_697 62
961 3300046491 Ga0495584_0440124 Ga0495584_0440124_89_283 62
962 3300046492 Ga0495585_0000231 Ga0495585_0000231_14529_14723 62
963 3300046492 Ga0495585_0000661 Ga0495585_0000661_16701_16895 62
964 3300046492 Ga0495585_0002388 Ga0495585_0002388_10223_10417 62
965 3300046492 Ga0495585_0005416 Ga0495585_0005416_6410_6604 62
966 3300046492 Ga0495585_0016127 Ga0495585_0016127_1936_2130 62
967 3300046492 Ga0495585_0017357 Ga0495585_0017357_1463_1675 62
968 3300046492 Ga0495585_0022952 Ga0495585_0022952_1286_1480 62
969 3300046492 Ga0495585_0040248 Ga0495585_0040248_711_923 62
970 3300046492 Ga0495585_0043165 Ga0495585_0043165_831_1025 62
971 3300046492 Ga0495585_0044484 Ga0495585_0044484_800_994 62
972 3300046492 Ga0495585_0045810 Ga0495585_0045810_217_411 62
973 3300046492 Ga0495585_0099299 Ga0495585_0099299_476_688 62
974 3300046492 Ga0495585_0169492 Ga0495585_0169492_150_344 62
975 3300046492 Ga0495585_0222060 Ga0495585_0222060_727_921 62
976 3300046492 Ga0495585_0283329 Ga0495585_0283329_379_591 62
977 3300046492 Ga0495585_0539679 Ga0495585_0539679_159_353 62
978 3300046499 Ga0495594_0011833 Ga0495594_0011833_371_565 62
979 3300046499 Ga0495594_0021249 Ga0495594_0021249_3249_3443 62
980 3300046499 Ga0495594_0036723 Ga0495594_0036723_2262_2456 62
981 3300046499 Ga0495594_0051108 Ga0495594_0051108_1695_1889 62
982 3300046499 Ga0495594_0054367 Ga0495594_0054367_1850_2062 62
983 3300046499 Ga0495594_0324754 Ga0495594_0324754_181_393 62
984 3300046499 Ga0495594_0338716 Ga0495594_0338716_424_618 62
985 3300046499 Ga0495594_0356054 Ga0495594_0356054_619_813 62
986 3300046499 Ga0495594_0382486 Ga0495594_0382486_194_388 62
987 3300046500 Ga0495596_0000167 Ga0495596_0000167_14574_14768 62
988 3300046500 Ga0495596_0001935 Ga0495596_0001935_1308_1520 62
989 3300046500 Ga0495596_0007949 Ga0495596_0007949_2855_3067 62
990 3300046500 Ga0495596_0026810 Ga0495596_0026810_1609_1803 62
991 3300046500 Ga0495596_0029308 Ga0495596_0029308_1430_1624 62
992 3300046500 Ga0495596_0031074 Ga0495596_0031074_1072_1266 62
993 3300046500 Ga0495596_0042041 Ga0495596_0042041_718_912 62
994 3300046500 Ga0495596_0068204 Ga0495596_0068204_154_366 62
995 3300046500 Ga0495596_0143485 Ga0495596_0143485_445_657 62
996 3300046500 Ga0495596_0150353 Ga0495596_0150353_575_787 62
997 3300046500 Ga0495596_0240678 Ga0495596_0240678_66_278 62
998 3300046500 Ga0495596_0241420 Ga0495596_0241420_56_250 62
999 3300046501 Ga0495607_0000541 Ga0495607_0000541_2295_2489 62
1000 3300046501 Ga0495607_0002543 Ga0495607_0002543_3045_3257 62
1001 3300046501 Ga0495607_0007152 Ga0495607_0007152_3027_3239 62
1002 3300046501 Ga0495607_0011135 Ga0495607_0011135_1408_1596 62
1003 3300046501 Ga0495607_0013308 Ga0495607_0013308_4857_5051 62
1004 3300046501 Ga0495607_0037147 Ga0495607_0037147_639_833 62
1005 3300046501 Ga0495607_0037367 Ga0495607_0037367_1358_1552 62
1006 3300046501 Ga0495607_0039743 Ga0495607_0039743_710_904 62
1007 3300046501 Ga0495607_0075265 Ga0495607_0075265_726_938 62
1008 3300046501 Ga0495607_0077343 Ga0495607_0077343_109_303 62
1009 3300046501 Ga0495607_0085457 Ga0495607_0085457_610_804 62
1010 3300046501 Ga0495607_0186214 Ga0495607_0186214_27_221 62
1011 3300046501 Ga0495607_0285720 Ga0495607_0285720_574_768 62
1012 3300046501 Ga0495607_0432634 Ga0495607_0432634_329_541 62
1013 3300046506 Ga0495583_0001039 Ga0495583_0001039_11882_12076 62
1014 3300046506 Ga0495583_0002475 Ga0495583_0002475_12184_12378 62
1015 3300046506 Ga0495583_0003003 Ga0495583_0003003_10218_10430 62
1016 3300046506 Ga0495583_0003424 Ga0495583_0003424_1542_1754 62
1017 3300046506 Ga0495583_0016509 Ga0495583_0016509_1678_1872 62
1018 3300046506 Ga0495583_0040804 Ga0495583_0040804_1011_1199 62
1019 3300046506 Ga0495583_0046883 Ga0495583_0046883_1195_1389 62
1020 3300046506 Ga0495583_0141923 Ga0495583_0141923_55_249 62
1021 3300046506 Ga0495583_0206862 Ga0495583_0206862_237_431 62
1022 3300046506 Ga0495583_0284704 Ga0495583_0284704_109_321 62
1023 3300046506 Ga0495583_0412657 Ga0495583_0412657_115_309 62
1024 3300046507 Ga0495606_0004147 Ga0495606_0004147_10782_10976 62
1025 3300046507 Ga0495606_0007667 Ga0495606_0007667_4783_4977 62
1026 3300046507 Ga0495606_0117704 Ga0495606_0117704_720_914 62
1027 3300046507 Ga0495606_0135869 Ga0495606_0135869_827_1021 62
1028 3300046507 Ga0495606_0163968 Ga0495606_0163968_369_581 62
1029 3300046507 Ga0495606_0363673 Ga0495606_0363673_130_324 62
1030 3300046512 Ga0495610_0000670 Ga0495610_0000670_11395_11607 62
1031 3300046513 Ga0495616_0000513 Ga0495616_0000513_3052_3246 62
1032 3300046513 Ga0495616_0001343 Ga0495616_0001343_13658_13852 62
1033 3300046513 Ga0495616_0014810 Ga0495616_0014810_2206_2400 62
1034 3300046513 Ga0495616_0026806 Ga0495616_0026806_2636_2848 62
1035 3300046513 Ga0495616_0030576 Ga0495616_0030576_19_213 62
1036 3300046513 Ga0495616_0033581 Ga0495616_0033581_1827_2039 62
1037 3300046513 Ga0495616_0050386 Ga0495616_0050386_669_863 62
1038 3300046513 Ga0495616_0059048 Ga0495616_0059048_292_480 62
1039 3300046513 Ga0495616_0070740 Ga0495616_0070740_1271_1483 62
1040 3300046513 Ga0495616_0111796 Ga0495616_0111796_775_969 62
1041 3300046513 Ga0495616_0180477 Ga0495616_0180477_40_234 62
1042 3300046513 Ga0495616_0193188 Ga0495616_0193188_664_858 62
1043 3300046516 Ga0495628_0113774 Ga0495628_0113774_562_756 62
1044 3300046517 Ga0495630_0034352 Ga0495630_0034352_1235_1429 62
1045 3300046517 Ga0495630_0128986 Ga0495630_0128986_1584_1778 62
1046 3300046518 Ga0495631_0001460 Ga0495631_0001460_5456_5668 62
1047 3300046518 Ga0495631_0002828 Ga0495631_0002828_3033_3227 62
1048 3300046518 Ga0495631_0009060 Ga0495631_0009060_1918_2130 62
1049 3300046518 Ga0495631_0010172 Ga0495631_0010172_413_607 62
1050 3300046518 Ga0495631_0016695 Ga0495631_0016695_2945_3157 62
1051 3300046518 Ga0495631_0017704 Ga0495631_0017704_2067_2261 62
1052 3300046518 Ga0495631_0017820 Ga0495631_0017820_438_632 62
1053 3300046518 Ga0495631_0022351 Ga0495631_0022351_1458_1670 62
1054 3300046518 Ga0495631_0039135 Ga0495631_0039135_346_558 62
1055 3300046518 Ga0495631_0047668 Ga0495631_0047668_405_599 62
1056 3300046518 Ga0495631_0057785 Ga0495631_0057785_240_452 62
1057 3300046518 Ga0495631_0060076 Ga0495631_0060076_209_403 62
1058 3300046518 Ga0495631_0073921 Ga0495631_0073921_960_1154 62
1059 3300046518 Ga0495631_0087777 Ga0495631_0087777_522_716 62
1060 3300046519 Ga0495632_0001800 Ga0495632_0001800_14007_14201 62
1061 3300046519 Ga0495632_0005326 Ga0495632_0005326_6133_6327 62
1062 3300046519 Ga0495632_0008341 Ga0495632_0008341_2957_3151 62
1063 3300046519 Ga0495632_0010039 Ga0495632_0010039_3049_3261 62
1064 3300046519 Ga0495632_0038108 Ga0495632_0038108_946_1140 62
1065 3300046519 Ga0495632_0047193 Ga0495632_0047193_915_1109 62
1066 3300046519 Ga0495632_0243404 Ga0495632_0243404_20_214 62
1067 3300046519 Ga0495632_0246601 Ga0495632_0246601_448_642 62
1068 3300046520 Ga0495637_0002124 Ga0495637_0002124_5588_5800 62
1069 3300046520 Ga0495637_0036587 Ga0495637_0036587_161_355 62
1070 3300046520 Ga0495637_0112935 Ga0495637_0112935_223_435 62
1071 3300046520 Ga0495637_0162171 Ga0495637_0162171_227_421 62
1072 3300046522 Ga0495643_0000672 Ga0495643_0000672_2982_3176 62
1073 3300046522 Ga0495643_0009379 Ga0495643_0009379_1734_1928 62
1074 3300046522 Ga0495643_0014488 Ga0495643_0014488_714_908 62
1075 3300046522 Ga0495643_0036703 Ga0495643_0036703_1098_1310 62
1076 3300046522 Ga0495643_0081703 Ga0495643_0081703_1271_1459 62
1077 3300046522 Ga0495643_0097179 Ga0495643_0097179_1066_1278 62
1078 3300046523 Ga0495644_0011476 Ga0495644_0011476_3045_3257 62
1079 3300046523 Ga0495644_0025470 Ga0495644_0025470_1233_1427 62
1080 3300046523 Ga0495644_0026300 Ga0495644_0026300_536_730 62
1081 3300046523 Ga0495644_0029820 Ga0495644_0029820_217_429 62
1082 3300046523 Ga0495644_0105894 Ga0495644_0105894_233_427 62
1083 3300046523 Ga0495644_0164353 Ga0495644_0164353_227_439 62
1084 3300046523 Ga0495644_0203464 Ga0495644_0203464_371_583 62
1085 3300046523 Ga0495644_0310720 Ga0495644_0310720_98_292 62
1086 3300046524 Ga0495648_0000305 Ga0495648_0000305_39954_40148 62
1087 3300046524 Ga0495648_0001823 Ga0495648_0001823_3323_3517 62
1088 3300046524 Ga0495648_0010172 Ga0495648_0010172_5857_6051 62
1089 3300046524 Ga0495648_0013289 Ga0495648_0013289_2859_3071 62
1090 3300046524 Ga0495648_0028695 Ga0495648_0028695_3453_3665 62
1091 3300046524 Ga0495648_0085246 Ga0495648_0085246_859_1053 62
1092 3300046524 Ga0495648_0088322 Ga0495648_0088322_353_547 62
1093 3300046524 Ga0495648_0154615 Ga0495648_0154615_866_1060 62
1094 3300046524 Ga0495648_0252550 Ga0495648_0252550_505_717 62
1095 3300046525 Ga0495663_0078783 Ga0495663_0078783_58_252 62
1096 3300046525 Ga0495663_0356533 Ga0495663_0356533_234_428 62
1097 3300046526 Ga0495666_0001755 Ga0495666_0001755_10131_10325 62
1098 3300046526 Ga0495666_0007423 Ga0495666_0007423_3104_3316 62
1099 3300046526 Ga0495666_0016804 Ga0495666_0016804_3298_3492 62
1100 3300046526 Ga0495666_0091741 Ga0495666_0091741_208_402 62
1101 3300046526 Ga0495666_0394005 Ga0495666_0394005_267_461 62
1102 3300046528 Ga0495642_0000183 Ga0495642_0000183_33986_34198 62
1103 3300046528 Ga0495642_0001255 Ga0495642_0001255_4426_4620 62
1104 3300046528 Ga0495642_0007953 Ga0495642_0007953_831_1025 62
1105 3300046528 Ga0495642_0014164 Ga0495642_0014164_2048_2260 62
1106 3300046528 Ga0495642_0016993 Ga0495642_0016993_28_222 62
1107 3300046528 Ga0495642_0025887 Ga0495642_0025887_1464_1658 62
1108 3300046528 Ga0495642_0033505 Ga0495642_0033505_1819_2013 62
1109 3300046528 Ga0495642_0034030 Ga0495642_0034030_1398_1592 62
1110 3300046528 Ga0495642_0065935 Ga0495642_0065935_825_1019 62
1111 3300046528 Ga0495642_0115111 Ga0495642_0115111_435_647 62
1112 3300046528 Ga0495642_0117360 Ga0495642_0117360_902_1096 62
1113 3300046528 Ga0495642_0267938 Ga0495642_0267938_349_543 62
1114 3300046528 Ga0495642_0494475 Ga0495642_0494475_53_265 62
1115 3300046529 Ga0495652_0004868 Ga0495652_0004868_1858_2052 62
1116 3300046529 Ga0495652_0067329 Ga0495652_0067329_1460_1654 62
1117 3300046530 Ga0495654_0027865 Ga0495654_0027865_1935_2147 62
1118 3300046530 Ga0495654_0034900 Ga0495654_0034900_2101_2295 62
1119 3300046530 Ga0495654_0046888 Ga0495654_0046888_442_636 62
1120 3300046530 Ga0495654_0096931 Ga0495654_0096931_15_227 62
1121 3300046530 Ga0495654_0136419 Ga0495654_0136419_110_322 62
1122 3300046530 Ga0495654_0155184 Ga0495654_0155184_372_584 62
1123 3300046531 Ga0495665_0019946 Ga0495665_0019946_1490_1684 62
1124 3300046531 Ga0495665_0056383 Ga0495665_0056383_1762_1956 62
1125 3300046531 Ga0495665_0120444 Ga0495665_0120444_849_1043 62
1126 3300046533 Ga0495640_0086504 Ga0495640_0086504_589_801 62
1127 3300046535 Ga0495586_0004976 Ga0495586_0004976_3656_3850 62
1128 3300046535 Ga0495586_0012825 Ga0495586_0012825_1384_1596 62
1129 3300046535 Ga0495586_0095563 Ga0495586_0095563_792_1004 62
1130 3300046535 Ga0495586_0103072 Ga0495586_0103072_924_1118 62
1131 3300046535 Ga0495586_0452278 Ga0495586_0452278_60_254 62
1132 3300046536 Ga0495587_0032789 Ga0495587_0032789_332_526 62
1133 3300046536 Ga0495587_0103788 Ga0495587_0103788_1071_1265 62
1134 3300046537 Ga0495598_0192449 Ga0495598_0192449_164_358 62
1135 3300046538 Ga0495609_0005634 Ga0495609_0005634_1434_1622 62
1136 3300046538 Ga0495609_0006036 Ga0495609_0006036_4196_4390 62
1137 3300046538 Ga0495609_0008274 Ga0495609_0008274_4322_4516 62
1138 3300046538 Ga0495609_0018251 Ga0495609_0018251_1123_1317 62
1139 3300046538 Ga0495609_0039214 Ga0495609_0039214_945_1139 62
1140 3300046538 Ga0495609_0039663 Ga0495609_0039663_1800_2012 62
1141 3300046538 Ga0495609_0044547 Ga0495609_0044547_79_291 62
1142 3300046538 Ga0495609_0079497 Ga0495609_0079497_1228_1422 62
1143 3300046538 Ga0495609_0266738 Ga0495609_0266738_139_351 62
1144 3300046542 Ga0495597_0000750 Ga0495597_0000750_16245_16439 62
1145 3300046542 Ga0495597_0001696 Ga0495597_0001696_3802_4014 62
1146 3300046542 Ga0495597_0002408 Ga0495597_0002408_3179_3373 62
1147 3300046542 Ga0495597_0003492 Ga0495597_0003492_2856_3050 62
1148 3300046542 Ga0495597_0009047 Ga0495597_0009047_1764_1958 62
1149 3300046542 Ga0495597_0018655 Ga0495597_0018655_526_720 62
1150 3300046542 Ga0495597_0047011 Ga0495597_0047011_411_605 62
1151 3300046542 Ga0495597_0064538 Ga0495597_0064538_132_320 62
1152 3300046542 Ga0495597_0070070 Ga0495597_0070070_540_734 62
1153 3300046542 Ga0495597_0078307 Ga0495597_0078307_301_513 62
1154 3300046542 Ga0495597_0145064 Ga0495597_0145064_525_719 62
1155 3300046542 Ga0495597_0318896 Ga0495597_0318896_127_321 62
1156 3300046543 Ga0495645_0017268 Ga0495645_0017268_4034_4228 62
1157 3300046557 Ga0495622_0004031 Ga0495622_0004031_2590_2802 62
1158 3300046557 Ga0495622_0004396 Ga0495622_0004396_1719_1913 62
1159 3300046557 Ga0495622_0027134 Ga0495622_0027134_458_652 62
1160 3300046557 Ga0495622_0052977 Ga0495622_0052977_343_537 62
1161 3300046557 Ga0495622_0117707 Ga0495622_0117707_442_636 62
1162 3300046557 Ga0495622_0259833 Ga0495622_0259833_332_526 62
1163 3300046557 Ga0495622_0307603 Ga0495622_0307603_127_321 62
1164 3300046558 Ga0495633_0004010 Ga0495633_0004010_6171_6383 62
1165 3300046558 Ga0495633_0005029 Ga0495633_0005029_6397_6591 62
1166 3300046558 Ga0495633_0016596 Ga0495633_0016596_2231_2425 62
1167 3300046558 Ga0495633_0022110 Ga0495633_0022110_828_1022 62
1168 3300046558 Ga0495633_0058811 Ga0495633_0058811_534_728 62
1169 3300046558 Ga0495633_0106076 Ga0495633_0106076_385_579 62
1170 3300046558 Ga0495633_0109078 Ga0495633_0109078_157_351 62
1171 3300046558 Ga0495633_0126302 Ga0495633_0126302_468_680 62
1172 3300046558 Ga0495633_0195211 Ga0495633_0195211_462_656 62
1173 3300046558 Ga0495633_0513054 Ga0495633_0513054_221_415 62
1174 3300046559 Ga0495667_0161036 Ga0495667_0161036_1028_1222 62
1175 3300046559 Ga0495667_0771660 Ga0495667_0771660_180_374 62
1176 3300046615 Ga0495656_0001534 Ga0495656_0001534_574_771 62
1177 3300046615 Ga0495656_0009091 Ga0495656_0009091_607_819 62
1178 3300046615 Ga0495656_0034549 Ga0495656_0034549_93_281 62
1179 3300046615 Ga0495656_0072976 Ga0495656_0072976_124_318 62
1180 3300046615 Ga0495656_0575212 Ga0495656_0575212_254_466 62
1181 3300046615 Ga0495656_0721638 Ga0495656_0721638_20_214 62
1182 3300046616 Ga0495668_0000008 Ga0495668_0000008_209509_209697 62
1183 3300046616 Ga0495668_0002663 Ga0495668_0002663_3002_3214 62
1184 3300046616 Ga0495668_0011308 Ga0495668_0011308_1483_1695 62
1185 3300046616 Ga0495668_0018876 Ga0495668_0018876_310_504 62
1186 3300046616 Ga0495668_0026166 Ga0495668_0026166_1752_1946 62
1187 3300046616 Ga0495668_0038446 Ga0495668_0038446_1682_1894 62
1188 3300046616 Ga0495668_0040587 Ga0495668_0040587_913_1107 62
1189 3300046616 Ga0495668_0049125 Ga0495668_0049125_107_295 62
1190 3300046616 Ga0495668_0107267 Ga0495668_0107267_359_571 62
1191 3300046616 Ga0495668_0124011 Ga0495668_0124011_298_492 62
1192 3300046616 Ga0495668_0257876 Ga0495668_0257876_707_919 62
1193 3300046642 Ga0495634_0071133 Ga0495634_0071133_1495_1689 62
1194 3300046642 Ga0495634_0382547 Ga0495634_0382547_490_684 62
1195 3300046642 Ga0495634_0414708 Ga0495634_0414708_475_687 62
1196 3300046648 Ga0495611_0004165 Ga0495611_0004165_4999_5211 62
1197 3300046648 Ga0495611_0008787 Ga0495611_0008787_2959_3153 62
1198 3300046648 Ga0495611_0013099 Ga0495611_0013099_2879_3091 62
1199 3300046648 Ga0495611_0018491 Ga0495611_0018491_1778_1972 62
1200 3300046648 Ga0495611_0027894 Ga0495611_0027894_19_213 62
1201 3300046648 Ga0495611_0037430 Ga0495611_0037430_221_433 62
1202 3300046648 Ga0495611_0061736 Ga0495611_0061736_373_567 62
1203 3300046648 Ga0495611_0377273 Ga0495611_0377273_300_494 62
1204 3300046660 Ga0495625_0004860 Ga0495625_0004860_435_629 62
1205 3300046660 Ga0495625_0009751 Ga0495625_0009751_3158_3352 62
1206 3300046660 Ga0495625_0071803 Ga0495625_0071803_1435_1623 62
1207 3300046660 Ga0495625_0120141 Ga0495625_0120141_1501_1713 62
1208 3300046660 Ga0495625_0165047 Ga0495625_0165047_557_769 62
1209 3300046660 Ga0495625_0374666 Ga0495625_0374666_28_222 62
1210 3300046663 Ga0495635_0061833 Ga0495635_0061833_702_914 62
1211 3300046663 Ga0495635_0253179 Ga0495635_0253179_485_679 62
1212 3300046664 Ga0495659_0006683 Ga0495659_0006683_2029_2217 62
1213 3300046664 Ga0495659_0063289 Ga0495659_0063289_184_378 62
1214 3300046664 Ga0495659_0096027 Ga0495659_0096027_738_932 62
1215 3300046665 Ga0495661_0002137 Ga0495661_0002137_3130_3324 62
1216 3300046665 Ga0495661_0007102 Ga0495661_0007102_1364_1552 62
1217 3300046665 Ga0495661_0007586 Ga0495661_0007586_4317_4511 62
1218 3300046665 Ga0495661_0009450 Ga0495661_0009450_3045_3257 62
1219 3300046665 Ga0495661_0010426 Ga0495661_0010426_3057_3251 62
1220 3300046665 Ga0495661_0013323 Ga0495661_0013323_594_806 62
1221 3300046665 Ga0495661_0021589 Ga0495661_0021589_1526_1720 62
1222 3300046665 Ga0495661_0033130 Ga0495661_0033130_1434_1628 62
1223 3300046665 Ga0495661_0036060 Ga0495661_0036060_774_968 62
1224 3300046665 Ga0495661_0044737 Ga0495661_0044737_1085_1279 62
1225 3300046665 Ga0495661_0047611 Ga0495661_0047611_1075_1269 62
1226 3300046665 Ga0495661_0051913 Ga0495661_0051913_1780_1992 62
1227 3300046665 Ga0495661_0059915 Ga0495661_0059915_761_955 62
1228 3300046665 Ga0495661_0076266 Ga0495661_0076266_775_969 62
1229 3300046665 Ga0495661_0076505 Ga0495661_0076505_1019_1231 62
1230 3300046665 Ga0495661_0080102 Ga0495661_0080102_1458_1670 62
1231 3300046665 Ga0495661_0090702 Ga0495661_0090702_396_590 62
1232 3300046665 Ga0495661_0149782 Ga0495661_0149782_506_700 62
1233 3300046665 Ga0495661_0216054 Ga0495661_0216054_740_934 62
1234 3300046665 Ga0495661_0247407 Ga0495661_0247407_107_301 62
1235 3300046665 Ga0495661_0445173 Ga0495661_0445173_408_602 62
1236 3300046665 Ga0495661_0554911 Ga0495661_0554911_48_242 62
1237 3300046674 Ga0495588_0000070 Ga0495588_0000070_209868_210062 62
1238 3300046674 Ga0495588_0021639 Ga0495588_0021639_1623_1835 62
1239 3300046674 Ga0495588_0024022 Ga0495588_0024022_1336_1530 62
1240 3300046674 Ga0495588_0028284 Ga0495588_0028284_2558_2752 62
1241 3300046674 Ga0495588_0036330 Ga0495588_0036330_117_311 62
1242 3300046674 Ga0495588_0037675 Ga0495588_0037675_1222_1416 62
1243 3300046674 Ga0495588_0056773 Ga0495588_0056773_1328_1522 62
1244 3300046674 Ga0495588_0087644 Ga0495588_0087644_979_1191 62
1245 3300046674 Ga0495588_0131471 Ga0495588_0131471_709_903 62
1246 3300046674 Ga0495588_0134741 Ga0495588_0134741_633_845 62
1247 3300046679 Ga0495623_0005716 Ga0495623_0005716_3794_3988 62
1248 3300046679 Ga0495623_0016901 Ga0495623_0016901_4381_4575 62
1249 3300046679 Ga0495623_0072479 Ga0495623_0072479_272_484 62
1250 3300046679 Ga0495623_0194837 Ga0495623_0194837_220_414 62
1251 3300046679 Ga0495623_0211900 Ga0495623_0211900_371_565 62
1252 3300046680 Ga0495646_0118017 Ga0495646_0118017_1293_1487 62
1253 3300046680 Ga0495646_0567688 Ga0495646_0567688_180_374 62
1254 3300046684 Ga0495669_0003622 Ga0495669_0003622_3240_3452 62
1255 3300046684 Ga0495669_0006862 Ga0495669_0006862_3221_3415 62
1256 3300046684 Ga0495669_0010378 Ga0495669_0010378_1438_1632 62
1257 3300046684 Ga0495669_0010911 Ga0495669_0010911_2095_2307 62
1258 3300046684 Ga0495669_0013578 Ga0495669_0013578_1822_2016 62
1259 3300046684 Ga0495669_0029766 Ga0495669_0029766_1819_2031 62
1260 3300046684 Ga0495669_0070653 Ga0495669_0070653_1181_1375 62
1261 3300046684 Ga0495669_0082095 Ga0495669_0082095_1190_1384 62
1262 3300046684 Ga0495669_0555180 Ga0495669_0555180_74_268 62
1263 3300046684 Ga0495669_0566692 Ga0495669_0566692_107_295 62
1264 3300046689 Ga0495613_0008593 Ga0495613_0008593_3129_3341 62
1265 3300046689 Ga0495613_0077562 Ga0495613_0077562_1452_1646 62
1266 3300046689 Ga0495613_0472519 Ga0495613_0472519_423_635 62
1267 3300046690 Ga0495624_0053063 Ga0495624_0053063_1656_1850 62
1268 3300046691 Ga0495670_0000858 Ga0495670_0000858_11380_11574 62
1269 3300046691 Ga0495670_0007604 Ga0495670_0007604_2156_2350 62
1270 3300046691 Ga0495670_0010624 Ga0495670_0010624_1435_1629 62
1271 3300046691 Ga0495670_0020705 Ga0495670_0020705_1018_1212 62
1272 3300046691 Ga0495670_0037875 Ga0495670_0037875_420_614 62
1273 3300046691 Ga0495670_0055003 Ga0495670_0055003_288_482 62
1274 3300046691 Ga0495670_0089031 Ga0495670_0089031_525_719 62
1275 3300046691 Ga0495670_0212799 Ga0495670_0212799_633_845 62
1276 3300046691 Ga0495670_0333239 Ga0495670_0333239_134_328 62
1277 3300046691 Ga0495670_0474476 Ga0495670_0474476_289_483 62
1278 3300046692 Ga0495671_0010899 Ga0495671_0010899_1723_1935 62
1279 3300046692 Ga0495671_0077072 Ga0495671_0077072_1367_1561 62
1280 3300046692 Ga0495671_0105022 Ga0495671_0105022_394_582 62
1281 3300046692 Ga0495671_0114595 Ga0495671_0114595_176_370 62
1282 3300046692 Ga0495671_0147315 Ga0495671_0147315_345_557 62
1283 3300046694 Ga0495649_0001152 Ga0495649_0001152_17647_17841 62
1284 3300046694 Ga0495649_0001587 Ga0495649_0001587_2639_2851 62
1285 3300046694 Ga0495649_0005680 Ga0495649_0005680_3578_3766 62
1286 3300046694 Ga0495649_0023517 Ga0495649_0023517_1945_2139 62
1287 3300046694 Ga0495649_0070020 Ga0495649_0070020_1400_1591 62
1288 3300046694 Ga0495649_0083163 Ga0495649_0083163_1361_1573 62
1289 3300046694 Ga0495649_0212700 Ga0495649_0212700_648_842 62
1290 3300046694 Ga0495649_0241260 Ga0495649_0241260_57_251 62
1291 3300046694 Ga0495649_0420604 Ga0495649_0420604_348_542 62
1292 3300046794 Ga0495589_0000175 Ga0495589_0000175_52338_52532 62
1293 3300046794 Ga0495589_0006172 Ga0495589_0006172_3146_3358 62
1294 3300046794 Ga0495589_0008611 Ga0495589_0008611_2107_2319 62
1295 3300046794 Ga0495589_0015652 Ga0495589_0015652_1090_1284 62
1296 3300046794 Ga0495589_0029680 Ga0495589_0029680_1463_1675 62
1297 3300046794 Ga0495589_0059859 Ga0495589_0059859_129_323 62
1298 3300046794 Ga0495589_0096445 Ga0495589_0096445_147_341 62
1299 3300046794 Ga0495589_0100072 Ga0495589_0100072_517_729 62
1300 3300046794 Ga0495589_0111488 Ga0495589_0111488_581_793 62
1301 3300046794 Ga0495589_0149748 Ga0495589_0149748_455_649 62
1302 3300046794 Ga0495589_0428732 Ga0495589_0428732_399_587 62
1303 3300046794 Ga0495589_0509956 Ga0495589_0509956_344_538 62
1304 3300046809 Ga0495600_0029364 Ga0495600_0029364_2980_3174 62
1305 3300046809 Ga0495600_0077432 Ga0495600_0077432_1517_1711 62
1306 3300046810 Ga0495660_0000113 Ga0495660_0000113_55394_55588 62
1307 3300046810 Ga0495660_0011822 Ga0495660_0011822_1278_1472 62
1308 3300046810 Ga0495660_0013074 Ga0495660_0013074_422_616 62
1309 3300046810 Ga0495660_0018065 Ga0495660_0018065_2036_2230 62
1310 3300046810 Ga0495660_0058835 Ga0495660_0058835_517_711 62
1311 3300046810 Ga0495660_0087344 Ga0495660_0087344_332_526 62
1312 3300046810 Ga0495660_0089041 Ga0495660_0089041_815_1009 62
1313 3300046810 Ga0495660_0091058 Ga0495660_0091058_853_1041 62
1314 3300046810 Ga0495660_0119957 Ga0495660_0119957_600_794 62
1315 3300046810 Ga0495660_0191455 Ga0495660_0191455_486_698 62
1316 3300047315 Ga0495581_0036204 Ga0495581_0036204_653_865 62
1317 3300047315 Ga0495581_0106183 Ga0495581_0106183_487_681 62
1318 3300047315 Ga0495581_0128311 Ga0495581_0128311_457_651 62
1319 3300047315 Ga0495581_0239874 Ga0495581_0239874_800_994 62
1320 3300047315 Ga0495581_0326300 Ga0495581_0326300_332_526 62
1321 3300047317 Ga0495604_0037771 Ga0495604_0037771_3040_3234 62
1322 3300047317 Ga0495604_0104486 Ga0495604_0104486_822_1016 62
1323 3300047317 Ga0495604_0215908 Ga0495604_0215908_480_692 62
1324 3300047317 Ga0495604_0994598 Ga0495604_0994598_272_484 62
1325 3300047318 Ga0495636_0002635 Ga0495636_0002635_1028_1222 62
1326 3300047318 Ga0495636_0024504 Ga0495636_0024504_219_407 62
1327 3300047318 Ga0495636_0024928 Ga0495636_0024928_576_770 62
1328 3300047318 Ga0495636_0094257 Ga0495636_0094257_927_1121 62
1329 3300047318 Ga0495636_0459209 Ga0495636_0459209_290_484 62
1330 3300047319 Ga0495674_0126304 Ga0495674_0126304_1170_1364 62
1331 3300047319 Ga0495674_1463061 Ga0495674_1463061_11_205 62
1332 3300047320 Ga0495672_0000014 Ga0495672_0000014_300961_301155 62
1333 3300047320 Ga0495672_0000802 Ga0495672_0000802_30604_30816 62
1334 3300047320 Ga0495672_0001524 Ga0495672_0001524_5388_5582 62
1335 3300047320 Ga0495672_0008898 Ga0495672_0008898_2971_3165 62
1336 3300047320 Ga0495672_0049785 Ga0495672_0049785_781_975 62
1337 3300047320 Ga0495672_0075371 Ga0495672_0075371_213_407 62
1338 3300047320 Ga0495672_0081406 Ga0495672_0081406_953_1147 62
1339 3300047320 Ga0495672_0091240 Ga0495672_0091240_60_254 62
1340 3300047320 Ga0495672_0232320 Ga0495672_0232320_14_208 62
1341 3300047320 Ga0495672_0293467 Ga0495672_0293467_57_269 62
1342 3300047320 Ga0495672_0371481 Ga0495672_0371481_72_266 62
1343 3300047321 Ga0495676_0000635 Ga0495676_0000635_15092_15304 62
1344 3300047321 Ga0495676_0024556 Ga0495676_0024556_367_561 62
1345 3300047322 Ga0495680_0007985 Ga0495680_0007985_570_782 62
1346 3300047322 Ga0495680_0886271 Ga0495680_0886271_139_333 62
1347 3300047323 Ga0495683_0004597 Ga0495683_0004597_4532_4744 62
1348 3300047323 Ga0495683_0018374 Ga0495683_0018374_2438_2632 62
1349 3300047323 Ga0495683_0051367 Ga0495683_0051367_1536_1748 62
1350 3300047323 Ga0495683_0084867 Ga0495683_0084867_365_577 62
1351 3300047323 Ga0495683_0092427 Ga0495683_0092427_216_410 62
1352 3300047323 Ga0495683_0123858 Ga0495683_0123858_265_459 62
1353 3300047323 Ga0495683_0131796 Ga0495683_0131796_249_461 62
1354 3300047323 Ga0495683_0300778 Ga0495683_0300778_211_405 62
1355 3300047443 Ga0495687_000256 Ga0495687_000256_55463_55657 62
1356 3300047443 Ga0495687_001662 Ga0495687_001662_2920_3114 62
1357 3300047443 Ga0495687_002171 Ga0495687_002171_5065_5277 62
1358 3300047443 Ga0495687_002621 Ga0495687_002621_4081_4275 62
1359 3300047443 Ga0495687_081327 Ga0495687_081327_322_510 62
1360 3300047444 Ga0495675_0004484 Ga0495675_0004484_3171_3365 62
1361 3300047444 Ga0495675_0009446 Ga0495675_0009446_537_749 62
1362 3300047444 Ga0495675_0083856 Ga0495675_0083856_1226_1438 62
1363 3300047444 Ga0495675_0283877 Ga0495675_0283877_355_549 62
1364 3300047445 Ga0495677_0000285 Ga0495677_0000285_2047_2259 62
1365 3300047445 Ga0495677_0000526 Ga0495677_0000526_1762_1956 62
1366 3300047445 Ga0495677_0002208 Ga0495677_0002208_6387_6581 62
1367 3300047445 Ga0495677_0002393 Ga0495677_0002393_5515_5709 62
1368 3300047445 Ga0495677_0004272 Ga0495677_0004272_3773_3985 62
1369 3300047445 Ga0495677_0006101 Ga0495677_0006101_328_522 62
1370 3300047445 Ga0495677_0013292 Ga0495677_0013292_1571_1759 62
1371 3300047445 Ga0495677_0022540 Ga0495677_0022540_1627_1839 62
1372 3300047445 Ga0495677_0023041 Ga0495677_0023041_660_854 62
1373 3300047445 Ga0495677_0133912 Ga0495677_0133912_733_927 62
1374 3300047445 Ga0495677_0153867 Ga0495677_0153867_82_276 62
1375 3300047446 Ga0495679_001976 Ga0495679_001976_2661_2855 62
1376 3300047446 Ga0495679_008571 Ga0495679_008571_2336_2548 62
1377 3300047446 Ga0495679_038226 Ga0495679_038226_627_821 62
1378 3300047446 Ga0495679_042065 Ga0495679_042065_1164_1358 62
1379 3300047446 Ga0495679_050380 Ga0495679_050380_514_726 62
1380 3300047446 Ga0495679_085372 Ga0495679_085372_233_427 62
1381 3300047446 Ga0495679_090044 Ga0495679_090044_147_341 62
1382 3300047447 Ga0495685_001659 Ga0495685_001659_1463_1657 62
1383 3300047447 Ga0495685_017258 Ga0495685_017258_1830_2024 62
1384 3300047447 Ga0495685_023277 Ga0495685_023277_727_939 62
1385 3300047447 Ga0495685_042836 Ga0495685_042836_1011_1199 62
1386 3300047447 Ga0495685_101556 Ga0495685_101556_229_423 62
1387 3300047447 Ga0495685_223931 Ga0495685_223931_393_587 62
1388 3300047469 Ga0495673_0026744 Ga0495673_0026744_1045_1257 62
1389 3300047470 Ga0495681_0002303 Ga0495681_0002303_12020_12214 62
1390 3300047470 Ga0495681_0002957 Ga0495681_0002957_11194_11382 62
1391 3300047470 Ga0495681_0004255 Ga0495681_0004255_5215_5409 62
1392 3300047470 Ga0495681_0016882 Ga0495681_0016882_32_226 62
1393 3300047470 Ga0495681_0016966 Ga0495681_0016966_508_720 62
1394 3300047470 Ga0495681_0026169 Ga0495681_0026169_1392_1604 62
1395 3300047470 Ga0495681_0045254 Ga0495681_0045254_795_1007 62
1396 3300047470 Ga0495681_0046523 Ga0495681_0046523_559_753 62
1397 3300047470 Ga0495681_0087970 Ga0495681_0087970_385_597 62
1398 3300047470 Ga0495681_0116679 Ga0495681_0116679_283_477 62
1399 3300047470 Ga0495681_0149333 Ga0495681_0149333_584_796 62
1400 3300047470 Ga0495681_0166863 Ga0495681_0166863_208_420 62
1401 3300047470 Ga0495681_0224552 Ga0495681_0224552_332_526 62
1402 3300047470 Ga0495681_0233152 Ga0495681_0233152_179_391 62
1403 3300047472 Ga0495686_0000612 Ga0495686_0000612_32397_32591 62
1404 3300047472 Ga0495686_0007392 Ga0495686_0007392_1458_1646 62
1405 3300047472 Ga0495686_0026052 Ga0495686_0026052_898_1101 62
1406 3300047472 Ga0495686_0052739 Ga0495686_0052739_989_1201 62
1407 3300047472 Ga0495686_0057652 Ga0495686_0057652_1690_1884 62
1408 3300047673 Ga0495593_0065585 Ga0495593_0065585_1037_1249 62
1409 3300047673 Ga0495593_0090787 Ga0495593_0090787_1052_1246 62
1410 3300047673 Ga0495593_0191581 Ga0495593_0191581_370_564 62
1411 3300047673 Ga0495593_0199628 Ga0495593_0199628_559_771 62
1412 3300047673 Ga0495593_0240489 Ga0495593_0240489_534_728 62
1413 3300048088 Ga0495602_0006516 Ga0495602_0006516_1900_2094 62
1414 3300048088 Ga0495602_0129568 Ga0495602_0129568_946_1140 62
1415 3300048089 Ga0495614_0010297 Ga0495614_0010297_2544_2756 62
1416 3300048089 Ga0495614_0034116 Ga0495614_0034116_188_400 62
1417 3300048089 Ga0495614_0078450 Ga0495614_0078450_729_923 62
1418 3300048090 Ga0495615_0277052 Ga0495615_0277052_53_265 62
1419 3300048091 Ga0495626_0000030 Ga0495626_0000030_15823_16017 62
1420 3300048091 Ga0495626_0001112 Ga0495626_0001112_4020_4214 62
1421 3300048091 Ga0495626_0003446 Ga0495626_0003446_1716_1910 62
1422 3300048091 Ga0495626_0008158 Ga0495626_0008158_3516_3710 62
1423 3300048091 Ga0495626_0013319 Ga0495626_0013319_1216_1410 62
1424 3300048091 Ga0495626_0017773 Ga0495626_0017773_1966_2160 62
1425 3300048091 Ga0495626_0019121 Ga0495626_0019121_571_765 62
1426 3300048091 Ga0495626_0037898 Ga0495626_0037898_614_826 62
1427 3300048091 Ga0495626_0050532 Ga0495626_0050532_815_1009 62
1428 3300048091 Ga0495626_0069697 Ga0495626_0069697_13_207 62
1429 3300048091 Ga0495626_0118822 Ga0495626_0118822_812_1006 62
1430 3300048091 Ga0495626_0129870 Ga0495626_0129870_614_808 62
1431 3300048091 Ga0495626_0147652 Ga0495626_0147652_481_693 62
1432 3300048903 Ga0496100_0015402 Ga0496100_0015402_2631_2825 62
1433 3300048903 Ga0496100_0522339 Ga0496100_0522339_314_508 62
1434 3300048903 Ga0496100_0731895 Ga0496100_0731895_258_452 62
1435 3300048903 Ga0496100_0748557 Ga0496100_0748557_40_234 62
1436 3300048903 Ga0496100_0775748 Ga0496100_0775748_242_430 62
1437 3300048904 Ga0496101_0022303 Ga0496101_0022303_894_1088 62
1438 3300048904 Ga0496101_1151843 Ga0496101_1151843_74_268 62
1439 3300048905 Ga0496102_0000107 Ga0496102_0000107_17799_17993 62
1440 3300048905 Ga0496102_0002399 Ga0496102_0002399_3157_3351 62
1441 3300048905 Ga0496102_0154892 Ga0496102_0154892_287_481 62
1442 3300048905 Ga0496102_0360849 Ga0496102_0360849_564_758 62
1443 3300048905 Ga0496102_0471576 Ga0496102_0471576_501_695 62
1444 3300048905 Ga0496102_0905887 Ga0496102_0905887_463_657 62
1445 3300048906 Ga0496103_0013925 Ga0496103_0013925_110_304 62
1446 3300048906 Ga0496103_0027712 Ga0496103_0027712_1952_2146 62
1447 3300048906 Ga0496103_0272794 Ga0496103_0272794_689_901 62
1448 3300048906 Ga0496103_0459573 Ga0496103_0459573_465_659 62
1449 3300048906 Ga0496103_0547058 Ga0496103_0547058_209_403 62
1450 3300048907 Ga0496104_0514006 Ga0496104_0514006_868_1062 62
1451 3300048907 Ga0496104_1176458 Ga0496104_1176458_186_380 62
1452 3300048908 Ga0496105_0423836 Ga0496105_0423836_200_394 62
1453 3300048908 Ga0496105_0715560 Ga0496105_0715560_516_710 62
1454 3300048909 Ga0496106_1048597 Ga0496106_1048597_46_240 62
1455 3300048910 Ga0496107_0131886 Ga0496107_0131886_959_1153 62
1456 3300048911 Ga0496108_0173153 Ga0496108_0173153_989_1183 62
1457 3300048911 Ga0496108_1079097 Ga0496108_1079097_97_291 62
1458 3300048912 Ga0496109_0022473 Ga0496109_0022473_2183_2377 62
1459 3300048912 Ga0496109_1039118 Ga0496109_1039118_407_601 62
1460 3300048912 Ga0496109_1433848 Ga0496109_1433848_356_550 62
1461 3300048913 Ga0496110_0000073 Ga0496110_0000073_4086_4298 62
1462 3300048913 Ga0496110_0408481 Ga0496110_0408481_1030_1224 62
1463 3300048913 Ga0496110_0729724 Ga0496110_0729724_525_719 62
1464 3300048913 Ga0496110_1800402 Ga0496110_1800402_276_470 62
1465 3300048914 Ga0496111_0076108 Ga0496111_0076108_1267_1479 62
1466 3300048914 Ga0496111_0243968 Ga0496111_0243968_1126_1320 62
1467 3300048914 Ga0496111_0244250 Ga0496111_0244250_161_355 62
1468 3300048914 Ga0496111_0308709 Ga0496111_0308709_349_543 62
1469 3300048916 Ga0496113_0006791 Ga0496113_0006791_642_836 62
1470 3300048916 Ga0496113_0115806 Ga0496113_0115806_1457_1651 62
1471 3300048916 Ga0496113_0534784 Ga0496113_0534784_51_245 62
1472 3300048918 Ga0496115_0005153 Ga0496115_0005153_7076_7270 62
1473 3300048918 Ga0496115_0648522 Ga0496115_0648522_200_394 62
1474 3300048924 Ga0496121_0010080 Ga0496121_0010080_1561_1755 62
1475 3300048924 Ga0496121_0319154 Ga0496121_0319154_314_508 62
1476 3300048924 Ga0496121_0397102 Ga0496121_0397102_347_541 62
1477 3300048925 Ga0496122_0004240 Ga0496122_0004240_17146_17340 62
1478 3300048925 Ga0496122_0005480 Ga0496122_0005480_11747_11941 62
1479 3300048925 Ga0496122_0014909 Ga0496122_0014909_954_1148 62
1480 3300048926 Ga0496123_0004584 Ga0496123_0004584_2026_2220 62
1481 3300048926 Ga0496123_0004651 Ga0496123_0004651_2017_2211 62
1482 3300048926 Ga0496123_0093325 Ga0496123_0093325_764_958 62
1483 3300048927 Ga0496124_0025849 Ga0496124_0025849_3555_3749 62
1484 3300048927 Ga0496124_0042104 Ga0496124_0042104_2961_3155 62
1485 3300048927 Ga0496124_0073546 Ga0496124_0073546_911_1105 62
1486 3300048927 Ga0496124_0088863 Ga0496124_0088863_612_806 62
1487 3300048927 Ga0496124_0158903 Ga0496124_0158903_1174_1368 62
1488 3300048927 Ga0496124_0221766 Ga0496124_0221766_641_835 62
1489 3300048927 Ga0496124_0923772 Ga0496124_0923772_249_461 62
1490 3300048927 Ga0496124_0989646 Ga0496124_0989646_124_330 62
1491 3300048928 Ga0496125_0005966 Ga0496125_0005966_11456_11650 62
1492 3300048928 Ga0496125_0166028 Ga0496125_0166028_709_903 62
1493 3300048928 Ga0496125_0272016 Ga0496125_0272016_306_500 62
1494 3300049128 Ga0501308_029752 Ga0501308_029752_52_246 62
1495 3300049459 Ga0495678_000230 Ga0495678_000230_60872_61084 62
1496 3300049459 Ga0495678_000523 Ga0495678_000523_32742_32954 62
1497 3300049459 Ga0495678_001473 Ga0495678_001473_7880_8092 62
1498 3300049459 Ga0495678_004643 Ga0495678_004643_6356_6550 62
1499 3300049459 Ga0495678_031893 Ga0495678_031893_1371_1559 62
1500 3300049459 Ga0495678_141569 Ga0495678_141569_244_438 62
1501 3300049459 Ga0495678_166213 Ga0495678_166213_91_285 62
1502 3300049460 Ga0495682_0001242 Ga0495682_0001242_10780_10992 62
1503 3300049460 Ga0495682_0008310 Ga0495682_0008310_2193_2405 62
1504 3300049460 Ga0495682_0008772 Ga0495682_0008772_2974_3168 62
1505 3300049460 Ga0495682_0017767 Ga0495682_0017767_1543_1737 62
1506 3300049460 Ga0495682_0169457 Ga0495682_0169457_268_456 62
1507 3300049460 Ga0495682_0285193 Ga0495682_0285193_61_273 62
1508 3300049571 Ga0501034_0039455 Ga0501034_0039455_134_343 62
1509 3300049572 Ga0501036_0231432 Ga0501036_0231432_642_836 62
1510 3300049579 Ga0501043_1185868 Ga0501043_1185868_268_477 62
1511 3300049581 Ga0501047_0481759 Ga0501047_0481759_362_556 62
1512 3300049581 Ga0501047_0512813 Ga0501047_0512813_609_818 62
1513 3300049583 Ga0501067_0011741 Ga0501067_0011741_1168_1377 62
1514 3300049583 Ga0501067_0578406 Ga0501067_0578406_401_604 62
1515 3300049586 Ga0501070_0022870 Ga0501070_0022870_458_667 62
1516 3300049586 Ga0501070_0734491 Ga0501070_0734491_226_435 62
1517 3300049588 Ga0501072_0296063 Ga0501072_0296063_985_1194 62
1518 3300049589 Ga0501073_0036699 Ga0501073_0036699_2960_3169 62
1519 3300049671 Ga0501238_005850 Ga0501238_005850_1161_1352 62
1520 3300049673 Ga0501240_087372 Ga0501240_087372_167_361 62
1521 3300049679 Ga0501249_081265 Ga0501249_081265_41_235 62
1522 3300049741 Ga0501079_0396811 Ga0501079_0396811_204_413 62
1523 3300049742 Ga0501080_0020160 Ga0501080_0020160_5099_5308 62
1524 3300049742 Ga0501080_0332827 Ga0501080_0332827_574_783 62
1525 3300049744 Ga0501083_0083255 Ga0501083_0083255_1494_1703 62
1526 3300049760 Ga0501263_050956 Ga0501263_050956_17_211 62
1527 3300049822 Ga0501035_0024716 Ga0501035_0024716_5253_5447 62
1528 3300049823 Ga0501044_0484661 Ga0501044_0484661_660_854 62
1529 3300059491 Ga0587070_108964 Ga0587070_108964_425_619 62
1530 3300059505 Ga0587083_0063905 Ga0587083_0063905_374_568 62
1531 3300059508 Ga0587088_084515 Ga0587088_084515_390_584 62
1532 3300059511 Ga0587091_144887 Ga0587091_144887_36_230 62
1533 3300059604 Ga0587098_051426 Ga0587098_051426_40_234 62
1534 3300059623 Ga0587101_092632 Ga0587101_092632_289_483 62
1535 3300059647 Ga0587079_051086 Ga0587079_051086_617_811 62
1536 3300060353 Ga0501082_0631383 Ga0501082_0631383_507_716 62
1537 3300061719 Ga0466962_0090693 Ga0466962_0090693_1120_1314 62
1538 3300061719 Ga0466962_0099875 Ga0466962_0099875_167_361 62
1539 3300061719 Ga0466962_0119251 Ga0466962_0119251_671_865 62

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF10276

zf-CHCC

Zinc-finger domain

28

64

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
6zki-assembly1.cif.gz_b complex i with nadh, open2 0.7632 30 52
7ak5-assembly1.cif.gz_R cryo-em structure of respiratory complex i in the deactive state from mus musculus at 3.2 a 0.7462 30 52
8ca3-assembly1.cif.gz_R cryo-em structure ndufs4 knockout complex i from mus musculus heart (class 2). 0.7418 28 53
6zkt-assembly1.cif.gz_b deactive complex i, open2 0.6851 30 55
8buu-assembly1.cif.gz_0 are-abcf vmlr2 bound to a 70s ribosome 0.6437 40 52
ID Description Score Start End Superfamily
af_C6SXD2_1_92_2.20.25.30 Mainly Beta;Single Sheet;N-terminal domain of TfIIb; 0.9213 40 52 2.20.25.30
af_Q8I5N0_14_80_3.10.660.10 Alpha Beta;Roll;Microbial ribonuclease fold;DPH Zinc finger 0.8837 40 53 3.10.660.10
af_I1NHN5_48_134_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8375 41 52 3.30.40.10
af_Q9TZ74_129_204_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.8195 39 50 3.30.40.10
af_K7KKY2_751_958_3.30.40.10 Alpha Beta;2-Layer Sandwich;Herpes Virus-1;Zinc/RING finger domain, C3HC4 (zinc finger) 0.7575 40 52 3.30.40.10
ID Description Score Start End GO Terms
AF-A0A4P7BFP8-F1-model_v4 deleted 0.9252 1 62
AF-G0AFW4-F1-model_v4 Zinc finger CHCC-type domain-containing protein 0.9204 1 62
AF-A0A3S9HFV4-F1-model_v4 Zinc-finger domain-containing protein 0.9153 1 62
AF-A0A6L8KRJ3-F1-model_v4 Zinc-finger domain-containing protein 0.9149 1 62
AF-A0A4P7BFP8-F1-model_v4 deleted 0.9114 1 62

Feature Viewer

pLDDT pTM Quality
76.62 0.6 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map