F494578
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1527 | 741 | 3054 | 319 |
Family's Representative Sequence
| Representative Sequence | iso_pu_bacteria|2513237102|2513700424 |
| Length | 385 |
| Sequence | VRRDDSGGNETALTSAASPQKEPGPHRLIWLAPHERTSQTIEDAKLLSATLTSLRSKAPPPYIELMQDQMRSYLDFEKPVAELDSKVDELRALAASGTDISDEIGRIEDKAAQALADLYQNLTPWQKTLVARHPQRPHFNDFIKGLITEFTPLAGDRKFGEDEALVAGFGRFRGEPICVMGQEKGDSTESRIRHNFGMARPEGYRKCVRLMEMAERFGLPVLSLADSAGAYPGIGAEERGQAEAIARSTDACLALTVPNVAIITGEGMSGGAIAITTANKVLMLEHAIYSVISPEAASSILWRDGTKAQEAANNMKITAQDMLRFGVIDQILKEPVGGAHRDPAAMIATTGEAIAKAFDELRDLDGEAIRKQRRQKFLDIGRKLG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 2 | 3300001989 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 | Metagenome | Rhizosphere |
| 3 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 4 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 5 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 6 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 7 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 8 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 9 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 10 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 11 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 12 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 13 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 14 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 15 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 16 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 21 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 23 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 25 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 41 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 45 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 46 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 47 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 55 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 57 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 58 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 59 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 61 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 62 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 63 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 64 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 65 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 66 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 69 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 70 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 71 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 72 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 73 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 74 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 76 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 77 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 78 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 79 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 80 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 81 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 82 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 83 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 84 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 85 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 86 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 87 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 88 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 89 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006942 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW | Metagenome | Nodule |
| 95 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 98 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 110 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 111 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 112 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 113 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 123 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 124 | 3300021324 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 | Metagenome | Nodule |
| 125 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 126 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 127 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 128 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 129 | 3300021441 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 | Metagenome | Rhizosphere |
| 130 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 132 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 136 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 137 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 138 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 139 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 141 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 142 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 143 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 198 | 3300027357 | Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 199 | 3300027361 | Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) | Metagenome | Nodule |
| 200 | 3300027363 | Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 201 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 203 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 207 | 3300028786 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM | Metagenome | Unclassified |
| 208 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 211 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 212 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 213 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 214 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 215 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 216 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 217 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 218 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 219 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 220 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 221 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 222 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 223 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 224 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 225 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 226 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 227 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 228 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 229 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 230 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 231 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 232 | 3300033442 | Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 | Metagenome | Nodule |
| 233 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 234 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 235 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 238 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 246 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 247 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 248 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 249 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 250 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 251 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 252 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 253 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 254 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 259 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 260 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 261 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 262 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 263 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 264 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 265 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 266 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 269 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 270 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 271 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 272 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 273 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 274 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 275 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 276 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 358 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 359 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 360 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 361 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 362 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 363 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 364 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 365 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 366 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 367 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 368 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 369 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 370 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 371 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 372 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 373 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 374 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 375 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 376 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 377 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 378 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 379 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 380 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 381 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 382 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 383 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 384 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 385 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 386 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 387 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 388 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 389 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 390 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 391 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 392 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 393 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 394 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 395 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 400 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 401 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 403 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 404 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 405 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 406 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 407 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 408 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 410 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 411 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 412 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 413 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 414 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 415 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 416 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 417 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 418 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 419 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 420 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 421 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 422 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 423 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 424 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 425 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 426 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 427 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 428 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 429 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 430 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 431 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 432 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 433 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 434 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 435 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 436 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 437 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 438 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 439 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 440 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 441 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 442 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 443 | 3300053080 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere | Metagenome | Endosphere |
| 444 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 445 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 446 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 447 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 448 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 449 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 450 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 451 | 3300053095 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere | Metagenome | Endosphere |
| 452 | 3300053096 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere | Metagenome | Endosphere |
| 453 | 3300053097 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere | Metagenome | Endosphere |
| 454 | 3300053098 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere | Metagenome | Endosphere |
| 455 | 3300053102 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere | Metagenome | Endosphere |
| 456 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 457 | 3300053104 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere | Metagenome | Endosphere |
| 458 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 459 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 460 | 3300053109 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere | Metagenome | Endosphere |
| 461 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 462 | 3300053116 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere | Metagenome | Endosphere |
| 463 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 464 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 465 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 466 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 467 | 3300053123 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere | Metagenome | Endosphere |
| 468 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 469 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 470 | 3300053131 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere | Metagenome | Endosphere |
| 471 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 472 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 473 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 474 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 475 | 3300053145 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere | Metagenome | Endosphere |
| 476 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 477 | 3300053150 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere | Metagenome | Endosphere |
| 478 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 479 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 480 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 481 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 482 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 483 | 3300053162 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere | Metagenome | Endosphere |
| 484 | 3300053163 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere | Metagenome | Endosphere |
| 485 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 486 | 3300053178 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere | Metagenome | Endosphere |
| 487 | 3300053725 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere | Metagenome | Endosphere |
| 488 | 3300053727 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere | Metagenome | Endosphere |
| 489 | 3300053729 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere | Metagenome | Endosphere |
| 490 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 491 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 492 | 3300053735 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere | Metagenome | Endosphere |
| 493 | 3300053737 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere | Metagenome | Endosphere |
| 494 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 495 | 3300055283 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere | Metagenome | Endosphere |
| 496 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 497 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 498 | 2513237102 | Bradyrhizobium japonicum USDA 135 | Isolate | Nodule |
| 499 | 2507262055 | Bradyrhizobium sp. WSM1417 | Isolate | Nodule |
| 500 | 2508501009 | Bradyrhizobium sp. WSM471 | Isolate | Nodule |
| 501 | 2508501042 | Bradyrhizobium sp. WSM1253 | Isolate | Nodule |
| 502 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 503 | 2508501128 | Bradyrhizobium sp. ARR65 | Isolate | Nodule |
| 504 | 2510917020 | Caulobacter sp. AP07 | Isolate | Rhizosphere |
| 505 | 2511231028 | Bradyrhizobium sp. YR681 | Isolate | Rhizosphere |
| 506 | 2513237092 | Bradyrhizobium sp. WSM1743 | Isolate | Nodule |
| 507 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 508 | 2513237095 | Bradyrhizobium diazoefficiens USDA 122 | Isolate | Nodule |
| 509 | 2513237096 | Bradyrhizobium pachyrhizi USDA 3259 | Isolate | Nodule |
| 510 | 2513237101 | Bradyrhizobium murdochi WSM1741 | Isolate | Nodule |
| 511 | 2513237104 | Bradyrhizobium sp. EC3.3 | Isolate | Nodule |
| 512 | 2513237137 | Bradyrhizobium elkanii USDA 94 | Isolate | Nodule |
| 513 | 2513237139 | Bradyrhizobium ottawaense USDA 4 | Isolate | Nodule |
| 514 | 2513237141 | Bradyrhizobium sp. TV2a.2 | Isolate | Nodule |
| 515 | 2513237145 | Bradyrhizobium elkanii USDA 3254 | Isolate | Nodule |
| 516 | 2513237161 | Bradyrhizobium sp. WSM2793 | Isolate | Nodule |
| 517 | 2515154112 | Bradyrhizobium sp. WSM4349 | Isolate | Nodule |
| 518 | 2517093001 | Bradyrhizobium japonicum USDA 124 | Isolate | Nodule |
| 519 | 2517572143 | Bradyrhizobium elkanii USDA 76 | Isolate | Nodule |
| 520 | 2524023205 | Bradyrhizobium sp. Cp5.3 | Isolate | Nodule |
| 521 | 2524023210 | Bradyrhizobium sp. Ai1a-2 | Isolate | Nodule |
| 522 | 2524023228 | Bradyrhizobium sp. Th.b2 | Isolate | Nodule |
| 523 | 2528768022 | Bradyrhizobium japonicum USDA 123 | Isolate | Nodule |
| 524 | 2582581279 | Caulobacter henricii OK261 | Isolate | Rhizosphere |
| 525 | 2582581280 | Caulobacter henricii CF287 | Isolate | Rhizosphere |
| 526 | 2582581293 | Caulobacter henricii YR570 | Isolate | Rhizosphere |
| 527 | 2602042107 | Bradyrhizobium sp. NFR13 | Isolate | Rhizoplane |
| 528 | 2617270735 | Bradyrhizobium shewense ERR11 | Isolate | Nodule |
| 529 | 2617270741 | Bradyrhizobium yuanmingense CCBAU 10071 | Isolate | Nodule |
| 530 | 2643221545 | Caulobacter sp. Root1455 | Isolate | Unclassified |
| 531 | 2643221552 | Caulobacter sp. Root1472 | Isolate | Unclassified |
| 532 | 2643221583 | Caulobacter sp. Root655 | Isolate | Unclassified |
| 533 | 2643221584 | Caulobacter sp. Root656 | Isolate | Unclassified |
| 534 | 2643221691 | Caulobacter sp. Root487D2Y | Isolate | Unclassified |
| 535 | 2643221733 | Bosea sp. Root381 | Isolate | Unclassified |
| 536 | 2643221734 | Bosea sp. Root670 | Isolate | Unclassified |
| 537 | 2667528175 | Rhizobium tropici NFR14 | Isolate | Rhizoplane |
| 538 | 2721755755 | Bradyrhizobium icense LMTR 13 | Isolate | Nodule |
| 539 | 2728368998 | Bradyrhizobium macuxiense BR 10303 | Isolate | Nodule |
| 540 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 541 | 2744054633 | Bradyrhizobium neotropicale BR 10247 | Isolate | Unclassified |
| 542 | 2791355196 | Bradyrhizobium sp. Y36 | Isolate | Nodule |
| 543 | 2791355197 | Bradyrhizobium sp. C9 | Isolate | Nodule |
| 544 | 2791355199 | |||
| 545 | 2802429603 | Bradyrhizobium ottawaense L2 | Isolate | Nodule |
| 546 | 2816332527 | Bradyrhizobium diazoefficiens Y21 | Isolate | Nodule |
| 547 | 2818991435 | Caulobacter henricii 536 | Isolate | Unclassified |
| 548 | 2818991454 | Caulobacter rhizosphaerae 3260 | Isolate | Rhizosphere |
| 549 | 2824600985 | Bradyrhizobium sp.HAMBI 2135 | Isolate | Unclassified |
| 550 | 2824609381 | Bradyrhizobium sp. HAMBI 2134 | Isolate | Unclassified |
| 551 | 2824617872 | Bradyrhizobium sp. HAMBI 2133 | Isolate | Unclassified |
| 552 | 2824626560 | Bradyrhizobium sp. HAMBI 2149 | Isolate | Unclassified |
| 553 | 2824635225 | Bradyrhizobium sp. HAMBI 2136 | Isolate | Unclassified |
| 554 | 2824644064 | Bradyrhizobium sp. HAMBI 2137 | Isolate | Unclassified |
| 555 | 2824653114 | Bradyrhizobium sp. HAMBI 2142 | Isolate | Unclassified |
| 556 | 2824661429 | Bradyrhizobium sp. HAMBI 2115 | Isolate | Unclassified |
| 557 | 2824671348 | Bradyrhizobium sp. HAMBI 2125 | Isolate | Unclassified |
| 558 | 2824679649 | Bradyrhizobium sp.HAMBI 2116 | Isolate | Unclassified |
| 559 | 2824687955 | Bradyrhizobium sp. HAMBI 2126 | Isolate | Unclassified |
| 560 | 2824696289 | Bradyrhizobium sp. HAMBI 2127 | Isolate | Unclassified |
| 561 | 2824704595 | Bradyrhizobium sp. HAMBI 2150 | Isolate | Unclassified |
| 562 | 2824714736 | Bradyrhizobium sp. HAMBI 2151 | Isolate | Unclassified |
| 563 | 2824723954 | Bradyrhizobium sp. HAMBI 2152 | Isolate | Unclassified |
| 564 | 2824732956 | Bradyrhizobium sp. HAMBI 2153 | Isolate | Unclassified |
| 565 | 2824746037 | Bradyrhizobium sp. HAMBI 2299 | Isolate | Unclassified |
| 566 | 2824753945 | Bradyrhizobium sp. HAMBI 2128 | Isolate | Unclassified |
| 567 | 2824763712 | Bradyrhizobium sp. HAMBI 2129 | Isolate | Unclassified |
| 568 | 2824773399 | Bradyrhizobium sp. HAMBI 2130 | Isolate | Unclassified |
| 569 | 2838122688 | Bradyrhizobium sp. CIR3A | Isolate | Nodule |
| 570 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 571 | 2841941048 | Bradyrhizobium sp. SBR1B | Isolate | Nodule |
| 572 | 2841949485 | Bradyrhizobium sp. ERR14 | Isolate | Nodule |
| 573 | 2841957949 | Bradyrhizobium sp. CIR1 | Isolate | Nodule |
| 574 | 2841966195 | Bradyrhizobium sp. CIR18 | Isolate | Nodule |
| 575 | 2841974524 | Bradyrhizobium sp. CIR48 | Isolate | Nodule |
| 576 | 2841983080 | Bradyrhizobium sp. IAR9 | Isolate | Nodule |
| 577 | 2842038055 | Bradyrhizobium centrosematis SEMIA 424 | Isolate | Nodule |
| 578 | 2842045827 | Bradyrhizobium centrosematis SEMIA 431 | Isolate | Nodule |
| 579 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 580 | 2847930680 | Bradyrhizobium zhanjiangense CCBAU 51778 | Isolate | Unclassified |
| 581 | 2847939898 | Bradyrhizobium ottawaense OO99 | Isolate | Unclassified |
| 582 | 2849076700 | Bradyrhizobium symbiodeficiens 85S1MB | Isolate | Nodule |
| 583 | 2857509624 | Bradyrhizobium sp. R-73088 | Isolate | Unclassified |
| 584 | 2857524615 | Tardiphaga sp. R-73074 | Isolate | Unclassified |
| 585 | 2874590934 | Bradyrhizobium canariense UBMA181 | Isolate | Nodule |
| 586 | 2874604998 | Bradyrhizobium sp. LMTR 3 | Isolate | Nodule |
| 587 | 2874612657 | Bradyrhizobium forestalis INPA54B | Isolate | Nodule |
| 588 | 2874620515 | Bradyrhizobium nanningense CCBAU 53390 | Isolate | Unclassified |
| 589 | 2874628541 | Bradyrhizobium betae Opo-243 | Isolate | Unclassified |
| 590 | 2874645413 | Bradyrhizobium canariense UBMA122 | Isolate | Nodule |
| 591 | 2876761206 | Bradyrhizobium centrolobii BR 10245 | Isolate | Nodule |
| 592 | 2876771140 | Bradyrhizobium canariense UBMA192 | Isolate | Nodule |
| 593 | 2876818435 | Bradyrhizobium canariense UBMA195 | Isolate | Nodule |
| 594 | 2879074833 | Bradyrhizobium canariense UBMA171 | Isolate | Nodule |
| 595 | 2879083081 | Bradyrhizobium zhanjiangense CCBAU 51787 | Isolate | Unclassified |
| 596 | 2879099564 | Bradyrhizobium japonicum UBMA197 | Isolate | Nodule |
| 597 | 2879110137 | Bradyrhizobium algeriense RST91 | Isolate | Nodule |
| 598 | 2879127579 | Bradyrhizobium canariense UBMA052 | Isolate | Nodule |
| 599 | 2879142872 | Bradyrhizobium canariense UBMA061 | Isolate | Nodule |
| 600 | 2881364244 | Bradyrhizobium sp. RP6 | Isolate | Unclassified |
| 601 | 2881665667 | Bradyrhizobium vignae LMG 28791 | Isolate | Unclassified |
| 602 | 2885366525 | Bradyrhizobium sp. LVM 105 | Isolate | Unclassified |
| 603 | 2885374607 | Bradyrhizobium sp. NAS96.2 | Isolate | Unclassified |
| 604 | 2885383462 | Bradyrhizobium sp. Leo170 | Isolate | Unclassified |
| 605 | 2885409591 | Bradyrhizobium sp. NAS80.1 | Isolate | Unclassified |
| 606 | 2888378607 | Bradyrhizobium sp. LCT2 | Isolate | Unclassified |
| 607 | 2888388044 | Bradyrhizobium cosmicum 58S1 | Isolate | Unclassified |
| 608 | 2888419890 | Bradyrhizobium sp. 1(2017) 63S1MB | Isolate | Unclassified |
| 609 | 2889033259 | Bradyrhizobium sp. CCBAU 051011 | Isolate | Unclassified |
| 610 | 2891088606 | Methylosinus sp. 3S-1 | Isolate | Rhizosphere |
| 611 | 2893066018 | Tardiphaga sp. P9-11 | Isolate | Unclassified |
| 612 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 613 | 2903768456 | Bradyrhizobium sp. Leo121 | Isolate | Unclassified |
| 614 | 2904666416 | Bradyrhizobium nanningense CCBAU 51757 | Isolate | Unclassified |
| 615 | 2904690495 | Bradyrhizobium ivorense CI-1B | Isolate | Nodule |
| 616 | 2904699407 | |||
| 617 | 2904711408 | Bradyrhizobium sp. USDA 3456 | Isolate | Unclassified |
| 618 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 619 | 2906610324 | |||
| 620 | 2906626472 | Bradyrhizobium hipponense aSej3 | Isolate | Unclassified |
| 621 | 2906635258 | Bradyrhizobium sp. USDA 3458 | Isolate | Unclassified |
| 622 | 2906643746 | Bradyrhizobium genosp. SA-3 Rp7b | Isolate | Unclassified |
| 623 | 2906660503 | Bradyrhizobium brasilense UFLA 03-321 | Isolate | Unclassified |
| 624 | 2908739725 | Bradyrhizobium sp. UFLA03-84 | Isolate | Nodule |
| 625 | 2908756301 | Bradyrhizobium ivorense CI-41S | Isolate | Nodule |
| 626 | 2908775508 | Bradyrhizobium sp. SUTN9-2 | Isolate | Unclassified |
| 627 | 2917699015 | Bosea sp. F3-2 | Isolate | Rhizosphere |
| 628 | 2919073203 | Tardiphaga robiniae 1155 | Isolate | Unclassified |
| 629 | 2922361189 | Bradyrhizobium australiense WSM 1791 | Isolate | Nodule |
| 630 | 2922368715 | |||
| 631 | 2922386360 | Bradyrhizobium archetypum WSM 1744 | Isolate | Nodule |
| 632 | 2922393267 | Bradyrhizobium sp. WBAH10 | Isolate | Nodule |
| 633 | 2922425934 | |||
| 634 | 2929615660 | Bradyrhizobium japonicum TXVA | Isolate | Nodule |
| 635 | 2929624759 | Bradyrhizobium japonicum TXEA | Isolate | Nodule |
| 636 | 2932784394 | Bradyrhizobium sp. S3.2.12 | Isolate | Nodule |
| 637 | 2932794094 | Bradyrhizobium sp. S3.2.6 | Isolate | Nodule |
| 638 | 2932801729 | Bradyrhizobium sp. S3.3.6 | Isolate | Nodule |
| 639 | 2932809354 | Bradyrhizobium sp. S3.5.5 | Isolate | Nodule |
| 640 | 2932818245 | Bradyrhizobium sp. S3.9.1 | Isolate | Nodule |
| 641 | 2932828146 | Bradyrhizobium sp. S3.9.2 | Isolate | Nodule |
| 642 | 2933577622 | Bradyrhizobium japonicum SEMIA 417 | Isolate | Nodule |
| 643 | 2935608549 | Bradyrhizobium sp. RT6a | Isolate | Nodule |
| 644 | 2935616580 | Bradyrhizobium sp. RT7a | Isolate | Nodule |
| 645 | 2935630451 | Bradyrhizobium sp. I1.14.4 | Isolate | Nodule |
| 646 | 2935638405 | Bradyrhizobium sp. JR19.8 | Isolate | Nodule |
| 647 | 2935648319 | Bradyrhizobium sp. JR4.3 | Isolate | Nodule |
| 648 | 2935656913 | Bradyrhizobium sp. JR5.3 | Isolate | Nodule |
| 649 | 2935665750 | Bradyrhizobium sp. JR7.2 | Isolate | Nodule |
| 650 | 2935675223 | Bradyrhizobium sp. LA2.1 | Isolate | Nodule |
| 651 | 2935684952 | Bradyrhizobium sp. LA3.X | Isolate | Nodule |
| 652 | 2935694250 | Bradyrhizobium sp. LA6.1 | Isolate | Nodule |
| 653 | 2935703347 | Bradyrhizobium sp. LA6.10 | Isolate | Nodule |
| 654 | 2935713505 | Bradyrhizobium sp. LA6.12 | Isolate | Nodule |
| 655 | 2935722832 | Bradyrhizobium sp. LA6.3 | Isolate | Nodule |
| 656 | 2935732158 | Bradyrhizobium sp. LA6.4 | Isolate | Nodule |
| 657 | 2935741537 | Bradyrhizobium sp. LA6.7 | Isolate | Nodule |
| 658 | 2935750917 | Bradyrhizobium sp. LA6.8 | Isolate | Nodule |
| 659 | 2935760218 | Bradyrhizobium sp. LA7.1 | Isolate | Nodule |
| 660 | 2935769743 | Bradyrhizobium sp. LB12.1 | Isolate | Nodule |
| 661 | 2935777560 | Bradyrhizobium sp. LB14.3 | Isolate | Nodule |
| 662 | 2935785616 | Bradyrhizobium sp. LB5.2 | Isolate | Nodule |
| 663 | 2935793552 | Bradyrhizobium sp. LB8.2 | Isolate | Nodule |
| 664 | 2935801545 | Bradyrhizobium sp. RT10b | Isolate | Nodule |
| 665 | 2935810662 | Bradyrhizobium sp. RT3a | Isolate | Nodule |
| 666 | 2935819856 | Bradyrhizobium sp. RT3b | Isolate | Nodule |
| 667 | 2935827899 | Bradyrhizobium sp. RT4a | Isolate | Nodule |
| 668 | 2935837841 | Bradyrhizobium sp. RT4b | Isolate | Nodule |
| 669 | 2935847175 | Bradyrhizobium sp. RT5a | Isolate | Nodule |
| 670 | 2935855204 | Bradyrhizobium sp. RT7b | Isolate | Nodule |
| 671 | 2935864058 | Bradyrhizobium sp. RT9a | Isolate | Nodule |
| 672 | 2935873716 | Bradyrhizobium sp. RT9b | Isolate | Nodule |
| 673 | 2935883170 | Bradyrhizobium sp. S3.12.5 | Isolate | Nodule |
| 674 | 2935908558 | Bradyrhizobium sp. F1.1.1 | Isolate | Nodule |
| 675 | 2935916978 | Bradyrhizobium sp. F1.13.3 | Isolate | Nodule |
| 676 | 2935926038 | Bradyrhizobium sp. F1.2.1 | Isolate | Nodule |
| 677 | 2935934488 | Bradyrhizobium sp. F1.2.2 | Isolate | Nodule |
| 678 | 2935942939 | Bradyrhizobium sp. F1.2.6 | Isolate | Nodule |
| 679 | 2935951376 | Bradyrhizobium sp. F1.2.8 | Isolate | Nodule |
| 680 | 2935959822 | Bradyrhizobium sp. F1.4.3 | Isolate | Nodule |
| 681 | 2935967501 | Bradyrhizobium sp. F1.6.2 | Isolate | Nodule |
| 682 | 2935975950 | Bradyrhizobium sp. GM2.2 | Isolate | Nodule |
| 683 | 2935984226 | Bradyrhizobium sp. i1.15.2 | Isolate | Nodule |
| 684 | 2935992306 | Bradyrhizobium sp. I1.7.5 | Isolate | Nodule |
| 685 | 2936002035 | Bradyrhizobium sp. I1.8.5 | Isolate | Nodule |
| 686 | 2936011229 | Bradyrhizobium sp. JR1.1 | Isolate | Nodule |
| 687 | 2936019824 | Bradyrhizobium sp. JR1.5 | Isolate | Nodule |
| 688 | 2936028420 | Bradyrhizobium sp. JR1.7 | Isolate | Nodule |
| 689 | 2936037263 | Bradyrhizobium sp. JR18.2 | Isolate | Nodule |
| 690 | 2936046547 | Bradyrhizobium sp. JR3.12 | Isolate | Nodule |
| 691 | 2936055302 | Bradyrhizobium sp. JR4.1 | Isolate | Nodule |
| 692 | 2940556831 | Bradyrhizobium sp. LA8.1 | Isolate | Nodule |
| 693 | 2941507105 | Bradyrhizobium sp. i1.12.3 | Isolate | Nodule |
| 694 | 2941515067 | Bradyrhizobium sp. i1.14.1 | Isolate | Nodule |
| 695 | 2941523033 | Bradyrhizobium sp. i1.8.4 | Isolate | Nodule |
| 696 | 2941531003 | Bradyrhizobium sp. LB11.1 | Isolate | Nodule |
| 697 | 2941538514 | Bradyrhizobium sp. RT11b | Isolate | Nodule |
| 698 | 3005483717 | Bradyrhizobium agreste CNPSo 4010 | Isolate | Unclassified |
| 699 | 3005506211 | Bradyrhizobium diazoefficiens SZCCT0449 | Isolate | Unclassified |
| 700 | 3005587118 | Bradyrhizobium glycinis CNPSo 4016 | Isolate | Unclassified |
| 701 | 3005594810 | Bradyrhizobium sp. CCBAU 53340 | Isolate | Nodule |
| 702 | 3005710791 | Bradyrhizobium genosp. B BDV5040 | Isolate | Unclassified |
| 703 | 3005718088 | Bradyrhizobium sp. CCBAU 53338 | Isolate | Nodule |
| 704 | 8006926726 | Bradyrhizobium guangdongense SM32 | Isolate | Unclassified |
| 705 | 8006933436 | Bradyrhizobium septentrionale 7(2017) | Isolate | Unclassified |
| 706 | 8006964411 | Bradyrhizobium sp. sBnM-33 | Isolate | Nodule |
| 707 | 8006973647 | Bradyrhizobium septentrionale 162S2 | Isolate | Nodule |
| 708 | 8006984368 | Bradyrhizobium sp. SRL28 | Isolate | Unclassified |
| 709 | 8006994254 | Bradyrhizobium sp. sGM-13 | Isolate | Nodule |
| 710 | 8016511872 | Bradyrhizobium sp. S3.14.4 | Isolate | Nodule |
| 711 | 8016522445 | Bradyrhizobium sp. LM6.9 | Isolate | Nodule |
| 712 | 8016530956 | Bradyrhizobium sp. LM6.11 | Isolate | Nodule |
| 713 | 8016557553 | Bradyrhizobium sp. LM3.4 | Isolate | Nodule |
| 714 | 8016566248 | Bradyrhizobium sp. LM3.2 | Isolate | Nodule |
| 715 | 8016575299 | Bradyrhizobium sp. LM2.9 | Isolate | Nodule |
| 716 | 8016583857 | Bradyrhizobium sp. LM2.7 | Isolate | Nodule |
| 717 | 8016595262 | Bradyrhizobium sp. LM2.3 | Isolate | Nodule |
| 718 | 8016603502 | Bradyrhizobium sp. LB7.2 | Isolate | Nodule |
| 719 | 8016613128 | Bradyrhizobium sp. LB7.1 | Isolate | Nodule |
| 720 | 8016622563 | Bradyrhizobium sp. LB13.1 | Isolate | Nodule |
| 721 | 8016630954 | Bradyrhizobium sp. F1.13.1 | Isolate | Nodule |
| 722 | 8017057580 | Bradyrhizobium sp. S3.7.6 | Isolate | Nodule |
| 723 | 8019538911 | Bradyrhizobium sp. LB9.1b | Isolate | Nodule |
| 724 | 8019547302 | Bradyrhizobium sp. LB1.3 | Isolate | Nodule |
| 725 | 8019555841 | Bradyrhizobium sp. JR6.1 | Isolate | Nodule |
| 726 | 8019576017 | Bradyrhizobium sp. i1.7.7 | Isolate | Nodule |
| 727 | 8019586578 | Bradyrhizobium sp. i1.4.4 | Isolate | Nodule |
| 728 | 8019597564 | Bradyrhizobium sp. i1.3.6 | Isolate | Nodule |
| 729 | 8019608314 | Bradyrhizobium sp. i1.3.1 | Isolate | Nodule |
| 730 | 8019619141 | Bradyrhizobium sp. GM7.3 | Isolate | Nodule |
| 731 | 8019629233 | Bradyrhizobium sp. GM6.1 | Isolate | Nodule |
| 732 | 8019638758 | Bradyrhizobium sp. GM5.1 | Isolate | Nodule |
| 733 | 8019659431 | Bradyrhizobium sp. GM22.5 | Isolate | Nodule |
| 734 | 8019668869 | Bradyrhizobium sp. GM2.4 | Isolate | Nodule |
| 735 | 8019678201 | Bradyrhizobium sp. GM0.4 | Isolate | Nodule |
| 736 | 8019687851 | Bradyrhizobium sp. F1.13.4 | Isolate | Nodule |
| 737 | 8055742211 | Bradyrhizobium japonicum 5038 | Isolate | Nodule |
| 738 | 8056673599 | Bradyrhizobium hereditatis WSM 1738 | Isolate | Nodule |
| 739 | 8056681323 | Bradyrhizobium cenepequi CNPSo 4026 | Isolate | Nodule |
| 740 | 8056689827 | Bradyrhizobium semiaridum WSM 1704 | Isolate | Nodule |
| 741 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 84.23 |
| Metatranscriptomes | 0 |
| Isolates | 15.77 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 11.53 |
| Nodule | 11.79 |
| Rhizoplane | 6.35 |
| Rhizosphere | 60.38 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009104 | 3300001979 | Bacteria | 3904 |
| 2 | JGI24739J22299_10051274 | 3300001989 | Bacteria | 1331 |
| 3 | JGI25151J46595_10000339 | 3300003187 | Bacteria | 50125 |
| 4 | JGI25151J46595_10000511 | 3300003187 | Bacteria | 36352 |
| 5 | JGI25406J46586_10000037 | 3300003203 | Bacteria | 60422 |
| 6 | JGI25406J46586_10011025 | 3300003203 | Bacteria | 3975 |
| 7 | JGI25165J46597_1010949 | 3300003214 | Bacteria | 1308 |
| 8 | JGI25165J46597_1011014 | 3300003214 | Bacteria | 1302 |
| 9 | JGI25153J46596_10017912 | 3300003215 | Bacteria | 2770 |
| 10 | JGI25160J50197_1001469 | 3300003354 | Bacteria | 11758 |
| 11 | JGI25160J50197_1006549 | 3300003354 | Bacteria | 4697 |
| 12 | JGI25161J50226_1011108 | 3300003374 | Bacteria | 1153 |
| 13 | JGI25404J52841_10009407 | 3300003659 | Bacteria | 2090 |
| 14 | Ga0055526_1003688 | 3300003771 | Bacteria | 9577 |
| 15 | Ga0055526_1017843 | 3300003771 | Bacteria | 2685 |
| 16 | Ga0055526_1019303 | 3300003771 | Bacteria | 2490 |
| 17 | Ga0055537_1003689 | 3300003773 | Bacteria | 4633 |
| 18 | Ga0055528_1012512 | 3300003790 | Bacteria | 3285 |
| 19 | Ga0055531_10001877 | 3300003794 | Bacteria | 14724 |
| 20 | Ga0055543_1020848 | 3300004625 | Bacteria | 1200 |
| 21 | Ga0065165_1001029 | 3300005262 | Bacteria | 33794 |
| 22 | Ga0065165_1001154 | 3300005262 | Bacteria | 30829 |
| 23 | Ga0065165_1002192 | 3300005262 | Bacteria | 17555 |
| 24 | Ga0065165_1036438 | 3300005262 | Bacteria | 1500 |
| 25 | Ga0070658_10013187 | 3300005327 | Bacteria | 6630 |
| 26 | Ga0070658_10084612 | 3300005327 | Bacteria | 2608 |
| 27 | Ga0070683_100030576 | 3300005329 | Bacteria | 4890 |
| 28 | Ga0070683_100105357 | 3300005329 | Bacteria | 2659 |
| 29 | Ga0070683_100209347 | 3300005329 | Bacteria | 1852 |
| 30 | Ga0070670_100012038 | 3300005331 | Bacteria | 7400 |
| 31 | Ga0068869_100117711 | 3300005334 | Bacteria | 2028 |
| 32 | Ga0070680_100010838 | 3300005336 | Bacteria | 7039 |
| 33 | Ga0070680_100054220 | 3300005336 | Bacteria | 3273 |
| 34 | Ga0070680_100159319 | 3300005336 | Bacteria | 1896 |
| 35 | Ga0070682_100142269 | 3300005337 | Bacteria | 1637 |
| 36 | Ga0070682_100155993 | 3300005337 | Bacteria | 1572 |
| 37 | Ga0068868_100184941 | 3300005338 | Bacteria | 1730 |
| 38 | Ga0068868_100285209 | 3300005338 | Bacteria | 1399 |
| 39 | Ga0070660_100045764 | 3300005339 | Bacteria | 3351 |
| 40 | Ga0070660_100126166 | 3300005339 | Bacteria | 2045 |
| 41 | Ga0070660_100305969 | 3300005339 | Bacteria | 1304 |
| 42 | Ga0070689_100092651 | 3300005340 | Bacteria | 2384 |
| 43 | Ga0070689_100107729 | 3300005340 | Bacteria | 2213 |
| 44 | Ga0070691_10148549 | 3300005341 | Bacteria | 1200 |
| 45 | Ga0070687_100020363 | 3300005343 | Bacteria | 3101 |
| 46 | Ga0070661_100021771 | 3300005344 | Bacteria | 4584 |
| 47 | Ga0070661_100053350 | 3300005344 | Bacteria | 2958 |
| 48 | Ga0070661_100103174 | 3300005344 | Bacteria | 2124 |
| 49 | Ga0070669_100019282 | 3300005353 | Bacteria | 4872 |
| 50 | Ga0070669_100114802 | 3300005353 | Bacteria | 2048 |
| 51 | Ga0070671_100198882 | 3300005355 | Bacteria | 1699 |
| 52 | Ga0070674_100014497 | 3300005356 | Bacteria | 4900 |
| 53 | Ga0070674_100151333 | 3300005356 | Bacteria | 1751 |
| 54 | Ga0070688_100069361 | 3300005365 | Bacteria | 2250 |
| 55 | Ga0070688_100127480 | 3300005365 | Bacteria | 1712 |
| 56 | Ga0070659_100189375 | 3300005366 | Bacteria | 1690 |
| 57 | Ga0070667_100366666 | 3300005367 | Bacteria | 1306 |
| 58 | Ga0070709_10004068 | 3300005434 | Bacteria | 7892 |
| 59 | Ga0070709_10007215 | 3300005434 | Bacteria | 6089 |
| 60 | Ga0070709_10167440 | 3300005434 | Bacteria | 1533 |
| 61 | Ga0070714_100002014 | 3300005435 | Bacteria | 14871 |
| 62 | Ga0070714_100101837 | 3300005435 | Bacteria | 2531 |
| 63 | Ga0070713_100004390 | 3300005436 | Bacteria | 9476 |
| 64 | Ga0070713_100022427 | 3300005436 | Bacteria | 4879 |
| 65 | Ga0070713_100358163 | 3300005436 | Bacteria | 1355 |
| 66 | Ga0070710_10001042 | 3300005437 | Bacteria | 13175 |
| 67 | Ga0070710_10001151 | 3300005437 | Bacteria | 12525 |
| 68 | Ga0070710_10003221 | 3300005437 | Bacteria | 7731 |
| 69 | Ga0070710_10096486 | 3300005437 | Bacteria | 1752 |
| 70 | Ga0070701_10073112 | 3300005438 | Bacteria | 1838 |
| 71 | Ga0070711_100006813 | 3300005439 | Bacteria | 6919 |
| 72 | Ga0070711_100021205 | 3300005439 | Bacteria | 4197 |
| 73 | Ga0070711_100033555 | 3300005439 | Bacteria | 3418 |
| 74 | Ga0070711_100287129 | 3300005439 | Bacteria | 1304 |
| 75 | Ga0070700_100030000 | 3300005441 | Bacteria | 3246 |
| 76 | Ga0070663_100011844 | 3300005455 | Bacteria | 5495 |
| 77 | Ga0070663_100018623 | 3300005455 | Bacteria | 4556 |
| 78 | Ga0070663_100079114 | 3300005455 | Bacteria | 2411 |
| 79 | Ga0070663_100086319 | 3300005455 | Bacteria | 2317 |
| 80 | Ga0070663_100096317 | 3300005455 | Bacteria | 2201 |
| 81 | Ga0070663_100101611 | 3300005455 | Bacteria | 2146 |
| 82 | Ga0070678_100199754 | 3300005456 | Bacteria | 1649 |
| 83 | Ga0070662_100007653 | 3300005457 | Bacteria | 7009 |
| 84 | Ga0070662_100441925 | 3300005457 | Bacteria | 1078 |
| 85 | Ga0070681_10005467 | 3300005458 | Bacteria | 12272 |
| 86 | Ga0070681_10005807 | 3300005458 | Bacteria | 11943 |
| 87 | Ga0070681_10090767 | 3300005458 | Bacteria | 3005 |
| 88 | Ga0068867_100018925 | 3300005459 | Bacteria | 4901 |
| 89 | Ga0068867_100024373 | 3300005459 | Bacteria | 4334 |
| 90 | Ga0070685_10008823 | 3300005466 | Bacteria | 5195 |
| 91 | Ga0070698_100149838 | 3300005471 | Bacteria | 2281 |
| 92 | Ga0070679_100167416 | 3300005530 | Bacteria | 2171 |
| 93 | Ga0070679_100204651 | 3300005530 | Bacteria | 1938 |
| 94 | Ga0070684_100010049 | 3300005535 | Bacteria | 7481 |
| 95 | Ga0070684_100036442 | 3300005535 | Bacteria | 4214 |
| 96 | Ga0070684_100105675 | 3300005535 | Bacteria | 2519 |
| 97 | Ga0068853_100000394 | 3300005539 | Bacteria | 29870 |
| 98 | Ga0068853_100037399 | 3300005539 | Bacteria | 4130 |
| 99 | Ga0068853_100088582 | 3300005539 | Bacteria | 2717 |
| 100 | Ga0068853_100247886 | 3300005539 | Bacteria | 1634 |
| 101 | Ga0068853_100321887 | 3300005539 | Bacteria | 1434 |
| 102 | Ga0070672_100035524 | 3300005543 | Bacteria | 3789 |
| 103 | Ga0070672_100118458 | 3300005543 | Bacteria | 2165 |
| 104 | Ga0070672_100165647 | 3300005543 | Bacteria | 1836 |
| 105 | Ga0070686_100026130 | 3300005544 | Bacteria | 3520 |
| 106 | Ga0070665_100015225 | 3300005548 | Bacteria | 7720 |
| 107 | Ga0070665_100026195 | 3300005548 | Bacteria | 5872 |
| 108 | Ga0070665_100036826 | 3300005548 | Bacteria | 4920 |
| 109 | Ga0070665_100057997 | 3300005548 | Bacteria | 3882 |
| 110 | Ga0070665_100067534 | 3300005548 | Bacteria | 3585 |
| 111 | Ga0070665_100107799 | 3300005548 | Bacteria | 2788 |
| 112 | Ga0070665_100161918 | 3300005548 | Bacteria | 2239 |
| 113 | Ga0070665_100202518 | 3300005548 | Bacteria | 1985 |
| 114 | Ga0068855_100160160 | 3300005563 | Bacteria | 2555 |
| 115 | Ga0068855_100160864 | 3300005563 | Bacteria | 2549 |
| 116 | Ga0068855_100200378 | 3300005563 | Bacteria | 2247 |
| 117 | Ga0068855_100212068 | 3300005563 | Bacteria | 2175 |
| 118 | Ga0068855_100232792 | 3300005563 | Bacteria | 2062 |
| 119 | Ga0068855_100237584 | 3300005563 | Bacteria | 2037 |
| 120 | Ga0070664_100132579 | 3300005564 | Bacteria | 2189 |
| 121 | Ga0070664_100193038 | 3300005564 | Bacteria | 1815 |
| 122 | Ga0068857_100023868 | 3300005577 | Bacteria | 5382 |
| 123 | Ga0068857_100061244 | 3300005577 | Bacteria | 3343 |
| 124 | Ga0068857_100093922 | 3300005577 | Bacteria | 2686 |
| 125 | Ga0068857_100113188 | 3300005577 | Bacteria | 2440 |
| 126 | Ga0068857_100188973 | 3300005577 | Bacteria | 1876 |
| 127 | Ga0068857_100271465 | 3300005577 | Bacteria | 1559 |
| 128 | Ga0068857_100285121 | 3300005577 | Bacteria | 1520 |
| 129 | Ga0068854_100011204 | 3300005578 | Bacteria | 5827 |
| 130 | Ga0068856_100000905 | 3300005614 | Bacteria | 31696 |
| 131 | Ga0068856_100002885 | 3300005614 | Bacteria | 17586 |
| 132 | Ga0068856_100164263 | 3300005614 | Bacteria | 2231 |
| 133 | Ga0068856_100184861 | 3300005614 | Bacteria | 2098 |
| 134 | Ga0068856_100237104 | 3300005614 | Bacteria | 1840 |
| 135 | Ga0068856_100293010 | 3300005614 | Bacteria | 1644 |
| 136 | Ga0068856_100494579 | 3300005614 | Bacteria | 1244 |
| 137 | Ga0070702_100022702 | 3300005615 | Bacteria | 3322 |
| 138 | Ga0070702_100121076 | 3300005615 | Bacteria | 1638 |
| 139 | Ga0068852_100014713 | 3300005616 | Bacteria | 6035 |
| 140 | Ga0068852_100236269 | 3300005616 | Bacteria | 1745 |
| 141 | Ga0068859_100085781 | 3300005617 | Bacteria | 3194 |
| 142 | Ga0068859_100162077 | 3300005617 | Bacteria | 2315 |
| 143 | Ga0068859_100307388 | 3300005617 | Bacteria | 1679 |
| 144 | Ga0068864_100155422 | 3300005618 | Bacteria | 2076 |
| 145 | Ga0068864_100156373 | 3300005618 | Bacteria | 2069 |
| 146 | Ga0068864_100243019 | 3300005618 | Bacteria | 1668 |
| 147 | Ga0068861_100192402 | 3300005719 | Bacteria | 1706 |
| 148 | Ga0068851_10004128 | 3300005834 | Bacteria | 6534 |
| 149 | Ga0068851_10023841 | 3300005834 | Bacteria | 2993 |
| 150 | Ga0068870_10018341 | 3300005840 | Bacteria | 3377 |
| 151 | Ga0068863_100168195 | 3300005841 | Bacteria | 2102 |
| 152 | Ga0068863_100183208 | 3300005841 | Bacteria | 2010 |
| 153 | Ga0068863_100198187 | 3300005841 | Bacteria | 1931 |
| 154 | Ga0068858_100117270 | 3300005842 | Bacteria | 2488 |
| 155 | Ga0068858_100147996 | 3300005842 | Bacteria | 2206 |
| 156 | Ga0068860_100000840 | 3300005843 | Bacteria | 34384 |
| 157 | Ga0068860_100013212 | 3300005843 | Bacteria | 8100 |
| 158 | Ga0068860_100023212 | 3300005843 | Bacteria | 5995 |
| 159 | Ga0068860_100190751 | 3300005843 | Bacteria | 1983 |
| 160 | Ga0068862_100174421 | 3300005844 | Bacteria | 1926 |
| 161 | Ga0068862_100254431 | 3300005844 | Bacteria | 1601 |
| 162 | Ga0081455_10022044 | 3300005937 | Bacteria | 5963 |
| 163 | Ga0081455_10032010 | 3300005937 | Bacteria | 4747 |
| 164 | Ga0081455_10035974 | 3300005937 | Bacteria | 4416 |
| 165 | Ga0081455_10043817 | 3300005937 | Bacteria | 3911 |
| 166 | Ga0081455_10049455 | 3300005937 | Bacteria | 3624 |
| 167 | Ga0081538_10035922 | 3300005981 | Bacteria | 3245 |
| 168 | Ga0081540_1003518 | 3300005983 | Bacteria | 12357 |
| 169 | Ga0081540_1007804 | 3300005983 | Bacteria | 7571 |
| 170 | Ga0081540_1018183 | 3300005983 | Bacteria | 4323 |
| 171 | Ga0081540_1034156 | 3300005983 | Bacteria | 2748 |
| 172 | Ga0081540_1073564 | 3300005983 | Bacteria | 1570 |
| 173 | Ga0081539_10000129 | 3300005985 | Bacteria | 178675 |
| 174 | Ga0081539_10001014 | 3300005985 | Bacteria | 51820 |
| 175 | Ga0081539_10013531 | 3300005985 | Bacteria | 6139 |
| 176 | Ga0070717_10001143 | 3300006028 | Bacteria | 17925 |
| 177 | Ga0070717_10008317 | 3300006028 | Bacteria | 7747 |
| 178 | Ga0070717_10208823 | 3300006028 | Bacteria | 1713 |
| 179 | Ga0075365_10010667 | 3300006038 | Bacteria | 5366 |
| 180 | Ga0075365_10023623 | 3300006038 | Bacteria | 3869 |
| 181 | Ga0075365_10184713 | 3300006038 | Bacteria | 1458 |
| 182 | Ga0075365_10187110 | 3300006038 | Bacteria | 1448 |
| 183 | Ga0075363_100000174 | 3300006048 | Bacteria | 16828 |
| 184 | Ga0075363_100016650 | 3300006048 | Bacteria | 3634 |
| 185 | Ga0075363_100239604 | 3300006048 | Bacteria | 1043 |
| 186 | Ga0075364_10000925 | 3300006051 | Bacteria | 15511 |
| 187 | Ga0075364_10104086 | 3300006051 | Bacteria | 1891 |
| 188 | Ga0075364_10148103 | 3300006051 | Bacteria | 1581 |
| 189 | Ga0070715_10004589 | 3300006163 | Bacteria | 4549 |
| 190 | Ga0070716_100000855 | 3300006173 | Bacteria | 13112 |
| 191 | Ga0070716_100001543 | 3300006173 | Bacteria | 10329 |
| 192 | Ga0070716_100140567 | 3300006173 | Bacteria | 1539 |
| 193 | Ga0070716_100170752 | 3300006173 | Bacteria | 1419 |
| 194 | Ga0070712_100002401 | 3300006175 | Bacteria | 11532 |
| 195 | Ga0070712_100014160 | 3300006175 | Bacteria | 5117 |
| 196 | Ga0070712_100023032 | 3300006175 | Bacteria | 4109 |
| 197 | Ga0070712_100027911 | 3300006175 | Bacteria | 3772 |
| 198 | Ga0070712_100231121 | 3300006175 | Bacteria | 1469 |
| 199 | Ga0075362_10065646 | 3300006177 | Bacteria | 1648 |
| 200 | Ga0075367_10032163 | 3300006178 | Bacteria | 3016 |
| 201 | Ga0075367_10148236 | 3300006178 | Bacteria | 1455 |
| 202 | Ga0075369_10026154 | 3300006186 | Bacteria | 2431 |
| 203 | Ga0097621_100123307 | 3300006237 | Bacteria | 2199 |
| 204 | Ga0097621_100124709 | 3300006237 | Bacteria | 2187 |
| 205 | Ga0075370_10105155 | 3300006353 | Bacteria | 1636 |
| 206 | Ga0075370_10164575 | 3300006353 | Bacteria | 1302 |
| 207 | Ga0068871_100062766 | 3300006358 | Bacteria | 3037 |
| 208 | Ga0075428_100017893 | 3300006844 | Bacteria | 7832 |
| 209 | Ga0075428_100060675 | 3300006844 | Bacteria | 4141 |
| 210 | Ga0075428_100087121 | 3300006844 | Bacteria | 3406 |
| 211 | Ga0075430_100076366 | 3300006846 | Bacteria | 2808 |
| 212 | Ga0075430_100103191 | 3300006846 | Bacteria | 2381 |
| 213 | Ga0075431_100064819 | 3300006847 | Bacteria | 3773 |
| 214 | Ga0075431_100074655 | 3300006847 | Bacteria | 3498 |
| 215 | Ga0075431_100182975 | 3300006847 | Bacteria | 2150 |
| 216 | Ga0075433_10415822 | 3300006852 | Bacteria | 1186 |
| 217 | Ga0075434_100073828 | 3300006871 | Bacteria | 3404 |
| 218 | Ga0068865_100057395 | 3300006881 | Bacteria | 2715 |
| 219 | Ga0068865_100066160 | 3300006881 | Bacteria | 2549 |
| 220 | Ga0097620_100085777 | 3300006931 | Bacteria | 3194 |
| 221 | Ga0097620_100162075 | 3300006931 | Bacteria | 2315 |
| 222 | Ga0097620_100307383 | 3300006931 | Bacteria | 1679 |
| 223 | Ga0099824_1005437 | 3300006942 | Bacteria | 17948 |
| 224 | Ga0099824_1019303 | 3300006942 | Bacteria | 5353 |
| 225 | Ga0099823_1021543 | 3300006944 | Bacteria | 6021 |
| 226 | Ga0099794_10092105 | 3300007265 | Bacteria | 1505 |
| 227 | Ga0105240_10003827 | 3300009093 | Bacteria | 23265 |
| 228 | Ga0105240_10019441 | 3300009093 | Bacteria | 9074 |
| 229 | Ga0105240_10341685 | 3300009093 | Bacteria | 1700 |
| 230 | Ga0111539_10076597 | 3300009094 | Bacteria | 3938 |
| 231 | Ga0111539_10241498 | 3300009094 | Bacteria | 2103 |
| 232 | Ga0105245_10154763 | 3300009098 | Bacteria | 2171 |
| 233 | Ga0105245_10237695 | 3300009098 | Bacteria | 1764 |
| 234 | Ga0105245_10249088 | 3300009098 | Bacteria | 1725 |
| 235 | Ga0105247_10011850 | 3300009101 | Bacteria | 5242 |
| 236 | Ga0105247_10045923 | 3300009101 | Bacteria | 2681 |
| 237 | Ga0114129_10005063 | 3300009147 | Bacteria | 18550 |
| 238 | Ga0114129_10098068 | 3300009147 | Bacteria | 4056 |
| 239 | Ga0114129_10294007 | 3300009147 | Bacteria | 2167 |
| 240 | Ga0114129_10526533 | 3300009147 | Bacteria | 1540 |
| 241 | Ga0105243_10057159 | 3300009148 | Bacteria | 3105 |
| 242 | Ga0105243_10140789 | 3300009148 | Bacteria | 2058 |
| 243 | Ga0105241_10000556 | 3300009174 | Bacteria | 28213 |
| 244 | Ga0105241_10044147 | 3300009174 | Bacteria | 3377 |
| 245 | Ga0105241_10061791 | 3300009174 | Bacteria | 2886 |
| 246 | Ga0105241_10135187 | 3300009174 | Bacteria | 2001 |
| 247 | Ga0105241_10413717 | 3300009174 | Bacteria | 1185 |
| 248 | Ga0105248_10058261 | 3300009177 | Bacteria | 4337 |
| 249 | Ga0105248_10141182 | 3300009177 | Bacteria | 2717 |
| 250 | Ga0105248_10272296 | 3300009177 | Bacteria | 1906 |
| 251 | Ga0105248_10755432 | 3300009177 | Bacteria | 1097 |
| 252 | Ga0105237_10017741 | 3300009545 | Bacteria | 7379 |
| 253 | Ga0105237_10026514 | 3300009545 | Bacteria | 5923 |
| 254 | Ga0105237_10059686 | 3300009545 | Bacteria | 3816 |
| 255 | Ga0105237_10073147 | 3300009545 | Bacteria | 3420 |
| 256 | Ga0105237_10159141 | 3300009545 | Bacteria | 2256 |
| 257 | Ga0105238_10001118 | 3300009551 | Bacteria | 27100 |
| 258 | Ga0105238_10344110 | 3300009551 | Bacteria | 1480 |
| 259 | Ga0105239_10003377 | 3300010375 | Bacteria | 19579 |
| 260 | Ga0105239_10010894 | 3300010375 | Bacteria | 10159 |
| 261 | Ga0105239_10034448 | 3300010375 | Bacteria | 5560 |
| 262 | Ga0105239_10059927 | 3300010375 | Bacteria | 4177 |
| 263 | Ga0105239_10152353 | 3300010375 | Bacteria | 2580 |
| 264 | Ga0105239_10189763 | 3300010375 | Bacteria | 2301 |
| 265 | Ga0105239_10199396 | 3300010375 | Bacteria | 2242 |
| 266 | Ga0105239_10349306 | 3300010375 | Bacteria | 1670 |
| 267 | Ga0105246_10070789 | 3300011119 | Bacteria | 2454 |
| 268 | Ga0157373_10020152 | 3300013100 | Bacteria | 4851 |
| 269 | Ga0157373_10335880 | 3300013100 | Bacteria | 1076 |
| 270 | Ga0157370_10061898 | 3300013104 | Bacteria | 3551 |
| 271 | Ga0157370_10073237 | 3300013104 | Bacteria | 3232 |
| 272 | Ga0157370_10133128 | 3300013104 | Bacteria | 2318 |
| 273 | Ga0157370_10390335 | 3300013104 | Bacteria | 1282 |
| 274 | Ga0157369_10074086 | 3300013105 | Bacteria | 3651 |
| 275 | Ga0157369_10111585 | 3300013105 | Bacteria | 2906 |
| 276 | Ga0171462_1024 | 3300013250 | Bacteria | 129278 |
| 277 | Ga0157374_10025168 | 3300013296 | Bacteria | 5340 |
| 278 | Ga0157374_10068395 | 3300013296 | Bacteria | 3342 |
| 279 | Ga0157374_10251918 | 3300013296 | Bacteria | 1738 |
| 280 | Ga0157374_10384031 | 3300013296 | Bacteria | 1399 |
| 281 | Ga0157378_10048834 | 3300013297 | Bacteria | 3764 |
| 282 | Ga0163162_10025657 | 3300013306 | Bacteria | 5827 |
| 283 | Ga0163162_10308733 | 3300013306 | Bacteria | 1714 |
| 284 | Ga0157375_10296004 | 3300013308 | Bacteria | 1781 |
| 285 | Ga0157380_10180227 | 3300014326 | Bacteria | 1855 |
| 286 | Ga0157377_10020563 | 3300014745 | Bacteria | 3460 |
| 287 | Ga0157379_10158582 | 3300014968 | Bacteria | 2042 |
| 288 | Ga0157376_10245231 | 3300014969 | Bacteria | 1671 |
| 289 | Ga0157376_10247854 | 3300014969 | Bacteria | 1662 |
| 290 | Ga0157376_10268446 | 3300014969 | Bacteria | 1602 |
| 291 | Ga0163161_10161517 | 3300017792 | Bacteria | 1708 |
| 292 | Ga0214544_1000087 | 3300021320 | Bacteria | 119600 |
| 293 | Ga0214542_1000018 | 3300021321 | Bacteria | 202226 |
| 294 | Ga0214545_1000009 | 3300021324 | Bacteria | 202915 |
| 295 | Ga0214543_1000037 | 3300021327 | Bacteria | 182113 |
| 296 | Ga0213873_10017573 | 3300021358 | Bacteria | 1634 |
| 297 | Ga0213872_10029426 | 3300021361 | Bacteria | 2519 |
| 298 | Ga0213876_10000506 | 3300021384 | Bacteria | 30344 |
| 299 | Ga0213876_10085240 | 3300021384 | Bacteria | 1672 |
| 300 | Ga0213871_10014861 | 3300021441 | Bacteria | 1853 |
| 301 | Ga0209563_102656 | 3300025230 | Bacteria | 3959 |
| 302 | Ga0209677_100279 | 3300025253 | Bacteria | 34040 |
| 303 | Ga0209677_101823 | 3300025253 | Bacteria | 8714 |
| 304 | Ga0209148_1000743 | 3300025254 | Bacteria | 25189 |
| 305 | Ga0209233_1002530 | 3300025261 | Bacteria | 6678 |
| 306 | Ga0209233_1020556 | 3300025261 | Bacteria | 1728 |
| 307 | Ga0209565_1000234 | 3300025263 | Bacteria | 60830 |
| 308 | Ga0209673_1001141 | 3300025273 | Bacteria | 29196 |
| 309 | Ga0209673_1016587 | 3300025273 | Bacteria | 2746 |
| 310 | Ga0209675_1005480 | 3300025291 | Bacteria | 5305 |
| 311 | Ga0209025_1000017 | 3300025294 | Bacteria | 768983 |
| 312 | Ga0209564_1000044 | 3300025295 | Bacteria | 381017 |
| 313 | Ga0209564_1001508 | 3300025295 | Bacteria | 23302 |
| 314 | Ga0209564_1001652 | 3300025295 | Bacteria | 21520 |
| 315 | Ga0209758_1000030 | 3300025297 | Bacteria | 509217 |
| 316 | Ga0209758_1000884 | 3300025297 | Bacteria | 41143 |
| 317 | Ga0209758_1000949 | 3300025297 | Bacteria | 39098 |
| 318 | Ga0209758_1001021 | 3300025297 | Bacteria | 37026 |
| 319 | Ga0209758_1003078 | 3300025297 | Bacteria | 15842 |
| 320 | Ga0209758_1003950 | 3300025297 | Bacteria | 12878 |
| 321 | Ga0209758_1004035 | 3300025297 | Bacteria | 12664 |
| 322 | Ga0209758_1013339 | 3300025297 | Bacteria | 4491 |
| 323 | Ga0209758_1031502 | 3300025297 | Bacteria | 2173 |
| 324 | Ga0209256_1001055 | 3300025299 | Bacteria | 32004 |
| 325 | Ga0209256_1005633 | 3300025299 | Bacteria | 7078 |
| 326 | Ga0207426_1002551 | 3300025302 | Bacteria | 11405 |
| 327 | Ga0207426_1008813 | 3300025302 | Bacteria | 4038 |
| 328 | Ga0209257_1000246 | 3300025304 | Bacteria | 125942 |
| 329 | Ga0209257_1001419 | 3300025304 | Bacteria | 28521 |
| 330 | Ga0207656_10000874 | 3300025321 | Bacteria | 9816 |
| 331 | Ga0207656_10025611 | 3300025321 | Bacteria | 2396 |
| 332 | Ga0207653_10010152 | 3300025885 | Bacteria | 2936 |
| 333 | Ga0207692_10015708 | 3300025898 | Bacteria | 3338 |
| 334 | Ga0207692_10019740 | 3300025898 | Bacteria | 3051 |
| 335 | Ga0207692_10053400 | 3300025898 | Bacteria | 2058 |
| 336 | Ga0207710_10024653 | 3300025900 | Bacteria | 2592 |
| 337 | Ga0207688_10003085 | 3300025901 | Bacteria | 9093 |
| 338 | Ga0207688_10054536 | 3300025901 | Bacteria | 2243 |
| 339 | Ga0207647_10001617 | 3300025904 | Bacteria | 17326 |
| 340 | Ga0207647_10009026 | 3300025904 | Bacteria | 7101 |
| 341 | Ga0207647_10055203 | 3300025904 | Bacteria | 2441 |
| 342 | Ga0207685_10004594 | 3300025905 | Bacteria | 3536 |
| 343 | Ga0207699_10000614 | 3300025906 | Bacteria | 17364 |
| 344 | Ga0207699_10012377 | 3300025906 | Bacteria | 4340 |
| 345 | Ga0207699_10013219 | 3300025906 | Bacteria | 4219 |
| 346 | Ga0207699_10015252 | 3300025906 | Bacteria | 3987 |
| 347 | Ga0207645_10004656 | 3300025907 | Bacteria | 10106 |
| 348 | Ga0207643_10024474 | 3300025908 | Bacteria | 3332 |
| 349 | Ga0207643_10211894 | 3300025908 | Bacteria | 1183 |
| 350 | Ga0207705_10033296 | 3300025909 | Bacteria | 3680 |
| 351 | Ga0207705_10088600 | 3300025909 | Bacteria | 2264 |
| 352 | Ga0207705_10091227 | 3300025909 | Bacteria | 2231 |
| 353 | Ga0207654_10029065 | 3300025911 | Bacteria | 3021 |
| 354 | Ga0207654_10030270 | 3300025911 | Bacteria | 2970 |
| 355 | Ga0207654_10054556 | 3300025911 | Bacteria | 2310 |
| 356 | Ga0207707_10000507 | 3300025912 | Bacteria | 40006 |
| 357 | Ga0207707_10004195 | 3300025912 | Bacteria | 12767 |
| 358 | Ga0207707_10051011 | 3300025912 | Bacteria | 3603 |
| 359 | Ga0207695_10000059 | 3300025913 | Bacteria | 363920 |
| 360 | Ga0207695_10000366 | 3300025913 | Bacteria | 103345 |
| 361 | Ga0207695_10152138 | 3300025913 | Bacteria | 2252 |
| 362 | Ga0207695_10167673 | 3300025913 | Bacteria | 2123 |
| 363 | Ga0207671_10012190 | 3300025914 | Bacteria | 6935 |
| 364 | Ga0207671_10049183 | 3300025914 | Bacteria | 3121 |
| 365 | Ga0207671_10058501 | 3300025914 | Bacteria | 2858 |
| 366 | Ga0207671_10091293 | 3300025914 | Bacteria | 2295 |
| 367 | Ga0207671_10116613 | 3300025914 | Bacteria | 2037 |
| 368 | Ga0207671_10146678 | 3300025914 | Bacteria | 1821 |
| 369 | Ga0207693_10000073 | 3300025915 | Bacteria | 89380 |
| 370 | Ga0207693_10006707 | 3300025915 | Bacteria | 9504 |
| 371 | Ga0207693_10008050 | 3300025915 | Bacteria | 8652 |
| 372 | Ga0207693_10203660 | 3300025915 | Bacteria | 1556 |
| 373 | Ga0207663_10003754 | 3300025916 | Bacteria | 7489 |
| 374 | Ga0207663_10102911 | 3300025916 | Bacteria | 1922 |
| 375 | Ga0207660_10016060 | 3300025917 | Bacteria | 4950 |
| 376 | Ga0207660_10033087 | 3300025917 | Bacteria | 3573 |
| 377 | Ga0207662_10005397 | 3300025918 | Bacteria | 6809 |
| 378 | Ga0207657_10005397 | 3300025919 | Bacteria | 13360 |
| 379 | Ga0207657_10114625 | 3300025919 | Bacteria | 2222 |
| 380 | Ga0207657_10130648 | 3300025919 | Bacteria | 2058 |
| 381 | Ga0207657_10191881 | 3300025919 | Bacteria | 1647 |
| 382 | Ga0207657_10196434 | 3300025919 | Bacteria | 1625 |
| 383 | Ga0207649_10021159 | 3300025920 | Bacteria | 3739 |
| 384 | Ga0207649_10078684 | 3300025920 | Bacteria | 2128 |
| 385 | Ga0207652_10004176 | 3300025921 | Bacteria | 11779 |
| 386 | Ga0207681_10196596 | 3300025923 | Bacteria | 1546 |
| 387 | Ga0207694_10001314 | 3300025924 | Bacteria | 21361 |
| 388 | Ga0207650_10032958 | 3300025925 | Bacteria | 3750 |
| 389 | Ga0207650_10351681 | 3300025925 | Bacteria | 1212 |
| 390 | Ga0207687_10019263 | 3300025927 | Bacteria | 4519 |
| 391 | Ga0207687_10136956 | 3300025927 | Bacteria | 1853 |
| 392 | Ga0207700_10018518 | 3300025928 | Bacteria | 4682 |
| 393 | Ga0207700_10044222 | 3300025928 | Bacteria | 3277 |
| 394 | Ga0207700_10049231 | 3300025928 | Bacteria | 3134 |
| 395 | Ga0207700_10051688 | 3300025928 | Bacteria | 3068 |
| 396 | Ga0207700_10083105 | 3300025928 | Bacteria | 2506 |
| 397 | Ga0207700_10162917 | 3300025928 | Bacteria | 1854 |
| 398 | Ga0207700_10274425 | 3300025928 | Bacteria | 1448 |
| 399 | Ga0207664_10029373 | 3300025929 | Bacteria | 4186 |
| 400 | Ga0207664_10060869 | 3300025929 | Bacteria | 3011 |
| 401 | Ga0207664_10092204 | 3300025929 | Bacteria | 2486 |
| 402 | Ga0207664_10182671 | 3300025929 | Bacteria | 1801 |
| 403 | Ga0207664_10261712 | 3300025929 | Bacteria | 1513 |
| 404 | Ga0207706_10007519 | 3300025933 | Bacteria | 10081 |
| 405 | Ga0207706_10025021 | 3300025933 | Bacteria | 5353 |
| 406 | Ga0207706_10064020 | 3300025933 | Bacteria | 3237 |
| 407 | Ga0207706_10234414 | 3300025933 | Bacteria | 1605 |
| 408 | Ga0207709_10151369 | 3300025935 | Bacteria | 1607 |
| 409 | Ga0207665_10000629 | 3300025939 | Bacteria | 23661 |
| 410 | Ga0207665_10029050 | 3300025939 | Bacteria | 3656 |
| 411 | Ga0207665_10110878 | 3300025939 | Bacteria | 1928 |
| 412 | Ga0207691_10058700 | 3300025940 | Bacteria | 3499 |
| 413 | Ga0207691_10381644 | 3300025940 | Bacteria | 1203 |
| 414 | Ga0207711_10073672 | 3300025941 | Bacteria | 2968 |
| 415 | Ga0207711_10087064 | 3300025941 | Bacteria | 2740 |
| 416 | Ga0207711_10452457 | 3300025941 | Bacteria | 1195 |
| 417 | Ga0207689_10008326 | 3300025942 | Bacteria | 9034 |
| 418 | Ga0207689_10010026 | 3300025942 | Bacteria | 8168 |
| 419 | Ga0207661_10067769 | 3300025944 | Bacteria | 2903 |
| 420 | Ga0207661_10077070 | 3300025944 | Bacteria | 2740 |
| 421 | Ga0207661_10342179 | 3300025944 | Bacteria | 1348 |
| 422 | Ga0207679_10063418 | 3300025945 | Bacteria | 2758 |
| 423 | Ga0207667_10002298 | 3300025949 | Bacteria | 24013 |
| 424 | Ga0207667_10013554 | 3300025949 | Bacteria | 9320 |
| 425 | Ga0207667_10030667 | 3300025949 | Bacteria | 5812 |
| 426 | Ga0207667_10137864 | 3300025949 | Bacteria | 2512 |
| 427 | Ga0207667_10155155 | 3300025949 | Bacteria | 2356 |
| 428 | Ga0207667_10234286 | 3300025949 | Bacteria | 1879 |
| 429 | Ga0207712_10003482 | 3300025961 | Bacteria | 9932 |
| 430 | Ga0207712_10094761 | 3300025961 | Bacteria | 2206 |
| 431 | Ga0207668_10018573 | 3300025972 | Bacteria | 4379 |
| 432 | Ga0207640_10005225 | 3300025981 | Bacteria | 7065 |
| 433 | Ga0207640_10007537 | 3300025981 | Bacteria | 6010 |
| 434 | Ga0207640_10015748 | 3300025981 | Bacteria | 4383 |
| 435 | Ga0207658_10062745 | 3300025986 | Bacteria | 2782 |
| 436 | Ga0207658_10191381 | 3300025986 | Bacteria | 1701 |
| 437 | Ga0207658_10207632 | 3300025986 | Bacteria | 1639 |
| 438 | Ga0207677_10006929 | 3300026023 | Bacteria | 6230 |
| 439 | Ga0207677_10103142 | 3300026023 | Bacteria | 2105 |
| 440 | Ga0207677_10173295 | 3300026023 | Bacteria | 1690 |
| 441 | Ga0207703_10051866 | 3300026035 | Bacteria | 3327 |
| 442 | Ga0207703_10208547 | 3300026035 | Bacteria | 1741 |
| 443 | Ga0207703_10347467 | 3300026035 | Bacteria | 1365 |
| 444 | Ga0207639_10018749 | 3300026041 | Bacteria | 4920 |
| 445 | Ga0207639_10067837 | 3300026041 | Bacteria | 2777 |
| 446 | Ga0207639_10258180 | 3300026041 | Bacteria | 1523 |
| 447 | Ga0207639_10393497 | 3300026041 | Bacteria | 1247 |
| 448 | Ga0207678_10014114 | 3300026067 | Bacteria | 7026 |
| 449 | Ga0207678_10021891 | 3300026067 | Bacteria | 5604 |
| 450 | Ga0207678_10024742 | 3300026067 | Bacteria | 5242 |
| 451 | Ga0207678_10050636 | 3300026067 | Bacteria | 3588 |
| 452 | Ga0207678_10067301 | 3300026067 | Bacteria | 3075 |
| 453 | Ga0207678_10070754 | 3300026067 | Bacteria | 2991 |
| 454 | Ga0207678_10286285 | 3300026067 | Bacteria | 1415 |
| 455 | Ga0207708_10000628 | 3300026075 | Bacteria | 27158 |
| 456 | Ga0207708_10045582 | 3300026075 | Bacteria | 3341 |
| 457 | Ga0207708_10217563 | 3300026075 | Bacteria | 1529 |
| 458 | Ga0207702_10000090 | 3300026078 | Bacteria | 104566 |
| 459 | Ga0207702_10001808 | 3300026078 | Bacteria | 21040 |
| 460 | Ga0207702_10019738 | 3300026078 | Bacteria | 5580 |
| 461 | Ga0207702_10323527 | 3300026078 | Bacteria | 1469 |
| 462 | Ga0207641_10332373 | 3300026088 | Bacteria | 1444 |
| 463 | Ga0207648_10032162 | 3300026089 | Bacteria | 4634 |
| 464 | Ga0207648_10059696 | 3300026089 | Bacteria | 3326 |
| 465 | Ga0207648_10217876 | 3300026089 | Bacteria | 1696 |
| 466 | Ga0207648_10350338 | 3300026089 | Bacteria | 1331 |
| 467 | Ga0207676_10114012 | 3300026095 | Bacteria | 2267 |
| 468 | Ga0207674_10003131 | 3300026116 | Bacteria | 20388 |
| 469 | Ga0207674_10010715 | 3300026116 | Bacteria | 10352 |
| 470 | Ga0207674_10025881 | 3300026116 | Bacteria | 6246 |
| 471 | Ga0207674_10053308 | 3300026116 | Bacteria | 4123 |
| 472 | Ga0207674_10108340 | 3300026116 | Bacteria | 2755 |
| 473 | Ga0207674_10129512 | 3300026116 | Bacteria | 2487 |
| 474 | Ga0207675_100038377 | 3300026118 | Bacteria | 4470 |
| 475 | Ga0207675_100241620 | 3300026118 | Bacteria | 1745 |
| 476 | Ga0207675_100276403 | 3300026118 | Bacteria | 1631 |
| 477 | Ga0207683_10060969 | 3300026121 | Bacteria | 3318 |
| 478 | Ga0207683_10157970 | 3300026121 | Bacteria | 2048 |
| 479 | Ga0207683_10211137 | 3300026121 | Bacteria | 1767 |
| 480 | Ga0207683_10433859 | 3300026121 | Bacteria | 1210 |
| 481 | Ga0207698_10005567 | 3300026142 | Bacteria | 7789 |
| 482 | Ga0209389_1000300 | 3300027296 | Bacteria | 30909 |
| 483 | Ga0209389_1000600 | 3300027296 | Bacteria | 22104 |
| 484 | Ga0209589_1000026 | 3300027357 | Bacteria | 158154 |
| 485 | Ga0209589_1000103 | 3300027357 | Bacteria | 86516 |
| 486 | Ga0209489_100046 | 3300027361 | Bacteria | 158154 |
| 487 | Ga0209489_100304 | 3300027361 | Bacteria | 86516 |
| 488 | Ga0209489_105428 | 3300027361 | Bacteria | 22104 |
| 489 | Ga0209700_100047 | 3300027363 | Bacteria | 158154 |
| 490 | Ga0209700_104718 | 3300027363 | Bacteria | 24141 |
| 491 | Ga0209588_1047760 | 3300027671 | Bacteria | 1385 |
| 492 | Ga0207428_10232932 | 3300027907 | Bacteria | 1378 |
| 493 | Ga0268266_10002806 | 3300028379 | Bacteria | 18166 |
| 494 | Ga0268266_10017176 | 3300028379 | Bacteria | 6178 |
| 495 | Ga0268266_10047899 | 3300028379 | Bacteria | 3663 |
| 496 | Ga0268266_10085822 | 3300028379 | Bacteria | 2751 |
| 497 | Ga0268266_10190731 | 3300028379 | Bacteria | 1871 |
| 498 | Ga0268266_10309692 | 3300028379 | Bacteria | 1475 |
| 499 | Ga0268265_10071041 | 3300028380 | Bacteria | 2709 |
| 500 | Ga0268265_10141454 | 3300028380 | Bacteria | 2015 |
| 501 | Ga0268264_10000050 | 3300028381 | Bacteria | 323697 |
| 502 | Ga0268264_10068650 | 3300028381 | Bacteria | 2996 |
| 503 | Ga0268264_10116325 | 3300028381 | Bacteria | 2350 |
| 504 | Ga0265336_10007697 | 3300028666 | Bacteria | 3820 |
| 505 | Ga0307517_10001290 | 3300028786 | Bacteria | 42017 |
| 506 | Ga0307515_10021936 | 3300028794 | Bacteria | 11290 |
| 507 | Ga0307515_10054429 | 3300028794 | Bacteria | 5875 |
| 508 | Ga0307515_10124283 | 3300028794 | Bacteria | 2896 |
| 509 | Ga0307515_10144547 | 3300028794 | Bacteria | 2528 |
| 510 | Ga0265338_10000621 | 3300028800 | Bacteria | 61786 |
| 511 | Ga0307511_10033707 | 3300030521 | Bacteria | 4514 |
| 512 | Ga0265330_10017512 | 3300031235 | Bacteria | 3298 |
| 513 | Ga0265330_10035491 | 3300031235 | Bacteria | 2224 |
| 514 | Ga0265332_10017880 | 3300031238 | Bacteria | 3126 |
| 515 | Ga0265328_10002266 | 3300031239 | Bacteria | 8668 |
| 516 | Ga0265329_10039751 | 3300031242 | Bacteria | 1511 |
| 517 | Ga0265340_10017259 | 3300031247 | Bacteria | 3731 |
| 518 | Ga0265340_10026191 | 3300031247 | Bacteria | 2949 |
| 519 | Ga0265339_10019152 | 3300031249 | Bacteria | 4021 |
| 520 | Ga0265339_10053462 | 3300031249 | Bacteria | 2197 |
| 521 | Ga0265331_10002340 | 3300031250 | Bacteria | 12874 |
| 522 | Ga0265316_10023990 | 3300031344 | Bacteria | 5121 |
| 523 | Ga0307509_10052922 | 3300031507 | Bacteria | 4332 |
| 524 | Ga0307509_10062012 | 3300031507 | Bacteria | 3944 |
| 525 | Ga0307509_10066790 | 3300031507 | Bacteria | 3770 |
| 526 | Ga0307509_10188611 | 3300031507 | Bacteria | 1916 |
| 527 | Ga0307408_100029075 | 3300031548 | Bacteria | 3826 |
| 528 | Ga0307508_10000005 | 3300031616 | Bacteria | 286511 |
| 529 | Ga0307508_10039337 | 3300031616 | Bacteria | 4249 |
| 530 | Ga0265314_10004999 | 3300031711 | Bacteria | 12078 |
| 531 | Ga0265342_10006002 | 3300031712 | Bacteria | 9133 |
| 532 | Ga0265342_10071404 | 3300031712 | Bacteria | 2023 |
| 533 | Ga0307516_10018977 | 3300031730 | Bacteria | 7137 |
| 534 | Ga0307516_10163452 | 3300031730 | Bacteria | 1974 |
| 535 | Ga0307405_10125334 | 3300031731 | Bacteria | 1765 |
| 536 | Ga0307406_10293655 | 3300031901 | Bacteria | 1245 |
| 537 | Ga0307409_100111075 | 3300031995 | Bacteria | 2298 |
| 538 | Ga0307411_10065175 | 3300032005 | Bacteria | 2442 |
| 539 | Ga0307415_100035640 | 3300032126 | Bacteria | 3251 |
| 540 | Ga0307415_100114114 | 3300032126 | Bacteria | 2011 |
| 541 | Ga0307415_100158925 | 3300032126 | Bacteria | 1749 |
| 542 | Ga0307507_10028702 | 3300033179 | Bacteria | 5920 |
| 543 | Ga0307510_10017519 | 3300033180 | Bacteria | 8445 |
| 544 | Ga0307510_10109050 | 3300033180 | Bacteria | 2519 |
| 545 | Ga0307510_10129657 | 3300033180 | Bacteria | 2199 |
| 546 | Ga0307510_10184021 | 3300033180 | Bacteria | 1647 |
| 547 | Ga0315911_1000035 | 3300033442 | Bacteria | 66589 |
| 548 | Ga0373926_0013704 | 3300035083 | Bacteria | 2752 |
| 549 | Ga0373934_0006345 | 3300035086 | Bacteria | 4385 |
| 550 | Ga0373934_0021064 | 3300035086 | Bacteria | 2510 |
| 551 | Ga0373923_0000525 | 3300035111 | Bacteria | 9307 |
| 552 | Ga0373923_0020966 | 3300035111 | Bacteria | 2546 |
| 553 | Ga0373923_0065620 | 3300035111 | Bacteria | 1550 |
| 554 | Ga0373936_0003270 | 3300035113 | Bacteria | 6074 |
| 555 | Ga0373936_0023654 | 3300035113 | Bacteria | 2396 |
| 556 | Ga0373945_0015899 | 3300035116 | Bacteria | 2535 |
| 557 | Ga0373953_0000204 | 3300035117 | Bacteria | 15899 |
| 558 | Ga0373953_0018955 | 3300035117 | Bacteria | 2554 |
| 559 | Ga0373953_0080581 | 3300035117 | Bacteria | 1353 |
| 560 | Ga0373954_0001865 | 3300035118 | Bacteria | 8710 |
| 561 | Ga0373954_0011302 | 3300035118 | Bacteria | 3954 |
| 562 | Ga0373954_0015630 | 3300035118 | Bacteria | 3393 |
| 563 | Ga0373956_0002489 | 3300035119 | Bacteria | 7497 |
| 564 | Ga0373957_0000424 | 3300035120 | Bacteria | 10671 |
| 565 | Ga0373957_0000593 | 3300035120 | Bacteria | 9175 |
| 566 | Ga0373943_0021096 | 3300035170 | Bacteria | 3008 |
| 567 | Ga0373943_0021894 | 3300035170 | Bacteria | 2955 |
| 568 | Ga0373943_0062793 | 3300035170 | Bacteria | 1860 |
| 569 | Ga0373946_0001185 | 3300035171 | Bacteria | 9035 |
| 570 | Ga0373946_0009709 | 3300035171 | Bacteria | 3553 |
| 571 | Ga0373955_0000184 | 3300035172 | Bacteria | 25709 |
| 572 | Ga0373955_0004466 | 3300035172 | Bacteria | 6196 |
| 573 | Ga0373924_0005456 | 3300035410 | Bacteria | 4506 |
| 574 | Ga0373924_0012525 | 3300035410 | Bacteria | 3170 |
| 575 | Ga0373931_0017214 | 3300035691 | Bacteria | 3570 |
| 576 | Ga0373931_0058396 | 3300035691 | Bacteria | 2072 |
| 577 | Ga0373931_0079351 | 3300035691 | Bacteria | 1808 |
| 578 | Ga0373935_0003480 | 3300035692 | Bacteria | 9153 |
| 579 | Ga0373935_0211204 | 3300035692 | Bacteria | 1345 |
| 580 | Ga0373927_0000109 | 3300035695 | Bacteria | 62878 |
| 581 | Ga0373927_0018866 | 3300035695 | Bacteria | 4526 |
| 582 | Ga0373927_0023688 | 3300035695 | Bacteria | 4019 |
| 583 | Ga0373927_0046180 | 3300035695 | Bacteria | 2818 |
| 584 | Ga0373927_0077811 | 3300035695 | Bacteria | 2148 |
| 585 | Ga0373927_0127320 | 3300035695 | Bacteria | 1663 |
| 586 | Ga0373933_0000277 | 3300035724 | Bacteria | 33337 |
| 587 | Ga0373933_0000554 | 3300035724 | Bacteria | 23320 |
| 588 | Ga0373933_0029273 | 3300035724 | Bacteria | 3183 |
| 589 | Ga0373947_0001517 | 3300035725 | Bacteria | 14225 |
| 590 | Ga0373947_0037203 | 3300035725 | Bacteria | 2888 |
| 591 | Ga0373947_0039506 | 3300035725 | Bacteria | 2808 |
| 592 | Ga0373937_0002867 | 3300036401 | Bacteria | 14406 |
| 593 | Ga0373937_0046190 | 3300036401 | Bacteria | 3982 |
| 594 | Ga0373937_0069801 | 3300036401 | Bacteria | 3240 |
| 595 | Ga0373937_0154475 | 3300036401 | Bacteria | 2150 |
| 596 | Ga0373925_0009034 | 3300037068 | Bacteria | 7256 |
| 597 | Ga0373925_0014057 | 3300037068 | Bacteria | 5794 |
| 598 | Ga0373925_0036544 | 3300037068 | Bacteria | 3625 |
| 599 | Ga0373925_0137912 | 3300037068 | Bacteria | 1907 |
| 600 | Ga0395899_0000018 | 3300037312 | Bacteria | 423194 |
| 601 | Ga0395899_0014550 | 3300037312 | Bacteria | 6008 |
| 602 | Ga0395899_0094681 | 3300037312 | Bacteria | 2161 |
| 603 | Ga0395899_0109567 | 3300037312 | Bacteria | 1986 |
| 604 | Ga0395900_0000833 | 3300037418 | Bacteria | 40657 |
| 605 | Ga0395900_0044930 | 3300037418 | Bacteria | 4550 |
| 606 | Ga0395900_0075127 | 3300037418 | Bacteria | 3474 |
| 607 | Ga0395898_0094881 | 3300037466 | Bacteria | 2867 |
| 608 | Ga0395898_0141613 | 3300037466 | Bacteria | 2302 |
| 609 | Ga0395898_0277715 | 3300037466 | Bacteria | 1598 |
| 610 | Ga0395905_0000002 | 3300037471 | Bacteria | 1356358 |
| 611 | Ga0395905_0014893 | 3300037471 | Bacteria | 7420 |
| 612 | Ga0395905_0018837 | 3300037471 | Bacteria | 6547 |
| 613 | Ga0395905_0068044 | 3300037471 | Bacteria | 3336 |
| 614 | Ga0395905_0376289 | 3300037471 | Bacteria | 1314 |
| 615 | Ga0436364_0608267 | 3300037853 | Bacteria | 3683 |
| 616 | Ga0395901_0005514 | 3300038443 | Bacteria | 12813 |
| 617 | Ga0395901_0063364 | 3300038443 | Bacteria | 3848 |
| 618 | Ga0395901_0311579 | 3300038443 | Bacteria | 1630 |
| 619 | Ga0395901_0501363 | 3300038443 | Bacteria | 1236 |
| 620 | Ga0436365_0870327 | 3300039437 | Bacteria | 1856 |
| 621 | Ga0436365_1327145 | 3300039437 | Bacteria | 20947 |
| 622 | Ga0436365_1639132 | 3300039437 | Bacteria | 2027 |
| 623 | Ga0436365_1885173 | 3300039437 | Bacteria | 1255 |
| 624 | Ga0436360_0188092 | 3300039438 | Bacteria | 1342 |
| 625 | Ga0436360_0192034 | 3300039438 | Bacteria | 1726 |
| 626 | Ga0436360_0216049 | 3300039438 | Bacteria | 3573 |
| 627 | Ga0436363_1623990 | 3300039450 | Bacteria | 1140 |
| 628 | Ga0436362_0669995 | 3300039453 | Bacteria | 2147 |
| 629 | Ga0439465_0005228 | 3300041413 | Bacteria | 4158 |
| 630 | Ga0439465_0077959 | 3300041413 | Bacteria | 1119 |
| 631 | Ga0451853_2565009 | 3300041512 | Bacteria | 1799 |
| 632 | Ga0439458_0011673 | 3300042157 | Bacteria | 1966 |
| 633 | Ga0466969_0088707 | 3300044656 | Bacteria | 1468 |
| 634 | Ga0466969_0089476 | 3300044656 | Bacteria | 1460 |
| 635 | Ga0466972_0000871 | 3300044658 | Bacteria | 14493 |
| 636 | Ga0466972_0070594 | 3300044658 | Bacteria | 1666 |
| 637 | Ga0466965_0019156 | 3300044683 | Bacteria | 3286 |
| 638 | Ga0466966_0000137 | 3300044684 | Bacteria | 46695 |
| 639 | Ga0466966_0081559 | 3300044684 | Bacteria | 2014 |
| 640 | Ga0466961_0000039 | 3300044693 | Bacteria | 79787 |
| 641 | Ga0466961_0000182 | 3300044693 | Bacteria | 42657 |
| 642 | Ga0466964_0045903 | 3300044706 | Bacteria | 1779 |
| 643 | Ga0466971_0000562 | 3300044719 | Bacteria | 14692 |
| 644 | Ga0466971_0059791 | 3300044719 | Bacteria | 1722 |
| 645 | Ga0466970_0015491 | 3300044765 | Bacteria | 3921 |
| 646 | Ga0466957_0002614 | 3300044842 | Bacteria | 9709 |
| 647 | Ga0466957_0113199 | 3300044842 | Bacteria | 1723 |
| 648 | Ga0466957_0178751 | 3300044842 | Bacteria | 1385 |
| 649 | Ga0466960_0023816 | 3300044901 | Bacteria | 2754 |
| 650 | Ga0466959_0000028 | 3300045049 | Bacteria | 114144 |
| 651 | Ga0466959_0002520 | 3300045049 | Bacteria | 11745 |
| 652 | Ga0466959_0065022 | 3300045049 | Bacteria | 2647 |
| 653 | Ga0466959_0079846 | 3300045049 | Bacteria | 2359 |
| 654 | Ga0466958_0000162 | 3300045836 | Bacteria | 23703 |
| 655 | Ga0466967_0035287 | 3300045976 | Bacteria | 4255 |
| 656 | Ga0495617_026398 | 3300046452 | Bacteria | 1955 |
| 657 | Ga0495627_002311 | 3300046453 | Bacteria | 9389 |
| 658 | Ga0495592_0000678 | 3300046454 | Bacteria | 23715 |
| 659 | Ga0495592_0046911 | 3300046454 | Bacteria | 3219 |
| 660 | Ga0495603_0000189 | 3300046455 | Bacteria | 32189 |
| 661 | Ga0495603_0033579 | 3300046455 | Bacteria | 3087 |
| 662 | Ga0495603_0040481 | 3300046455 | Bacteria | 2789 |
| 663 | Ga0495603_0054816 | 3300046455 | Bacteria | 2362 |
| 664 | Ga0495603_0143314 | 3300046455 | Bacteria | 1389 |
| 665 | Ga0495590_0008709 | 3300046457 | Bacteria | 3861 |
| 666 | Ga0495629_0000268 | 3300046459 | Bacteria | 45291 |
| 667 | Ga0495629_0150296 | 3300046459 | Bacteria | 1619 |
| 668 | Ga0495638_0002733 | 3300046460 | Bacteria | 14177 |
| 669 | Ga0495638_0003907 | 3300046460 | Bacteria | 11530 |
| 670 | Ga0495638_0004594 | 3300046460 | Bacteria | 10449 |
| 671 | Ga0495638_0006283 | 3300046460 | Bacteria | 8671 |
| 672 | Ga0495638_0037250 | 3300046460 | Bacteria | 3094 |
| 673 | Ga0495638_0043467 | 3300046460 | Bacteria | 2834 |
| 674 | Ga0495641_0008241 | 3300046461 | Bacteria | 6381 |
| 675 | Ga0495651_0002545 | 3300046462 | Bacteria | 14107 |
| 676 | Ga0495651_0004117 | 3300046462 | Bacteria | 11135 |
| 677 | Ga0495651_0134106 | 3300046462 | Bacteria | 1804 |
| 678 | Ga0495653_0001252 | 3300046463 | Bacteria | 19662 |
| 679 | Ga0495653_0050722 | 3300046463 | Bacteria | 3190 |
| 680 | Ga0495653_0104304 | 3300046463 | Bacteria | 2049 |
| 681 | Ga0495650_0000114 | 3300046471 | Bacteria | 192527 |
| 682 | Ga0495650_0019974 | 3300046471 | Bacteria | 3279 |
| 683 | Ga0495580_0002333 | 3300046472 | Bacteria | 16564 |
| 684 | Ga0495580_0025076 | 3300046472 | Bacteria | 4359 |
| 685 | Ga0495580_0067373 | 3300046472 | Bacteria | 2505 |
| 686 | Ga0495582_0000144 | 3300046473 | Bacteria | 38436 |
| 687 | Ga0495582_0009481 | 3300046473 | Bacteria | 5362 |
| 688 | Ga0495605_0021634 | 3300046474 | Bacteria | 3403 |
| 689 | Ga0495605_0031478 | 3300046474 | Bacteria | 2710 |
| 690 | Ga0495605_0117082 | 3300046474 | Bacteria | 1211 |
| 691 | Ga0495639_0000067 | 3300046475 | Bacteria | 47932 |
| 692 | Ga0495639_0014306 | 3300046475 | Bacteria | 3435 |
| 693 | Ga0495639_0014334 | 3300046475 | Bacteria | 3431 |
| 694 | Ga0495639_0071724 | 3300046475 | Bacteria | 1600 |
| 695 | Ga0495639_0103719 | 3300046475 | Bacteria | 1345 |
| 696 | Ga0495662_0000005 | 3300046476 | Bacteria | 81157 |
| 697 | Ga0495662_0065818 | 3300046476 | Bacteria | 1752 |
| 698 | Ga0495664_0003350 | 3300046477 | Bacteria | 8709 |
| 699 | Ga0495664_0004265 | 3300046477 | Bacteria | 7805 |
| 700 | Ga0495664_0075429 | 3300046477 | Bacteria | 2018 |
| 701 | Ga0495664_0088639 | 3300046477 | Bacteria | 1860 |
| 702 | Ga0495664_0094845 | 3300046477 | Bacteria | 1796 |
| 703 | Ga0495584_0103591 | 3300046491 | Bacteria | 1439 |
| 704 | Ga0495594_0027701 | 3300046499 | Bacteria | 3054 |
| 705 | Ga0495594_0073449 | 3300046499 | Bacteria | 1904 |
| 706 | Ga0495596_0066604 | 3300046500 | Bacteria | 1400 |
| 707 | Ga0495607_0029468 | 3300046501 | Bacteria | 3378 |
| 708 | Ga0495607_0076292 | 3300046501 | Bacteria | 1854 |
| 709 | Ga0495583_0000013 | 3300046506 | Bacteria | 323372 |
| 710 | Ga0495583_0069144 | 3300046506 | Bacteria | 1556 |
| 711 | Ga0495606_0000858 | 3300046507 | Bacteria | 45651 |
| 712 | Ga0495606_0028077 | 3300046507 | Bacteria | 3975 |
| 713 | Ga0495606_0035190 | 3300046507 | Bacteria | 3426 |
| 714 | Ga0495606_0060045 | 3300046507 | Bacteria | 2437 |
| 715 | Ga0495606_0166439 | 3300046507 | Bacteria | 1282 |
| 716 | Ga0495608_0000255 | 3300046511 | Bacteria | 38655 |
| 717 | Ga0495608_0003767 | 3300046511 | Bacteria | 10889 |
| 718 | Ga0495610_0008642 | 3300046512 | Bacteria | 6564 |
| 719 | Ga0495610_0024830 | 3300046512 | Bacteria | 3228 |
| 720 | Ga0495616_0000053 | 3300046513 | Bacteria | 104389 |
| 721 | Ga0495616_0023169 | 3300046513 | Bacteria | 3343 |
| 722 | Ga0495618_0039118 | 3300046514 | Bacteria | 2982 |
| 723 | Ga0495618_0077305 | 3300046514 | Bacteria | 2121 |
| 724 | Ga0495618_0093913 | 3300046514 | Bacteria | 1918 |
| 725 | Ga0495618_0216734 | 3300046514 | Bacteria | 1209 |
| 726 | Ga0495620_0020567 | 3300046515 | Bacteria | 3222 |
| 727 | Ga0495628_0014733 | 3300046516 | Bacteria | 6545 |
| 728 | Ga0495628_0139155 | 3300046516 | Bacteria | 1853 |
| 729 | Ga0495628_0249602 | 3300046516 | Bacteria | 1325 |
| 730 | Ga0495630_0015290 | 3300046517 | Bacteria | 5601 |
| 731 | Ga0495630_0020943 | 3300046517 | Bacteria | 4826 |
| 732 | Ga0495630_0117424 | 3300046517 | Bacteria | 2017 |
| 733 | Ga0495631_0001968 | 3300046518 | Bacteria | 12034 |
| 734 | Ga0495631_0025704 | 3300046518 | Bacteria | 2708 |
| 735 | Ga0495632_0000335 | 3300046519 | Bacteria | 44771 |
| 736 | Ga0495637_0008165 | 3300046520 | Bacteria | 5153 |
| 737 | Ga0495637_0018711 | 3300046520 | Bacteria | 3209 |
| 738 | Ga0495637_0019164 | 3300046520 | Bacteria | 3165 |
| 739 | Ga0495643_0022446 | 3300046522 | Bacteria | 3601 |
| 740 | Ga0495644_0047202 | 3300046523 | Bacteria | 1618 |
| 741 | Ga0495648_0000072 | 3300046524 | Bacteria | 132630 |
| 742 | Ga0495648_0000664 | 3300046524 | Bacteria | 36757 |
| 743 | Ga0495648_0028166 | 3300046524 | Bacteria | 3746 |
| 744 | Ga0495648_0041967 | 3300046524 | Bacteria | 2883 |
| 745 | Ga0495666_0046111 | 3300046526 | Bacteria | 2102 |
| 746 | Ga0495652_0006124 | 3300046529 | Bacteria | 11240 |
| 747 | Ga0495652_0007010 | 3300046529 | Bacteria | 10415 |
| 748 | Ga0495654_0000082 | 3300046530 | Bacteria | 108599 |
| 749 | Ga0495654_0027297 | 3300046530 | Bacteria | 2928 |
| 750 | Ga0495665_0001692 | 3300046531 | Bacteria | 11840 |
| 751 | Ga0495665_0031918 | 3300046531 | Bacteria | 2818 |
| 752 | Ga0495640_0002790 | 3300046533 | Bacteria | 14051 |
| 753 | Ga0495640_0012191 | 3300046533 | Bacteria | 6580 |
| 754 | Ga0495640_0013838 | 3300046533 | Bacteria | 6128 |
| 755 | Ga0495640_0016475 | 3300046533 | Bacteria | 5528 |
| 756 | Ga0495587_0002484 | 3300046536 | Bacteria | 12307 |
| 757 | Ga0495587_0033195 | 3300046536 | Bacteria | 3117 |
| 758 | Ga0495587_0123562 | 3300046536 | Bacteria | 1482 |
| 759 | Ga0495598_0060739 | 3300046537 | Bacteria | 1165 |
| 760 | Ga0495609_0050752 | 3300046538 | Bacteria | 1849 |
| 761 | Ga0495597_0007237 | 3300046542 | Bacteria | 5654 |
| 762 | Ga0495645_0004244 | 3300046543 | Bacteria | 9786 |
| 763 | Ga0495645_0006922 | 3300046543 | Bacteria | 7879 |
| 764 | Ga0495622_0011946 | 3300046557 | Bacteria | 4017 |
| 765 | Ga0495622_0017449 | 3300046557 | Bacteria | 3341 |
| 766 | Ga0495622_0046154 | 3300046557 | Bacteria | 2024 |
| 767 | Ga0495622_0059535 | 3300046557 | Bacteria | 1768 |
| 768 | Ga0495667_0000121 | 3300046559 | Bacteria | 56223 |
| 769 | Ga0495667_0006748 | 3300046559 | Bacteria | 7790 |
| 770 | Ga0495667_0096853 | 3300046559 | Bacteria | 1910 |
| 771 | Ga0495656_0012851 | 3300046615 | Bacteria | 3100 |
| 772 | Ga0495656_0015199 | 3300046615 | Bacteria | 2902 |
| 773 | Ga0495668_0026914 | 3300046616 | Bacteria | 3261 |
| 774 | Ga0495668_0047980 | 3300046616 | Bacteria | 2370 |
| 775 | Ga0495668_0049516 | 3300046616 | Bacteria | 2330 |
| 776 | Ga0495668_0131764 | 3300046616 | Bacteria | 1368 |
| 777 | Ga0495634_0001407 | 3300046642 | Bacteria | 21535 |
| 778 | Ga0495634_0009303 | 3300046642 | Bacteria | 7248 |
| 779 | Ga0495634_0013633 | 3300046642 | Bacteria | 5872 |
| 780 | Ga0495634_0068133 | 3300046642 | Bacteria | 2352 |
| 781 | Ga0495625_0000290 | 3300046660 | Bacteria | 77650 |
| 782 | Ga0495625_0016762 | 3300046660 | Bacteria | 5755 |
| 783 | Ga0495625_0019463 | 3300046660 | Bacteria | 5264 |
| 784 | Ga0495625_0049575 | 3300046660 | Bacteria | 3017 |
| 785 | Ga0495625_0100837 | 3300046660 | Bacteria | 1984 |
| 786 | Ga0495625_0144679 | 3300046660 | Bacteria | 1601 |
| 787 | Ga0495635_0000072 | 3300046663 | Bacteria | 62736 |
| 788 | Ga0495635_0002392 | 3300046663 | Bacteria | 12785 |
| 789 | Ga0495635_0007293 | 3300046663 | Bacteria | 7723 |
| 790 | Ga0495635_0022140 | 3300046663 | Bacteria | 4427 |
| 791 | Ga0495635_0125192 | 3300046663 | Bacteria | 1752 |
| 792 | Ga0495659_0017556 | 3300046664 | Bacteria | 2373 |
| 793 | Ga0495659_0109805 | 3300046664 | Bacteria | 1076 |
| 794 | Ga0495661_0026266 | 3300046665 | Bacteria | 3751 |
| 795 | Ga0495588_0022358 | 3300046674 | Bacteria | 3125 |
| 796 | Ga0495588_0045133 | 3300046674 | Bacteria | 2259 |
| 797 | Ga0495588_0052717 | 3300046674 | Bacteria | 2097 |
| 798 | Ga0495588_0052950 | 3300046674 | Bacteria | 2092 |
| 799 | Ga0495657_0004073 | 3300046675 | Bacteria | 11719 |
| 800 | Ga0495657_0014654 | 3300046675 | Bacteria | 5755 |
| 801 | Ga0495657_0127280 | 3300046675 | Bacteria | 1599 |
| 802 | Ga0495599_0000468 | 3300046678 | Bacteria | 23004 |
| 803 | Ga0495599_0026745 | 3300046678 | Bacteria | 3616 |
| 804 | Ga0495599_0045178 | 3300046678 | Bacteria | 2762 |
| 805 | Ga0495623_0022493 | 3300046679 | Bacteria | 4072 |
| 806 | Ga0495646_0005577 | 3300046680 | Bacteria | 7961 |
| 807 | Ga0495646_0029722 | 3300046680 | Bacteria | 3414 |
| 808 | Ga0495646_0041694 | 3300046680 | Bacteria | 2819 |
| 809 | Ga0495647_0014841 | 3300046681 | Bacteria | 2719 |
| 810 | Ga0495647_0014973 | 3300046681 | Bacteria | 2710 |
| 811 | Ga0495647_0046107 | 3300046681 | Bacteria | 1677 |
| 812 | Ga0495658_0001103 | 3300046683 | Bacteria | 14275 |
| 813 | Ga0495669_0002316 | 3300046684 | Bacteria | 7803 |
| 814 | Ga0495613_0018960 | 3300046689 | Bacteria | 5126 |
| 815 | Ga0495613_0079473 | 3300046689 | Bacteria | 2385 |
| 816 | Ga0495613_0093627 | 3300046689 | Bacteria | 2175 |
| 817 | Ga0495613_0154125 | 3300046689 | Bacteria | 1637 |
| 818 | Ga0495624_0000460 | 3300046690 | Bacteria | 31973 |
| 819 | Ga0495624_0035416 | 3300046690 | Bacteria | 3223 |
| 820 | Ga0495670_0036380 | 3300046691 | Bacteria | 2453 |
| 821 | Ga0495670_0043471 | 3300046691 | Bacteria | 2242 |
| 822 | Ga0495671_0036785 | 3300046692 | Bacteria | 2479 |
| 823 | Ga0495671_0051961 | 3300046692 | Bacteria | 2037 |
| 824 | Ga0495671_0067341 | 3300046692 | Bacteria | 1761 |
| 825 | Ga0495589_0031361 | 3300046794 | Bacteria | 2676 |
| 826 | Ga0495600_0001056 | 3300046809 | Bacteria | 14933 |
| 827 | Ga0495600_0006711 | 3300046809 | Bacteria | 7014 |
| 828 | Ga0495660_0025111 | 3300046810 | Bacteria | 3386 |
| 829 | Ga0495581_0000178 | 3300047315 | Bacteria | 29093 |
| 830 | Ga0495581_0076596 | 3300047315 | Bacteria | 1935 |
| 831 | Ga0495604_0002293 | 3300047317 | Bacteria | 15325 |
| 832 | Ga0495604_0013732 | 3300047317 | Bacteria | 6457 |
| 833 | Ga0495674_0004128 | 3300047319 | Bacteria | 14021 |
| 834 | Ga0495674_0016488 | 3300047319 | Bacteria | 6891 |
| 835 | Ga0495674_0314638 | 3300047319 | Bacteria | 1277 |
| 836 | Ga0495672_0013122 | 3300047320 | Bacteria | 5731 |
| 837 | Ga0495672_0018740 | 3300047320 | Bacteria | 4584 |
| 838 | Ga0495672_0047646 | 3300047320 | Bacteria | 2547 |
| 839 | Ga0495676_0093195 | 3300047321 | Bacteria | 2246 |
| 840 | Ga0495676_0097123 | 3300047321 | Bacteria | 2188 |
| 841 | Ga0495680_0001208 | 3300047322 | Bacteria | 28311 |
| 842 | Ga0495680_0012539 | 3300047322 | Bacteria | 7454 |
| 843 | Ga0495680_0085047 | 3300047322 | Bacteria | 2382 |
| 844 | Ga0495683_0061678 | 3300047323 | Bacteria | 1857 |
| 845 | Ga0495683_0112413 | 3300047323 | Bacteria | 1299 |
| 846 | Ga0495687_011216 | 3300047443 | Bacteria | 4836 |
| 847 | Ga0495675_0003178 | 3300047444 | Bacteria | 9868 |
| 848 | Ga0495677_0014791 | 3300047445 | Bacteria | 2839 |
| 849 | Ga0495679_006243 | 3300047446 | Bacteria | 5161 |
| 850 | Ga0495673_0000025 | 3300047469 | Bacteria | 512352 |
| 851 | Ga0495673_0015713 | 3300047469 | Bacteria | 3893 |
| 852 | Ga0495673_0036262 | 3300047469 | Bacteria | 2264 |
| 853 | Ga0495684_0002454 | 3300047471 | Bacteria | 14798 |
| 854 | Ga0495684_0026908 | 3300047471 | Bacteria | 4419 |
| 855 | Ga0495684_0242714 | 3300047471 | Bacteria | 1313 |
| 856 | Ga0495686_0003968 | 3300047472 | Bacteria | 12414 |
| 857 | Ga0495686_0037559 | 3300047472 | Bacteria | 3102 |
| 858 | Ga0495686_0064279 | 3300047472 | Bacteria | 2272 |
| 859 | Ga0495686_0090786 | 3300047472 | Bacteria | 1854 |
| 860 | Ga0495686_0131045 | 3300047472 | Bacteria | 1486 |
| 861 | Ga0495593_0000038 | 3300047673 | Bacteria | 53141 |
| 862 | Ga0495593_0000109 | 3300047673 | Bacteria | 38355 |
| 863 | Ga0495593_0012360 | 3300047673 | Bacteria | 4879 |
| 864 | Ga0495602_0008629 | 3300048088 | Bacteria | 10643 |
| 865 | Ga0495602_0024467 | 3300048088 | Bacteria | 5858 |
| 866 | Ga0495602_0138489 | 3300048088 | Bacteria | 1930 |
| 867 | Ga0495614_0058587 | 3300048089 | Bacteria | 1654 |
| 868 | Ga0495615_0016929 | 3300048090 | Bacteria | 1580 |
| 869 | Ga0495626_0024253 | 3300048091 | Bacteria | 2976 |
| 870 | Ga0495626_0113413 | 3300048091 | Bacteria | 1172 |
| 871 | Ga0496100_0004173 | 3300048903 | Bacteria | 7618 |
| 872 | Ga0496100_0022384 | 3300048903 | Bacteria | 3824 |
| 873 | Ga0496100_0053083 | 3300048903 | Bacteria | 2638 |
| 874 | Ga0496100_0114466 | 3300048903 | Bacteria | 1879 |
| 875 | Ga0496100_0169550 | 3300048903 | Bacteria | 1571 |
| 876 | Ga0496101_0005878 | 3300048904 | Bacteria | 7856 |
| 877 | Ga0496101_0025066 | 3300048904 | Bacteria | 4134 |
| 878 | Ga0496101_0181616 | 3300048904 | Bacteria | 1620 |
| 879 | Ga0496101_0250749 | 3300048904 | Bacteria | 1379 |
| 880 | Ga0496102_0008645 | 3300048905 | Bacteria | 8739 |
| 881 | Ga0496102_0024656 | 3300048905 | Bacteria | 5349 |
| 882 | Ga0496102_0031103 | 3300048905 | Bacteria | 4784 |
| 883 | Ga0496102_0076991 | 3300048905 | Bacteria | 3069 |
| 884 | Ga0496102_0094828 | 3300048905 | Bacteria | 2765 |
| 885 | Ga0496102_0113864 | 3300048905 | Bacteria | 2524 |
| 886 | Ga0496102_0251869 | 3300048905 | Bacteria | 1665 |
| 887 | Ga0496102_0281205 | 3300048905 | Bacteria | 1568 |
| 888 | Ga0496103_0015806 | 3300048906 | Bacteria | 4499 |
| 889 | Ga0496103_0023402 | 3300048906 | Bacteria | 3724 |
| 890 | Ga0496103_0156683 | 3300048906 | Bacteria | 1460 |
| 891 | Ga0496103_0230343 | 3300048906 | Bacteria | 1192 |
| 892 | Ga0496104_0013379 | 3300048907 | Bacteria | 7393 |
| 893 | Ga0496104_0015039 | 3300048907 | Bacteria | 7002 |
| 894 | Ga0496104_0015607 | 3300048907 | Bacteria | 6885 |
| 895 | Ga0496104_0019922 | 3300048907 | Bacteria | 6143 |
| 896 | Ga0496104_0046196 | 3300048907 | Bacteria | 4099 |
| 897 | Ga0496104_0169108 | 3300048907 | Bacteria | 2096 |
| 898 | Ga0496104_0202556 | 3300048907 | Bacteria | 1896 |
| 899 | Ga0496104_0403927 | 3300048907 | Bacteria | 1278 |
| 900 | Ga0496105_0007692 | 3300048908 | Bacteria | 8356 |
| 901 | Ga0496105_0119343 | 3300048908 | Bacteria | 2175 |
| 902 | Ga0496105_0144823 | 3300048908 | Bacteria | 1954 |
| 903 | Ga0496105_0170453 | 3300048908 | Bacteria | 1784 |
| 904 | Ga0496105_0170793 | 3300048908 | Bacteria | 1782 |
| 905 | Ga0496105_0312403 | 3300048908 | Bacteria | 1261 |
| 906 | Ga0496106_0043894 | 3300048909 | Bacteria | 3356 |
| 907 | Ga0496106_0079997 | 3300048909 | Bacteria | 2509 |
| 908 | Ga0496106_0113165 | 3300048909 | Bacteria | 2115 |
| 909 | Ga0496106_0217929 | 3300048909 | Bacteria | 1521 |
| 910 | Ga0496106_0288896 | 3300048909 | Bacteria | 1314 |
| 911 | Ga0496106_0311315 | 3300048909 | Bacteria | 1263 |
| 912 | Ga0496107_0000821 | 3300048910 | Bacteria | 18074 |
| 913 | Ga0496107_0009564 | 3300048910 | Bacteria | 6724 |
| 914 | Ga0496107_0010126 | 3300048910 | Bacteria | 6540 |
| 915 | Ga0496107_0017264 | 3300048910 | Bacteria | 5075 |
| 916 | Ga0496107_0035767 | 3300048910 | Bacteria | 3561 |
| 917 | Ga0496107_0091899 | 3300048910 | Bacteria | 2218 |
| 918 | Ga0496108_0000553 | 3300048911 | Bacteria | 29302 |
| 919 | Ga0496108_0040135 | 3300048911 | Bacteria | 3901 |
| 920 | Ga0496108_0043553 | 3300048911 | Bacteria | 3749 |
| 921 | Ga0496108_0153969 | 3300048911 | Bacteria | 1984 |
| 922 | Ga0496108_0165589 | 3300048911 | Bacteria | 1911 |
| 923 | Ga0496109_0000574 | 3300048912 | Bacteria | 30746 |
| 924 | Ga0496109_0014214 | 3300048912 | Bacteria | 6924 |
| 925 | Ga0496109_0014907 | 3300048912 | Bacteria | 6765 |
| 926 | Ga0496109_0067541 | 3300048912 | Bacteria | 3276 |
| 927 | Ga0496109_0164013 | 3300048912 | Bacteria | 2082 |
| 928 | Ga0496109_0188534 | 3300048912 | Bacteria | 1937 |
| 929 | Ga0496109_0250828 | 3300048912 | Bacteria | 1667 |
| 930 | Ga0496110_0015270 | 3300048913 | Bacteria | 6388 |
| 931 | Ga0496110_0022137 | 3300048913 | Bacteria | 5392 |
| 932 | Ga0496110_0022422 | 3300048913 | Bacteria | 5361 |
| 933 | Ga0496110_0024393 | 3300048913 | Bacteria | 5154 |
| 934 | Ga0496110_0031954 | 3300048913 | Bacteria | 4543 |
| 935 | Ga0496110_0047439 | 3300048913 | Bacteria | 3761 |
| 936 | Ga0496110_0260660 | 3300048913 | Bacteria | 1578 |
| 937 | Ga0496110_0574992 | 3300048913 | Bacteria | 1023 |
| 938 | Ga0496111_0000254 | 3300048914 | Bacteria | 25829 |
| 939 | Ga0496111_0038744 | 3300048914 | Bacteria | 3416 |
| 940 | Ga0496111_0114014 | 3300048914 | Bacteria | 1992 |
| 941 | Ga0496111_0226915 | 3300048914 | Bacteria | 1387 |
| 942 | Ga0496112_0000065 | 3300048915 | Bacteria | 70119 |
| 943 | Ga0496112_0005410 | 3300048915 | Bacteria | 11035 |
| 944 | Ga0496112_0009978 | 3300048915 | Bacteria | 8594 |
| 945 | Ga0496112_0011336 | 3300048915 | Bacteria | 8135 |
| 946 | Ga0496112_0034980 | 3300048915 | Bacteria | 4889 |
| 947 | Ga0496112_0057686 | 3300048915 | Bacteria | 3823 |
| 948 | Ga0496112_0059684 | 3300048915 | Bacteria | 3759 |
| 949 | Ga0496112_0118017 | 3300048915 | Bacteria | 2623 |
| 950 | Ga0496112_0134453 | 3300048915 | Bacteria | 2443 |
| 951 | Ga0496112_0251642 | 3300048915 | Bacteria | 1717 |
| 952 | Ga0496113_0000209 | 3300048916 | Bacteria | 27329 |
| 953 | Ga0496113_0017578 | 3300048916 | Bacteria | 4967 |
| 954 | Ga0496113_0099558 | 3300048916 | Bacteria | 2251 |
| 955 | Ga0496113_0100062 | 3300048916 | Bacteria | 2246 |
| 956 | Ga0496113_0218242 | 3300048916 | Bacteria | 1519 |
| 957 | Ga0496113_0240405 | 3300048916 | Bacteria | 1445 |
| 958 | Ga0496113_0251121 | 3300048916 | Bacteria | 1412 |
| 959 | Ga0496114_0007557 | 3300048917 | Bacteria | 8598 |
| 960 | Ga0496114_0156999 | 3300048917 | Bacteria | 1976 |
| 961 | Ga0496114_0233169 | 3300048917 | Bacteria | 1618 |
| 962 | Ga0496115_0003049 | 3300048918 | Bacteria | 12025 |
| 963 | Ga0496115_0027806 | 3300048918 | Bacteria | 4427 |
| 964 | Ga0496115_0058651 | 3300048918 | Bacteria | 3098 |
| 965 | Ga0496115_0078514 | 3300048918 | Bacteria | 2685 |
| 966 | Ga0496116_0003085 | 3300048919 | Bacteria | 16786 |
| 967 | Ga0496116_0160508 | 3300048919 | Bacteria | 1234 |
| 968 | Ga0496117_0007135 | 3300048920 | Bacteria | 11042 |
| 969 | Ga0496117_0024076 | 3300048920 | Bacteria | 4828 |
| 970 | Ga0496117_0072968 | 3300048920 | Bacteria | 2291 |
| 971 | Ga0496117_0163544 | 3300048920 | Bacteria | 1301 |
| 972 | Ga0496118_0005552 | 3300048921 | Bacteria | 14295 |
| 973 | Ga0496118_0015872 | 3300048921 | Bacteria | 6943 |
| 974 | Ga0496118_0017902 | 3300048921 | Bacteria | 6427 |
| 975 | Ga0496118_0033771 | 3300048921 | Bacteria | 4189 |
| 976 | Ga0496118_0135115 | 3300048921 | Bacteria | 1576 |
| 977 | Ga0496119_0044038 | 3300048922 | Bacteria | 2814 |
| 978 | Ga0496119_0090119 | 3300048922 | Bacteria | 1745 |
| 979 | Ga0496119_0100564 | 3300048922 | Bacteria | 1624 |
| 980 | Ga0496119_0107164 | 3300048922 | Bacteria | 1558 |
| 981 | Ga0496119_0136213 | 3300048922 | Bacteria | 1331 |
| 982 | Ga0496120_0005683 | 3300048923 | Bacteria | 9849 |
| 983 | Ga0496120_0010445 | 3300048923 | Bacteria | 6479 |
| 984 | Ga0496121_0000453 | 3300048924 | Bacteria | 80749 |
| 985 | Ga0496121_0002104 | 3300048924 | Bacteria | 31321 |
| 986 | Ga0496121_0002583 | 3300048924 | Bacteria | 27387 |
| 987 | Ga0496121_0006128 | 3300048924 | Bacteria | 15107 |
| 988 | Ga0496121_0016140 | 3300048924 | Bacteria | 7737 |
| 989 | Ga0496121_0021760 | 3300048924 | Bacteria | 6264 |
| 990 | Ga0496121_0043512 | 3300048924 | Bacteria | 3888 |
| 991 | Ga0496121_0052036 | 3300048924 | Bacteria | 3443 |
| 992 | Ga0496121_0056847 | 3300048924 | Bacteria | 3247 |
| 993 | Ga0496121_0074801 | 3300048924 | Bacteria | 2708 |
| 994 | Ga0496121_0097871 | 3300048924 | Bacteria | 2272 |
| 995 | Ga0496121_0099348 | 3300048924 | Bacteria | 2249 |
| 996 | Ga0496121_0235803 | 3300048924 | Bacteria | 1278 |
| 997 | Ga0496122_0051260 | 3300048925 | Bacteria | 3138 |
| 998 | Ga0496123_0106959 | 3300048926 | Bacteria | 1610 |
| 999 | Ga0496124_0002831 | 3300048927 | Bacteria | 21956 |
| 1000 | Ga0496124_0020645 | 3300048927 | Bacteria | 6080 |
| 1001 | Ga0496125_0003090 | 3300048928 | Bacteria | 20775 |
| 1002 | Ga0496125_0005379 | 3300048928 | Bacteria | 14274 |
| 1003 | Ga0496125_0016016 | 3300048928 | Bacteria | 7218 |
| 1004 | Ga0496125_0069645 | 3300048928 | Bacteria | 2759 |
| 1005 | Ga0496125_0120943 | 3300048928 | Bacteria | 1868 |
| 1006 | Ga0496126_0002707 | 3300048929 | Bacteria | 23413 |
| 1007 | Ga0496126_0012688 | 3300048929 | Bacteria | 8621 |
| 1008 | Ga0496126_0021067 | 3300048929 | Bacteria | 6376 |
| 1009 | Ga0496126_0032509 | 3300048929 | Bacteria | 4914 |
| 1010 | Ga0496126_0042154 | 3300048929 | Bacteria | 4216 |
| 1011 | Ga0496126_0053918 | 3300048929 | Bacteria | 3645 |
| 1012 | Ga0496126_0150841 | 3300048929 | Bacteria | 1992 |
| 1013 | Ga0496126_0160188 | 3300048929 | Bacteria | 1923 |
| 1014 | Ga0496126_0165352 | 3300048929 | Bacteria | 1888 |
| 1015 | Ga0496126_0167090 | 3300048929 | Bacteria | 1877 |
| 1016 | Ga0496126_0170504 | 3300048929 | Bacteria | 1854 |
| 1017 | Ga0496126_0225470 | 3300048929 | Bacteria | 1572 |
| 1018 | Ga0495678_001114 | 3300049459 | Bacteria | 22387 |
| 1019 | Ga0501031_0018544 | 3300049568 | Bacteria | 4530 |
| 1020 | Ga0501031_0018611 | 3300049568 | Bacteria | 4523 |
| 1021 | Ga0501031_0055908 | 3300049568 | Bacteria | 2571 |
| 1022 | Ga0501032_0000309 | 3300049569 | Bacteria | 41024 |
| 1023 | Ga0501032_0023936 | 3300049569 | Bacteria | 4217 |
| 1024 | Ga0501032_0034437 | 3300049569 | Bacteria | 3467 |
| 1025 | Ga0501032_0063456 | 3300049569 | Bacteria | 2473 |
| 1026 | Ga0501032_0072665 | 3300049569 | Bacteria | 2292 |
| 1027 | Ga0501033_0001437 | 3300049570 | Bacteria | 21135 |
| 1028 | Ga0501033_0001792 | 3300049570 | Bacteria | 18732 |
| 1029 | Ga0501033_0005552 | 3300049570 | Bacteria | 9973 |
| 1030 | Ga0501033_0011464 | 3300049570 | Bacteria | 6783 |
| 1031 | Ga0501033_0146852 | 3300049570 | Bacteria | 1702 |
| 1032 | Ga0501034_0000082 | 3300049571 | Bacteria | 170039 |
| 1033 | Ga0501034_0038159 | 3300049571 | Bacteria | 4864 |
| 1034 | Ga0501034_0043255 | 3300049571 | Bacteria | 4559 |
| 1035 | Ga0501034_0120069 | 3300049571 | Bacteria | 2615 |
| 1036 | Ga0501034_0470216 | 3300049571 | Bacteria | 1173 |
| 1037 | Ga0501036_0000121 | 3300049572 | Bacteria | 48901 |
| 1038 | Ga0501036_0017730 | 3300049572 | Bacteria | 5961 |
| 1039 | Ga0501036_0059762 | 3300049572 | Bacteria | 3229 |
| 1040 | Ga0501036_0074431 | 3300049572 | Bacteria | 2872 |
| 1041 | Ga0501036_0075582 | 3300049572 | Bacteria | 2849 |
| 1042 | Ga0501036_0261572 | 3300049572 | Bacteria | 1449 |
| 1043 | Ga0501037_0001873 | 3300049573 | Bacteria | 15281 |
| 1044 | Ga0501037_0003883 | 3300049573 | Bacteria | 10842 |
| 1045 | Ga0501037_0004517 | 3300049573 | Bacteria | 10111 |
| 1046 | Ga0501037_0011302 | 3300049573 | Bacteria | 6571 |
| 1047 | Ga0501037_0055880 | 3300049573 | Bacteria | 2885 |
| 1048 | Ga0501037_0064072 | 3300049573 | Bacteria | 2679 |
| 1049 | Ga0501038_0001766 | 3300049574 | Bacteria | 20109 |
| 1050 | Ga0501038_0007655 | 3300049574 | Bacteria | 9961 |
| 1051 | Ga0501038_0011654 | 3300049574 | Bacteria | 8018 |
| 1052 | Ga0501038_0020734 | 3300049574 | Bacteria | 5907 |
| 1053 | Ga0501038_0028126 | 3300049574 | Bacteria | 4994 |
| 1054 | Ga0501038_0131751 | 3300049574 | Bacteria | 2052 |
| 1055 | Ga0501038_0133621 | 3300049574 | Bacteria | 2034 |
| 1056 | Ga0501039_0008300 | 3300049575 | Bacteria | 7913 |
| 1057 | Ga0501039_0008973 | 3300049575 | Bacteria | 7617 |
| 1058 | Ga0501039_0019231 | 3300049575 | Bacteria | 5238 |
| 1059 | Ga0501039_0163379 | 3300049575 | Bacteria | 1751 |
| 1060 | Ga0501039_0182526 | 3300049575 | Bacteria | 1650 |
| 1061 | Ga0501039_0245128 | 3300049575 | Bacteria | 1409 |
| 1062 | Ga0501039_0322592 | 3300049575 | Bacteria | 1214 |
| 1063 | Ga0501040_0019588 | 3300049576 | Bacteria | 4502 |
| 1064 | Ga0501041_0024090 | 3300049577 | Bacteria | 3652 |
| 1065 | Ga0501042_0002459 | 3300049578 | Bacteria | 11380 |
| 1066 | Ga0501042_0020947 | 3300049578 | Bacteria | 4553 |
| 1067 | Ga0501043_0000109 | 3300049579 | Bacteria | 77120 |
| 1068 | Ga0501043_0018022 | 3300049579 | Bacteria | 5538 |
| 1069 | Ga0501043_0020967 | 3300049579 | Bacteria | 5124 |
| 1070 | Ga0501043_0031418 | 3300049579 | Bacteria | 4174 |
| 1071 | Ga0501043_0054188 | 3300049579 | Bacteria | 3149 |
| 1072 | Ga0501043_0065893 | 3300049579 | Bacteria | 2844 |
| 1073 | Ga0501043_0071423 | 3300049579 | Bacteria | 2726 |
| 1074 | Ga0501043_0097384 | 3300049579 | Bacteria | 2313 |
| 1075 | Ga0501043_0223631 | 3300049579 | Bacteria | 1455 |
| 1076 | Ga0501046_0006125 | 3300049580 | Bacteria | 10686 |
| 1077 | Ga0501046_0011755 | 3300049580 | Bacteria | 7474 |
| 1078 | Ga0501046_0020055 | 3300049580 | Bacteria | 5535 |
| 1079 | Ga0501046_0108527 | 3300049580 | Bacteria | 2122 |
| 1080 | Ga0501046_0145287 | 3300049580 | Bacteria | 1792 |
| 1081 | Ga0501046_0241597 | 3300049580 | Bacteria | 1332 |
| 1082 | Ga0501047_0000331 | 3300049581 | Bacteria | 54371 |
| 1083 | Ga0501047_0005862 | 3300049581 | Bacteria | 11565 |
| 1084 | Ga0501047_0013763 | 3300049581 | Bacteria | 7682 |
| 1085 | Ga0501047_0016114 | 3300049581 | Bacteria | 7129 |
| 1086 | Ga0501047_0081308 | 3300049581 | Bacteria | 3114 |
| 1087 | Ga0501047_0119800 | 3300049581 | Bacteria | 2514 |
| 1088 | Ga0501048_0000124 | 3300049582 | Bacteria | 44765 |
| 1089 | Ga0501048_0006242 | 3300049582 | Bacteria | 9062 |
| 1090 | Ga0501048_0207138 | 3300049582 | Bacteria | 1391 |
| 1091 | Ga0501048_0209467 | 3300049582 | Bacteria | 1383 |
| 1092 | Ga0501067_0000754 | 3300049583 | Bacteria | 17403 |
| 1093 | Ga0501067_0004772 | 3300049583 | Bacteria | 7512 |
| 1094 | Ga0501068_0003061 | 3300049584 | Bacteria | 8923 |
| 1095 | Ga0501068_0013934 | 3300049584 | Bacteria | 4586 |
| 1096 | Ga0501069_0043468 | 3300049585 | Bacteria | 2487 |
| 1097 | Ga0501069_0231905 | 3300049585 | Bacteria | 1075 |
| 1098 | Ga0501070_0109696 | 3300049586 | Bacteria | 2280 |
| 1099 | Ga0501070_0120997 | 3300049586 | Bacteria | 2163 |
| 1100 | Ga0501071_0058511 | 3300049587 | Bacteria | 2787 |
| 1101 | Ga0501072_0001910 | 3300049588 | Bacteria | 15511 |
| 1102 | Ga0501072_0011811 | 3300049588 | Bacteria | 6671 |
| 1103 | Ga0501073_0000101 | 3300049589 | Bacteria | 54365 |
| 1104 | Ga0501073_0007671 | 3300049589 | Bacteria | 8007 |
| 1105 | Ga0501073_0022798 | 3300049589 | Bacteria | 4504 |
| 1106 | Ga0501074_0000673 | 3300049590 | Bacteria | 21320 |
| 1107 | Ga0501074_0022078 | 3300049590 | Bacteria | 4624 |
| 1108 | Ga0501076_0023212 | 3300049592 | Bacteria | 4780 |
| 1109 | Ga0501076_0057238 | 3300049592 | Bacteria | 3095 |
| 1110 | Ga0501077_0007464 | 3300049593 | Bacteria | 6746 |
| 1111 | Ga0501079_0007287 | 3300049741 | Bacteria | 8351 |
| 1112 | Ga0501079_0044414 | 3300049741 | Bacteria | 3429 |
| 1113 | Ga0501079_0053524 | 3300049741 | Bacteria | 3114 |
| 1114 | Ga0501080_0000151 | 3300049742 | Bacteria | 49588 |
| 1115 | Ga0501080_0014075 | 3300049742 | Bacteria | 7363 |
| 1116 | Ga0501080_0028786 | 3300049742 | Bacteria | 5172 |
| 1117 | Ga0501080_0324447 | 3300049742 | Bacteria | 1393 |
| 1118 | Ga0501080_0339089 | 3300049742 | Bacteria | 1358 |
| 1119 | Ga0501083_0001467 | 3300049744 | Bacteria | 16100 |
| 1120 | Ga0501083_0083002 | 3300049744 | Bacteria | 2123 |
| 1121 | Ga0501083_0243988 | 3300049744 | Bacteria | 1170 |
| 1122 | Ga0501035_0000150 | 3300049822 | Bacteria | 85450 |
| 1123 | Ga0501035_0005831 | 3300049822 | Bacteria | 11617 |
| 1124 | Ga0501035_0025197 | 3300049822 | Bacteria | 5453 |
| 1125 | Ga0501035_0030637 | 3300049822 | Bacteria | 4903 |
| 1126 | Ga0501035_0032463 | 3300049822 | Bacteria | 4749 |
| 1127 | Ga0501035_0053293 | 3300049822 | Bacteria | 3618 |
| 1128 | Ga0501035_0490784 | 3300049822 | Bacteria | 1012 |
| 1129 | Ga0501044_0000247 | 3300049823 | Bacteria | 68674 |
| 1130 | Ga0501044_0005266 | 3300049823 | Bacteria | 14384 |
| 1131 | Ga0501044_0036813 | 3300049823 | Bacteria | 5118 |
| 1132 | Ga0501044_0037013 | 3300049823 | Bacteria | 5102 |
| 1133 | Ga0501044_0087334 | 3300049823 | Bacteria | 3150 |
| 1134 | Ga0501044_0144108 | 3300049823 | Bacteria | 2369 |
| 1135 | Ga0501044_0238803 | 3300049823 | Bacteria | 1761 |
| 1136 | Ga0501044_0271729 | 3300049823 | Bacteria | 1630 |
| 1137 | Ga0501045_0009953 | 3300049824 | Bacteria | 6651 |
| 1138 | Ga0501045_0010576 | 3300049824 | Bacteria | 6464 |
| 1139 | nmdc:mga03683_82989_c1 | 3300050489 | Bacteria | 1387 |
| 1140 | nmdc:mga03n38_2959_c1 | 3300050490 | Bacteria | 5366 |
| 1141 | nmdc:mga03n38_3537_c1 | 3300050490 | Bacteria | 5040 |
| 1142 | nmdc:mga03n38_3664_c1 | 3300050490 | Bacteria | 4969 |
| 1143 | nmdc:mga00v17_122202_c1 | 3300050491 | Bacteria | 1659 |
| 1144 | nmdc:mga00v17_18034_c1 | 3300050491 | Bacteria | 4006 |
| 1145 | nmdc:mga00v17_2135_c1 | 3300050491 | Bacteria | 7772 |
| 1146 | nmdc:mga0yw44_11059_c1 | 3300050492 | Bacteria | 4639 |
| 1147 | nmdc:mga0yw44_171210_c1 | 3300050492 | Bacteria | 1426 |
| 1148 | nmdc:mga0yw44_17603_c1 | 3300050492 | Bacteria | 3893 |
| 1149 | nmdc:mga0yw44_21959_c1 | 3300050492 | Bacteria | 3570 |
| 1150 | nmdc:mga0yw44_70359_c1 | 3300050492 | Bacteria | 2169 |
| 1151 | nmdc:mga0yw44_8315_c1 | 3300050492 | Bacteria | 5159 |
| 1152 | nmdc:mga0yw44_83423_c1 | 3300050492 | Bacteria | 1394 |
| 1153 | nmdc:mga06z11_67020_c1 | 3300050494 | Bacteria | 1889 |
| 1154 | nmdc:mga06z11_97470_c1 | 3300050494 | Bacteria | 1607 |
| 1155 | nmdc:mga04h51_40526_c1 | 3300050495 | Bacteria | 1518 |
| 1156 | nmdc:mga07m45_33103_c1 | 3300050496 | Bacteria | 2869 |
| 1157 | nmdc:mga05p37_27900_c1 | 3300050507 | Bacteria | 6878 |
| 1158 | nmdc:mga05p37_48317_c1 | 3300050507 | Bacteria | 5234 |
| 1159 | nmdc:mga0qj67_179491_c1 | 3300050509 | Bacteria | 1719 |
| 1160 | nmdc:mga06r32_119041_c1 | 3300050510 | Bacteria | 2604 |
| 1161 | nmdc:mga06r32_355300_c1 | 3300050510 | Bacteria | 1450 |
| 1162 | nmdc:mga06r32_54021_c1 | 3300050510 | Bacteria | 3851 |
| 1163 | nmdc:mga08y16_504615_c1 | 3300050511 | Bacteria | 1229 |
| 1164 | nmdc:mga08y16_510493_c1 | 3300050511 | Bacteria | 1220 |
| 1165 | nmdc:mga08y16_65363_c1 | 3300050511 | Bacteria | 3797 |
| 1166 | nmdc:mga0rr50_162149_c1 | 3300050513 | Bacteria | 1815 |
| 1167 | nmdc:mga0a205_318113_c1 | 3300050515 | Bacteria | 1427 |
| 1168 | nmdc:mga0sz30_12253_c1 | 3300050516 | Bacteria | 3333 |
| 1169 | Ga0495601_0005665 | 3300053077 | Bacteria | 7285 |
| 1170 | Ga0495601_0022706 | 3300053077 | Bacteria | 3855 |
| 1171 | Ga0495601_0044081 | 3300053077 | Bacteria | 2804 |
| 1172 | Ga0495612_0012883 | 3300053078 | Bacteria | 3369 |
| 1173 | Ga0495612_0016639 | 3300053078 | Bacteria | 2947 |
| 1174 | Ga0500635_0006237 | 3300053080 | Bacteria | 3174 |
| 1175 | Ga0500635_0058978 | 3300053080 | Bacteria | 1334 |
| 1176 | Ga0495655_0030429 | 3300053083 | Bacteria | 1306 |
| 1177 | Ga0495595_0000437 | 3300053084 | Bacteria | 15807 |
| 1178 | Ga0495595_0037333 | 3300053084 | Bacteria | 2208 |
| 1179 | Ga0495595_0075238 | 3300053084 | Bacteria | 1601 |
| 1180 | Ga0495595_0089325 | 3300053084 | Bacteria | 1477 |
| 1181 | Ga0495619_0001386 | 3300053085 | Bacteria | 15942 |
| 1182 | Ga0495619_0019949 | 3300053085 | Bacteria | 4265 |
| 1183 | Ga0495619_0106067 | 3300053085 | Bacteria | 1916 |
| 1184 | Ga0500578_0000124 | 3300053086 | Bacteria | 92437 |
| 1185 | Ga0500578_0097862 | 3300053086 | Bacteria | 1859 |
| 1186 | Ga0500643_000117 | 3300053087 | Bacteria | 82982 |
| 1187 | Ga0500643_027479 | 3300053087 | Bacteria | 1769 |
| 1188 | Ga0500651_0007987 | 3300053093 | Bacteria | 6192 |
| 1189 | Ga0500651_0036263 | 3300053093 | Bacteria | 3107 |
| 1190 | Ga0500566_0012564 | 3300053094 | Bacteria | 4982 |
| 1191 | Ga0500640_016614 | 3300053095 | Bacteria | 3106 |
| 1192 | Ga0500640_031016 | 3300053095 | Bacteria | 2342 |
| 1193 | Ga0500641_0029521 | 3300053096 | Bacteria | 2149 |
| 1194 | Ga0500641_0107514 | 3300053096 | Bacteria | 1199 |
| 1195 | Ga0500648_086624 | 3300053097 | Bacteria | 1757 |
| 1196 | Ga0500650_0000885 | 3300053098 | Bacteria | 8373 |
| 1197 | Ga0500554_008277 | 3300053102 | Bacteria | 2436 |
| 1198 | Ga0500554_018093 | 3300053102 | Bacteria | 1896 |
| 1199 | Ga0500555_004649 | 3300053103 | Bacteria | 3897 |
| 1200 | Ga0500556_0000019 | 3300053104 | Bacteria | 186017 |
| 1201 | Ga0500556_0004025 | 3300053104 | Bacteria | 4231 |
| 1202 | Ga0500556_0010261 | 3300053104 | Bacteria | 2744 |
| 1203 | Ga0500556_0072231 | 3300053104 | Bacteria | 1291 |
| 1204 | Ga0500557_000143 | 3300053105 | Bacteria | 16681 |
| 1205 | Ga0500562_001270 | 3300053108 | Bacteria | 6232 |
| 1206 | Ga0500569_005216 | 3300053109 | Bacteria | 2782 |
| 1207 | Ga0500572_000955 | 3300053111 | Bacteria | 8762 |
| 1208 | Ga0500572_025605 | 3300053111 | Bacteria | 1601 |
| 1209 | Ga0500592_000579 | 3300053116 | Bacteria | 6028 |
| 1210 | Ga0500592_014465 | 3300053116 | Bacteria | 1264 |
| 1211 | Ga0500594_0000239 | 3300053118 | Bacteria | 13259 |
| 1212 | Ga0500594_0011714 | 3300053118 | Bacteria | 2052 |
| 1213 | Ga0500595_001903 | 3300053119 | Bacteria | 10754 |
| 1214 | Ga0500595_002222 | 3300053119 | Bacteria | 9858 |
| 1215 | Ga0500595_007252 | 3300053119 | Bacteria | 4607 |
| 1216 | Ga0500595_008236 | 3300053119 | Bacteria | 4271 |
| 1217 | Ga0500595_027287 | 3300053119 | Bacteria | 1957 |
| 1218 | Ga0500595_044546 | 3300053119 | Bacteria | 1405 |
| 1219 | Ga0500595_054382 | 3300053119 | Bacteria | 1229 |
| 1220 | Ga0500607_095861 | 3300053121 | Bacteria | 1483 |
| 1221 | Ga0500608_040872 | 3300053122 | Bacteria | 2223 |
| 1222 | Ga0500614_012243 | 3300053123 | Bacteria | 1867 |
| 1223 | Ga0500618_000093 | 3300053125 | Bacteria | 73010 |
| 1224 | Ga0500642_0000048 | 3300053130 | Bacteria | 81787 |
| 1225 | Ga0500642_0000137 | 3300053130 | Bacteria | 32609 |
| 1226 | Ga0500642_0004012 | 3300053130 | Bacteria | 4545 |
| 1227 | Ga0500652_005581 | 3300053131 | Bacteria | 3976 |
| 1228 | Ga0500559_0000060 | 3300053136 | Bacteria | 87673 |
| 1229 | Ga0500559_0001161 | 3300053136 | Bacteria | 15833 |
| 1230 | Ga0500559_0004287 | 3300053136 | Bacteria | 6824 |
| 1231 | Ga0500559_0008025 | 3300053136 | Bacteria | 4649 |
| 1232 | Ga0500559_0013786 | 3300053136 | Bacteria | 3418 |
| 1233 | Ga0500564_000502 | 3300053138 | Bacteria | 11537 |
| 1234 | Ga0500568_0002172 | 3300053139 | Bacteria | 11820 |
| 1235 | Ga0500568_0012112 | 3300053139 | Bacteria | 3976 |
| 1236 | Ga0500568_0019114 | 3300053139 | Bacteria | 2985 |
| 1237 | Ga0500568_0069123 | 3300053139 | Bacteria | 1355 |
| 1238 | Ga0500573_0010850 | 3300053140 | Bacteria | 5089 |
| 1239 | Ga0500573_0200219 | 3300053140 | Bacteria | 1061 |
| 1240 | Ga0500586_005266 | 3300053145 | Bacteria | 3259 |
| 1241 | Ga0500590_069628 | 3300053148 | Bacteria | 1751 |
| 1242 | Ga0500590_084246 | 3300053148 | Bacteria | 1556 |
| 1243 | Ga0500603_002291 | 3300053150 | Bacteria | 4206 |
| 1244 | Ga0500616_0000038 | 3300053153 | Bacteria | 386801 |
| 1245 | Ga0500616_0000059 | 3300053153 | Bacteria | 259741 |
| 1246 | Ga0500616_0025571 | 3300053153 | Bacteria | 3273 |
| 1247 | Ga0500622_0000995 | 3300053156 | Bacteria | 23890 |
| 1248 | Ga0500622_0002106 | 3300053156 | Bacteria | 14828 |
| 1249 | Ga0500622_0004401 | 3300053156 | Bacteria | 8868 |
| 1250 | Ga0500622_0005729 | 3300053156 | Bacteria | 7381 |
| 1251 | Ga0500622_0009444 | 3300053156 | Bacteria | 5396 |
| 1252 | Ga0500622_0051451 | 3300053156 | Bacteria | 2120 |
| 1253 | Ga0500624_006663 | 3300053157 | Bacteria | 1568 |
| 1254 | Ga0500627_0016814 | 3300053158 | Bacteria | 2861 |
| 1255 | Ga0500634_0025972 | 3300053161 | Bacteria | 3189 |
| 1256 | Ga0500638_046986 | 3300053162 | Bacteria | 2091 |
| 1257 | Ga0500639_017206 | 3300053163 | Bacteria | 3813 |
| 1258 | Ga0500636_0001114 | 3300053177 | Bacteria | 14397 |
| 1259 | Ga0500636_0008789 | 3300053177 | Bacteria | 5860 |
| 1260 | Ga0500636_0092519 | 3300053177 | Bacteria | 1730 |
| 1261 | Ga0500636_0101943 | 3300053177 | Bacteria | 1631 |
| 1262 | Ga0500637_0000500 | 3300053178 | Bacteria | 15189 |
| 1263 | Ga0500637_0028532 | 3300053178 | Bacteria | 3088 |
| 1264 | Ga0500576_009372 | 3300053725 | Bacteria | 4296 |
| 1265 | Ga0500611_008909 | 3300053727 | Bacteria | 1570 |
| 1266 | Ga0500625_013646 | 3300053729 | Bacteria | 3738 |
| 1267 | Ga0500645_000484 | 3300053730 | Bacteria | 26930 |
| 1268 | Ga0500609_000477 | 3300053731 | Bacteria | 5968 |
| 1269 | Ga0500609_005115 | 3300053731 | Bacteria | 1795 |
| 1270 | Ga0500596_006542 | 3300053735 | Bacteria | 1964 |
| 1271 | Ga0500596_009396 | 3300053735 | Bacteria | 1527 |
| 1272 | Ga0500601_000813 | 3300053737 | Bacteria | 3879 |
| 1273 | Ga0500601_001894 | 3300053737 | Bacteria | 2246 |
| 1274 | Ga0501084_0012721 | 3300054114 | Bacteria | 6970 |
| 1275 | Ga0501084_0075126 | 3300054114 | Bacteria | 2831 |
| 1276 | Ga0500661_000621 | 3300055283 | Bacteria | 6620 |
| 1277 | Ga0501082_0003420 | 3300060353 | Bacteria | 13858 |
| 1278 | Ga0501082_0018039 | 3300060353 | Bacteria | 6078 |
| 1279 | Ga0501082_0086418 | 3300060353 | Bacteria | 2705 |
| 1280 | Ga0501082_0207213 | 3300060353 | Bacteria | 1706 |
| 1281 | Ga0501082_0238928 | 3300060353 | Bacteria | 1581 |
| 1282 | Ga0466962_0000142 | 3300061719 | Bacteria | 29518 |
| 1283 | 2513700424 | 2513237102 | Bacteria | 7703324 |
| 1284 | 2507505623 | 2507262055 | Bacteria | 8048963 |
| 1285 | 2508539516 | 2508501009 | Bacteria | 7784016 |
| 1286 | 2508695886 | 2508501042 | Bacteria | 8719808 |
| 1287 | 2509079133 | 2508501114 | Bacteria | 7082538 |
| 1288 | 2509150142 | 2508501128 | Bacteria | 8613869 |
| 1289 | 2511121662 | 2510917020 | Bacteria | 5657507 |
| 1290 | 2511401107 | 2511231028 | Bacteria | 8046582 |
| 1291 | 2513628921 | 2513237092 | Bacteria | 8341956 |
| 1292 | 2513642263 | 2513237094 | Bacteria | 8789602 |
| 1293 | 2513652799 | 2513237095 | Bacteria | 8976980 |
| 1294 | 2513661881 | 2513237096 | Bacteria | 8722461 |
| 1295 | 2513694024 | 2513237101 | Bacteria | 7952346 |
| 1296 | 2513718829 | 2513237104 | Bacteria | 10034502 |
| 1297 | 2513862539 | 2513237137 | Bacteria | 9558895 |
| 1298 | 2513876929 | 2513237139 | Bacteria | 8737671 |
| 1299 | 2513890479 | 2513237141 | Bacteria | 8496279 |
| 1300 | 2513919110 | 2513237145 | Bacteria | 8979722 |
| 1301 | 2514016091 | 2513237161 | Bacteria | 8871253 |
| 1302 | 2515624024 | 2515154112 | Bacteria | 8294334 |
| 1303 | 2517105888 | 2517093001 | Bacteria | 9002274 |
| 1304 | 2517888428 | 2517572143 | Bacteria | 9484767 |
| 1305 | 2524440067 | 2524023205 | Bacteria | 8918781 |
| 1306 | 2524468379 | 2524023210 | Bacteria | 9029266 |
| 1307 | 2524535263 | 2524023228 | Bacteria | 10118060 |
| 1308 | 2528852077 | 2528768022 | Bacteria | 10457665 |
| 1309 | 2585147844 | 2582581279 | Bacteria | 4980720 |
| 1310 | 2585151564 | 2582581280 | Bacteria | 5994497 |
| 1311 | 2585195562 | 2582581293 | Bacteria | 5907401 |
| 1312 | 2603861709 | 2602042107 | Bacteria | 6226103 |
| 1313 | 2617353255 | 2617270735 | Bacteria | 9163226 |
| 1314 | 2617377293 | 2617270741 | Bacteria | 8201522 |
| 1315 | 2643749273 | 2643221545 | Bacteria | 5083237 |
| 1316 | 2643781394 | 2643221552 | Bacteria | 5708754 |
| 1317 | 2643922986 | 2643221583 | Bacteria | 5218014 |
| 1318 | 2643929133 | 2643221584 | Bacteria | 5511711 |
| 1319 | 2644508953 | 2643221691 | Bacteria | 5093099 |
| 1320 | 2644728799 | 2643221733 | Bacteria | 5690728 |
| 1321 | 2644734187 | 2643221734 | Bacteria | 5365412 |
| 1322 | 2671123633 | 2667528175 | Bacteria | 7532676 |
| 1323 | 2723849327 | 2721755755 | Bacteria | 8322773 |
| 1324 | 2728752065 | 2728368998 | Bacteria | 8720350 |
| 1325 | 2739792302 | 2739367756 | Bacteria | 4553612 |
| 1326 | 2745077821 | 2744054633 | Bacteria | 8678936 |
| 1327 | 2793065644 | 2791355196 | Bacteria | 7323613 |
| 1328 | 2793065915 | 2791355196 | Bacteria | 7323613 |
| 1329 | 2793067245 | 2791355197 | Bacteria | 8420563 |
| 1330 | 2793077107 | |||
| 1331 | 2805921277 | 2802429603 | Bacteria | 8777136 |
| 1332 | 2818239252 | 2816332527 | Bacteria | 8933356 |
| 1333 | 2819536374 | 2818991435 | Bacteria | 5433759 |
| 1334 | 2819644629 | 2818991454 | Bacteria | 5563326 |
| 1335 | 2824607499 | 2824600985 | Bacteria | 8488197 |
| 1336 | 2824617549 | 2824609381 | Bacteria | 8672835 |
| 1337 | 2824624910 | 2824617872 | Bacteria | 8814715 |
| 1338 | 2824631738 | 2824626560 | Bacteria | 8813858 |
| 1339 | 2824643206 | 2824635225 | Bacteria | 8785348 |
| 1340 | 2824652309 | 2824644064 | Bacteria | 8743947 |
| 1341 | 2824660963 | 2824653114 | Bacteria | 8493680 |
| 1342 | 2824670739 | 2824661429 | Bacteria | 9877870 |
| 1343 | 2824678637 | 2824671348 | Bacteria | 8369588 |
| 1344 | 2824686947 | 2824679649 | Bacteria | 8248951 |
| 1345 | 2824695082 | 2824687955 | Bacteria | 8360029 |
| 1346 | 2824703434 | 2824696289 | Bacteria | 8335049 |
| 1347 | 2824712920 | 2824704595 | Bacteria | 9667483 |
| 1348 | 2824721555 | 2824714736 | Bacteria | 8717648 |
| 1349 | 2824731485 | 2824723954 | Bacteria | 8758240 |
| 1350 | 2824740008 | 2824732956 | Bacteria | 7810675 |
| 1351 | 2824753558 | 2824746037 | Bacteria | 7911610 |
| 1352 | 2824762108 | 2824753945 | Bacteria | 9787441 |
| 1353 | 2824772397 | 2824763712 | Bacteria | 9792355 |
| 1354 | 2824777518 | 2824773399 | Bacteria | 8360218 |
| 1355 | 2838125754 | 2838122688 | Bacteria | 8803140 |
| 1356 | 2841920176 | 2841917233 | Bacteria | 6173500 |
| 1357 | 2841947965 | 2841941048 | Bacteria | 8688029 |
| 1358 | 2841957062 | 2841949485 | Bacteria | 8680857 |
| 1359 | 2841965124 | 2841957949 | Bacteria | 8652217 |
| 1360 | 2841972793 | 2841966195 | Bacteria | 8673214 |
| 1361 | 2841977570 | 2841974524 | Bacteria | 8931498 |
| 1362 | 2841984872 | 2841983080 | Bacteria | 8395090 |
| 1363 | 2842041374 | 2842038055 | Bacteria | 8002051 |
| 1364 | 2842049416 | 2842045827 | Bacteria | 8006841 |
| 1365 | 2844315857 | 2844315083 | Bacteria | 8138177 |
| 1366 | 2847930718 | 2847930680 | Bacteria | 9342022 |
| 1367 | 2847942680 | 2847939898 | Bacteria | 8606328 |
| 1368 | 2849083425 | 2849076700 | Bacteria | 7039503 |
| 1369 | 2857515630 | 2857509624 | Bacteria | 7472071 |
| 1370 | 2857525897 | 2857524615 | Bacteria | 6615449 |
| 1371 | 2874593255 | 2874590934 | Bacteria | 8299676 |
| 1372 | 2874608441 | 2874604998 | Bacteria | 7834745 |
| 1373 | 2874617146 | 2874612657 | Bacteria | 8252029 |
| 1374 | 2874621377 | 2874620515 | Bacteria | 8290088 |
| 1375 | 2874636766 | 2874628541 | Bacteria | 8630250 |
| 1376 | 2874647768 | 2874645413 | Bacteria | 8214782 |
| 1377 | 2876762904 | 2876761206 | Bacteria | 10111113 |
| 1378 | 2876773295 | 2876771140 | Bacteria | 8287509 |
| 1379 | 2876818922 | 2876818435 | Bacteria | 8274608 |
| 1380 | 2879075374 | 2879074833 | Bacteria | 8279565 |
| 1381 | 2879089860 | 2879083081 | Bacteria | 8587928 |
| 1382 | 2879106704 | 2879099564 | Bacteria | 10442239 |
| 1383 | 2879112796 | 2879110137 | Bacteria | 8907982 |
| 1384 | 2879134118 | 2879127579 | Bacteria | 8294491 |
| 1385 | 2879145569 | 2879142872 | Bacteria | 8267021 |
| 1386 | 2881367140 | 2881364244 | Bacteria | 7710352 |
| 1387 | 2881668416 | 2881665667 | Bacteria | 8175609 |
| 1388 | 2885368719 | 2885366525 | Bacteria | 8326213 |
| 1389 | 2885379862 | 2885374607 | Bacteria | 8927485 |
| 1390 | 2885384667 | 2885383462 | Bacteria | 9473874 |
| 1391 | 2885411183 | 2885409591 | Bacteria | 9235467 |
| 1392 | 2888379115 | 2888378607 | Bacteria | 9652610 |
| 1393 | 2888390291 | 2888388044 | Bacteria | 7304136 |
| 1394 | 2888427511 | 2888419890 | Bacteria | 7857137 |
| 1395 | 2889035878 | 2889033259 | Bacteria | 9099371 |
| 1396 | 2891091149 | 2891088606 | Bacteria | 4762464 |
| 1397 | 2893067821 | 2893066018 | Bacteria | 6158120 |
| 1398 | 2903731807 | 2903727486 | Bacteria | 8281579 |
| 1399 | 2903777945 | 2903768456 | Bacteria | 9749579 |
| 1400 | 2904668047 | 2904666416 | Bacteria | 8226587 |
| 1401 | 2904699280 | 2904690495 | Bacteria | 9412302 |
| 1402 | 2904707832 | |||
| 1403 | 2904714178 | 2904711408 | Bacteria | 9771557 |
| 1404 | 2906603666 | 2906602504 | Bacteria | 8295279 |
| 1405 | 2906614209 | |||
| 1406 | 2906633210 | 2906626472 | Bacteria | 8826946 |
| 1407 | 2906638818 | 2906635258 | Bacteria | 8601019 |
| 1408 | 2906648040 | 2906643746 | Bacteria | 8722424 |
| 1409 | 2906660919 | 2906660503 | Bacteria | 8595048 |
| 1410 | 2908746962 | 2908739725 | Bacteria | 8628932 |
| 1411 | 2908758877 | 2908756301 | Bacteria | 8864324 |
| 1412 | 2908775808 | 2908775508 | Bacteria | 8092255 |
| 1413 | 2917703302 | 2917699015 | Bacteria | 7043791 |
| 1414 | 2919074242 | 2919073203 | Bacteria | 6531949 |
| 1415 | 2922364355 | 2922361189 | Bacteria | 7436256 |
| 1416 | 2922369151 | |||
| 1417 | 2922389052 | 2922386360 | Bacteria | 7017218 |
| 1418 | 2922400763 | 2922393267 | Bacteria | 8285685 |
| 1419 | 2922426031 | |||
| 1420 | 2929619005 | 2929615660 | Bacteria | 9193770 |
| 1421 | 2929631082 | 2929624759 | Bacteria | 9339455 |
| 1422 | 2932789047 | 2932784394 | Bacteria | 9704911 |
| 1423 | 2932801322 | 2932794094 | Bacteria | 7915132 |
| 1424 | 2932808835 | 2932801729 | Bacteria | 7987968 |
| 1425 | 2932814316 | 2932809354 | Bacteria | 9135765 |
| 1426 | 2932820442 | 2932818245 | Bacteria | 9955613 |
| 1427 | 2932834474 | 2932828146 | Bacteria | 9745859 |
| 1428 | 2933580285 | 2933577622 | Bacteria | 9116884 |
| 1429 | 2935614679 | 2935608549 | Bacteria | 8203142 |
| 1430 | 2935624457 | 2935616580 | Bacteria | 9032984 |
| 1431 | 2935632451 | 2935630451 | Bacteria | 8169952 |
| 1432 | 2935645847 | 2935638405 | Bacteria | 10015038 |
| 1433 | 2935649069 | 2935648319 | Bacteria | 8801166 |
| 1434 | 2935658159 | 2935656913 | Bacteria | 8965014 |
| 1435 | 2935673414 | 2935665750 | Bacteria | 9571747 |
| 1436 | 2935682591 | 2935675223 | Bacteria | 9928132 |
| 1437 | 2935686795 | 2935684952 | Bacteria | 9590419 |
| 1438 | 2935701525 | 2935694250 | Bacteria | 9291695 |
| 1439 | 2935710500 | 2935703347 | Bacteria | 10242284 |
| 1440 | 2935716483 | 2935713505 | Bacteria | 9608509 |
| 1441 | 2935723392 | 2935722832 | Bacteria | 9608746 |
| 1442 | 2935734948 | 2935732158 | Bacteria | 9706831 |
| 1443 | 2935744261 | 2935741537 | Bacteria | 9707219 |
| 1444 | 2935752761 | 2935750917 | Bacteria | 9590372 |
| 1445 | 2935764692 | 2935760218 | Bacteria | 9817913 |
| 1446 | 2935774671 | 2935769743 | Bacteria | 7878163 |
| 1447 | 2935783758 | 2935777560 | Bacteria | 8077691 |
| 1448 | 2935789814 | 2935785616 | Bacteria | 7962367 |
| 1449 | 2935797818 | 2935793552 | Bacteria | 8012592 |
| 1450 | 2935806197 | 2935801545 | Bacteria | 9301974 |
| 1451 | 2935816969 | 2935810662 | Bacteria | 9401221 |
| 1452 | 2935826280 | 2935819856 | Bacteria | 8261050 |
| 1453 | 2935835252 | 2935827899 | Bacteria | 10038562 |
| 1454 | 2935841366 | 2935837841 | Bacteria | 9454360 |
| 1455 | 2935853776 | 2935847175 | Bacteria | 8228321 |
| 1456 | 2935863066 | 2935855204 | Bacteria | 9035059 |
| 1457 | 2935871876 | 2935864058 | Bacteria | 9784707 |
| 1458 | 2935882233 | 2935873716 | Bacteria | 9632195 |
| 1459 | 2935883294 | 2935883170 | Bacteria | 7964738 |
| 1460 | 2935910997 | 2935908558 | Bacteria | 8568796 |
| 1461 | 2935924158 | 2935916978 | Bacteria | 9113783 |
| 1462 | 2935932789 | 2935926038 | Bacteria | 8601059 |
| 1463 | 2935937352 | 2935934488 | Bacteria | 8602579 |
| 1464 | 2935949447 | 2935942939 | Bacteria | 8599779 |
| 1465 | 2935958154 | 2935951376 | Bacteria | 8602333 |
| 1466 | 2935967245 | 2935959822 | Bacteria | 7869783 |
| 1467 | 2935971191 | 2935967501 | Bacteria | 8603075 |
| 1468 | 2935982216 | 2935975950 | Bacteria | 8347125 |
| 1469 | 2935985354 | 2935984226 | Bacteria | 8302647 |
| 1470 | 2936000196 | 2935992306 | Bacteria | 9802711 |
| 1471 | 2936010110 | 2936002035 | Bacteria | 9362176 |
| 1472 | 2936012378 | 2936011229 | Bacteria | 8801034 |
| 1473 | 2936020541 | 2936019824 | Bacteria | 8804134 |
| 1474 | 2936029671 | 2936028420 | Bacteria | 8965941 |
| 1475 | 2936043960 | 2936037263 | Bacteria | 9446081 |
| 1476 | 2936051864 | 2936046547 | Bacteria | 8903709 |
| 1477 | 2936056882 | 2936055302 | Bacteria | 8785755 |
| 1478 | 2940558674 | 2940556831 | Bacteria | 9590747 |
| 1479 | 2941508886 | 2941507105 | Bacteria | 8166816 |
| 1480 | 2941516715 | 2941515067 | Bacteria | 8166720 |
| 1481 | 2941524268 | 2941523033 | Bacteria | 8169134 |
| 1482 | 2941535707 | 2941531003 | Bacteria | 7653939 |
| 1483 | 2941543592 | 2941538514 | Bacteria | 9402094 |
| 1484 | 3005486376 | 3005483717 | Bacteria | 7877331 |
| 1485 | 3005506284 | 3005506211 | Bacteria | 6943378 |
| 1486 | 3005589064 | 3005587118 | Bacteria | 7794411 |
| 1487 | 3005595441 | 3005594810 | Bacteria | 8716512 |
| 1488 | 3005711401 | 3005710791 | Bacteria | 7622528 |
| 1489 | 3005718676 | 3005718088 | Bacteria | 8283608 |
| 1490 | 8006931209 | 8006926726 | Bacteria | 6749210 |
| 1491 | 8006936731 | 8006933436 | Bacteria | 10410654 |
| 1492 | 8006967862 | 8006964411 | Bacteria | 8966052 |
| 1493 | 8006976701 | 8006973647 | Bacteria | 10679141 |
| 1494 | 8006992458 | 8006984368 | Bacteria | 9651211 |
| 1495 | 8006998528 | 8006994254 | Bacteria | 8309700 |
| 1496 | 8016517755 | 8016511872 | Bacteria | 9921665 |
| 1497 | 8016525810 | 8016522445 | Bacteria | 8156687 |
| 1498 | 8016539409 | 8016530956 | Bacteria | 8155261 |
| 1499 | 8016558013 | 8016557553 | Bacteria | 8154380 |
| 1500 | 8016569104 | 8016566248 | Bacteria | 8158151 |
| 1501 | 8016581739 | 8016575299 | Bacteria | 8154085 |
| 1502 | 8016585928 | 8016583857 | Bacteria | 10421953 |
| 1503 | 8016596027 | 8016595262 | Bacteria | 8149947 |
| 1504 | 8016606902 | 8016603502 | Bacteria | 8731218 |
| 1505 | 8016618810 | 8016613128 | Bacteria | 8794220 |
| 1506 | 8016622726 | 8016622563 | Bacteria | 7999408 |
| 1507 | 8016635220 | 8016630954 | Bacteria | 9217207 |
| 1508 | 8017058875 | 8017057580 | Bacteria | 10023680 |
| 1509 | 8019540891 | 8019538911 | Bacteria | 7872763 |
| 1510 | 8019549723 | 8019547302 | Bacteria | 7996444 |
| 1511 | 8019561968 | 8019555841 | Bacteria | 9642137 |
| 1512 | 8019576775 | 8019576017 | Bacteria | 10049540 |
| 1513 | 8019594832 | 8019586578 | Bacteria | 10212056 |
| 1514 | 8019606908 | 8019597564 | Bacteria | 10041141 |
| 1515 | 8019611600 | 8019608314 | Bacteria | 10042931 |
| 1516 | 8019623365 | 8019619141 | Bacteria | 9218857 |
| 1517 | 8019629729 | 8019629233 | Bacteria | 8687553 |
| 1518 | 8019640887 | 8019638758 | Bacteria | 9062356 |
| 1519 | 8019666573 | 8019659431 | Bacteria | 8577854 |
| 1520 | 8019676267 | 8019668869 | Bacteria | 8791617 |
| 1521 | 8019679717 | 8019678201 | Bacteria | 8863603 |
| 1522 | 8019695783 | 8019687851 | Bacteria | 8712826 |
| 1523 | 8055742854 | 8055742211 | Bacteria | 9226248 |
| 1524 | 8056676293 | 8056673599 | Bacteria | 7871253 |
| 1525 | 8056683210 | 8056681323 | Bacteria | 8472857 |
| 1526 | 8056693994 | 8056689827 | Bacteria | 6712655 |
| 1527 | 8056970847 | 8056967851 | Bacteria | 9038162 |
| 1528 | JGI24740J21852_10009104 | |||
| 1529 | JGI24739J22299_10051274 | |||
| 1530 | JGI25151J46595_10000339 | |||
| 1531 | JGI25151J46595_10000511 | |||
| 1532 | JGI25406J46586_10000037 | |||
| 1533 | JGI25406J46586_10011025 | |||
| 1534 | JGI25165J46597_1010949 | |||
| 1535 | JGI25165J46597_1011014 | |||
| 1536 | JGI25153J46596_10017912 | |||
| 1537 | JGI25160J50197_1001469 | |||
| 1538 | JGI25160J50197_1006549 | |||
| 1539 | JGI25161J50226_1011108 | |||
| 1540 | JGI25404J52841_10009407 | |||
| 1541 | Ga0055526_1003688 | |||
| 1542 | Ga0055526_1017843 | |||
| 1543 | Ga0055526_1019303 | |||
| 1544 | Ga0055537_1003689 | |||
| 1545 | Ga0055528_1012512 | |||
| 1546 | Ga0055531_10001877 | |||
| 1547 | Ga0055543_1020848 | |||
| 1548 | Ga0065165_1001029 | |||
| 1549 | Ga0065165_1001154 | |||
| 1550 | Ga0065165_1002192 | |||
| 1551 | Ga0065165_1036438 | |||
| 1552 | Ga0070658_10013187 | |||
| 1553 | Ga0070658_10084612 | |||
| 1554 | Ga0070683_100030576 | |||
| 1555 | Ga0070683_100105357 | |||
| 1556 | Ga0070683_100209347 | |||
| 1557 | Ga0070670_100012038 | |||
| 1558 | Ga0068869_100117711 | |||
| 1559 | Ga0070680_100010838 | |||
| 1560 | Ga0070680_100054220 | |||
| 1561 | Ga0070680_100159319 | |||
| 1562 | Ga0070682_100142269 | |||
| 1563 | Ga0070682_100155993 | |||
| 1564 | Ga0068868_100184941 | |||
| 1565 | Ga0068868_100285209 | |||
| 1566 | Ga0070660_100045764 | |||
| 1567 | Ga0070660_100126166 | |||
| 1568 | Ga0070660_100305969 | |||
| 1569 | Ga0070689_100092651 | |||
| 1570 | Ga0070689_100107729 | |||
| 1571 | Ga0070691_10148549 | |||
| 1572 | Ga0070687_100020363 | |||
| 1573 | Ga0070661_100021771 | |||
| 1574 | Ga0070661_100053350 | |||
| 1575 | Ga0070661_100103174 | |||
| 1576 | Ga0070669_100019282 | |||
| 1577 | Ga0070669_100114802 | |||
| 1578 | Ga0070671_100198882 | |||
| 1579 | Ga0070674_100014497 | |||
| 1580 | Ga0070674_100151333 | |||
| 1581 | Ga0070688_100069361 | |||
| 1582 | Ga0070688_100127480 | |||
| 1583 | Ga0070659_100189375 | |||
| 1584 | Ga0070667_100366666 | |||
| 1585 | Ga0070709_10004068 | |||
| 1586 | Ga0070709_10007215 | |||
| 1587 | Ga0070709_10167440 | |||
| 1588 | Ga0070714_100002014 | |||
| 1589 | Ga0070714_100101837 | |||
| 1590 | Ga0070713_100004390 | |||
| 1591 | Ga0070713_100022427 | |||
| 1592 | Ga0070713_100358163 | |||
| 1593 | Ga0070710_10001042 | |||
| 1594 | Ga0070710_10001151 | |||
| 1595 | Ga0070710_10003221 | |||
| 1596 | Ga0070710_10096486 | |||
| 1597 | Ga0070701_10073112 | |||
| 1598 | Ga0070711_100006813 | |||
| 1599 | Ga0070711_100021205 | |||
| 1600 | Ga0070711_100033555 | |||
| 1601 | Ga0070711_100287129 | |||
| 1602 | Ga0070700_100030000 | |||
| 1603 | Ga0070663_100011844 | |||
| 1604 | Ga0070663_100018623 | |||
| 1605 | Ga0070663_100079114 | |||
| 1606 | Ga0070663_100086319 | |||
| 1607 | Ga0070663_100096317 | |||
| 1608 | Ga0070663_100101611 | |||
| 1609 | Ga0070678_100199754 | |||
| 1610 | Ga0070662_100007653 | |||
| 1611 | Ga0070662_100441925 | |||
| 1612 | Ga0070681_10005467 | |||
| 1613 | Ga0070681_10005807 | |||
| 1614 | Ga0070681_10090767 | |||
| 1615 | Ga0068867_100018925 | |||
| 1616 | Ga0068867_100024373 | |||
| 1617 | Ga0070685_10008823 | |||
| 1618 | Ga0070698_100149838 | |||
| 1619 | Ga0070679_100167416 | |||
| 1620 | Ga0070679_100204651 | |||
| 1621 | Ga0070684_100010049 | |||
| 1622 | Ga0070684_100036442 | |||
| 1623 | Ga0070684_100105675 | |||
| 1624 | Ga0068853_100000394 | |||
| 1625 | Ga0068853_100037399 | |||
| 1626 | Ga0068853_100088582 | |||
| 1627 | Ga0068853_100247886 | |||
| 1628 | Ga0068853_100321887 | |||
| 1629 | Ga0070672_100035524 | |||
| 1630 | Ga0070672_100118458 | |||
| 1631 | Ga0070672_100165647 | |||
| 1632 | Ga0070686_100026130 | |||
| 1633 | Ga0070665_100015225 | |||
| 1634 | Ga0070665_100026195 | |||
| 1635 | Ga0070665_100036826 | |||
| 1636 | Ga0070665_100057997 | |||
| 1637 | Ga0070665_100067534 | |||
| 1638 | Ga0070665_100107799 | |||
| 1639 | Ga0070665_100161918 | |||
| 1640 | Ga0070665_100202518 | |||
| 1641 | Ga0068855_100160160 | |||
| 1642 | Ga0068855_100160864 | |||
| 1643 | Ga0068855_100200378 | |||
| 1644 | Ga0068855_100212068 | |||
| 1645 | Ga0068855_100232792 | |||
| 1646 | Ga0068855_100237584 | |||
| 1647 | Ga0070664_100132579 | |||
| 1648 | Ga0070664_100193038 | |||
| 1649 | Ga0068857_100023868 | |||
| 1650 | Ga0068857_100061244 | |||
| 1651 | Ga0068857_100093922 | |||
| 1652 | Ga0068857_100113188 | |||
| 1653 | Ga0068857_100188973 | |||
| 1654 | Ga0068857_100271465 | |||
| 1655 | Ga0068857_100285121 | |||
| 1656 | Ga0068854_100011204 | |||
| 1657 | Ga0068856_100000905 | |||
| 1658 | Ga0068856_100002885 | |||
| 1659 | Ga0068856_100164263 | |||
| 1660 | Ga0068856_100184861 | |||
| 1661 | Ga0068856_100237104 | |||
| 1662 | Ga0068856_100293010 | |||
| 1663 | Ga0068856_100494579 | |||
| 1664 | Ga0070702_100022702 | |||
| 1665 | Ga0070702_100121076 | |||
| 1666 | Ga0068852_100014713 | |||
| 1667 | Ga0068852_100236269 | |||
| 1668 | Ga0068859_100085781 | |||
| 1669 | Ga0068859_100162077 | |||
| 1670 | Ga0068859_100307388 | |||
| 1671 | Ga0068864_100155422 | |||
| 1672 | Ga0068864_100156373 | |||
| 1673 | Ga0068864_100243019 | |||
| 1674 | Ga0068861_100192402 | |||
| 1675 | Ga0068851_10004128 | |||
| 1676 | Ga0068851_10023841 | |||
| 1677 | Ga0068870_10018341 | |||
| 1678 | Ga0068863_100168195 | |||
| 1679 | Ga0068863_100183208 | |||
| 1680 | Ga0068863_100198187 | |||
| 1681 | Ga0068858_100117270 | |||
| 1682 | Ga0068858_100147996 | |||
| 1683 | Ga0068860_100000840 | |||
| 1684 | Ga0068860_100013212 | |||
| 1685 | Ga0068860_100023212 | |||
| 1686 | Ga0068860_100190751 | |||
| 1687 | Ga0068862_100174421 | |||
| 1688 | Ga0068862_100254431 | |||
| 1689 | Ga0081455_10022044 | |||
| 1690 | Ga0081455_10032010 | |||
| 1691 | Ga0081455_10035974 | |||
| 1692 | Ga0081455_10043817 | |||
| 1693 | Ga0081455_10049455 | |||
| 1694 | Ga0081538_10035922 | |||
| 1695 | Ga0081540_1003518 | |||
| 1696 | Ga0081540_1007804 | |||
| 1697 | Ga0081540_1018183 | |||
| 1698 | Ga0081540_1034156 | |||
| 1699 | Ga0081540_1073564 | |||
| 1700 | Ga0081539_10000129 | |||
| 1701 | Ga0081539_10001014 | |||
| 1702 | Ga0081539_10013531 | |||
| 1703 | Ga0070717_10001143 | |||
| 1704 | Ga0070717_10008317 | |||
| 1705 | Ga0070717_10208823 | |||
| 1706 | Ga0075365_10010667 | |||
| 1707 | Ga0075365_10023623 | |||
| 1708 | Ga0075365_10184713 | |||
| 1709 | Ga0075365_10187110 | |||
| 1710 | Ga0075363_100000174 | |||
| 1711 | Ga0075363_100016650 | |||
| 1712 | Ga0075363_100239604 | |||
| 1713 | Ga0075364_10000925 | |||
| 1714 | Ga0075364_10104086 | |||
| 1715 | Ga0075364_10148103 | |||
| 1716 | Ga0070715_10004589 | |||
| 1717 | Ga0070716_100000855 | |||
| 1718 | Ga0070716_100001543 | |||
| 1719 | Ga0070716_100140567 | |||
| 1720 | Ga0070716_100170752 | |||
| 1721 | Ga0070712_100002401 | |||
| 1722 | Ga0070712_100014160 | |||
| 1723 | Ga0070712_100023032 | |||
| 1724 | Ga0070712_100027911 | |||
| 1725 | Ga0070712_100231121 | |||
| 1726 | Ga0075362_10065646 | |||
| 1727 | Ga0075367_10032163 | |||
| 1728 | Ga0075367_10148236 | |||
| 1729 | Ga0075369_10026154 | |||
| 1730 | Ga0097621_100123307 | |||
| 1731 | Ga0097621_100124709 | |||
| 1732 | Ga0075370_10105155 | |||
| 1733 | Ga0075370_10164575 | |||
| 1734 | Ga0068871_100062766 | |||
| 1735 | Ga0075428_100017893 | |||
| 1736 | Ga0075428_100060675 | |||
| 1737 | Ga0075428_100087121 | |||
| 1738 | Ga0075430_100076366 | |||
| 1739 | Ga0075430_100103191 | |||
| 1740 | Ga0075431_100064819 | |||
| 1741 | Ga0075431_100074655 | |||
| 1742 | Ga0075431_100182975 | |||
| 1743 | Ga0075433_10415822 | |||
| 1744 | Ga0075434_100073828 | |||
| 1745 | Ga0068865_100057395 | |||
| 1746 | Ga0068865_100066160 | |||
| 1747 | Ga0097620_100085777 | |||
| 1748 | Ga0097620_100162075 | |||
| 1749 | Ga0097620_100307383 | |||
| 1750 | Ga0099824_1005437 | |||
| 1751 | Ga0099824_1019303 | |||
| 1752 | Ga0099823_1021543 | |||
| 1753 | Ga0099794_10092105 | |||
| 1754 | Ga0105240_10003827 | |||
| 1755 | Ga0105240_10019441 | |||
| 1756 | Ga0105240_10341685 | |||
| 1757 | Ga0111539_10076597 | |||
| 1758 | Ga0111539_10241498 | |||
| 1759 | Ga0105245_10154763 | |||
| 1760 | Ga0105245_10237695 | |||
| 1761 | Ga0105245_10249088 | |||
| 1762 | Ga0105247_10011850 | |||
| 1763 | Ga0105247_10045923 | |||
| 1764 | Ga0114129_10005063 | |||
| 1765 | Ga0114129_10098068 | |||
| 1766 | Ga0114129_10294007 | |||
| 1767 | Ga0114129_10526533 | |||
| 1768 | Ga0105243_10057159 | |||
| 1769 | Ga0105243_10140789 | |||
| 1770 | Ga0105241_10000556 | |||
| 1771 | Ga0105241_10044147 | |||
| 1772 | Ga0105241_10061791 | |||
| 1773 | Ga0105241_10135187 | |||
| 1774 | Ga0105241_10413717 | |||
| 1775 | Ga0105248_10058261 | |||
| 1776 | Ga0105248_10141182 | |||
| 1777 | Ga0105248_10272296 | |||
| 1778 | Ga0105248_10755432 | |||
| 1779 | Ga0105237_10017741 | |||
| 1780 | Ga0105237_10026514 | |||
| 1781 | Ga0105237_10059686 | |||
| 1782 | Ga0105237_10073147 | |||
| 1783 | Ga0105237_10159141 | |||
| 1784 | Ga0105238_10001118 | |||
| 1785 | Ga0105238_10344110 | |||
| 1786 | Ga0105239_10003377 | |||
| 1787 | Ga0105239_10010894 | |||
| 1788 | Ga0105239_10034448 | |||
| 1789 | Ga0105239_10059927 | |||
| 1790 | Ga0105239_10152353 | |||
| 1791 | Ga0105239_10189763 | |||
| 1792 | Ga0105239_10199396 | |||
| 1793 | Ga0105239_10349306 | |||
| 1794 | Ga0105246_10070789 | |||
| 1795 | Ga0157373_10020152 | |||
| 1796 | Ga0157373_10335880 | |||
| 1797 | Ga0157370_10061898 | |||
| 1798 | Ga0157370_10073237 | |||
| 1799 | Ga0157370_10133128 | |||
| 1800 | Ga0157370_10390335 | |||
| 1801 | Ga0157369_10074086 | |||
| 1802 | Ga0157369_10111585 | |||
| 1803 | Ga0171462_1024 | |||
| 1804 | Ga0157374_10025168 | |||
| 1805 | Ga0157374_10068395 | |||
| 1806 | Ga0157374_10251918 | |||
| 1807 | Ga0157374_10384031 | |||
| 1808 | Ga0157378_10048834 | |||
| 1809 | Ga0163162_10025657 | |||
| 1810 | Ga0163162_10308733 | |||
| 1811 | Ga0157375_10296004 | |||
| 1812 | Ga0157380_10180227 | |||
| 1813 | Ga0157377_10020563 | |||
| 1814 | Ga0157379_10158582 | |||
| 1815 | Ga0157376_10245231 | |||
| 1816 | Ga0157376_10247854 | |||
| 1817 | Ga0157376_10268446 | |||
| 1818 | Ga0163161_10161517 | |||
| 1819 | Ga0214544_1000087 | |||
| 1820 | Ga0214542_1000018 | |||
| 1821 | Ga0214545_1000009 | |||
| 1822 | Ga0214543_1000037 | |||
| 1823 | Ga0213873_10017573 | |||
| 1824 | Ga0213872_10029426 | |||
| 1825 | Ga0213876_10000506 | |||
| 1826 | Ga0213876_10085240 | |||
| 1827 | Ga0213871_10014861 | |||
| 1828 | Ga0209563_102656 | |||
| 1829 | Ga0209677_100279 | |||
| 1830 | Ga0209677_101823 | |||
| 1831 | Ga0209148_1000743 | |||
| 1832 | Ga0209233_1002530 | |||
| 1833 | Ga0209233_1020556 | |||
| 1834 | Ga0209565_1000234 | |||
| 1835 | Ga0209673_1001141 | |||
| 1836 | Ga0209673_1016587 | |||
| 1837 | Ga0209675_1005480 | |||
| 1838 | Ga0209025_1000017 | |||
| 1839 | Ga0209564_1000044 | |||
| 1840 | Ga0209564_1001508 | |||
| 1841 | Ga0209564_1001652 | |||
| 1842 | Ga0209758_1000030 | |||
| 1843 | Ga0209758_1000884 | |||
| 1844 | Ga0209758_1000949 | |||
| 1845 | Ga0209758_1001021 | |||
| 1846 | Ga0209758_1003078 | |||
| 1847 | Ga0209758_1003950 | |||
| 1848 | Ga0209758_1004035 | |||
| 1849 | Ga0209758_1013339 | |||
| 1850 | Ga0209758_1031502 | |||
| 1851 | Ga0209256_1001055 | |||
| 1852 | Ga0209256_1005633 | |||
| 1853 | Ga0207426_1002551 | |||
| 1854 | Ga0207426_1008813 | |||
| 1855 | Ga0209257_1000246 | |||
| 1856 | Ga0209257_1001419 | |||
| 1857 | Ga0207656_10000874 | |||
| 1858 | Ga0207656_10025611 | |||
| 1859 | Ga0207653_10010152 | |||
| 1860 | Ga0207692_10015708 | |||
| 1861 | Ga0207692_10019740 | |||
| 1862 | Ga0207692_10053400 | |||
| 1863 | Ga0207710_10024653 | |||
| 1864 | Ga0207688_10003085 | |||
| 1865 | Ga0207688_10054536 | |||
| 1866 | Ga0207647_10001617 | |||
| 1867 | Ga0207647_10009026 | |||
| 1868 | Ga0207647_10055203 | |||
| 1869 | Ga0207685_10004594 | |||
| 1870 | Ga0207699_10000614 | |||
| 1871 | Ga0207699_10012377 | |||
| 1872 | Ga0207699_10013219 | |||
| 1873 | Ga0207699_10015252 | |||
| 1874 | Ga0207645_10004656 | |||
| 1875 | Ga0207643_10024474 | |||
| 1876 | Ga0207643_10211894 | |||
| 1877 | Ga0207705_10033296 | |||
| 1878 | Ga0207705_10088600 | |||
| 1879 | Ga0207705_10091227 | |||
| 1880 | Ga0207654_10029065 | |||
| 1881 | Ga0207654_10030270 | |||
| 1882 | Ga0207654_10054556 | |||
| 1883 | Ga0207707_10000507 | |||
| 1884 | Ga0207707_10004195 | |||
| 1885 | Ga0207707_10051011 | |||
| 1886 | Ga0207695_10000059 | |||
| 1887 | Ga0207695_10000366 | |||
| 1888 | Ga0207695_10152138 | |||
| 1889 | Ga0207695_10167673 | |||
| 1890 | Ga0207671_10012190 | |||
| 1891 | Ga0207671_10049183 | |||
| 1892 | Ga0207671_10058501 | |||
| 1893 | Ga0207671_10091293 | |||
| 1894 | Ga0207671_10116613 | |||
| 1895 | Ga0207671_10146678 | |||
| 1896 | Ga0207693_10000073 | |||
| 1897 | Ga0207693_10006707 | |||
| 1898 | Ga0207693_10008050 | |||
| 1899 | Ga0207693_10203660 | |||
| 1900 | Ga0207663_10003754 | |||
| 1901 | Ga0207663_10102911 | |||
| 1902 | Ga0207660_10016060 | |||
| 1903 | Ga0207660_10033087 | |||
| 1904 | Ga0207662_10005397 | |||
| 1905 | Ga0207657_10005397 | |||
| 1906 | Ga0207657_10114625 | |||
| 1907 | Ga0207657_10130648 | |||
| 1908 | Ga0207657_10191881 | |||
| 1909 | Ga0207657_10196434 | |||
| 1910 | Ga0207649_10021159 | |||
| 1911 | Ga0207649_10078684 | |||
| 1912 | Ga0207652_10004176 | |||
| 1913 | Ga0207681_10196596 | |||
| 1914 | Ga0207694_10001314 | |||
| 1915 | Ga0207650_10032958 | |||
| 1916 | Ga0207650_10351681 | |||
| 1917 | Ga0207687_10019263 | |||
| 1918 | Ga0207687_10136956 | |||
| 1919 | Ga0207700_10018518 | |||
| 1920 | Ga0207700_10044222 | |||
| 1921 | Ga0207700_10049231 | |||
| 1922 | Ga0207700_10051688 | |||
| 1923 | Ga0207700_10083105 | |||
| 1924 | Ga0207700_10162917 | |||
| 1925 | Ga0207700_10274425 | |||
| 1926 | Ga0207664_10029373 | |||
| 1927 | Ga0207664_10060869 | |||
| 1928 | Ga0207664_10092204 | |||
| 1929 | Ga0207664_10182671 | |||
| 1930 | Ga0207664_10261712 | |||
| 1931 | Ga0207706_10007519 | |||
| 1932 | Ga0207706_10025021 | |||
| 1933 | Ga0207706_10064020 | |||
| 1934 | Ga0207706_10234414 | |||
| 1935 | Ga0207709_10151369 | |||
| 1936 | Ga0207665_10000629 | |||
| 1937 | Ga0207665_10029050 | |||
| 1938 | Ga0207665_10110878 | |||
| 1939 | Ga0207691_10058700 | |||
| 1940 | Ga0207691_10381644 | |||
| 1941 | Ga0207711_10073672 | |||
| 1942 | Ga0207711_10087064 | |||
| 1943 | Ga0207711_10452457 | |||
| 1944 | Ga0207689_10008326 | |||
| 1945 | Ga0207689_10010026 | |||
| 1946 | Ga0207661_10067769 | |||
| 1947 | Ga0207661_10077070 | |||
| 1948 | Ga0207661_10342179 | |||
| 1949 | Ga0207679_10063418 | |||
| 1950 | Ga0207667_10002298 | |||
| 1951 | Ga0207667_10013554 | |||
| 1952 | Ga0207667_10030667 | |||
| 1953 | Ga0207667_10137864 | |||
| 1954 | Ga0207667_10155155 | |||
| 1955 | Ga0207667_10234286 | |||
| 1956 | Ga0207712_10003482 | |||
| 1957 | Ga0207712_10094761 | |||
| 1958 | Ga0207668_10018573 | |||
| 1959 | Ga0207640_10005225 | |||
| 1960 | Ga0207640_10007537 | |||
| 1961 | Ga0207640_10015748 | |||
| 1962 | Ga0207658_10062745 | |||
| 1963 | Ga0207658_10191381 | |||
| 1964 | Ga0207658_10207632 | |||
| 1965 | Ga0207677_10006929 | |||
| 1966 | Ga0207677_10103142 | |||
| 1967 | Ga0207677_10173295 | |||
| 1968 | Ga0207703_10051866 | |||
| 1969 | Ga0207703_10208547 | |||
| 1970 | Ga0207703_10347467 | |||
| 1971 | Ga0207639_10018749 | |||
| 1972 | Ga0207639_10067837 | |||
| 1973 | Ga0207639_10258180 | |||
| 1974 | Ga0207639_10393497 | |||
| 1975 | Ga0207678_10014114 | |||
| 1976 | Ga0207678_10021891 | |||
| 1977 | Ga0207678_10024742 | |||
| 1978 | Ga0207678_10050636 | |||
| 1979 | Ga0207678_10067301 | |||
| 1980 | Ga0207678_10070754 | |||
| 1981 | Ga0207678_10286285 | |||
| 1982 | Ga0207708_10000628 | |||
| 1983 | Ga0207708_10045582 | |||
| 1984 | Ga0207708_10217563 | |||
| 1985 | Ga0207702_10000090 | |||
| 1986 | Ga0207702_10001808 | |||
| 1987 | Ga0207702_10019738 | |||
| 1988 | Ga0207702_10323527 | |||
| 1989 | Ga0207641_10332373 | |||
| 1990 | Ga0207648_10032162 | |||
| 1991 | Ga0207648_10059696 | |||
| 1992 | Ga0207648_10217876 | |||
| 1993 | Ga0207648_10350338 | |||
| 1994 | Ga0207676_10114012 | |||
| 1995 | Ga0207674_10003131 | |||
| 1996 | Ga0207674_10010715 | |||
| 1997 | Ga0207674_10025881 | |||
| 1998 | Ga0207674_10053308 | |||
| 1999 | Ga0207674_10108340 | |||
| 2000 | Ga0207674_10129512 | |||
| 2001 | Ga0207675_100038377 | |||
| 2002 | Ga0207675_100241620 | |||
| 2003 | Ga0207675_100276403 | |||
| 2004 | Ga0207683_10060969 | |||
| 2005 | Ga0207683_10157970 | |||
| 2006 | Ga0207683_10211137 | |||
| 2007 | Ga0207683_10433859 | |||
| 2008 | Ga0207698_10005567 | |||
| 2009 | Ga0209389_1000300 | |||
| 2010 | Ga0209389_1000600 | |||
| 2011 | Ga0209589_1000026 | |||
| 2012 | Ga0209589_1000103 | |||
| 2013 | Ga0209489_100046 | |||
| 2014 | Ga0209489_100304 | |||
| 2015 | Ga0209489_105428 | |||
| 2016 | Ga0209700_100047 | |||
| 2017 | Ga0209700_104718 | |||
| 2018 | Ga0209588_1047760 | |||
| 2019 | Ga0207428_10232932 | |||
| 2020 | Ga0268266_10002806 | |||
| 2021 | Ga0268266_10017176 | |||
| 2022 | Ga0268266_10047899 | |||
| 2023 | Ga0268266_10085822 | |||
| 2024 | Ga0268266_10190731 | |||
| 2025 | Ga0268266_10309692 | |||
| 2026 | Ga0268265_10071041 | |||
| 2027 | Ga0268265_10141454 | |||
| 2028 | Ga0268264_10000050 | |||
| 2029 | Ga0268264_10068650 | |||
| 2030 | Ga0268264_10116325 | |||
| 2031 | Ga0265336_10007697 | |||
| 2032 | Ga0307517_10001290 | |||
| 2033 | Ga0307515_10021936 | |||
| 2034 | Ga0307515_10054429 | |||
| 2035 | Ga0307515_10124283 | |||
| 2036 | Ga0307515_10144547 | |||
| 2037 | Ga0265338_10000621 | |||
| 2038 | Ga0307511_10033707 | |||
| 2039 | Ga0265330_10017512 | |||
| 2040 | Ga0265330_10035491 | |||
| 2041 | Ga0265332_10017880 | |||
| 2042 | Ga0265328_10002266 | |||
| 2043 | Ga0265329_10039751 | |||
| 2044 | Ga0265340_10017259 | |||
| 2045 | Ga0265340_10026191 | |||
| 2046 | Ga0265339_10019152 | |||
| 2047 | Ga0265339_10053462 | |||
| 2048 | Ga0265331_10002340 | |||
| 2049 | Ga0265316_10023990 | |||
| 2050 | Ga0307509_10052922 | |||
| 2051 | Ga0307509_10062012 | |||
| 2052 | Ga0307509_10066790 | |||
| 2053 | Ga0307509_10188611 | |||
| 2054 | Ga0307408_100029075 | |||
| 2055 | Ga0307508_10000005 | |||
| 2056 | Ga0307508_10039337 | |||
| 2057 | Ga0265314_10004999 | |||
| 2058 | Ga0265342_10006002 | |||
| 2059 | Ga0265342_10071404 | |||
| 2060 | Ga0307516_10018977 | |||
| 2061 | Ga0307516_10163452 | |||
| 2062 | Ga0307405_10125334 | |||
| 2063 | Ga0307406_10293655 | |||
| 2064 | Ga0307409_100111075 | |||
| 2065 | Ga0307411_10065175 | |||
| 2066 | Ga0307415_100035640 | |||
| 2067 | Ga0307415_100114114 | |||
| 2068 | Ga0307415_100158925 | |||
| 2069 | Ga0307507_10028702 | |||
| 2070 | Ga0307510_10017519 | |||
| 2071 | Ga0307510_10109050 | |||
| 2072 | Ga0307510_10129657 | |||
| 2073 | Ga0307510_10184021 | |||
| 2074 | Ga0315911_1000035 | |||
| 2075 | Ga0373926_0013704 | |||
| 2076 | Ga0373934_0006345 | |||
| 2077 | Ga0373934_0021064 | |||
| 2078 | Ga0373923_0000525 | |||
| 2079 | Ga0373923_0020966 | |||
| 2080 | Ga0373923_0065620 | |||
| 2081 | Ga0373936_0003270 | |||
| 2082 | Ga0373936_0023654 | |||
| 2083 | Ga0373945_0015899 | |||
| 2084 | Ga0373953_0000204 | |||
| 2085 | Ga0373953_0018955 | |||
| 2086 | Ga0373953_0080581 | |||
| 2087 | Ga0373954_0001865 | |||
| 2088 | Ga0373954_0011302 | |||
| 2089 | Ga0373954_0015630 | |||
| 2090 | Ga0373956_0002489 | |||
| 2091 | Ga0373957_0000424 | |||
| 2092 | Ga0373957_0000593 | |||
| 2093 | Ga0373943_0021096 | |||
| 2094 | Ga0373943_0021894 | |||
| 2095 | Ga0373943_0062793 | |||
| 2096 | Ga0373946_0001185 | |||
| 2097 | Ga0373946_0009709 | |||
| 2098 | Ga0373955_0000184 | |||
| 2099 | Ga0373955_0004466 | |||
| 2100 | Ga0373924_0005456 | |||
| 2101 | Ga0373924_0012525 | |||
| 2102 | Ga0373931_0017214 | |||
| 2103 | Ga0373931_0058396 | |||
| 2104 | Ga0373931_0079351 | |||
| 2105 | Ga0373935_0003480 | |||
| 2106 | Ga0373935_0211204 | |||
| 2107 | Ga0373927_0000109 | |||
| 2108 | Ga0373927_0018866 | |||
| 2109 | Ga0373927_0023688 | |||
| 2110 | Ga0373927_0046180 | |||
| 2111 | Ga0373927_0077811 | |||
| 2112 | Ga0373927_0127320 | |||
| 2113 | Ga0373933_0000277 | |||
| 2114 | Ga0373933_0000554 | |||
| 2115 | Ga0373933_0029273 | |||
| 2116 | Ga0373947_0001517 | |||
| 2117 | Ga0373947_0037203 | |||
| 2118 | Ga0373947_0039506 | |||
| 2119 | Ga0373937_0002867 | |||
| 2120 | Ga0373937_0046190 | |||
| 2121 | Ga0373937_0069801 | |||
| 2122 | Ga0373937_0154475 | |||
| 2123 | Ga0373925_0009034 | |||
| 2124 | Ga0373925_0014057 | |||
| 2125 | Ga0373925_0036544 | |||
| 2126 | Ga0373925_0137912 | |||
| 2127 | Ga0395899_0000018 | |||
| 2128 | Ga0395899_0014550 | |||
| 2129 | Ga0395899_0094681 | |||
| 2130 | Ga0395899_0109567 | |||
| 2131 | Ga0395900_0000833 | |||
| 2132 | Ga0395900_0044930 | |||
| 2133 | Ga0395900_0075127 | |||
| 2134 | Ga0395898_0094881 | |||
| 2135 | Ga0395898_0141613 | |||
| 2136 | Ga0395898_0277715 | |||
| 2137 | Ga0395905_0000002 | |||
| 2138 | Ga0395905_0014893 | |||
| 2139 | Ga0395905_0018837 | |||
| 2140 | Ga0395905_0068044 | |||
| 2141 | Ga0395905_0376289 | |||
| 2142 | Ga0436364_0608267 | |||
| 2143 | Ga0395901_0005514 | |||
| 2144 | Ga0395901_0063364 | |||
| 2145 | Ga0395901_0311579 | |||
| 2146 | Ga0395901_0501363 | |||
| 2147 | Ga0436365_0870327 | |||
| 2148 | Ga0436365_1327145 | |||
| 2149 | Ga0436365_1639132 | |||
| 2150 | Ga0436365_1885173 | |||
| 2151 | Ga0436360_0188092 | |||
| 2152 | Ga0436360_0192034 | |||
| 2153 | Ga0436360_0216049 | |||
| 2154 | Ga0436363_1623990 | |||
| 2155 | Ga0436362_0669995 | |||
| 2156 | Ga0439465_0005228 | |||
| 2157 | Ga0439465_0077959 | |||
| 2158 | Ga0451853_2565009 | |||
| 2159 | Ga0439458_0011673 | |||
| 2160 | Ga0466969_0088707 | |||
| 2161 | Ga0466969_0089476 | |||
| 2162 | Ga0466972_0000871 | |||
| 2163 | Ga0466972_0070594 | |||
| 2164 | Ga0466965_0019156 | |||
| 2165 | Ga0466966_0000137 | |||
| 2166 | Ga0466966_0081559 | |||
| 2167 | Ga0466961_0000039 | |||
| 2168 | Ga0466961_0000182 | |||
| 2169 | Ga0466964_0045903 | |||
| 2170 | Ga0466971_0000562 | |||
| 2171 | Ga0466971_0059791 | |||
| 2172 | Ga0466970_0015491 | |||
| 2173 | Ga0466957_0002614 | |||
| 2174 | Ga0466957_0113199 | |||
| 2175 | Ga0466957_0178751 | |||
| 2176 | Ga0466960_0023816 | |||
| 2177 | Ga0466959_0000028 | |||
| 2178 | Ga0466959_0002520 | |||
| 2179 | Ga0466959_0065022 | |||
| 2180 | Ga0466959_0079846 | |||
| 2181 | Ga0466958_0000162 | |||
| 2182 | Ga0466967_0035287 | |||
| 2183 | Ga0495617_026398 | |||
| 2184 | Ga0495627_002311 | |||
| 2185 | Ga0495592_0000678 | |||
| 2186 | Ga0495592_0046911 | |||
| 2187 | Ga0495603_0000189 | |||
| 2188 | Ga0495603_0033579 | |||
| 2189 | Ga0495603_0040481 | |||
| 2190 | Ga0495603_0054816 | |||
| 2191 | Ga0495603_0143314 | |||
| 2192 | Ga0495590_0008709 | |||
| 2193 | Ga0495629_0000268 | |||
| 2194 | Ga0495629_0150296 | |||
| 2195 | Ga0495638_0002733 | |||
| 2196 | Ga0495638_0003907 | |||
| 2197 | Ga0495638_0004594 | |||
| 2198 | Ga0495638_0006283 | |||
| 2199 | Ga0495638_0037250 | |||
| 2200 | Ga0495638_0043467 | |||
| 2201 | Ga0495641_0008241 | |||
| 2202 | Ga0495651_0002545 | |||
| 2203 | Ga0495651_0004117 | |||
| 2204 | Ga0495651_0134106 | |||
| 2205 | Ga0495653_0001252 | |||
| 2206 | Ga0495653_0050722 | |||
| 2207 | Ga0495653_0104304 | |||
| 2208 | Ga0495650_0000114 | |||
| 2209 | Ga0495650_0019974 | |||
| 2210 | Ga0495580_0002333 | |||
| 2211 | Ga0495580_0025076 | |||
| 2212 | Ga0495580_0067373 | |||
| 2213 | Ga0495582_0000144 | |||
| 2214 | Ga0495582_0009481 | |||
| 2215 | Ga0495605_0021634 | |||
| 2216 | Ga0495605_0031478 | |||
| 2217 | Ga0495605_0117082 | |||
| 2218 | Ga0495639_0000067 | |||
| 2219 | Ga0495639_0014306 | |||
| 2220 | Ga0495639_0014334 | |||
| 2221 | Ga0495639_0071724 | |||
| 2222 | Ga0495639_0103719 | |||
| 2223 | Ga0495662_0000005 | |||
| 2224 | Ga0495662_0065818 | |||
| 2225 | Ga0495664_0003350 | |||
| 2226 | Ga0495664_0004265 | |||
| 2227 | Ga0495664_0075429 | |||
| 2228 | Ga0495664_0088639 | |||
| 2229 | Ga0495664_0094845 | |||
| 2230 | Ga0495584_0103591 | |||
| 2231 | Ga0495594_0027701 | |||
| 2232 | Ga0495594_0073449 | |||
| 2233 | Ga0495596_0066604 | |||
| 2234 | Ga0495607_0029468 | |||
| 2235 | Ga0495607_0076292 | |||
| 2236 | Ga0495583_0000013 | |||
| 2237 | Ga0495583_0069144 | |||
| 2238 | Ga0495606_0000858 | |||
| 2239 | Ga0495606_0028077 | |||
| 2240 | Ga0495606_0035190 | |||
| 2241 | Ga0495606_0060045 | |||
| 2242 | Ga0495606_0166439 | |||
| 2243 | Ga0495608_0000255 | |||
| 2244 | Ga0495608_0003767 | |||
| 2245 | Ga0495610_0008642 | |||
| 2246 | Ga0495610_0024830 | |||
| 2247 | Ga0495616_0000053 | |||
| 2248 | Ga0495616_0023169 | |||
| 2249 | Ga0495618_0039118 | |||
| 2250 | Ga0495618_0077305 | |||
| 2251 | Ga0495618_0093913 | |||
| 2252 | Ga0495618_0216734 | |||
| 2253 | Ga0495620_0020567 | |||
| 2254 | Ga0495628_0014733 | |||
| 2255 | Ga0495628_0139155 | |||
| 2256 | Ga0495628_0249602 | |||
| 2257 | Ga0495630_0015290 | |||
| 2258 | Ga0495630_0020943 | |||
| 2259 | Ga0495630_0117424 | |||
| 2260 | Ga0495631_0001968 | |||
| 2261 | Ga0495631_0025704 | |||
| 2262 | Ga0495632_0000335 | |||
| 2263 | Ga0495637_0008165 | |||
| 2264 | Ga0495637_0018711 | |||
| 2265 | Ga0495637_0019164 | |||
| 2266 | Ga0495643_0022446 | |||
| 2267 | Ga0495644_0047202 | |||
| 2268 | Ga0495648_0000072 | |||
| 2269 | Ga0495648_0000664 | |||
| 2270 | Ga0495648_0028166 | |||
| 2271 | Ga0495648_0041967 | |||
| 2272 | Ga0495666_0046111 | |||
| 2273 | Ga0495652_0006124 | |||
| 2274 | Ga0495652_0007010 | |||
| 2275 | Ga0495654_0000082 | |||
| 2276 | Ga0495654_0027297 | |||
| 2277 | Ga0495665_0001692 | |||
| 2278 | Ga0495665_0031918 | |||
| 2279 | Ga0495640_0002790 | |||
| 2280 | Ga0495640_0012191 | |||
| 2281 | Ga0495640_0013838 | |||
| 2282 | Ga0495640_0016475 | |||
| 2283 | Ga0495587_0002484 | |||
| 2284 | Ga0495587_0033195 | |||
| 2285 | Ga0495587_0123562 | |||
| 2286 | Ga0495598_0060739 | |||
| 2287 | Ga0495609_0050752 | |||
| 2288 | Ga0495597_0007237 | |||
| 2289 | Ga0495645_0004244 | |||
| 2290 | Ga0495645_0006922 | |||
| 2291 | Ga0495622_0011946 | |||
| 2292 | Ga0495622_0017449 | |||
| 2293 | Ga0495622_0046154 | |||
| 2294 | Ga0495622_0059535 | |||
| 2295 | Ga0495667_0000121 | |||
| 2296 | Ga0495667_0006748 | |||
| 2297 | Ga0495667_0096853 | |||
| 2298 | Ga0495656_0012851 | |||
| 2299 | Ga0495656_0015199 | |||
| 2300 | Ga0495668_0026914 | |||
| 2301 | Ga0495668_0047980 | |||
| 2302 | Ga0495668_0049516 | |||
| 2303 | Ga0495668_0131764 | |||
| 2304 | Ga0495634_0001407 | |||
| 2305 | Ga0495634_0009303 | |||
| 2306 | Ga0495634_0013633 | |||
| 2307 | Ga0495634_0068133 | |||
| 2308 | Ga0495625_0000290 | |||
| 2309 | Ga0495625_0016762 | |||
| 2310 | Ga0495625_0019463 | |||
| 2311 | Ga0495625_0049575 | |||
| 2312 | Ga0495625_0100837 | |||
| 2313 | Ga0495625_0144679 | |||
| 2314 | Ga0495635_0000072 | |||
| 2315 | Ga0495635_0002392 | |||
| 2316 | Ga0495635_0007293 | |||
| 2317 | Ga0495635_0022140 | |||
| 2318 | Ga0495635_0125192 | |||
| 2319 | Ga0495659_0017556 | |||
| 2320 | Ga0495659_0109805 | |||
| 2321 | Ga0495661_0026266 | |||
| 2322 | Ga0495588_0022358 | |||
| 2323 | Ga0495588_0045133 | |||
| 2324 | Ga0495588_0052717 | |||
| 2325 | Ga0495588_0052950 | |||
| 2326 | Ga0495657_0004073 | |||
| 2327 | Ga0495657_0014654 | |||
| 2328 | Ga0495657_0127280 | |||
| 2329 | Ga0495599_0000468 | |||
| 2330 | Ga0495599_0026745 | |||
| 2331 | Ga0495599_0045178 | |||
| 2332 | Ga0495623_0022493 | |||
| 2333 | Ga0495646_0005577 | |||
| 2334 | Ga0495646_0029722 | |||
| 2335 | Ga0495646_0041694 | |||
| 2336 | Ga0495647_0014841 | |||
| 2337 | Ga0495647_0014973 | |||
| 2338 | Ga0495647_0046107 | |||
| 2339 | Ga0495658_0001103 | |||
| 2340 | Ga0495669_0002316 | |||
| 2341 | Ga0495613_0018960 | |||
| 2342 | Ga0495613_0079473 | |||
| 2343 | Ga0495613_0093627 | |||
| 2344 | Ga0495613_0154125 | |||
| 2345 | Ga0495624_0000460 | |||
| 2346 | Ga0495624_0035416 | |||
| 2347 | Ga0495670_0036380 | |||
| 2348 | Ga0495670_0043471 | |||
| 2349 | Ga0495671_0036785 | |||
| 2350 | Ga0495671_0051961 | |||
| 2351 | Ga0495671_0067341 | |||
| 2352 | Ga0495589_0031361 | |||
| 2353 | Ga0495600_0001056 | |||
| 2354 | Ga0495600_0006711 | |||
| 2355 | Ga0495660_0025111 | |||
| 2356 | Ga0495581_0000178 | |||
| 2357 | Ga0495581_0076596 | |||
| 2358 | Ga0495604_0002293 | |||
| 2359 | Ga0495604_0013732 | |||
| 2360 | Ga0495674_0004128 | |||
| 2361 | Ga0495674_0016488 | |||
| 2362 | Ga0495674_0314638 | |||
| 2363 | Ga0495672_0013122 | |||
| 2364 | Ga0495672_0018740 | |||
| 2365 | Ga0495672_0047646 | |||
| 2366 | Ga0495676_0093195 | |||
| 2367 | Ga0495676_0097123 | |||
| 2368 | Ga0495680_0001208 | |||
| 2369 | Ga0495680_0012539 | |||
| 2370 | Ga0495680_0085047 | |||
| 2371 | Ga0495683_0061678 | |||
| 2372 | Ga0495683_0112413 | |||
| 2373 | Ga0495687_011216 | |||
| 2374 | Ga0495675_0003178 | |||
| 2375 | Ga0495677_0014791 | |||
| 2376 | Ga0495679_006243 | |||
| 2377 | Ga0495673_0000025 | |||
| 2378 | Ga0495673_0015713 | |||
| 2379 | Ga0495673_0036262 | |||
| 2380 | Ga0495684_0002454 | |||
| 2381 | Ga0495684_0026908 | |||
| 2382 | Ga0495684_0242714 | |||
| 2383 | Ga0495686_0003968 | |||
| 2384 | Ga0495686_0037559 | |||
| 2385 | Ga0495686_0064279 | |||
| 2386 | Ga0495686_0090786 | |||
| 2387 | Ga0495686_0131045 | |||
| 2388 | Ga0495593_0000038 | |||
| 2389 | Ga0495593_0000109 | |||
| 2390 | Ga0495593_0012360 | |||
| 2391 | Ga0495602_0008629 | |||
| 2392 | Ga0495602_0024467 | |||
| 2393 | Ga0495602_0138489 | |||
| 2394 | Ga0495614_0058587 | |||
| 2395 | Ga0495615_0016929 | |||
| 2396 | Ga0495626_0024253 | |||
| 2397 | Ga0495626_0113413 | |||
| 2398 | Ga0496100_0004173 | |||
| 2399 | Ga0496100_0022384 | |||
| 2400 | Ga0496100_0053083 | |||
| 2401 | Ga0496100_0114466 | |||
| 2402 | Ga0496100_0169550 | |||
| 2403 | Ga0496101_0005878 | |||
| 2404 | Ga0496101_0025066 | |||
| 2405 | Ga0496101_0181616 | |||
| 2406 | Ga0496101_0250749 | |||
| 2407 | Ga0496102_0008645 | |||
| 2408 | Ga0496102_0024656 | |||
| 2409 | Ga0496102_0031103 | |||
| 2410 | Ga0496102_0076991 | |||
| 2411 | Ga0496102_0094828 | |||
| 2412 | Ga0496102_0113864 | |||
| 2413 | Ga0496102_0251869 | |||
| 2414 | Ga0496102_0281205 | |||
| 2415 | Ga0496103_0015806 | |||
| 2416 | Ga0496103_0023402 | |||
| 2417 | Ga0496103_0156683 | |||
| 2418 | Ga0496103_0230343 | |||
| 2419 | Ga0496104_0013379 | |||
| 2420 | Ga0496104_0015039 | |||
| 2421 | Ga0496104_0015607 | |||
| 2422 | Ga0496104_0019922 | |||
| 2423 | Ga0496104_0046196 | |||
| 2424 | Ga0496104_0169108 | |||
| 2425 | Ga0496104_0202556 | |||
| 2426 | Ga0496104_0403927 | |||
| 2427 | Ga0496105_0007692 | |||
| 2428 | Ga0496105_0119343 | |||
| 2429 | Ga0496105_0144823 | |||
| 2430 | Ga0496105_0170453 | |||
| 2431 | Ga0496105_0170793 | |||
| 2432 | Ga0496105_0312403 | |||
| 2433 | Ga0496106_0043894 | |||
| 2434 | Ga0496106_0079997 | |||
| 2435 | Ga0496106_0113165 | |||
| 2436 | Ga0496106_0217929 | |||
| 2437 | Ga0496106_0288896 | |||
| 2438 | Ga0496106_0311315 | |||
| 2439 | Ga0496107_0000821 | |||
| 2440 | Ga0496107_0009564 | |||
| 2441 | Ga0496107_0010126 | |||
| 2442 | Ga0496107_0017264 | |||
| 2443 | Ga0496107_0035767 | |||
| 2444 | Ga0496107_0091899 | |||
| 2445 | Ga0496108_0000553 | |||
| 2446 | Ga0496108_0040135 | |||
| 2447 | Ga0496108_0043553 | |||
| 2448 | Ga0496108_0153969 | |||
| 2449 | Ga0496108_0165589 | |||
| 2450 | Ga0496109_0000574 | |||
| 2451 | Ga0496109_0014214 | |||
| 2452 | Ga0496109_0014907 | |||
| 2453 | Ga0496109_0067541 | |||
| 2454 | Ga0496109_0164013 | |||
| 2455 | Ga0496109_0188534 | |||
| 2456 | Ga0496109_0250828 | |||
| 2457 | Ga0496110_0015270 | |||
| 2458 | Ga0496110_0022137 | |||
| 2459 | Ga0496110_0022422 | |||
| 2460 | Ga0496110_0024393 | |||
| 2461 | Ga0496110_0031954 | |||
| 2462 | Ga0496110_0047439 | |||
| 2463 | Ga0496110_0260660 | |||
| 2464 | Ga0496110_0574992 | |||
| 2465 | Ga0496111_0000254 | |||
| 2466 | Ga0496111_0038744 | |||
| 2467 | Ga0496111_0114014 | |||
| 2468 | Ga0496111_0226915 | |||
| 2469 | Ga0496112_0000065 | |||
| 2470 | Ga0496112_0005410 | |||
| 2471 | Ga0496112_0009978 | |||
| 2472 | Ga0496112_0011336 | |||
| 2473 | Ga0496112_0034980 | |||
| 2474 | Ga0496112_0057686 | |||
| 2475 | Ga0496112_0059684 | |||
| 2476 | Ga0496112_0118017 | |||
| 2477 | Ga0496112_0134453 | |||
| 2478 | Ga0496112_0251642 | |||
| 2479 | Ga0496113_0000209 | |||
| 2480 | Ga0496113_0017578 | |||
| 2481 | Ga0496113_0099558 | |||
| 2482 | Ga0496113_0100062 | |||
| 2483 | Ga0496113_0218242 | |||
| 2484 | Ga0496113_0240405 | |||
| 2485 | Ga0496113_0251121 | |||
| 2486 | Ga0496114_0007557 | |||
| 2487 | Ga0496114_0156999 | |||
| 2488 | Ga0496114_0233169 | |||
| 2489 | Ga0496115_0003049 | |||
| 2490 | Ga0496115_0027806 | |||
| 2491 | Ga0496115_0058651 | |||
| 2492 | Ga0496115_0078514 | |||
| 2493 | Ga0496116_0003085 | |||
| 2494 | Ga0496116_0160508 | |||
| 2495 | Ga0496117_0007135 | |||
| 2496 | Ga0496117_0024076 | |||
| 2497 | Ga0496117_0072968 | |||
| 2498 | Ga0496117_0163544 | |||
| 2499 | Ga0496118_0005552 | |||
| 2500 | Ga0496118_0015872 | |||
| 2501 | Ga0496118_0017902 | |||
| 2502 | Ga0496118_0033771 | |||
| 2503 | Ga0496118_0135115 | |||
| 2504 | Ga0496119_0044038 | |||
| 2505 | Ga0496119_0090119 | |||
| 2506 | Ga0496119_0100564 | |||
| 2507 | Ga0496119_0107164 | |||
| 2508 | Ga0496119_0136213 | |||
| 2509 | Ga0496120_0005683 | |||
| 2510 | Ga0496120_0010445 | |||
| 2511 | Ga0496121_0000453 | |||
| 2512 | Ga0496121_0002104 | |||
| 2513 | Ga0496121_0002583 | |||
| 2514 | Ga0496121_0006128 | |||
| 2515 | Ga0496121_0016140 | |||
| 2516 | Ga0496121_0021760 | |||
| 2517 | Ga0496121_0043512 | |||
| 2518 | Ga0496121_0052036 | |||
| 2519 | Ga0496121_0056847 | |||
| 2520 | Ga0496121_0074801 | |||
| 2521 | Ga0496121_0097871 | |||
| 2522 | Ga0496121_0099348 | |||
| 2523 | Ga0496121_0235803 | |||
| 2524 | Ga0496122_0051260 | |||
| 2525 | Ga0496123_0106959 | |||
| 2526 | Ga0496124_0002831 | |||
| 2527 | Ga0496124_0020645 | |||
| 2528 | Ga0496125_0003090 | |||
| 2529 | Ga0496125_0005379 | |||
| 2530 | Ga0496125_0016016 | |||
| 2531 | Ga0496125_0069645 | |||
| 2532 | Ga0496125_0120943 | |||
| 2533 | Ga0496126_0002707 | |||
| 2534 | Ga0496126_0012688 | |||
| 2535 | Ga0496126_0021067 | |||
| 2536 | Ga0496126_0032509 | |||
| 2537 | Ga0496126_0042154 | |||
| 2538 | Ga0496126_0053918 | |||
| 2539 | Ga0496126_0150841 | |||
| 2540 | Ga0496126_0160188 | |||
| 2541 | Ga0496126_0165352 | |||
| 2542 | Ga0496126_0167090 | |||
| 2543 | Ga0496126_0170504 | |||
| 2544 | Ga0496126_0225470 | |||
| 2545 | Ga0495678_001114 | |||
| 2546 | Ga0501031_0018544 | |||
| 2547 | Ga0501031_0018611 | |||
| 2548 | Ga0501031_0055908 | |||
| 2549 | Ga0501032_0000309 | |||
| 2550 | Ga0501032_0023936 | |||
| 2551 | Ga0501032_0034437 | |||
| 2552 | Ga0501032_0063456 | |||
| 2553 | Ga0501032_0072665 | |||
| 2554 | Ga0501033_0001437 | |||
| 2555 | Ga0501033_0001792 | |||
| 2556 | Ga0501033_0005552 | |||
| 2557 | Ga0501033_0011464 | |||
| 2558 | Ga0501033_0146852 | |||
| 2559 | Ga0501034_0000082 | |||
| 2560 | Ga0501034_0038159 | |||
| 2561 | Ga0501034_0043255 | |||
| 2562 | Ga0501034_0120069 | |||
| 2563 | Ga0501034_0470216 | |||
| 2564 | Ga0501036_0000121 | |||
| 2565 | Ga0501036_0017730 | |||
| 2566 | Ga0501036_0059762 | |||
| 2567 | Ga0501036_0074431 | |||
| 2568 | Ga0501036_0075582 | |||
| 2569 | Ga0501036_0261572 | |||
| 2570 | Ga0501037_0001873 | |||
| 2571 | Ga0501037_0003883 | |||
| 2572 | Ga0501037_0004517 | |||
| 2573 | Ga0501037_0011302 | |||
| 2574 | Ga0501037_0055880 | |||
| 2575 | Ga0501037_0064072 | |||
| 2576 | Ga0501038_0001766 | |||
| 2577 | Ga0501038_0007655 | |||
| 2578 | Ga0501038_0011654 | |||
| 2579 | Ga0501038_0020734 | |||
| 2580 | Ga0501038_0028126 | |||
| 2581 | Ga0501038_0131751 | |||
| 2582 | Ga0501038_0133621 | |||
| 2583 | Ga0501039_0008300 | |||
| 2584 | Ga0501039_0008973 | |||
| 2585 | Ga0501039_0019231 | |||
| 2586 | Ga0501039_0163379 | |||
| 2587 | Ga0501039_0182526 | |||
| 2588 | Ga0501039_0245128 | |||
| 2589 | Ga0501039_0322592 | |||
| 2590 | Ga0501040_0019588 | |||
| 2591 | Ga0501041_0024090 | |||
| 2592 | Ga0501042_0002459 | |||
| 2593 | Ga0501042_0020947 | |||
| 2594 | Ga0501043_0000109 | |||
| 2595 | Ga0501043_0018022 | |||
| 2596 | Ga0501043_0020967 | |||
| 2597 | Ga0501043_0031418 | |||
| 2598 | Ga0501043_0054188 | |||
| 2599 | Ga0501043_0065893 | |||
| 2600 | Ga0501043_0071423 | |||
| 2601 | Ga0501043_0097384 | |||
| 2602 | Ga0501043_0223631 | |||
| 2603 | Ga0501046_0006125 | |||
| 2604 | Ga0501046_0011755 | |||
| 2605 | Ga0501046_0020055 | |||
| 2606 | Ga0501046_0108527 | |||
| 2607 | Ga0501046_0145287 | |||
| 2608 | Ga0501046_0241597 | |||
| 2609 | Ga0501047_0000331 | |||
| 2610 | Ga0501047_0005862 | |||
| 2611 | Ga0501047_0013763 | |||
| 2612 | Ga0501047_0016114 | |||
| 2613 | Ga0501047_0081308 | |||
| 2614 | Ga0501047_0119800 | |||
| 2615 | Ga0501048_0000124 | |||
| 2616 | Ga0501048_0006242 | |||
| 2617 | Ga0501048_0207138 | |||
| 2618 | Ga0501048_0209467 | |||
| 2619 | Ga0501067_0000754 | |||
| 2620 | Ga0501067_0004772 | |||
| 2621 | Ga0501068_0003061 | |||
| 2622 | Ga0501068_0013934 | |||
| 2623 | Ga0501069_0043468 | |||
| 2624 | Ga0501069_0231905 | |||
| 2625 | Ga0501070_0109696 | |||
| 2626 | Ga0501070_0120997 | |||
| 2627 | Ga0501071_0058511 | |||
| 2628 | Ga0501072_0001910 | |||
| 2629 | Ga0501072_0011811 | |||
| 2630 | Ga0501073_0000101 | |||
| 2631 | Ga0501073_0007671 | |||
| 2632 | Ga0501073_0022798 | |||
| 2633 | Ga0501074_0000673 | |||
| 2634 | Ga0501074_0022078 | |||
| 2635 | Ga0501076_0023212 | |||
| 2636 | Ga0501076_0057238 | |||
| 2637 | Ga0501077_0007464 | |||
| 2638 | Ga0501079_0007287 | |||
| 2639 | Ga0501079_0044414 | |||
| 2640 | Ga0501079_0053524 | |||
| 2641 | Ga0501080_0000151 | |||
| 2642 | Ga0501080_0014075 | |||
| 2643 | Ga0501080_0028786 | |||
| 2644 | Ga0501080_0324447 | |||
| 2645 | Ga0501080_0339089 | |||
| 2646 | Ga0501083_0001467 | |||
| 2647 | Ga0501083_0083002 | |||
| 2648 | Ga0501083_0243988 | |||
| 2649 | Ga0501035_0000150 | |||
| 2650 | Ga0501035_0005831 | |||
| 2651 | Ga0501035_0025197 | |||
| 2652 | Ga0501035_0030637 | |||
| 2653 | Ga0501035_0032463 | |||
| 2654 | Ga0501035_0053293 | |||
| 2655 | Ga0501035_0490784 | |||
| 2656 | Ga0501044_0000247 | |||
| 2657 | Ga0501044_0005266 | |||
| 2658 | Ga0501044_0036813 | |||
| 2659 | Ga0501044_0037013 | |||
| 2660 | Ga0501044_0087334 | |||
| 2661 | Ga0501044_0144108 | |||
| 2662 | Ga0501044_0238803 | |||
| 2663 | Ga0501044_0271729 | |||
| 2664 | Ga0501045_0009953 | |||
| 2665 | Ga0501045_0010576 | |||
| 2666 | nmdc:mga03683_82989_c1 | |||
| 2667 | nmdc:mga03n38_2959_c1 | |||
| 2668 | nmdc:mga03n38_3537_c1 | |||
| 2669 | nmdc:mga03n38_3664_c1 | |||
| 2670 | nmdc:mga00v17_122202_c1 | |||
| 2671 | nmdc:mga00v17_18034_c1 | |||
| 2672 | nmdc:mga00v17_2135_c1 | |||
| 2673 | nmdc:mga0yw44_11059_c1 | |||
| 2674 | nmdc:mga0yw44_171210_c1 | |||
| 2675 | nmdc:mga0yw44_17603_c1 | |||
| 2676 | nmdc:mga0yw44_21959_c1 | |||
| 2677 | nmdc:mga0yw44_70359_c1 | |||
| 2678 | nmdc:mga0yw44_8315_c1 | |||
| 2679 | nmdc:mga0yw44_83423_c1 | |||
| 2680 | nmdc:mga06z11_67020_c1 | |||
| 2681 | nmdc:mga06z11_97470_c1 | |||
| 2682 | nmdc:mga04h51_40526_c1 | |||
| 2683 | nmdc:mga07m45_33103_c1 | |||
| 2684 | nmdc:mga05p37_27900_c1 | |||
| 2685 | nmdc:mga05p37_48317_c1 | |||
| 2686 | nmdc:mga0qj67_179491_c1 | |||
| 2687 | nmdc:mga06r32_119041_c1 | |||
| 2688 | nmdc:mga06r32_355300_c1 | |||
| 2689 | nmdc:mga06r32_54021_c1 | |||
| 2690 | nmdc:mga08y16_504615_c1 | |||
| 2691 | nmdc:mga08y16_510493_c1 | |||
| 2692 | nmdc:mga08y16_65363_c1 | |||
| 2693 | nmdc:mga0rr50_162149_c1 | |||
| 2694 | nmdc:mga0a205_318113_c1 | |||
| 2695 | nmdc:mga0sz30_12253_c1 | |||
| 2696 | Ga0495601_0005665 | |||
| 2697 | Ga0495601_0022706 | |||
| 2698 | Ga0495601_0044081 | |||
| 2699 | Ga0495612_0012883 | |||
| 2700 | Ga0495612_0016639 | |||
| 2701 | Ga0500635_0006237 | |||
| 2702 | Ga0500635_0058978 | |||
| 2703 | Ga0495655_0030429 | |||
| 2704 | Ga0495595_0000437 | |||
| 2705 | Ga0495595_0037333 | |||
| 2706 | Ga0495595_0075238 | |||
| 2707 | Ga0495595_0089325 | |||
| 2708 | Ga0495619_0001386 | |||
| 2709 | Ga0495619_0019949 | |||
| 2710 | Ga0495619_0106067 | |||
| 2711 | Ga0500578_0000124 | |||
| 2712 | Ga0500578_0097862 | |||
| 2713 | Ga0500643_000117 | |||
| 2714 | Ga0500643_027479 | |||
| 2715 | Ga0500651_0007987 | |||
| 2716 | Ga0500651_0036263 | |||
| 2717 | Ga0500566_0012564 | |||
| 2718 | Ga0500640_016614 | |||
| 2719 | Ga0500640_031016 | |||
| 2720 | Ga0500641_0029521 | |||
| 2721 | Ga0500641_0107514 | |||
| 2722 | Ga0500648_086624 | |||
| 2723 | Ga0500650_0000885 | |||
| 2724 | Ga0500554_008277 | |||
| 2725 | Ga0500554_018093 | |||
| 2726 | Ga0500555_004649 | |||
| 2727 | Ga0500556_0000019 | |||
| 2728 | Ga0500556_0004025 | |||
| 2729 | Ga0500556_0010261 | |||
| 2730 | Ga0500556_0072231 | |||
| 2731 | Ga0500557_000143 | |||
| 2732 | Ga0500562_001270 | |||
| 2733 | Ga0500569_005216 | |||
| 2734 | Ga0500572_000955 | |||
| 2735 | Ga0500572_025605 | |||
| 2736 | Ga0500592_000579 | |||
| 2737 | Ga0500592_014465 | |||
| 2738 | Ga0500594_0000239 | |||
| 2739 | Ga0500594_0011714 | |||
| 2740 | Ga0500595_001903 | |||
| 2741 | Ga0500595_002222 | |||
| 2742 | Ga0500595_007252 | |||
| 2743 | Ga0500595_008236 | |||
| 2744 | Ga0500595_027287 | |||
| 2745 | Ga0500595_044546 | |||
| 2746 | Ga0500595_054382 | |||
| 2747 | Ga0500607_095861 | |||
| 2748 | Ga0500608_040872 | |||
| 2749 | Ga0500614_012243 | |||
| 2750 | Ga0500618_000093 | |||
| 2751 | Ga0500642_0000048 | |||
| 2752 | Ga0500642_0000137 | |||
| 2753 | Ga0500642_0004012 | |||
| 2754 | Ga0500652_005581 | |||
| 2755 | Ga0500559_0000060 | |||
| 2756 | Ga0500559_0001161 | |||
| 2757 | Ga0500559_0004287 | |||
| 2758 | Ga0500559_0008025 | |||
| 2759 | Ga0500559_0013786 | |||
| 2760 | Ga0500564_000502 | |||
| 2761 | Ga0500568_0002172 | |||
| 2762 | Ga0500568_0012112 | |||
| 2763 | Ga0500568_0019114 | |||
| 2764 | Ga0500568_0069123 | |||
| 2765 | Ga0500573_0010850 | |||
| 2766 | Ga0500573_0200219 | |||
| 2767 | Ga0500586_005266 | |||
| 2768 | Ga0500590_069628 | |||
| 2769 | Ga0500590_084246 | |||
| 2770 | Ga0500603_002291 | |||
| 2771 | Ga0500616_0000038 | |||
| 2772 | Ga0500616_0000059 | |||
| 2773 | Ga0500616_0025571 | |||
| 2774 | Ga0500622_0000995 | |||
| 2775 | Ga0500622_0002106 | |||
| 2776 | Ga0500622_0004401 | |||
| 2777 | Ga0500622_0005729 | |||
| 2778 | Ga0500622_0009444 | |||
| 2779 | Ga0500622_0051451 | |||
| 2780 | Ga0500624_006663 | |||
| 2781 | Ga0500627_0016814 | |||
| 2782 | Ga0500634_0025972 | |||
| 2783 | Ga0500638_046986 | |||
| 2784 | Ga0500639_017206 | |||
| 2785 | Ga0500636_0001114 | |||
| 2786 | Ga0500636_0008789 | |||
| 2787 | Ga0500636_0092519 | |||
| 2788 | Ga0500636_0101943 | |||
| 2789 | Ga0500637_0000500 | |||
| 2790 | Ga0500637_0028532 | |||
| 2791 | Ga0500576_009372 | |||
| 2792 | Ga0500611_008909 | |||
| 2793 | Ga0500625_013646 | |||
| 2794 | Ga0500645_000484 | |||
| 2795 | Ga0500609_000477 | |||
| 2796 | Ga0500609_005115 | |||
| 2797 | Ga0500596_006542 | |||
| 2798 | Ga0500596_009396 | |||
| 2799 | Ga0500601_000813 | |||
| 2800 | Ga0500601_001894 | |||
| 2801 | Ga0501084_0012721 | |||
| 2802 | Ga0501084_0075126 | |||
| 2803 | Ga0500661_000621 | |||
| 2804 | Ga0501082_0003420 | |||
| 2805 | Ga0501082_0018039 | |||
| 2806 | Ga0501082_0086418 | |||
| 2807 | Ga0501082_0207213 | |||
| 2808 | Ga0501082_0238928 | |||
| 2809 | Ga0466962_0000142 | |||
| 2810 | 2513700424 | |||
| 2811 | 2507505623 | |||
| 2812 | 2508539516 | |||
| 2813 | 2508695886 | |||
| 2814 | 2509079133 | |||
| 2815 | 2509150142 | |||
| 2816 | 2511121662 | |||
| 2817 | 2511401107 | |||
| 2818 | 2513628921 | |||
| 2819 | 2513642263 | |||
| 2820 | 2513652799 | |||
| 2821 | 2513661881 | |||
| 2822 | 2513694024 | |||
| 2823 | 2513718829 | |||
| 2824 | 2513862539 | |||
| 2825 | 2513876929 | |||
| 2826 | 2513890479 | |||
| 2827 | 2513919110 | |||
| 2828 | 2514016091 | |||
| 2829 | 2515624024 | |||
| 2830 | 2517105888 | |||
| 2831 | 2517888428 | |||
| 2832 | 2524440067 | |||
| 2833 | 2524468379 | |||
| 2834 | 2524535263 | |||
| 2835 | 2528852077 | |||
| 2836 | 2585147844 | |||
| 2837 | 2585151564 | |||
| 2838 | 2585195562 | |||
| 2839 | 2603861709 | |||
| 2840 | 2617353255 | |||
| 2841 | 2617377293 | |||
| 2842 | 2643749273 | |||
| 2843 | 2643781394 | |||
| 2844 | 2643922986 | |||
| 2845 | 2643929133 | |||
| 2846 | 2644508953 | |||
| 2847 | 2644728799 | |||
| 2848 | 2644734187 | |||
| 2849 | 2671123633 | |||
| 2850 | 2723849327 | |||
| 2851 | 2728752065 | |||
| 2852 | 2739792302 | |||
| 2853 | 2745077821 | |||
| 2854 | 2793065644 | |||
| 2855 | 2793065915 | |||
| 2856 | 2793067245 | |||
| 2857 | 2793077107 | |||
| 2858 | 2805921277 | |||
| 2859 | 2818239252 | |||
| 2860 | 2819536374 | |||
| 2861 | 2819644629 | |||
| 2862 | 2824607499 | |||
| 2863 | 2824617549 | |||
| 2864 | 2824624910 | |||
| 2865 | 2824631738 | |||
| 2866 | 2824643206 | |||
| 2867 | 2824652309 | |||
| 2868 | 2824660963 | |||
| 2869 | 2824670739 | |||
| 2870 | 2824678637 | |||
| 2871 | 2824686947 | |||
| 2872 | 2824695082 | |||
| 2873 | 2824703434 | |||
| 2874 | 2824712920 | |||
| 2875 | 2824721555 | |||
| 2876 | 2824731485 | |||
| 2877 | 2824740008 | |||
| 2878 | 2824753558 | |||
| 2879 | 2824762108 | |||
| 2880 | 2824772397 | |||
| 2881 | 2824777518 | |||
| 2882 | 2838125754 | |||
| 2883 | 2841920176 | |||
| 2884 | 2841947965 | |||
| 2885 | 2841957062 | |||
| 2886 | 2841965124 | |||
| 2887 | 2841972793 | |||
| 2888 | 2841977570 | |||
| 2889 | 2841984872 | |||
| 2890 | 2842041374 | |||
| 2891 | 2842049416 | |||
| 2892 | 2844315857 | |||
| 2893 | 2847930718 | |||
| 2894 | 2847942680 | |||
| 2895 | 2849083425 | |||
| 2896 | 2857515630 | |||
| 2897 | 2857525897 | |||
| 2898 | 2874593255 | |||
| 2899 | 2874608441 | |||
| 2900 | 2874617146 | |||
| 2901 | 2874621377 | |||
| 2902 | 2874636766 | |||
| 2903 | 2874647768 | |||
| 2904 | 2876762904 | |||
| 2905 | 2876773295 | |||
| 2906 | 2876818922 | |||
| 2907 | 2879075374 | |||
| 2908 | 2879089860 | |||
| 2909 | 2879106704 | |||
| 2910 | 2879112796 | |||
| 2911 | 2879134118 | |||
| 2912 | 2879145569 | |||
| 2913 | 2881367140 | |||
| 2914 | 2881668416 | |||
| 2915 | 2885368719 | |||
| 2916 | 2885379862 | |||
| 2917 | 2885384667 | |||
| 2918 | 2885411183 | |||
| 2919 | 2888379115 | |||
| 2920 | 2888390291 | |||
| 2921 | 2888427511 | |||
| 2922 | 2889035878 | |||
| 2923 | 2891091149 | |||
| 2924 | 2893067821 | |||
| 2925 | 2903731807 | |||
| 2926 | 2903777945 | |||
| 2927 | 2904668047 | |||
| 2928 | 2904699280 | |||
| 2929 | 2904707832 | |||
| 2930 | 2904714178 | |||
| 2931 | 2906603666 | |||
| 2932 | 2906614209 | |||
| 2933 | 2906633210 | |||
| 2934 | 2906638818 | |||
| 2935 | 2906648040 | |||
| 2936 | 2906660919 | |||
| 2937 | 2908746962 | |||
| 2938 | 2908758877 | |||
| 2939 | 2908775808 | |||
| 2940 | 2917703302 | |||
| 2941 | 2919074242 | |||
| 2942 | 2922364355 | |||
| 2943 | 2922369151 | |||
| 2944 | 2922389052 | |||
| 2945 | 2922400763 | |||
| 2946 | 2922426031 | |||
| 2947 | 2929619005 | |||
| 2948 | 2929631082 | |||
| 2949 | 2932789047 | |||
| 2950 | 2932801322 | |||
| 2951 | 2932808835 | |||
| 2952 | 2932814316 | |||
| 2953 | 2932820442 | |||
| 2954 | 2932834474 | |||
| 2955 | 2933580285 | |||
| 2956 | 2935614679 | |||
| 2957 | 2935624457 | |||
| 2958 | 2935632451 | |||
| 2959 | 2935645847 | |||
| 2960 | 2935649069 | |||
| 2961 | 2935658159 | |||
| 2962 | 2935673414 | |||
| 2963 | 2935682591 | |||
| 2964 | 2935686795 | |||
| 2965 | 2935701525 | |||
| 2966 | 2935710500 | |||
| 2967 | 2935716483 | |||
| 2968 | 2935723392 | |||
| 2969 | 2935734948 | |||
| 2970 | 2935744261 | |||
| 2971 | 2935752761 | |||
| 2972 | 2935764692 | |||
| 2973 | 2935774671 | |||
| 2974 | 2935783758 | |||
| 2975 | 2935789814 | |||
| 2976 | 2935797818 | |||
| 2977 | 2935806197 | |||
| 2978 | 2935816969 | |||
| 2979 | 2935826280 | |||
| 2980 | 2935835252 | |||
| 2981 | 2935841366 | |||
| 2982 | 2935853776 | |||
| 2983 | 2935863066 | |||
| 2984 | 2935871876 | |||
| 2985 | 2935882233 | |||
| 2986 | 2935883294 | |||
| 2987 | 2935910997 | |||
| 2988 | 2935924158 | |||
| 2989 | 2935932789 | |||
| 2990 | 2935937352 | |||
| 2991 | 2935949447 | |||
| 2992 | 2935958154 | |||
| 2993 | 2935967245 | |||
| 2994 | 2935971191 | |||
| 2995 | 2935982216 | |||
| 2996 | 2935985354 | |||
| 2997 | 2936000196 | |||
| 2998 | 2936010110 | |||
| 2999 | 2936012378 | |||
| 3000 | 2936020541 | |||
| 3001 | 2936029671 | |||
| 3002 | 2936043960 | |||
| 3003 | 2936051864 | |||
| 3004 | 2936056882 | |||
| 3005 | 2940558674 | |||
| 3006 | 2941508886 | |||
| 3007 | 2941516715 | |||
| 3008 | 2941524268 | |||
| 3009 | 2941535707 | |||
| 3010 | 2941543592 | |||
| 3011 | 3005486376 | |||
| 3012 | 3005506284 | |||
| 3013 | 3005589064 | |||
| 3014 | 3005595441 | |||
| 3015 | 3005711401 | |||
| 3016 | 3005718676 | |||
| 3017 | 8006931209 | |||
| 3018 | 8006936731 | |||
| 3019 | 8006967862 | |||
| 3020 | 8006976701 | |||
| 3021 | 8006992458 | |||
| 3022 | 8006998528 | |||
| 3023 | 8016517755 | |||
| 3024 | 8016525810 | |||
| 3025 | 8016539409 | |||
| 3026 | 8016558013 | |||
| 3027 | 8016569104 | |||
| 3028 | 8016581739 | |||
| 3029 | 8016585928 | |||
| 3030 | 8016596027 | |||
| 3031 | 8016606902 | |||
| 3032 | 8016618810 | |||
| 3033 | 8016622726 | |||
| 3034 | 8016635220 | |||
| 3035 | 8017058875 | |||
| 3036 | 8019540891 | |||
| 3037 | 8019549723 | |||
| 3038 | 8019561968 | |||
| 3039 | 8019576775 | |||
| 3040 | 8019594832 | |||
| 3041 | 8019606908 | |||
| 3042 | 8019611600 | |||
| 3043 | 8019623365 | |||
| 3044 | 8019629729 | |||
| 3045 | 8019640887 | |||
| 3046 | 8019666573 | |||
| 3047 | 8019676267 | |||
| 3048 | 8019679717 | |||
| 3049 | 8019695783 | |||
| 3050 | 8055742854 | |||
| 3051 | 8056676293 | |||
| 3052 | 8056683210 | |||
| 3053 | 8056693994 | |||
| 3054 | 8056970847 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 2f9y-assembly1.cif.gz_A-2 | the crystal structure of the carboxyltransferase subunit of acc from escherichia coli | 0.9208 | 7 | 313 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9184 | 8 | 316 |
| 5kdr-assembly1.cif.gz_A-2 | the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. | 0.9113 | 9 | 316 |
| 2f9i-assembly1.cif.gz_C | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9037 | 8 | 316 |
| 2f9i-assembly1.cif.gz_A | crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus | 0.9034 | 3 | 316 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9256 | 8 | 316 | 3.90.226.10 |
| af_Q2FXM7_1_314_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9088 | 8 | 316 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.9029 | 56 | 320 | 3.90.226.10 |
| af_P9WQH9_238_492_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.893 | 56 | 320 | 3.90.226.10 |
| af_O53578_265_515_3.90.226.10 | Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 | 0.7382 | 69 | 285 | 3.90.226.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A658S5V1-F1-model_v4 | deleted | 0.9627 | 214 | 316 |
|
| AF-A0A4V1T4P3-F1-model_v4 | acetyl-CoA carboxytransferase (EC 2.1.3.15) | 0.961 | 5 | 120 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A4Y8C129-F1-model_v4 | deleted | 0.9586 | 213 | 313 |
|
| AF-A0A562KXJ5-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9566 | 5 | 320 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |
| AF-A0A1G8P132-F1-model_v4 | Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) | 0.9557 | 1 | 320 |
GO:0003989
GO:0005524 GO:0006633 GO:0009317 GO:0016743 GO:2001295 |