F494578

General Info

Members Datasets Scaffolds Average Seq Length
1527 741 3054 319

Family's Representative Sequence

Representative Sequence iso_pu_bacteria|2513237102|2513700424
Length 385
Sequence VRRDDSGGNETALTSAASPQKEPGPHRLIWLAPHERTSQTIEDAKLLSATLTSLRSKAPPPYIELMQDQMRSYLDFEKPVAELDSKVDELRALAASGTDISDEIGRIEDKAAQALADLYQNLTPWQKTLVARHPQRPHFNDFIKGLITEFTPLAGDRKFGEDEALVAGFGRFRGEPICVMGQEKGDSTESRIRHNFGMARPEGYRKCVRLMEMAERFGLPVLSLADSAGAYPGIGAEERGQAEAIARSTDACLALTVPNVAIITGEGMSGGAIAITTANKVLMLEHAIYSVISPEAASSILWRDGTKAQEAANNMKITAQDMLRFGVIDQILKEPVGGAHRDPAAMIATTGEAIAKAFDELRDLDGEAIRKQRRQKFLDIGRKLG

Samples

Sample ID Description Type Environment
1 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
4 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
5 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
8 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
9 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
10 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
11 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
12 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
13 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
14 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
15 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
21 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
22 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
23 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
24 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
25 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
30 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
54 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
55 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
56 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
57 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
58 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
59 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
60 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
61 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
62 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
63 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
64 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
65 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
66 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
69 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
70 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
71 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
72 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
73 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
74 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
75 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
76 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
77 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
78 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
79 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
80 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
81 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
82 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
83 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
84 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
86 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
87 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
88 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
89 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006942 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW Metagenome Nodule
95 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
98 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
99 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
100 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
101 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
105 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
106 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
107 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
108 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
109 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
110 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
111 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
112 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
113 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
114 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
115 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
116 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
117 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
118 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
119 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
120 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
121 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
122 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
123 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
124 3300021324 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS4 Metagenome Nodule
125 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
126 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
127 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
128 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
129 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
130 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
131 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
132 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
134 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
136 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
137 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
138 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
141 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
142 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
198 3300027357 Root nodule microbial communities of legume samples collected from California USA - Cow pea white BW (SPAdes) (version 2) Metagenome Nodule
199 3300027361 Root nodule microbial communities of legume samples collected from California, USA - Siratro white BW (SPAdes) (version 2) Metagenome Nodule
200 3300027363 Root nodule microbial communities of legume samples collected from California, USA - Siratro red BW (SPAdes) (version 2) Metagenome Nodule
201 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
207 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
208 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
211 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
212 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
213 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
214 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
215 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
216 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
217 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
218 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
219 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
220 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
221 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
222 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
223 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
224 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
225 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
226 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
227 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
228 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
229 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
230 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
231 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
232 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
233 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
234 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
235 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
247 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
248 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
249 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
250 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
251 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
254 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
259 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
260 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
261 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
262 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
263 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
264 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
265 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
266 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
267 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
268 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
269 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
270 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
271 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
272 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
273 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
274 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
275 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
276 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
280 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
281 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
282 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
283 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
284 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
285 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
290 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
291 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
292 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
293 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
294 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
295 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
296 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
300 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
301 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
302 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
303 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
304 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
305 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
306 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
307 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
308 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
309 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
310 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
311 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
312 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
313 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
314 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
315 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
318 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
319 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
320 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
321 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
322 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
323 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
324 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
325 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
326 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
327 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
328 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
329 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
330 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
331 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
332 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
333 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
334 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
335 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
336 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
337 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
338 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
339 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
340 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
341 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
342 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
343 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
344 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
345 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
346 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
347 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
348 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
349 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
350 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
351 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
352 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
353 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
354 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
355 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
356 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
357 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
358 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
359 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
360 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
361 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
362 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
363 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
364 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
365 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
366 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
367 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
368 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
369 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
370 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
371 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
372 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
373 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
374 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
375 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
376 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
377 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
378 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
379 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
380 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
381 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
382 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
383 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
384 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
385 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
386 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
387 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
388 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
389 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
390 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
391 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
392 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
393 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
394 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
395 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
396 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
397 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
398 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
399 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
400 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
401 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
402 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
403 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
404 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
408 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
409 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
410 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
411 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
412 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
413 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
414 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
415 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
416 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
417 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
418 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
419 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
420 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
421 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
422 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
423 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
424 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
425 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
426 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
427 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
428 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
429 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
430 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
431 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
432 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
433 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
434 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
435 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
436 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
437 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
438 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
439 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
440 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
441 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
442 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
443 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
444 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
445 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
446 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
447 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
448 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
449 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
450 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
451 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
452 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
453 3300053097 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 endosphere Metagenome Endosphere
454 3300053098 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 endosphere Metagenome Endosphere
455 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
456 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
457 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
458 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
459 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
460 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
461 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
462 3300053116 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 endosphere Metagenome Endosphere
463 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
464 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
465 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
466 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
467 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
468 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
469 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
470 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
471 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
472 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
473 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
474 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
475 3300053145 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 endosphere Metagenome Endosphere
476 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
477 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
478 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
479 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
480 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
481 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
482 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
483 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
484 3300053163 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 endosphere Metagenome Endosphere
485 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
486 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
487 3300053725 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 endosphere Metagenome Endosphere
488 3300053727 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 endosphere Metagenome Endosphere
489 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
490 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
491 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
492 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
493 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
494 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
495 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
496 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
497 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
498 2513237102 Bradyrhizobium japonicum USDA 135 Isolate Nodule
499 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
500 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
501 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
502 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
503 2508501128 Bradyrhizobium sp. ARR65 Isolate Nodule
504 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
505 2511231028 Bradyrhizobium sp. YR681 Isolate Rhizosphere
506 2513237092 Bradyrhizobium sp. WSM1743 Isolate Nodule
507 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
508 2513237095 Bradyrhizobium diazoefficiens USDA 122 Isolate Nodule
509 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
510 2513237101 Bradyrhizobium murdochi WSM1741 Isolate Nodule
511 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
512 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
513 2513237139 Bradyrhizobium ottawaense USDA 4 Isolate Nodule
514 2513237141 Bradyrhizobium sp. TV2a.2 Isolate Nodule
515 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
516 2513237161 Bradyrhizobium sp. WSM2793 Isolate Nodule
517 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
518 2517093001 Bradyrhizobium japonicum USDA 124 Isolate Nodule
519 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
520 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
521 2524023210 Bradyrhizobium sp. Ai1a-2 Isolate Nodule
522 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
523 2528768022 Bradyrhizobium japonicum USDA 123 Isolate Nodule
524 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
525 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
526 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
527 2602042107 Bradyrhizobium sp. NFR13 Isolate Rhizoplane
528 2617270735 Bradyrhizobium shewense ERR11 Isolate Nodule
529 2617270741 Bradyrhizobium yuanmingense CCBAU 10071 Isolate Nodule
530 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
531 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
532 2643221583 Caulobacter sp. Root655 Isolate Unclassified
533 2643221584 Caulobacter sp. Root656 Isolate Unclassified
534 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
535 2643221733 Bosea sp. Root381 Isolate Unclassified
536 2643221734 Bosea sp. Root670 Isolate Unclassified
537 2667528175 Rhizobium tropici NFR14 Isolate Rhizoplane
538 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
539 2728368998 Bradyrhizobium macuxiense BR 10303 Isolate Nodule
540 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
541 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
542 2791355196 Bradyrhizobium sp. Y36 Isolate Nodule
543 2791355197 Bradyrhizobium sp. C9 Isolate Nodule
544 2791355199
545 2802429603 Bradyrhizobium ottawaense L2 Isolate Nodule
546 2816332527 Bradyrhizobium diazoefficiens Y21 Isolate Nodule
547 2818991435 Caulobacter henricii 536 Isolate Unclassified
548 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
549 2824600985 Bradyrhizobium sp.HAMBI 2135 Isolate Unclassified
550 2824609381 Bradyrhizobium sp. HAMBI 2134 Isolate Unclassified
551 2824617872 Bradyrhizobium sp. HAMBI 2133 Isolate Unclassified
552 2824626560 Bradyrhizobium sp. HAMBI 2149 Isolate Unclassified
553 2824635225 Bradyrhizobium sp. HAMBI 2136 Isolate Unclassified
554 2824644064 Bradyrhizobium sp. HAMBI 2137 Isolate Unclassified
555 2824653114 Bradyrhizobium sp. HAMBI 2142 Isolate Unclassified
556 2824661429 Bradyrhizobium sp. HAMBI 2115 Isolate Unclassified
557 2824671348 Bradyrhizobium sp. HAMBI 2125 Isolate Unclassified
558 2824679649 Bradyrhizobium sp.HAMBI 2116 Isolate Unclassified
559 2824687955 Bradyrhizobium sp. HAMBI 2126 Isolate Unclassified
560 2824696289 Bradyrhizobium sp. HAMBI 2127 Isolate Unclassified
561 2824704595 Bradyrhizobium sp. HAMBI 2150 Isolate Unclassified
562 2824714736 Bradyrhizobium sp. HAMBI 2151 Isolate Unclassified
563 2824723954 Bradyrhizobium sp. HAMBI 2152 Isolate Unclassified
564 2824732956 Bradyrhizobium sp. HAMBI 2153 Isolate Unclassified
565 2824746037 Bradyrhizobium sp. HAMBI 2299 Isolate Unclassified
566 2824753945 Bradyrhizobium sp. HAMBI 2128 Isolate Unclassified
567 2824763712 Bradyrhizobium sp. HAMBI 2129 Isolate Unclassified
568 2824773399 Bradyrhizobium sp. HAMBI 2130 Isolate Unclassified
569 2838122688 Bradyrhizobium sp. CIR3A Isolate Nodule
570 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
571 2841941048 Bradyrhizobium sp. SBR1B Isolate Nodule
572 2841949485 Bradyrhizobium sp. ERR14 Isolate Nodule
573 2841957949 Bradyrhizobium sp. CIR1 Isolate Nodule
574 2841966195 Bradyrhizobium sp. CIR18 Isolate Nodule
575 2841974524 Bradyrhizobium sp. CIR48 Isolate Nodule
576 2841983080 Bradyrhizobium sp. IAR9 Isolate Nodule
577 2842038055 Bradyrhizobium centrosematis SEMIA 424 Isolate Nodule
578 2842045827 Bradyrhizobium centrosematis SEMIA 431 Isolate Nodule
579 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
580 2847930680 Bradyrhizobium zhanjiangense CCBAU 51778 Isolate Unclassified
581 2847939898 Bradyrhizobium ottawaense OO99 Isolate Unclassified
582 2849076700 Bradyrhizobium symbiodeficiens 85S1MB Isolate Nodule
583 2857509624 Bradyrhizobium sp. R-73088 Isolate Unclassified
584 2857524615 Tardiphaga sp. R-73074 Isolate Unclassified
585 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
586 2874604998 Bradyrhizobium sp. LMTR 3 Isolate Nodule
587 2874612657 Bradyrhizobium forestalis INPA54B Isolate Nodule
588 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
589 2874628541 Bradyrhizobium betae Opo-243 Isolate Unclassified
590 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
591 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
592 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
593 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
594 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
595 2879083081 Bradyrhizobium zhanjiangense CCBAU 51787 Isolate Unclassified
596 2879099564 Bradyrhizobium japonicum UBMA197 Isolate Nodule
597 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
598 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
599 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
600 2881364244 Bradyrhizobium sp. RP6 Isolate Unclassified
601 2881665667 Bradyrhizobium vignae LMG 28791 Isolate Unclassified
602 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
603 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
604 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
605 2885409591 Bradyrhizobium sp. NAS80.1 Isolate Unclassified
606 2888378607 Bradyrhizobium sp. LCT2 Isolate Unclassified
607 2888388044 Bradyrhizobium cosmicum 58S1 Isolate Unclassified
608 2888419890 Bradyrhizobium sp. 1(2017) 63S1MB Isolate Unclassified
609 2889033259 Bradyrhizobium sp. CCBAU 051011 Isolate Unclassified
610 2891088606 Methylosinus sp. 3S-1 Isolate Rhizosphere
611 2893066018 Tardiphaga sp. P9-11 Isolate Unclassified
612 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
613 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
614 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
615 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
616 2904699407
617 2904711408 Bradyrhizobium sp. USDA 3456 Isolate Unclassified
618 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
619 2906610324
620 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
621 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
622 2906643746 Bradyrhizobium genosp. SA-3 Rp7b Isolate Unclassified
623 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
624 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
625 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
626 2908775508 Bradyrhizobium sp. SUTN9-2 Isolate Unclassified
627 2917699015 Bosea sp. F3-2 Isolate Rhizosphere
628 2919073203 Tardiphaga robiniae 1155 Isolate Unclassified
629 2922361189 Bradyrhizobium australiense WSM 1791 Isolate Nodule
630 2922368715
631 2922386360 Bradyrhizobium archetypum WSM 1744 Isolate Nodule
632 2922393267 Bradyrhizobium sp. WBAH10 Isolate Nodule
633 2922425934
634 2929615660 Bradyrhizobium japonicum TXVA Isolate Nodule
635 2929624759 Bradyrhizobium japonicum TXEA Isolate Nodule
636 2932784394 Bradyrhizobium sp. S3.2.12 Isolate Nodule
637 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
638 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
639 2932809354 Bradyrhizobium sp. S3.5.5 Isolate Nodule
640 2932818245 Bradyrhizobium sp. S3.9.1 Isolate Nodule
641 2932828146 Bradyrhizobium sp. S3.9.2 Isolate Nodule
642 2933577622 Bradyrhizobium japonicum SEMIA 417 Isolate Nodule
643 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
644 2935616580 Bradyrhizobium sp. RT7a Isolate Nodule
645 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
646 2935638405 Bradyrhizobium sp. JR19.8 Isolate Nodule
647 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
648 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
649 2935665750 Bradyrhizobium sp. JR7.2 Isolate Nodule
650 2935675223 Bradyrhizobium sp. LA2.1 Isolate Nodule
651 2935684952 Bradyrhizobium sp. LA3.X Isolate Nodule
652 2935694250 Bradyrhizobium sp. LA6.1 Isolate Nodule
653 2935703347 Bradyrhizobium sp. LA6.10 Isolate Nodule
654 2935713505 Bradyrhizobium sp. LA6.12 Isolate Nodule
655 2935722832 Bradyrhizobium sp. LA6.3 Isolate Nodule
656 2935732158 Bradyrhizobium sp. LA6.4 Isolate Nodule
657 2935741537 Bradyrhizobium sp. LA6.7 Isolate Nodule
658 2935750917 Bradyrhizobium sp. LA6.8 Isolate Nodule
659 2935760218 Bradyrhizobium sp. LA7.1 Isolate Nodule
660 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
661 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
662 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
663 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
664 2935801545 Bradyrhizobium sp. RT10b Isolate Nodule
665 2935810662 Bradyrhizobium sp. RT3a Isolate Nodule
666 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
667 2935827899 Bradyrhizobium sp. RT4a Isolate Nodule
668 2935837841 Bradyrhizobium sp. RT4b Isolate Nodule
669 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
670 2935855204 Bradyrhizobium sp. RT7b Isolate Nodule
671 2935864058 Bradyrhizobium sp. RT9a Isolate Nodule
672 2935873716 Bradyrhizobium sp. RT9b Isolate Nodule
673 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
674 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
675 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
676 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
677 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
678 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
679 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
680 2935959822 Bradyrhizobium sp. F1.4.3 Isolate Nodule
681 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
682 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
683 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
684 2935992306 Bradyrhizobium sp. I1.7.5 Isolate Nodule
685 2936002035 Bradyrhizobium sp. I1.8.5 Isolate Nodule
686 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
687 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
688 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
689 2936037263 Bradyrhizobium sp. JR18.2 Isolate Nodule
690 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
691 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
692 2940556831 Bradyrhizobium sp. LA8.1 Isolate Nodule
693 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
694 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
695 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
696 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
697 2941538514 Bradyrhizobium sp. RT11b Isolate Nodule
698 3005483717 Bradyrhizobium agreste CNPSo 4010 Isolate Unclassified
699 3005506211 Bradyrhizobium diazoefficiens SZCCT0449 Isolate Unclassified
700 3005587118 Bradyrhizobium glycinis CNPSo 4016 Isolate Unclassified
701 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
702 3005710791 Bradyrhizobium genosp. B BDV5040 Isolate Unclassified
703 3005718088 Bradyrhizobium sp. CCBAU 53338 Isolate Nodule
704 8006926726 Bradyrhizobium guangdongense SM32 Isolate Unclassified
705 8006933436 Bradyrhizobium septentrionale 7(2017) Isolate Unclassified
706 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
707 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
708 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
709 8006994254 Bradyrhizobium sp. sGM-13 Isolate Nodule
710 8016511872 Bradyrhizobium sp. S3.14.4 Isolate Nodule
711 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
712 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
713 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
714 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
715 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
716 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
717 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
718 8016603502 Bradyrhizobium sp. LB7.2 Isolate Nodule
719 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
720 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
721 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
722 8017057580 Bradyrhizobium sp. S3.7.6 Isolate Nodule
723 8019538911 Bradyrhizobium sp. LB9.1b Isolate Nodule
724 8019547302 Bradyrhizobium sp. LB1.3 Isolate Nodule
725 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
726 8019576017 Bradyrhizobium sp. i1.7.7 Isolate Nodule
727 8019586578 Bradyrhizobium sp. i1.4.4 Isolate Nodule
728 8019597564 Bradyrhizobium sp. i1.3.6 Isolate Nodule
729 8019608314 Bradyrhizobium sp. i1.3.1 Isolate Nodule
730 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
731 8019629233 Bradyrhizobium sp. GM6.1 Isolate Nodule
732 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
733 8019659431 Bradyrhizobium sp. GM22.5 Isolate Nodule
734 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
735 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
736 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
737 8055742211 Bradyrhizobium japonicum 5038 Isolate Nodule
738 8056673599 Bradyrhizobium hereditatis WSM 1738 Isolate Nodule
739 8056681323 Bradyrhizobium cenepequi CNPSo 4026 Isolate Nodule
740 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule
741 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 84.23
Metatranscriptomes 0
Isolates 15.77

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.53
Nodule 11.79
Rhizoplane 6.35
Rhizosphere 60.38
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009104 3300001979 Bacteria 3904
2 JGI24739J22299_10051274 3300001989 Bacteria 1331
3 JGI25151J46595_10000339 3300003187 Bacteria 50125
4 JGI25151J46595_10000511 3300003187 Bacteria 36352
5 JGI25406J46586_10000037 3300003203 Bacteria 60422
6 JGI25406J46586_10011025 3300003203 Bacteria 3975
7 JGI25165J46597_1010949 3300003214 Bacteria 1308
8 JGI25165J46597_1011014 3300003214 Bacteria 1302
9 JGI25153J46596_10017912 3300003215 Bacteria 2770
10 JGI25160J50197_1001469 3300003354 Bacteria 11758
11 JGI25160J50197_1006549 3300003354 Bacteria 4697
12 JGI25161J50226_1011108 3300003374 Bacteria 1153
13 JGI25404J52841_10009407 3300003659 Bacteria 2090
14 Ga0055526_1003688 3300003771 Bacteria 9577
15 Ga0055526_1017843 3300003771 Bacteria 2685
16 Ga0055526_1019303 3300003771 Bacteria 2490
17 Ga0055537_1003689 3300003773 Bacteria 4633
18 Ga0055528_1012512 3300003790 Bacteria 3285
19 Ga0055531_10001877 3300003794 Bacteria 14724
20 Ga0055543_1020848 3300004625 Bacteria 1200
21 Ga0065165_1001029 3300005262 Bacteria 33794
22 Ga0065165_1001154 3300005262 Bacteria 30829
23 Ga0065165_1002192 3300005262 Bacteria 17555
24 Ga0065165_1036438 3300005262 Bacteria 1500
25 Ga0070658_10013187 3300005327 Bacteria 6630
26 Ga0070658_10084612 3300005327 Bacteria 2608
27 Ga0070683_100030576 3300005329 Bacteria 4890
28 Ga0070683_100105357 3300005329 Bacteria 2659
29 Ga0070683_100209347 3300005329 Bacteria 1852
30 Ga0070670_100012038 3300005331 Bacteria 7400
31 Ga0068869_100117711 3300005334 Bacteria 2028
32 Ga0070680_100010838 3300005336 Bacteria 7039
33 Ga0070680_100054220 3300005336 Bacteria 3273
34 Ga0070680_100159319 3300005336 Bacteria 1896
35 Ga0070682_100142269 3300005337 Bacteria 1637
36 Ga0070682_100155993 3300005337 Bacteria 1572
37 Ga0068868_100184941 3300005338 Bacteria 1730
38 Ga0068868_100285209 3300005338 Bacteria 1399
39 Ga0070660_100045764 3300005339 Bacteria 3351
40 Ga0070660_100126166 3300005339 Bacteria 2045
41 Ga0070660_100305969 3300005339 Bacteria 1304
42 Ga0070689_100092651 3300005340 Bacteria 2384
43 Ga0070689_100107729 3300005340 Bacteria 2213
44 Ga0070691_10148549 3300005341 Bacteria 1200
45 Ga0070687_100020363 3300005343 Bacteria 3101
46 Ga0070661_100021771 3300005344 Bacteria 4584
47 Ga0070661_100053350 3300005344 Bacteria 2958
48 Ga0070661_100103174 3300005344 Bacteria 2124
49 Ga0070669_100019282 3300005353 Bacteria 4872
50 Ga0070669_100114802 3300005353 Bacteria 2048
51 Ga0070671_100198882 3300005355 Bacteria 1699
52 Ga0070674_100014497 3300005356 Bacteria 4900
53 Ga0070674_100151333 3300005356 Bacteria 1751
54 Ga0070688_100069361 3300005365 Bacteria 2250
55 Ga0070688_100127480 3300005365 Bacteria 1712
56 Ga0070659_100189375 3300005366 Bacteria 1690
57 Ga0070667_100366666 3300005367 Bacteria 1306
58 Ga0070709_10004068 3300005434 Bacteria 7892
59 Ga0070709_10007215 3300005434 Bacteria 6089
60 Ga0070709_10167440 3300005434 Bacteria 1533
61 Ga0070714_100002014 3300005435 Bacteria 14871
62 Ga0070714_100101837 3300005435 Bacteria 2531
63 Ga0070713_100004390 3300005436 Bacteria 9476
64 Ga0070713_100022427 3300005436 Bacteria 4879
65 Ga0070713_100358163 3300005436 Bacteria 1355
66 Ga0070710_10001042 3300005437 Bacteria 13175
67 Ga0070710_10001151 3300005437 Bacteria 12525
68 Ga0070710_10003221 3300005437 Bacteria 7731
69 Ga0070710_10096486 3300005437 Bacteria 1752
70 Ga0070701_10073112 3300005438 Bacteria 1838
71 Ga0070711_100006813 3300005439 Bacteria 6919
72 Ga0070711_100021205 3300005439 Bacteria 4197
73 Ga0070711_100033555 3300005439 Bacteria 3418
74 Ga0070711_100287129 3300005439 Bacteria 1304
75 Ga0070700_100030000 3300005441 Bacteria 3246
76 Ga0070663_100011844 3300005455 Bacteria 5495
77 Ga0070663_100018623 3300005455 Bacteria 4556
78 Ga0070663_100079114 3300005455 Bacteria 2411
79 Ga0070663_100086319 3300005455 Bacteria 2317
80 Ga0070663_100096317 3300005455 Bacteria 2201
81 Ga0070663_100101611 3300005455 Bacteria 2146
82 Ga0070678_100199754 3300005456 Bacteria 1649
83 Ga0070662_100007653 3300005457 Bacteria 7009
84 Ga0070662_100441925 3300005457 Bacteria 1078
85 Ga0070681_10005467 3300005458 Bacteria 12272
86 Ga0070681_10005807 3300005458 Bacteria 11943
87 Ga0070681_10090767 3300005458 Bacteria 3005
88 Ga0068867_100018925 3300005459 Bacteria 4901
89 Ga0068867_100024373 3300005459 Bacteria 4334
90 Ga0070685_10008823 3300005466 Bacteria 5195
91 Ga0070698_100149838 3300005471 Bacteria 2281
92 Ga0070679_100167416 3300005530 Bacteria 2171
93 Ga0070679_100204651 3300005530 Bacteria 1938
94 Ga0070684_100010049 3300005535 Bacteria 7481
95 Ga0070684_100036442 3300005535 Bacteria 4214
96 Ga0070684_100105675 3300005535 Bacteria 2519
97 Ga0068853_100000394 3300005539 Bacteria 29870
98 Ga0068853_100037399 3300005539 Bacteria 4130
99 Ga0068853_100088582 3300005539 Bacteria 2717
100 Ga0068853_100247886 3300005539 Bacteria 1634
101 Ga0068853_100321887 3300005539 Bacteria 1434
102 Ga0070672_100035524 3300005543 Bacteria 3789
103 Ga0070672_100118458 3300005543 Bacteria 2165
104 Ga0070672_100165647 3300005543 Bacteria 1836
105 Ga0070686_100026130 3300005544 Bacteria 3520
106 Ga0070665_100015225 3300005548 Bacteria 7720
107 Ga0070665_100026195 3300005548 Bacteria 5872
108 Ga0070665_100036826 3300005548 Bacteria 4920
109 Ga0070665_100057997 3300005548 Bacteria 3882
110 Ga0070665_100067534 3300005548 Bacteria 3585
111 Ga0070665_100107799 3300005548 Bacteria 2788
112 Ga0070665_100161918 3300005548 Bacteria 2239
113 Ga0070665_100202518 3300005548 Bacteria 1985
114 Ga0068855_100160160 3300005563 Bacteria 2555
115 Ga0068855_100160864 3300005563 Bacteria 2549
116 Ga0068855_100200378 3300005563 Bacteria 2247
117 Ga0068855_100212068 3300005563 Bacteria 2175
118 Ga0068855_100232792 3300005563 Bacteria 2062
119 Ga0068855_100237584 3300005563 Bacteria 2037
120 Ga0070664_100132579 3300005564 Bacteria 2189
121 Ga0070664_100193038 3300005564 Bacteria 1815
122 Ga0068857_100023868 3300005577 Bacteria 5382
123 Ga0068857_100061244 3300005577 Bacteria 3343
124 Ga0068857_100093922 3300005577 Bacteria 2686
125 Ga0068857_100113188 3300005577 Bacteria 2440
126 Ga0068857_100188973 3300005577 Bacteria 1876
127 Ga0068857_100271465 3300005577 Bacteria 1559
128 Ga0068857_100285121 3300005577 Bacteria 1520
129 Ga0068854_100011204 3300005578 Bacteria 5827
130 Ga0068856_100000905 3300005614 Bacteria 31696
131 Ga0068856_100002885 3300005614 Bacteria 17586
132 Ga0068856_100164263 3300005614 Bacteria 2231
133 Ga0068856_100184861 3300005614 Bacteria 2098
134 Ga0068856_100237104 3300005614 Bacteria 1840
135 Ga0068856_100293010 3300005614 Bacteria 1644
136 Ga0068856_100494579 3300005614 Bacteria 1244
137 Ga0070702_100022702 3300005615 Bacteria 3322
138 Ga0070702_100121076 3300005615 Bacteria 1638
139 Ga0068852_100014713 3300005616 Bacteria 6035
140 Ga0068852_100236269 3300005616 Bacteria 1745
141 Ga0068859_100085781 3300005617 Bacteria 3194
142 Ga0068859_100162077 3300005617 Bacteria 2315
143 Ga0068859_100307388 3300005617 Bacteria 1679
144 Ga0068864_100155422 3300005618 Bacteria 2076
145 Ga0068864_100156373 3300005618 Bacteria 2069
146 Ga0068864_100243019 3300005618 Bacteria 1668
147 Ga0068861_100192402 3300005719 Bacteria 1706
148 Ga0068851_10004128 3300005834 Bacteria 6534
149 Ga0068851_10023841 3300005834 Bacteria 2993
150 Ga0068870_10018341 3300005840 Bacteria 3377
151 Ga0068863_100168195 3300005841 Bacteria 2102
152 Ga0068863_100183208 3300005841 Bacteria 2010
153 Ga0068863_100198187 3300005841 Bacteria 1931
154 Ga0068858_100117270 3300005842 Bacteria 2488
155 Ga0068858_100147996 3300005842 Bacteria 2206
156 Ga0068860_100000840 3300005843 Bacteria 34384
157 Ga0068860_100013212 3300005843 Bacteria 8100
158 Ga0068860_100023212 3300005843 Bacteria 5995
159 Ga0068860_100190751 3300005843 Bacteria 1983
160 Ga0068862_100174421 3300005844 Bacteria 1926
161 Ga0068862_100254431 3300005844 Bacteria 1601
162 Ga0081455_10022044 3300005937 Bacteria 5963
163 Ga0081455_10032010 3300005937 Bacteria 4747
164 Ga0081455_10035974 3300005937 Bacteria 4416
165 Ga0081455_10043817 3300005937 Bacteria 3911
166 Ga0081455_10049455 3300005937 Bacteria 3624
167 Ga0081538_10035922 3300005981 Bacteria 3245
168 Ga0081540_1003518 3300005983 Bacteria 12357
169 Ga0081540_1007804 3300005983 Bacteria 7571
170 Ga0081540_1018183 3300005983 Bacteria 4323
171 Ga0081540_1034156 3300005983 Bacteria 2748
172 Ga0081540_1073564 3300005983 Bacteria 1570
173 Ga0081539_10000129 3300005985 Bacteria 178675
174 Ga0081539_10001014 3300005985 Bacteria 51820
175 Ga0081539_10013531 3300005985 Bacteria 6139
176 Ga0070717_10001143 3300006028 Bacteria 17925
177 Ga0070717_10008317 3300006028 Bacteria 7747
178 Ga0070717_10208823 3300006028 Bacteria 1713
179 Ga0075365_10010667 3300006038 Bacteria 5366
180 Ga0075365_10023623 3300006038 Bacteria 3869
181 Ga0075365_10184713 3300006038 Bacteria 1458
182 Ga0075365_10187110 3300006038 Bacteria 1448
183 Ga0075363_100000174 3300006048 Bacteria 16828
184 Ga0075363_100016650 3300006048 Bacteria 3634
185 Ga0075363_100239604 3300006048 Bacteria 1043
186 Ga0075364_10000925 3300006051 Bacteria 15511
187 Ga0075364_10104086 3300006051 Bacteria 1891
188 Ga0075364_10148103 3300006051 Bacteria 1581
189 Ga0070715_10004589 3300006163 Bacteria 4549
190 Ga0070716_100000855 3300006173 Bacteria 13112
191 Ga0070716_100001543 3300006173 Bacteria 10329
192 Ga0070716_100140567 3300006173 Bacteria 1539
193 Ga0070716_100170752 3300006173 Bacteria 1419
194 Ga0070712_100002401 3300006175 Bacteria 11532
195 Ga0070712_100014160 3300006175 Bacteria 5117
196 Ga0070712_100023032 3300006175 Bacteria 4109
197 Ga0070712_100027911 3300006175 Bacteria 3772
198 Ga0070712_100231121 3300006175 Bacteria 1469
199 Ga0075362_10065646 3300006177 Bacteria 1648
200 Ga0075367_10032163 3300006178 Bacteria 3016
201 Ga0075367_10148236 3300006178 Bacteria 1455
202 Ga0075369_10026154 3300006186 Bacteria 2431
203 Ga0097621_100123307 3300006237 Bacteria 2199
204 Ga0097621_100124709 3300006237 Bacteria 2187
205 Ga0075370_10105155 3300006353 Bacteria 1636
206 Ga0075370_10164575 3300006353 Bacteria 1302
207 Ga0068871_100062766 3300006358 Bacteria 3037
208 Ga0075428_100017893 3300006844 Bacteria 7832
209 Ga0075428_100060675 3300006844 Bacteria 4141
210 Ga0075428_100087121 3300006844 Bacteria 3406
211 Ga0075430_100076366 3300006846 Bacteria 2808
212 Ga0075430_100103191 3300006846 Bacteria 2381
213 Ga0075431_100064819 3300006847 Bacteria 3773
214 Ga0075431_100074655 3300006847 Bacteria 3498
215 Ga0075431_100182975 3300006847 Bacteria 2150
216 Ga0075433_10415822 3300006852 Bacteria 1186
217 Ga0075434_100073828 3300006871 Bacteria 3404
218 Ga0068865_100057395 3300006881 Bacteria 2715
219 Ga0068865_100066160 3300006881 Bacteria 2549
220 Ga0097620_100085777 3300006931 Bacteria 3194
221 Ga0097620_100162075 3300006931 Bacteria 2315
222 Ga0097620_100307383 3300006931 Bacteria 1679
223 Ga0099824_1005437 3300006942 Bacteria 17948
224 Ga0099824_1019303 3300006942 Bacteria 5353
225 Ga0099823_1021543 3300006944 Bacteria 6021
226 Ga0099794_10092105 3300007265 Bacteria 1505
227 Ga0105240_10003827 3300009093 Bacteria 23265
228 Ga0105240_10019441 3300009093 Bacteria 9074
229 Ga0105240_10341685 3300009093 Bacteria 1700
230 Ga0111539_10076597 3300009094 Bacteria 3938
231 Ga0111539_10241498 3300009094 Bacteria 2103
232 Ga0105245_10154763 3300009098 Bacteria 2171
233 Ga0105245_10237695 3300009098 Bacteria 1764
234 Ga0105245_10249088 3300009098 Bacteria 1725
235 Ga0105247_10011850 3300009101 Bacteria 5242
236 Ga0105247_10045923 3300009101 Bacteria 2681
237 Ga0114129_10005063 3300009147 Bacteria 18550
238 Ga0114129_10098068 3300009147 Bacteria 4056
239 Ga0114129_10294007 3300009147 Bacteria 2167
240 Ga0114129_10526533 3300009147 Bacteria 1540
241 Ga0105243_10057159 3300009148 Bacteria 3105
242 Ga0105243_10140789 3300009148 Bacteria 2058
243 Ga0105241_10000556 3300009174 Bacteria 28213
244 Ga0105241_10044147 3300009174 Bacteria 3377
245 Ga0105241_10061791 3300009174 Bacteria 2886
246 Ga0105241_10135187 3300009174 Bacteria 2001
247 Ga0105241_10413717 3300009174 Bacteria 1185
248 Ga0105248_10058261 3300009177 Bacteria 4337
249 Ga0105248_10141182 3300009177 Bacteria 2717
250 Ga0105248_10272296 3300009177 Bacteria 1906
251 Ga0105248_10755432 3300009177 Bacteria 1097
252 Ga0105237_10017741 3300009545 Bacteria 7379
253 Ga0105237_10026514 3300009545 Bacteria 5923
254 Ga0105237_10059686 3300009545 Bacteria 3816
255 Ga0105237_10073147 3300009545 Bacteria 3420
256 Ga0105237_10159141 3300009545 Bacteria 2256
257 Ga0105238_10001118 3300009551 Bacteria 27100
258 Ga0105238_10344110 3300009551 Bacteria 1480
259 Ga0105239_10003377 3300010375 Bacteria 19579
260 Ga0105239_10010894 3300010375 Bacteria 10159
261 Ga0105239_10034448 3300010375 Bacteria 5560
262 Ga0105239_10059927 3300010375 Bacteria 4177
263 Ga0105239_10152353 3300010375 Bacteria 2580
264 Ga0105239_10189763 3300010375 Bacteria 2301
265 Ga0105239_10199396 3300010375 Bacteria 2242
266 Ga0105239_10349306 3300010375 Bacteria 1670
267 Ga0105246_10070789 3300011119 Bacteria 2454
268 Ga0157373_10020152 3300013100 Bacteria 4851
269 Ga0157373_10335880 3300013100 Bacteria 1076
270 Ga0157370_10061898 3300013104 Bacteria 3551
271 Ga0157370_10073237 3300013104 Bacteria 3232
272 Ga0157370_10133128 3300013104 Bacteria 2318
273 Ga0157370_10390335 3300013104 Bacteria 1282
274 Ga0157369_10074086 3300013105 Bacteria 3651
275 Ga0157369_10111585 3300013105 Bacteria 2906
276 Ga0171462_1024 3300013250 Bacteria 129278
277 Ga0157374_10025168 3300013296 Bacteria 5340
278 Ga0157374_10068395 3300013296 Bacteria 3342
279 Ga0157374_10251918 3300013296 Bacteria 1738
280 Ga0157374_10384031 3300013296 Bacteria 1399
281 Ga0157378_10048834 3300013297 Bacteria 3764
282 Ga0163162_10025657 3300013306 Bacteria 5827
283 Ga0163162_10308733 3300013306 Bacteria 1714
284 Ga0157375_10296004 3300013308 Bacteria 1781
285 Ga0157380_10180227 3300014326 Bacteria 1855
286 Ga0157377_10020563 3300014745 Bacteria 3460
287 Ga0157379_10158582 3300014968 Bacteria 2042
288 Ga0157376_10245231 3300014969 Bacteria 1671
289 Ga0157376_10247854 3300014969 Bacteria 1662
290 Ga0157376_10268446 3300014969 Bacteria 1602
291 Ga0163161_10161517 3300017792 Bacteria 1708
292 Ga0214544_1000087 3300021320 Bacteria 119600
293 Ga0214542_1000018 3300021321 Bacteria 202226
294 Ga0214545_1000009 3300021324 Bacteria 202915
295 Ga0214543_1000037 3300021327 Bacteria 182113
296 Ga0213873_10017573 3300021358 Bacteria 1634
297 Ga0213872_10029426 3300021361 Bacteria 2519
298 Ga0213876_10000506 3300021384 Bacteria 30344
299 Ga0213876_10085240 3300021384 Bacteria 1672
300 Ga0213871_10014861 3300021441 Bacteria 1853
301 Ga0209563_102656 3300025230 Bacteria 3959
302 Ga0209677_100279 3300025253 Bacteria 34040
303 Ga0209677_101823 3300025253 Bacteria 8714
304 Ga0209148_1000743 3300025254 Bacteria 25189
305 Ga0209233_1002530 3300025261 Bacteria 6678
306 Ga0209233_1020556 3300025261 Bacteria 1728
307 Ga0209565_1000234 3300025263 Bacteria 60830
308 Ga0209673_1001141 3300025273 Bacteria 29196
309 Ga0209673_1016587 3300025273 Bacteria 2746
310 Ga0209675_1005480 3300025291 Bacteria 5305
311 Ga0209025_1000017 3300025294 Bacteria 768983
312 Ga0209564_1000044 3300025295 Bacteria 381017
313 Ga0209564_1001508 3300025295 Bacteria 23302
314 Ga0209564_1001652 3300025295 Bacteria 21520
315 Ga0209758_1000030 3300025297 Bacteria 509217
316 Ga0209758_1000884 3300025297 Bacteria 41143
317 Ga0209758_1000949 3300025297 Bacteria 39098
318 Ga0209758_1001021 3300025297 Bacteria 37026
319 Ga0209758_1003078 3300025297 Bacteria 15842
320 Ga0209758_1003950 3300025297 Bacteria 12878
321 Ga0209758_1004035 3300025297 Bacteria 12664
322 Ga0209758_1013339 3300025297 Bacteria 4491
323 Ga0209758_1031502 3300025297 Bacteria 2173
324 Ga0209256_1001055 3300025299 Bacteria 32004
325 Ga0209256_1005633 3300025299 Bacteria 7078
326 Ga0207426_1002551 3300025302 Bacteria 11405
327 Ga0207426_1008813 3300025302 Bacteria 4038
328 Ga0209257_1000246 3300025304 Bacteria 125942
329 Ga0209257_1001419 3300025304 Bacteria 28521
330 Ga0207656_10000874 3300025321 Bacteria 9816
331 Ga0207656_10025611 3300025321 Bacteria 2396
332 Ga0207653_10010152 3300025885 Bacteria 2936
333 Ga0207692_10015708 3300025898 Bacteria 3338
334 Ga0207692_10019740 3300025898 Bacteria 3051
335 Ga0207692_10053400 3300025898 Bacteria 2058
336 Ga0207710_10024653 3300025900 Bacteria 2592
337 Ga0207688_10003085 3300025901 Bacteria 9093
338 Ga0207688_10054536 3300025901 Bacteria 2243
339 Ga0207647_10001617 3300025904 Bacteria 17326
340 Ga0207647_10009026 3300025904 Bacteria 7101
341 Ga0207647_10055203 3300025904 Bacteria 2441
342 Ga0207685_10004594 3300025905 Bacteria 3536
343 Ga0207699_10000614 3300025906 Bacteria 17364
344 Ga0207699_10012377 3300025906 Bacteria 4340
345 Ga0207699_10013219 3300025906 Bacteria 4219
346 Ga0207699_10015252 3300025906 Bacteria 3987
347 Ga0207645_10004656 3300025907 Bacteria 10106
348 Ga0207643_10024474 3300025908 Bacteria 3332
349 Ga0207643_10211894 3300025908 Bacteria 1183
350 Ga0207705_10033296 3300025909 Bacteria 3680
351 Ga0207705_10088600 3300025909 Bacteria 2264
352 Ga0207705_10091227 3300025909 Bacteria 2231
353 Ga0207654_10029065 3300025911 Bacteria 3021
354 Ga0207654_10030270 3300025911 Bacteria 2970
355 Ga0207654_10054556 3300025911 Bacteria 2310
356 Ga0207707_10000507 3300025912 Bacteria 40006
357 Ga0207707_10004195 3300025912 Bacteria 12767
358 Ga0207707_10051011 3300025912 Bacteria 3603
359 Ga0207695_10000059 3300025913 Bacteria 363920
360 Ga0207695_10000366 3300025913 Bacteria 103345
361 Ga0207695_10152138 3300025913 Bacteria 2252
362 Ga0207695_10167673 3300025913 Bacteria 2123
363 Ga0207671_10012190 3300025914 Bacteria 6935
364 Ga0207671_10049183 3300025914 Bacteria 3121
365 Ga0207671_10058501 3300025914 Bacteria 2858
366 Ga0207671_10091293 3300025914 Bacteria 2295
367 Ga0207671_10116613 3300025914 Bacteria 2037
368 Ga0207671_10146678 3300025914 Bacteria 1821
369 Ga0207693_10000073 3300025915 Bacteria 89380
370 Ga0207693_10006707 3300025915 Bacteria 9504
371 Ga0207693_10008050 3300025915 Bacteria 8652
372 Ga0207693_10203660 3300025915 Bacteria 1556
373 Ga0207663_10003754 3300025916 Bacteria 7489
374 Ga0207663_10102911 3300025916 Bacteria 1922
375 Ga0207660_10016060 3300025917 Bacteria 4950
376 Ga0207660_10033087 3300025917 Bacteria 3573
377 Ga0207662_10005397 3300025918 Bacteria 6809
378 Ga0207657_10005397 3300025919 Bacteria 13360
379 Ga0207657_10114625 3300025919 Bacteria 2222
380 Ga0207657_10130648 3300025919 Bacteria 2058
381 Ga0207657_10191881 3300025919 Bacteria 1647
382 Ga0207657_10196434 3300025919 Bacteria 1625
383 Ga0207649_10021159 3300025920 Bacteria 3739
384 Ga0207649_10078684 3300025920 Bacteria 2128
385 Ga0207652_10004176 3300025921 Bacteria 11779
386 Ga0207681_10196596 3300025923 Bacteria 1546
387 Ga0207694_10001314 3300025924 Bacteria 21361
388 Ga0207650_10032958 3300025925 Bacteria 3750
389 Ga0207650_10351681 3300025925 Bacteria 1212
390 Ga0207687_10019263 3300025927 Bacteria 4519
391 Ga0207687_10136956 3300025927 Bacteria 1853
392 Ga0207700_10018518 3300025928 Bacteria 4682
393 Ga0207700_10044222 3300025928 Bacteria 3277
394 Ga0207700_10049231 3300025928 Bacteria 3134
395 Ga0207700_10051688 3300025928 Bacteria 3068
396 Ga0207700_10083105 3300025928 Bacteria 2506
397 Ga0207700_10162917 3300025928 Bacteria 1854
398 Ga0207700_10274425 3300025928 Bacteria 1448
399 Ga0207664_10029373 3300025929 Bacteria 4186
400 Ga0207664_10060869 3300025929 Bacteria 3011
401 Ga0207664_10092204 3300025929 Bacteria 2486
402 Ga0207664_10182671 3300025929 Bacteria 1801
403 Ga0207664_10261712 3300025929 Bacteria 1513
404 Ga0207706_10007519 3300025933 Bacteria 10081
405 Ga0207706_10025021 3300025933 Bacteria 5353
406 Ga0207706_10064020 3300025933 Bacteria 3237
407 Ga0207706_10234414 3300025933 Bacteria 1605
408 Ga0207709_10151369 3300025935 Bacteria 1607
409 Ga0207665_10000629 3300025939 Bacteria 23661
410 Ga0207665_10029050 3300025939 Bacteria 3656
411 Ga0207665_10110878 3300025939 Bacteria 1928
412 Ga0207691_10058700 3300025940 Bacteria 3499
413 Ga0207691_10381644 3300025940 Bacteria 1203
414 Ga0207711_10073672 3300025941 Bacteria 2968
415 Ga0207711_10087064 3300025941 Bacteria 2740
416 Ga0207711_10452457 3300025941 Bacteria 1195
417 Ga0207689_10008326 3300025942 Bacteria 9034
418 Ga0207689_10010026 3300025942 Bacteria 8168
419 Ga0207661_10067769 3300025944 Bacteria 2903
420 Ga0207661_10077070 3300025944 Bacteria 2740
421 Ga0207661_10342179 3300025944 Bacteria 1348
422 Ga0207679_10063418 3300025945 Bacteria 2758
423 Ga0207667_10002298 3300025949 Bacteria 24013
424 Ga0207667_10013554 3300025949 Bacteria 9320
425 Ga0207667_10030667 3300025949 Bacteria 5812
426 Ga0207667_10137864 3300025949 Bacteria 2512
427 Ga0207667_10155155 3300025949 Bacteria 2356
428 Ga0207667_10234286 3300025949 Bacteria 1879
429 Ga0207712_10003482 3300025961 Bacteria 9932
430 Ga0207712_10094761 3300025961 Bacteria 2206
431 Ga0207668_10018573 3300025972 Bacteria 4379
432 Ga0207640_10005225 3300025981 Bacteria 7065
433 Ga0207640_10007537 3300025981 Bacteria 6010
434 Ga0207640_10015748 3300025981 Bacteria 4383
435 Ga0207658_10062745 3300025986 Bacteria 2782
436 Ga0207658_10191381 3300025986 Bacteria 1701
437 Ga0207658_10207632 3300025986 Bacteria 1639
438 Ga0207677_10006929 3300026023 Bacteria 6230
439 Ga0207677_10103142 3300026023 Bacteria 2105
440 Ga0207677_10173295 3300026023 Bacteria 1690
441 Ga0207703_10051866 3300026035 Bacteria 3327
442 Ga0207703_10208547 3300026035 Bacteria 1741
443 Ga0207703_10347467 3300026035 Bacteria 1365
444 Ga0207639_10018749 3300026041 Bacteria 4920
445 Ga0207639_10067837 3300026041 Bacteria 2777
446 Ga0207639_10258180 3300026041 Bacteria 1523
447 Ga0207639_10393497 3300026041 Bacteria 1247
448 Ga0207678_10014114 3300026067 Bacteria 7026
449 Ga0207678_10021891 3300026067 Bacteria 5604
450 Ga0207678_10024742 3300026067 Bacteria 5242
451 Ga0207678_10050636 3300026067 Bacteria 3588
452 Ga0207678_10067301 3300026067 Bacteria 3075
453 Ga0207678_10070754 3300026067 Bacteria 2991
454 Ga0207678_10286285 3300026067 Bacteria 1415
455 Ga0207708_10000628 3300026075 Bacteria 27158
456 Ga0207708_10045582 3300026075 Bacteria 3341
457 Ga0207708_10217563 3300026075 Bacteria 1529
458 Ga0207702_10000090 3300026078 Bacteria 104566
459 Ga0207702_10001808 3300026078 Bacteria 21040
460 Ga0207702_10019738 3300026078 Bacteria 5580
461 Ga0207702_10323527 3300026078 Bacteria 1469
462 Ga0207641_10332373 3300026088 Bacteria 1444
463 Ga0207648_10032162 3300026089 Bacteria 4634
464 Ga0207648_10059696 3300026089 Bacteria 3326
465 Ga0207648_10217876 3300026089 Bacteria 1696
466 Ga0207648_10350338 3300026089 Bacteria 1331
467 Ga0207676_10114012 3300026095 Bacteria 2267
468 Ga0207674_10003131 3300026116 Bacteria 20388
469 Ga0207674_10010715 3300026116 Bacteria 10352
470 Ga0207674_10025881 3300026116 Bacteria 6246
471 Ga0207674_10053308 3300026116 Bacteria 4123
472 Ga0207674_10108340 3300026116 Bacteria 2755
473 Ga0207674_10129512 3300026116 Bacteria 2487
474 Ga0207675_100038377 3300026118 Bacteria 4470
475 Ga0207675_100241620 3300026118 Bacteria 1745
476 Ga0207675_100276403 3300026118 Bacteria 1631
477 Ga0207683_10060969 3300026121 Bacteria 3318
478 Ga0207683_10157970 3300026121 Bacteria 2048
479 Ga0207683_10211137 3300026121 Bacteria 1767
480 Ga0207683_10433859 3300026121 Bacteria 1210
481 Ga0207698_10005567 3300026142 Bacteria 7789
482 Ga0209389_1000300 3300027296 Bacteria 30909
483 Ga0209389_1000600 3300027296 Bacteria 22104
484 Ga0209589_1000026 3300027357 Bacteria 158154
485 Ga0209589_1000103 3300027357 Bacteria 86516
486 Ga0209489_100046 3300027361 Bacteria 158154
487 Ga0209489_100304 3300027361 Bacteria 86516
488 Ga0209489_105428 3300027361 Bacteria 22104
489 Ga0209700_100047 3300027363 Bacteria 158154
490 Ga0209700_104718 3300027363 Bacteria 24141
491 Ga0209588_1047760 3300027671 Bacteria 1385
492 Ga0207428_10232932 3300027907 Bacteria 1378
493 Ga0268266_10002806 3300028379 Bacteria 18166
494 Ga0268266_10017176 3300028379 Bacteria 6178
495 Ga0268266_10047899 3300028379 Bacteria 3663
496 Ga0268266_10085822 3300028379 Bacteria 2751
497 Ga0268266_10190731 3300028379 Bacteria 1871
498 Ga0268266_10309692 3300028379 Bacteria 1475
499 Ga0268265_10071041 3300028380 Bacteria 2709
500 Ga0268265_10141454 3300028380 Bacteria 2015
501 Ga0268264_10000050 3300028381 Bacteria 323697
502 Ga0268264_10068650 3300028381 Bacteria 2996
503 Ga0268264_10116325 3300028381 Bacteria 2350
504 Ga0265336_10007697 3300028666 Bacteria 3820
505 Ga0307517_10001290 3300028786 Bacteria 42017
506 Ga0307515_10021936 3300028794 Bacteria 11290
507 Ga0307515_10054429 3300028794 Bacteria 5875
508 Ga0307515_10124283 3300028794 Bacteria 2896
509 Ga0307515_10144547 3300028794 Bacteria 2528
510 Ga0265338_10000621 3300028800 Bacteria 61786
511 Ga0307511_10033707 3300030521 Bacteria 4514
512 Ga0265330_10017512 3300031235 Bacteria 3298
513 Ga0265330_10035491 3300031235 Bacteria 2224
514 Ga0265332_10017880 3300031238 Bacteria 3126
515 Ga0265328_10002266 3300031239 Bacteria 8668
516 Ga0265329_10039751 3300031242 Bacteria 1511
517 Ga0265340_10017259 3300031247 Bacteria 3731
518 Ga0265340_10026191 3300031247 Bacteria 2949
519 Ga0265339_10019152 3300031249 Bacteria 4021
520 Ga0265339_10053462 3300031249 Bacteria 2197
521 Ga0265331_10002340 3300031250 Bacteria 12874
522 Ga0265316_10023990 3300031344 Bacteria 5121
523 Ga0307509_10052922 3300031507 Bacteria 4332
524 Ga0307509_10062012 3300031507 Bacteria 3944
525 Ga0307509_10066790 3300031507 Bacteria 3770
526 Ga0307509_10188611 3300031507 Bacteria 1916
527 Ga0307408_100029075 3300031548 Bacteria 3826
528 Ga0307508_10000005 3300031616 Bacteria 286511
529 Ga0307508_10039337 3300031616 Bacteria 4249
530 Ga0265314_10004999 3300031711 Bacteria 12078
531 Ga0265342_10006002 3300031712 Bacteria 9133
532 Ga0265342_10071404 3300031712 Bacteria 2023
533 Ga0307516_10018977 3300031730 Bacteria 7137
534 Ga0307516_10163452 3300031730 Bacteria 1974
535 Ga0307405_10125334 3300031731 Bacteria 1765
536 Ga0307406_10293655 3300031901 Bacteria 1245
537 Ga0307409_100111075 3300031995 Bacteria 2298
538 Ga0307411_10065175 3300032005 Bacteria 2442
539 Ga0307415_100035640 3300032126 Bacteria 3251
540 Ga0307415_100114114 3300032126 Bacteria 2011
541 Ga0307415_100158925 3300032126 Bacteria 1749
542 Ga0307507_10028702 3300033179 Bacteria 5920
543 Ga0307510_10017519 3300033180 Bacteria 8445
544 Ga0307510_10109050 3300033180 Bacteria 2519
545 Ga0307510_10129657 3300033180 Bacteria 2199
546 Ga0307510_10184021 3300033180 Bacteria 1647
547 Ga0315911_1000035 3300033442 Bacteria 66589
548 Ga0373926_0013704 3300035083 Bacteria 2752
549 Ga0373934_0006345 3300035086 Bacteria 4385
550 Ga0373934_0021064 3300035086 Bacteria 2510
551 Ga0373923_0000525 3300035111 Bacteria 9307
552 Ga0373923_0020966 3300035111 Bacteria 2546
553 Ga0373923_0065620 3300035111 Bacteria 1550
554 Ga0373936_0003270 3300035113 Bacteria 6074
555 Ga0373936_0023654 3300035113 Bacteria 2396
556 Ga0373945_0015899 3300035116 Bacteria 2535
557 Ga0373953_0000204 3300035117 Bacteria 15899
558 Ga0373953_0018955 3300035117 Bacteria 2554
559 Ga0373953_0080581 3300035117 Bacteria 1353
560 Ga0373954_0001865 3300035118 Bacteria 8710
561 Ga0373954_0011302 3300035118 Bacteria 3954
562 Ga0373954_0015630 3300035118 Bacteria 3393
563 Ga0373956_0002489 3300035119 Bacteria 7497
564 Ga0373957_0000424 3300035120 Bacteria 10671
565 Ga0373957_0000593 3300035120 Bacteria 9175
566 Ga0373943_0021096 3300035170 Bacteria 3008
567 Ga0373943_0021894 3300035170 Bacteria 2955
568 Ga0373943_0062793 3300035170 Bacteria 1860
569 Ga0373946_0001185 3300035171 Bacteria 9035
570 Ga0373946_0009709 3300035171 Bacteria 3553
571 Ga0373955_0000184 3300035172 Bacteria 25709
572 Ga0373955_0004466 3300035172 Bacteria 6196
573 Ga0373924_0005456 3300035410 Bacteria 4506
574 Ga0373924_0012525 3300035410 Bacteria 3170
575 Ga0373931_0017214 3300035691 Bacteria 3570
576 Ga0373931_0058396 3300035691 Bacteria 2072
577 Ga0373931_0079351 3300035691 Bacteria 1808
578 Ga0373935_0003480 3300035692 Bacteria 9153
579 Ga0373935_0211204 3300035692 Bacteria 1345
580 Ga0373927_0000109 3300035695 Bacteria 62878
581 Ga0373927_0018866 3300035695 Bacteria 4526
582 Ga0373927_0023688 3300035695 Bacteria 4019
583 Ga0373927_0046180 3300035695 Bacteria 2818
584 Ga0373927_0077811 3300035695 Bacteria 2148
585 Ga0373927_0127320 3300035695 Bacteria 1663
586 Ga0373933_0000277 3300035724 Bacteria 33337
587 Ga0373933_0000554 3300035724 Bacteria 23320
588 Ga0373933_0029273 3300035724 Bacteria 3183
589 Ga0373947_0001517 3300035725 Bacteria 14225
590 Ga0373947_0037203 3300035725 Bacteria 2888
591 Ga0373947_0039506 3300035725 Bacteria 2808
592 Ga0373937_0002867 3300036401 Bacteria 14406
593 Ga0373937_0046190 3300036401 Bacteria 3982
594 Ga0373937_0069801 3300036401 Bacteria 3240
595 Ga0373937_0154475 3300036401 Bacteria 2150
596 Ga0373925_0009034 3300037068 Bacteria 7256
597 Ga0373925_0014057 3300037068 Bacteria 5794
598 Ga0373925_0036544 3300037068 Bacteria 3625
599 Ga0373925_0137912 3300037068 Bacteria 1907
600 Ga0395899_0000018 3300037312 Bacteria 423194
601 Ga0395899_0014550 3300037312 Bacteria 6008
602 Ga0395899_0094681 3300037312 Bacteria 2161
603 Ga0395899_0109567 3300037312 Bacteria 1986
604 Ga0395900_0000833 3300037418 Bacteria 40657
605 Ga0395900_0044930 3300037418 Bacteria 4550
606 Ga0395900_0075127 3300037418 Bacteria 3474
607 Ga0395898_0094881 3300037466 Bacteria 2867
608 Ga0395898_0141613 3300037466 Bacteria 2302
609 Ga0395898_0277715 3300037466 Bacteria 1598
610 Ga0395905_0000002 3300037471 Bacteria 1356358
611 Ga0395905_0014893 3300037471 Bacteria 7420
612 Ga0395905_0018837 3300037471 Bacteria 6547
613 Ga0395905_0068044 3300037471 Bacteria 3336
614 Ga0395905_0376289 3300037471 Bacteria 1314
615 Ga0436364_0608267 3300037853 Bacteria 3683
616 Ga0395901_0005514 3300038443 Bacteria 12813
617 Ga0395901_0063364 3300038443 Bacteria 3848
618 Ga0395901_0311579 3300038443 Bacteria 1630
619 Ga0395901_0501363 3300038443 Bacteria 1236
620 Ga0436365_0870327 3300039437 Bacteria 1856
621 Ga0436365_1327145 3300039437 Bacteria 20947
622 Ga0436365_1639132 3300039437 Bacteria 2027
623 Ga0436365_1885173 3300039437 Bacteria 1255
624 Ga0436360_0188092 3300039438 Bacteria 1342
625 Ga0436360_0192034 3300039438 Bacteria 1726
626 Ga0436360_0216049 3300039438 Bacteria 3573
627 Ga0436363_1623990 3300039450 Bacteria 1140
628 Ga0436362_0669995 3300039453 Bacteria 2147
629 Ga0439465_0005228 3300041413 Bacteria 4158
630 Ga0439465_0077959 3300041413 Bacteria 1119
631 Ga0451853_2565009 3300041512 Bacteria 1799
632 Ga0439458_0011673 3300042157 Bacteria 1966
633 Ga0466969_0088707 3300044656 Bacteria 1468
634 Ga0466969_0089476 3300044656 Bacteria 1460
635 Ga0466972_0000871 3300044658 Bacteria 14493
636 Ga0466972_0070594 3300044658 Bacteria 1666
637 Ga0466965_0019156 3300044683 Bacteria 3286
638 Ga0466966_0000137 3300044684 Bacteria 46695
639 Ga0466966_0081559 3300044684 Bacteria 2014
640 Ga0466961_0000039 3300044693 Bacteria 79787
641 Ga0466961_0000182 3300044693 Bacteria 42657
642 Ga0466964_0045903 3300044706 Bacteria 1779
643 Ga0466971_0000562 3300044719 Bacteria 14692
644 Ga0466971_0059791 3300044719 Bacteria 1722
645 Ga0466970_0015491 3300044765 Bacteria 3921
646 Ga0466957_0002614 3300044842 Bacteria 9709
647 Ga0466957_0113199 3300044842 Bacteria 1723
648 Ga0466957_0178751 3300044842 Bacteria 1385
649 Ga0466960_0023816 3300044901 Bacteria 2754
650 Ga0466959_0000028 3300045049 Bacteria 114144
651 Ga0466959_0002520 3300045049 Bacteria 11745
652 Ga0466959_0065022 3300045049 Bacteria 2647
653 Ga0466959_0079846 3300045049 Bacteria 2359
654 Ga0466958_0000162 3300045836 Bacteria 23703
655 Ga0466967_0035287 3300045976 Bacteria 4255
656 Ga0495617_026398 3300046452 Bacteria 1955
657 Ga0495627_002311 3300046453 Bacteria 9389
658 Ga0495592_0000678 3300046454 Bacteria 23715
659 Ga0495592_0046911 3300046454 Bacteria 3219
660 Ga0495603_0000189 3300046455 Bacteria 32189
661 Ga0495603_0033579 3300046455 Bacteria 3087
662 Ga0495603_0040481 3300046455 Bacteria 2789
663 Ga0495603_0054816 3300046455 Bacteria 2362
664 Ga0495603_0143314 3300046455 Bacteria 1389
665 Ga0495590_0008709 3300046457 Bacteria 3861
666 Ga0495629_0000268 3300046459 Bacteria 45291
667 Ga0495629_0150296 3300046459 Bacteria 1619
668 Ga0495638_0002733 3300046460 Bacteria 14177
669 Ga0495638_0003907 3300046460 Bacteria 11530
670 Ga0495638_0004594 3300046460 Bacteria 10449
671 Ga0495638_0006283 3300046460 Bacteria 8671
672 Ga0495638_0037250 3300046460 Bacteria 3094
673 Ga0495638_0043467 3300046460 Bacteria 2834
674 Ga0495641_0008241 3300046461 Bacteria 6381
675 Ga0495651_0002545 3300046462 Bacteria 14107
676 Ga0495651_0004117 3300046462 Bacteria 11135
677 Ga0495651_0134106 3300046462 Bacteria 1804
678 Ga0495653_0001252 3300046463 Bacteria 19662
679 Ga0495653_0050722 3300046463 Bacteria 3190
680 Ga0495653_0104304 3300046463 Bacteria 2049
681 Ga0495650_0000114 3300046471 Bacteria 192527
682 Ga0495650_0019974 3300046471 Bacteria 3279
683 Ga0495580_0002333 3300046472 Bacteria 16564
684 Ga0495580_0025076 3300046472 Bacteria 4359
685 Ga0495580_0067373 3300046472 Bacteria 2505
686 Ga0495582_0000144 3300046473 Bacteria 38436
687 Ga0495582_0009481 3300046473 Bacteria 5362
688 Ga0495605_0021634 3300046474 Bacteria 3403
689 Ga0495605_0031478 3300046474 Bacteria 2710
690 Ga0495605_0117082 3300046474 Bacteria 1211
691 Ga0495639_0000067 3300046475 Bacteria 47932
692 Ga0495639_0014306 3300046475 Bacteria 3435
693 Ga0495639_0014334 3300046475 Bacteria 3431
694 Ga0495639_0071724 3300046475 Bacteria 1600
695 Ga0495639_0103719 3300046475 Bacteria 1345
696 Ga0495662_0000005 3300046476 Bacteria 81157
697 Ga0495662_0065818 3300046476 Bacteria 1752
698 Ga0495664_0003350 3300046477 Bacteria 8709
699 Ga0495664_0004265 3300046477 Bacteria 7805
700 Ga0495664_0075429 3300046477 Bacteria 2018
701 Ga0495664_0088639 3300046477 Bacteria 1860
702 Ga0495664_0094845 3300046477 Bacteria 1796
703 Ga0495584_0103591 3300046491 Bacteria 1439
704 Ga0495594_0027701 3300046499 Bacteria 3054
705 Ga0495594_0073449 3300046499 Bacteria 1904
706 Ga0495596_0066604 3300046500 Bacteria 1400
707 Ga0495607_0029468 3300046501 Bacteria 3378
708 Ga0495607_0076292 3300046501 Bacteria 1854
709 Ga0495583_0000013 3300046506 Bacteria 323372
710 Ga0495583_0069144 3300046506 Bacteria 1556
711 Ga0495606_0000858 3300046507 Bacteria 45651
712 Ga0495606_0028077 3300046507 Bacteria 3975
713 Ga0495606_0035190 3300046507 Bacteria 3426
714 Ga0495606_0060045 3300046507 Bacteria 2437
715 Ga0495606_0166439 3300046507 Bacteria 1282
716 Ga0495608_0000255 3300046511 Bacteria 38655
717 Ga0495608_0003767 3300046511 Bacteria 10889
718 Ga0495610_0008642 3300046512 Bacteria 6564
719 Ga0495610_0024830 3300046512 Bacteria 3228
720 Ga0495616_0000053 3300046513 Bacteria 104389
721 Ga0495616_0023169 3300046513 Bacteria 3343
722 Ga0495618_0039118 3300046514 Bacteria 2982
723 Ga0495618_0077305 3300046514 Bacteria 2121
724 Ga0495618_0093913 3300046514 Bacteria 1918
725 Ga0495618_0216734 3300046514 Bacteria 1209
726 Ga0495620_0020567 3300046515 Bacteria 3222
727 Ga0495628_0014733 3300046516 Bacteria 6545
728 Ga0495628_0139155 3300046516 Bacteria 1853
729 Ga0495628_0249602 3300046516 Bacteria 1325
730 Ga0495630_0015290 3300046517 Bacteria 5601
731 Ga0495630_0020943 3300046517 Bacteria 4826
732 Ga0495630_0117424 3300046517 Bacteria 2017
733 Ga0495631_0001968 3300046518 Bacteria 12034
734 Ga0495631_0025704 3300046518 Bacteria 2708
735 Ga0495632_0000335 3300046519 Bacteria 44771
736 Ga0495637_0008165 3300046520 Bacteria 5153
737 Ga0495637_0018711 3300046520 Bacteria 3209
738 Ga0495637_0019164 3300046520 Bacteria 3165
739 Ga0495643_0022446 3300046522 Bacteria 3601
740 Ga0495644_0047202 3300046523 Bacteria 1618
741 Ga0495648_0000072 3300046524 Bacteria 132630
742 Ga0495648_0000664 3300046524 Bacteria 36757
743 Ga0495648_0028166 3300046524 Bacteria 3746
744 Ga0495648_0041967 3300046524 Bacteria 2883
745 Ga0495666_0046111 3300046526 Bacteria 2102
746 Ga0495652_0006124 3300046529 Bacteria 11240
747 Ga0495652_0007010 3300046529 Bacteria 10415
748 Ga0495654_0000082 3300046530 Bacteria 108599
749 Ga0495654_0027297 3300046530 Bacteria 2928
750 Ga0495665_0001692 3300046531 Bacteria 11840
751 Ga0495665_0031918 3300046531 Bacteria 2818
752 Ga0495640_0002790 3300046533 Bacteria 14051
753 Ga0495640_0012191 3300046533 Bacteria 6580
754 Ga0495640_0013838 3300046533 Bacteria 6128
755 Ga0495640_0016475 3300046533 Bacteria 5528
756 Ga0495587_0002484 3300046536 Bacteria 12307
757 Ga0495587_0033195 3300046536 Bacteria 3117
758 Ga0495587_0123562 3300046536 Bacteria 1482
759 Ga0495598_0060739 3300046537 Bacteria 1165
760 Ga0495609_0050752 3300046538 Bacteria 1849
761 Ga0495597_0007237 3300046542 Bacteria 5654
762 Ga0495645_0004244 3300046543 Bacteria 9786
763 Ga0495645_0006922 3300046543 Bacteria 7879
764 Ga0495622_0011946 3300046557 Bacteria 4017
765 Ga0495622_0017449 3300046557 Bacteria 3341
766 Ga0495622_0046154 3300046557 Bacteria 2024
767 Ga0495622_0059535 3300046557 Bacteria 1768
768 Ga0495667_0000121 3300046559 Bacteria 56223
769 Ga0495667_0006748 3300046559 Bacteria 7790
770 Ga0495667_0096853 3300046559 Bacteria 1910
771 Ga0495656_0012851 3300046615 Bacteria 3100
772 Ga0495656_0015199 3300046615 Bacteria 2902
773 Ga0495668_0026914 3300046616 Bacteria 3261
774 Ga0495668_0047980 3300046616 Bacteria 2370
775 Ga0495668_0049516 3300046616 Bacteria 2330
776 Ga0495668_0131764 3300046616 Bacteria 1368
777 Ga0495634_0001407 3300046642 Bacteria 21535
778 Ga0495634_0009303 3300046642 Bacteria 7248
779 Ga0495634_0013633 3300046642 Bacteria 5872
780 Ga0495634_0068133 3300046642 Bacteria 2352
781 Ga0495625_0000290 3300046660 Bacteria 77650
782 Ga0495625_0016762 3300046660 Bacteria 5755
783 Ga0495625_0019463 3300046660 Bacteria 5264
784 Ga0495625_0049575 3300046660 Bacteria 3017
785 Ga0495625_0100837 3300046660 Bacteria 1984
786 Ga0495625_0144679 3300046660 Bacteria 1601
787 Ga0495635_0000072 3300046663 Bacteria 62736
788 Ga0495635_0002392 3300046663 Bacteria 12785
789 Ga0495635_0007293 3300046663 Bacteria 7723
790 Ga0495635_0022140 3300046663 Bacteria 4427
791 Ga0495635_0125192 3300046663 Bacteria 1752
792 Ga0495659_0017556 3300046664 Bacteria 2373
793 Ga0495659_0109805 3300046664 Bacteria 1076
794 Ga0495661_0026266 3300046665 Bacteria 3751
795 Ga0495588_0022358 3300046674 Bacteria 3125
796 Ga0495588_0045133 3300046674 Bacteria 2259
797 Ga0495588_0052717 3300046674 Bacteria 2097
798 Ga0495588_0052950 3300046674 Bacteria 2092
799 Ga0495657_0004073 3300046675 Bacteria 11719
800 Ga0495657_0014654 3300046675 Bacteria 5755
801 Ga0495657_0127280 3300046675 Bacteria 1599
802 Ga0495599_0000468 3300046678 Bacteria 23004
803 Ga0495599_0026745 3300046678 Bacteria 3616
804 Ga0495599_0045178 3300046678 Bacteria 2762
805 Ga0495623_0022493 3300046679 Bacteria 4072
806 Ga0495646_0005577 3300046680 Bacteria 7961
807 Ga0495646_0029722 3300046680 Bacteria 3414
808 Ga0495646_0041694 3300046680 Bacteria 2819
809 Ga0495647_0014841 3300046681 Bacteria 2719
810 Ga0495647_0014973 3300046681 Bacteria 2710
811 Ga0495647_0046107 3300046681 Bacteria 1677
812 Ga0495658_0001103 3300046683 Bacteria 14275
813 Ga0495669_0002316 3300046684 Bacteria 7803
814 Ga0495613_0018960 3300046689 Bacteria 5126
815 Ga0495613_0079473 3300046689 Bacteria 2385
816 Ga0495613_0093627 3300046689 Bacteria 2175
817 Ga0495613_0154125 3300046689 Bacteria 1637
818 Ga0495624_0000460 3300046690 Bacteria 31973
819 Ga0495624_0035416 3300046690 Bacteria 3223
820 Ga0495670_0036380 3300046691 Bacteria 2453
821 Ga0495670_0043471 3300046691 Bacteria 2242
822 Ga0495671_0036785 3300046692 Bacteria 2479
823 Ga0495671_0051961 3300046692 Bacteria 2037
824 Ga0495671_0067341 3300046692 Bacteria 1761
825 Ga0495589_0031361 3300046794 Bacteria 2676
826 Ga0495600_0001056 3300046809 Bacteria 14933
827 Ga0495600_0006711 3300046809 Bacteria 7014
828 Ga0495660_0025111 3300046810 Bacteria 3386
829 Ga0495581_0000178 3300047315 Bacteria 29093
830 Ga0495581_0076596 3300047315 Bacteria 1935
831 Ga0495604_0002293 3300047317 Bacteria 15325
832 Ga0495604_0013732 3300047317 Bacteria 6457
833 Ga0495674_0004128 3300047319 Bacteria 14021
834 Ga0495674_0016488 3300047319 Bacteria 6891
835 Ga0495674_0314638 3300047319 Bacteria 1277
836 Ga0495672_0013122 3300047320 Bacteria 5731
837 Ga0495672_0018740 3300047320 Bacteria 4584
838 Ga0495672_0047646 3300047320 Bacteria 2547
839 Ga0495676_0093195 3300047321 Bacteria 2246
840 Ga0495676_0097123 3300047321 Bacteria 2188
841 Ga0495680_0001208 3300047322 Bacteria 28311
842 Ga0495680_0012539 3300047322 Bacteria 7454
843 Ga0495680_0085047 3300047322 Bacteria 2382
844 Ga0495683_0061678 3300047323 Bacteria 1857
845 Ga0495683_0112413 3300047323 Bacteria 1299
846 Ga0495687_011216 3300047443 Bacteria 4836
847 Ga0495675_0003178 3300047444 Bacteria 9868
848 Ga0495677_0014791 3300047445 Bacteria 2839
849 Ga0495679_006243 3300047446 Bacteria 5161
850 Ga0495673_0000025 3300047469 Bacteria 512352
851 Ga0495673_0015713 3300047469 Bacteria 3893
852 Ga0495673_0036262 3300047469 Bacteria 2264
853 Ga0495684_0002454 3300047471 Bacteria 14798
854 Ga0495684_0026908 3300047471 Bacteria 4419
855 Ga0495684_0242714 3300047471 Bacteria 1313
856 Ga0495686_0003968 3300047472 Bacteria 12414
857 Ga0495686_0037559 3300047472 Bacteria 3102
858 Ga0495686_0064279 3300047472 Bacteria 2272
859 Ga0495686_0090786 3300047472 Bacteria 1854
860 Ga0495686_0131045 3300047472 Bacteria 1486
861 Ga0495593_0000038 3300047673 Bacteria 53141
862 Ga0495593_0000109 3300047673 Bacteria 38355
863 Ga0495593_0012360 3300047673 Bacteria 4879
864 Ga0495602_0008629 3300048088 Bacteria 10643
865 Ga0495602_0024467 3300048088 Bacteria 5858
866 Ga0495602_0138489 3300048088 Bacteria 1930
867 Ga0495614_0058587 3300048089 Bacteria 1654
868 Ga0495615_0016929 3300048090 Bacteria 1580
869 Ga0495626_0024253 3300048091 Bacteria 2976
870 Ga0495626_0113413 3300048091 Bacteria 1172
871 Ga0496100_0004173 3300048903 Bacteria 7618
872 Ga0496100_0022384 3300048903 Bacteria 3824
873 Ga0496100_0053083 3300048903 Bacteria 2638
874 Ga0496100_0114466 3300048903 Bacteria 1879
875 Ga0496100_0169550 3300048903 Bacteria 1571
876 Ga0496101_0005878 3300048904 Bacteria 7856
877 Ga0496101_0025066 3300048904 Bacteria 4134
878 Ga0496101_0181616 3300048904 Bacteria 1620
879 Ga0496101_0250749 3300048904 Bacteria 1379
880 Ga0496102_0008645 3300048905 Bacteria 8739
881 Ga0496102_0024656 3300048905 Bacteria 5349
882 Ga0496102_0031103 3300048905 Bacteria 4784
883 Ga0496102_0076991 3300048905 Bacteria 3069
884 Ga0496102_0094828 3300048905 Bacteria 2765
885 Ga0496102_0113864 3300048905 Bacteria 2524
886 Ga0496102_0251869 3300048905 Bacteria 1665
887 Ga0496102_0281205 3300048905 Bacteria 1568
888 Ga0496103_0015806 3300048906 Bacteria 4499
889 Ga0496103_0023402 3300048906 Bacteria 3724
890 Ga0496103_0156683 3300048906 Bacteria 1460
891 Ga0496103_0230343 3300048906 Bacteria 1192
892 Ga0496104_0013379 3300048907 Bacteria 7393
893 Ga0496104_0015039 3300048907 Bacteria 7002
894 Ga0496104_0015607 3300048907 Bacteria 6885
895 Ga0496104_0019922 3300048907 Bacteria 6143
896 Ga0496104_0046196 3300048907 Bacteria 4099
897 Ga0496104_0169108 3300048907 Bacteria 2096
898 Ga0496104_0202556 3300048907 Bacteria 1896
899 Ga0496104_0403927 3300048907 Bacteria 1278
900 Ga0496105_0007692 3300048908 Bacteria 8356
901 Ga0496105_0119343 3300048908 Bacteria 2175
902 Ga0496105_0144823 3300048908 Bacteria 1954
903 Ga0496105_0170453 3300048908 Bacteria 1784
904 Ga0496105_0170793 3300048908 Bacteria 1782
905 Ga0496105_0312403 3300048908 Bacteria 1261
906 Ga0496106_0043894 3300048909 Bacteria 3356
907 Ga0496106_0079997 3300048909 Bacteria 2509
908 Ga0496106_0113165 3300048909 Bacteria 2115
909 Ga0496106_0217929 3300048909 Bacteria 1521
910 Ga0496106_0288896 3300048909 Bacteria 1314
911 Ga0496106_0311315 3300048909 Bacteria 1263
912 Ga0496107_0000821 3300048910 Bacteria 18074
913 Ga0496107_0009564 3300048910 Bacteria 6724
914 Ga0496107_0010126 3300048910 Bacteria 6540
915 Ga0496107_0017264 3300048910 Bacteria 5075
916 Ga0496107_0035767 3300048910 Bacteria 3561
917 Ga0496107_0091899 3300048910 Bacteria 2218
918 Ga0496108_0000553 3300048911 Bacteria 29302
919 Ga0496108_0040135 3300048911 Bacteria 3901
920 Ga0496108_0043553 3300048911 Bacteria 3749
921 Ga0496108_0153969 3300048911 Bacteria 1984
922 Ga0496108_0165589 3300048911 Bacteria 1911
923 Ga0496109_0000574 3300048912 Bacteria 30746
924 Ga0496109_0014214 3300048912 Bacteria 6924
925 Ga0496109_0014907 3300048912 Bacteria 6765
926 Ga0496109_0067541 3300048912 Bacteria 3276
927 Ga0496109_0164013 3300048912 Bacteria 2082
928 Ga0496109_0188534 3300048912 Bacteria 1937
929 Ga0496109_0250828 3300048912 Bacteria 1667
930 Ga0496110_0015270 3300048913 Bacteria 6388
931 Ga0496110_0022137 3300048913 Bacteria 5392
932 Ga0496110_0022422 3300048913 Bacteria 5361
933 Ga0496110_0024393 3300048913 Bacteria 5154
934 Ga0496110_0031954 3300048913 Bacteria 4543
935 Ga0496110_0047439 3300048913 Bacteria 3761
936 Ga0496110_0260660 3300048913 Bacteria 1578
937 Ga0496110_0574992 3300048913 Bacteria 1023
938 Ga0496111_0000254 3300048914 Bacteria 25829
939 Ga0496111_0038744 3300048914 Bacteria 3416
940 Ga0496111_0114014 3300048914 Bacteria 1992
941 Ga0496111_0226915 3300048914 Bacteria 1387
942 Ga0496112_0000065 3300048915 Bacteria 70119
943 Ga0496112_0005410 3300048915 Bacteria 11035
944 Ga0496112_0009978 3300048915 Bacteria 8594
945 Ga0496112_0011336 3300048915 Bacteria 8135
946 Ga0496112_0034980 3300048915 Bacteria 4889
947 Ga0496112_0057686 3300048915 Bacteria 3823
948 Ga0496112_0059684 3300048915 Bacteria 3759
949 Ga0496112_0118017 3300048915 Bacteria 2623
950 Ga0496112_0134453 3300048915 Bacteria 2443
951 Ga0496112_0251642 3300048915 Bacteria 1717
952 Ga0496113_0000209 3300048916 Bacteria 27329
953 Ga0496113_0017578 3300048916 Bacteria 4967
954 Ga0496113_0099558 3300048916 Bacteria 2251
955 Ga0496113_0100062 3300048916 Bacteria 2246
956 Ga0496113_0218242 3300048916 Bacteria 1519
957 Ga0496113_0240405 3300048916 Bacteria 1445
958 Ga0496113_0251121 3300048916 Bacteria 1412
959 Ga0496114_0007557 3300048917 Bacteria 8598
960 Ga0496114_0156999 3300048917 Bacteria 1976
961 Ga0496114_0233169 3300048917 Bacteria 1618
962 Ga0496115_0003049 3300048918 Bacteria 12025
963 Ga0496115_0027806 3300048918 Bacteria 4427
964 Ga0496115_0058651 3300048918 Bacteria 3098
965 Ga0496115_0078514 3300048918 Bacteria 2685
966 Ga0496116_0003085 3300048919 Bacteria 16786
967 Ga0496116_0160508 3300048919 Bacteria 1234
968 Ga0496117_0007135 3300048920 Bacteria 11042
969 Ga0496117_0024076 3300048920 Bacteria 4828
970 Ga0496117_0072968 3300048920 Bacteria 2291
971 Ga0496117_0163544 3300048920 Bacteria 1301
972 Ga0496118_0005552 3300048921 Bacteria 14295
973 Ga0496118_0015872 3300048921 Bacteria 6943
974 Ga0496118_0017902 3300048921 Bacteria 6427
975 Ga0496118_0033771 3300048921 Bacteria 4189
976 Ga0496118_0135115 3300048921 Bacteria 1576
977 Ga0496119_0044038 3300048922 Bacteria 2814
978 Ga0496119_0090119 3300048922 Bacteria 1745
979 Ga0496119_0100564 3300048922 Bacteria 1624
980 Ga0496119_0107164 3300048922 Bacteria 1558
981 Ga0496119_0136213 3300048922 Bacteria 1331
982 Ga0496120_0005683 3300048923 Bacteria 9849
983 Ga0496120_0010445 3300048923 Bacteria 6479
984 Ga0496121_0000453 3300048924 Bacteria 80749
985 Ga0496121_0002104 3300048924 Bacteria 31321
986 Ga0496121_0002583 3300048924 Bacteria 27387
987 Ga0496121_0006128 3300048924 Bacteria 15107
988 Ga0496121_0016140 3300048924 Bacteria 7737
989 Ga0496121_0021760 3300048924 Bacteria 6264
990 Ga0496121_0043512 3300048924 Bacteria 3888
991 Ga0496121_0052036 3300048924 Bacteria 3443
992 Ga0496121_0056847 3300048924 Bacteria 3247
993 Ga0496121_0074801 3300048924 Bacteria 2708
994 Ga0496121_0097871 3300048924 Bacteria 2272
995 Ga0496121_0099348 3300048924 Bacteria 2249
996 Ga0496121_0235803 3300048924 Bacteria 1278
997 Ga0496122_0051260 3300048925 Bacteria 3138
998 Ga0496123_0106959 3300048926 Bacteria 1610
999 Ga0496124_0002831 3300048927 Bacteria 21956
1000 Ga0496124_0020645 3300048927 Bacteria 6080
1001 Ga0496125_0003090 3300048928 Bacteria 20775
1002 Ga0496125_0005379 3300048928 Bacteria 14274
1003 Ga0496125_0016016 3300048928 Bacteria 7218
1004 Ga0496125_0069645 3300048928 Bacteria 2759
1005 Ga0496125_0120943 3300048928 Bacteria 1868
1006 Ga0496126_0002707 3300048929 Bacteria 23413
1007 Ga0496126_0012688 3300048929 Bacteria 8621
1008 Ga0496126_0021067 3300048929 Bacteria 6376
1009 Ga0496126_0032509 3300048929 Bacteria 4914
1010 Ga0496126_0042154 3300048929 Bacteria 4216
1011 Ga0496126_0053918 3300048929 Bacteria 3645
1012 Ga0496126_0150841 3300048929 Bacteria 1992
1013 Ga0496126_0160188 3300048929 Bacteria 1923
1014 Ga0496126_0165352 3300048929 Bacteria 1888
1015 Ga0496126_0167090 3300048929 Bacteria 1877
1016 Ga0496126_0170504 3300048929 Bacteria 1854
1017 Ga0496126_0225470 3300048929 Bacteria 1572
1018 Ga0495678_001114 3300049459 Bacteria 22387
1019 Ga0501031_0018544 3300049568 Bacteria 4530
1020 Ga0501031_0018611 3300049568 Bacteria 4523
1021 Ga0501031_0055908 3300049568 Bacteria 2571
1022 Ga0501032_0000309 3300049569 Bacteria 41024
1023 Ga0501032_0023936 3300049569 Bacteria 4217
1024 Ga0501032_0034437 3300049569 Bacteria 3467
1025 Ga0501032_0063456 3300049569 Bacteria 2473
1026 Ga0501032_0072665 3300049569 Bacteria 2292
1027 Ga0501033_0001437 3300049570 Bacteria 21135
1028 Ga0501033_0001792 3300049570 Bacteria 18732
1029 Ga0501033_0005552 3300049570 Bacteria 9973
1030 Ga0501033_0011464 3300049570 Bacteria 6783
1031 Ga0501033_0146852 3300049570 Bacteria 1702
1032 Ga0501034_0000082 3300049571 Bacteria 170039
1033 Ga0501034_0038159 3300049571 Bacteria 4864
1034 Ga0501034_0043255 3300049571 Bacteria 4559
1035 Ga0501034_0120069 3300049571 Bacteria 2615
1036 Ga0501034_0470216 3300049571 Bacteria 1173
1037 Ga0501036_0000121 3300049572 Bacteria 48901
1038 Ga0501036_0017730 3300049572 Bacteria 5961
1039 Ga0501036_0059762 3300049572 Bacteria 3229
1040 Ga0501036_0074431 3300049572 Bacteria 2872
1041 Ga0501036_0075582 3300049572 Bacteria 2849
1042 Ga0501036_0261572 3300049572 Bacteria 1449
1043 Ga0501037_0001873 3300049573 Bacteria 15281
1044 Ga0501037_0003883 3300049573 Bacteria 10842
1045 Ga0501037_0004517 3300049573 Bacteria 10111
1046 Ga0501037_0011302 3300049573 Bacteria 6571
1047 Ga0501037_0055880 3300049573 Bacteria 2885
1048 Ga0501037_0064072 3300049573 Bacteria 2679
1049 Ga0501038_0001766 3300049574 Bacteria 20109
1050 Ga0501038_0007655 3300049574 Bacteria 9961
1051 Ga0501038_0011654 3300049574 Bacteria 8018
1052 Ga0501038_0020734 3300049574 Bacteria 5907
1053 Ga0501038_0028126 3300049574 Bacteria 4994
1054 Ga0501038_0131751 3300049574 Bacteria 2052
1055 Ga0501038_0133621 3300049574 Bacteria 2034
1056 Ga0501039_0008300 3300049575 Bacteria 7913
1057 Ga0501039_0008973 3300049575 Bacteria 7617
1058 Ga0501039_0019231 3300049575 Bacteria 5238
1059 Ga0501039_0163379 3300049575 Bacteria 1751
1060 Ga0501039_0182526 3300049575 Bacteria 1650
1061 Ga0501039_0245128 3300049575 Bacteria 1409
1062 Ga0501039_0322592 3300049575 Bacteria 1214
1063 Ga0501040_0019588 3300049576 Bacteria 4502
1064 Ga0501041_0024090 3300049577 Bacteria 3652
1065 Ga0501042_0002459 3300049578 Bacteria 11380
1066 Ga0501042_0020947 3300049578 Bacteria 4553
1067 Ga0501043_0000109 3300049579 Bacteria 77120
1068 Ga0501043_0018022 3300049579 Bacteria 5538
1069 Ga0501043_0020967 3300049579 Bacteria 5124
1070 Ga0501043_0031418 3300049579 Bacteria 4174
1071 Ga0501043_0054188 3300049579 Bacteria 3149
1072 Ga0501043_0065893 3300049579 Bacteria 2844
1073 Ga0501043_0071423 3300049579 Bacteria 2726
1074 Ga0501043_0097384 3300049579 Bacteria 2313
1075 Ga0501043_0223631 3300049579 Bacteria 1455
1076 Ga0501046_0006125 3300049580 Bacteria 10686
1077 Ga0501046_0011755 3300049580 Bacteria 7474
1078 Ga0501046_0020055 3300049580 Bacteria 5535
1079 Ga0501046_0108527 3300049580 Bacteria 2122
1080 Ga0501046_0145287 3300049580 Bacteria 1792
1081 Ga0501046_0241597 3300049580 Bacteria 1332
1082 Ga0501047_0000331 3300049581 Bacteria 54371
1083 Ga0501047_0005862 3300049581 Bacteria 11565
1084 Ga0501047_0013763 3300049581 Bacteria 7682
1085 Ga0501047_0016114 3300049581 Bacteria 7129
1086 Ga0501047_0081308 3300049581 Bacteria 3114
1087 Ga0501047_0119800 3300049581 Bacteria 2514
1088 Ga0501048_0000124 3300049582 Bacteria 44765
1089 Ga0501048_0006242 3300049582 Bacteria 9062
1090 Ga0501048_0207138 3300049582 Bacteria 1391
1091 Ga0501048_0209467 3300049582 Bacteria 1383
1092 Ga0501067_0000754 3300049583 Bacteria 17403
1093 Ga0501067_0004772 3300049583 Bacteria 7512
1094 Ga0501068_0003061 3300049584 Bacteria 8923
1095 Ga0501068_0013934 3300049584 Bacteria 4586
1096 Ga0501069_0043468 3300049585 Bacteria 2487
1097 Ga0501069_0231905 3300049585 Bacteria 1075
1098 Ga0501070_0109696 3300049586 Bacteria 2280
1099 Ga0501070_0120997 3300049586 Bacteria 2163
1100 Ga0501071_0058511 3300049587 Bacteria 2787
1101 Ga0501072_0001910 3300049588 Bacteria 15511
1102 Ga0501072_0011811 3300049588 Bacteria 6671
1103 Ga0501073_0000101 3300049589 Bacteria 54365
1104 Ga0501073_0007671 3300049589 Bacteria 8007
1105 Ga0501073_0022798 3300049589 Bacteria 4504
1106 Ga0501074_0000673 3300049590 Bacteria 21320
1107 Ga0501074_0022078 3300049590 Bacteria 4624
1108 Ga0501076_0023212 3300049592 Bacteria 4780
1109 Ga0501076_0057238 3300049592 Bacteria 3095
1110 Ga0501077_0007464 3300049593 Bacteria 6746
1111 Ga0501079_0007287 3300049741 Bacteria 8351
1112 Ga0501079_0044414 3300049741 Bacteria 3429
1113 Ga0501079_0053524 3300049741 Bacteria 3114
1114 Ga0501080_0000151 3300049742 Bacteria 49588
1115 Ga0501080_0014075 3300049742 Bacteria 7363
1116 Ga0501080_0028786 3300049742 Bacteria 5172
1117 Ga0501080_0324447 3300049742 Bacteria 1393
1118 Ga0501080_0339089 3300049742 Bacteria 1358
1119 Ga0501083_0001467 3300049744 Bacteria 16100
1120 Ga0501083_0083002 3300049744 Bacteria 2123
1121 Ga0501083_0243988 3300049744 Bacteria 1170
1122 Ga0501035_0000150 3300049822 Bacteria 85450
1123 Ga0501035_0005831 3300049822 Bacteria 11617
1124 Ga0501035_0025197 3300049822 Bacteria 5453
1125 Ga0501035_0030637 3300049822 Bacteria 4903
1126 Ga0501035_0032463 3300049822 Bacteria 4749
1127 Ga0501035_0053293 3300049822 Bacteria 3618
1128 Ga0501035_0490784 3300049822 Bacteria 1012
1129 Ga0501044_0000247 3300049823 Bacteria 68674
1130 Ga0501044_0005266 3300049823 Bacteria 14384
1131 Ga0501044_0036813 3300049823 Bacteria 5118
1132 Ga0501044_0037013 3300049823 Bacteria 5102
1133 Ga0501044_0087334 3300049823 Bacteria 3150
1134 Ga0501044_0144108 3300049823 Bacteria 2369
1135 Ga0501044_0238803 3300049823 Bacteria 1761
1136 Ga0501044_0271729 3300049823 Bacteria 1630
1137 Ga0501045_0009953 3300049824 Bacteria 6651
1138 Ga0501045_0010576 3300049824 Bacteria 6464
1139 nmdc:mga03683_82989_c1 3300050489 Bacteria 1387
1140 nmdc:mga03n38_2959_c1 3300050490 Bacteria 5366
1141 nmdc:mga03n38_3537_c1 3300050490 Bacteria 5040
1142 nmdc:mga03n38_3664_c1 3300050490 Bacteria 4969
1143 nmdc:mga00v17_122202_c1 3300050491 Bacteria 1659
1144 nmdc:mga00v17_18034_c1 3300050491 Bacteria 4006
1145 nmdc:mga00v17_2135_c1 3300050491 Bacteria 7772
1146 nmdc:mga0yw44_11059_c1 3300050492 Bacteria 4639
1147 nmdc:mga0yw44_171210_c1 3300050492 Bacteria 1426
1148 nmdc:mga0yw44_17603_c1 3300050492 Bacteria 3893
1149 nmdc:mga0yw44_21959_c1 3300050492 Bacteria 3570
1150 nmdc:mga0yw44_70359_c1 3300050492 Bacteria 2169
1151 nmdc:mga0yw44_8315_c1 3300050492 Bacteria 5159
1152 nmdc:mga0yw44_83423_c1 3300050492 Bacteria 1394
1153 nmdc:mga06z11_67020_c1 3300050494 Bacteria 1889
1154 nmdc:mga06z11_97470_c1 3300050494 Bacteria 1607
1155 nmdc:mga04h51_40526_c1 3300050495 Bacteria 1518
1156 nmdc:mga07m45_33103_c1 3300050496 Bacteria 2869
1157 nmdc:mga05p37_27900_c1 3300050507 Bacteria 6878
1158 nmdc:mga05p37_48317_c1 3300050507 Bacteria 5234
1159 nmdc:mga0qj67_179491_c1 3300050509 Bacteria 1719
1160 nmdc:mga06r32_119041_c1 3300050510 Bacteria 2604
1161 nmdc:mga06r32_355300_c1 3300050510 Bacteria 1450
1162 nmdc:mga06r32_54021_c1 3300050510 Bacteria 3851
1163 nmdc:mga08y16_504615_c1 3300050511 Bacteria 1229
1164 nmdc:mga08y16_510493_c1 3300050511 Bacteria 1220
1165 nmdc:mga08y16_65363_c1 3300050511 Bacteria 3797
1166 nmdc:mga0rr50_162149_c1 3300050513 Bacteria 1815
1167 nmdc:mga0a205_318113_c1 3300050515 Bacteria 1427
1168 nmdc:mga0sz30_12253_c1 3300050516 Bacteria 3333
1169 Ga0495601_0005665 3300053077 Bacteria 7285
1170 Ga0495601_0022706 3300053077 Bacteria 3855
1171 Ga0495601_0044081 3300053077 Bacteria 2804
1172 Ga0495612_0012883 3300053078 Bacteria 3369
1173 Ga0495612_0016639 3300053078 Bacteria 2947
1174 Ga0500635_0006237 3300053080 Bacteria 3174
1175 Ga0500635_0058978 3300053080 Bacteria 1334
1176 Ga0495655_0030429 3300053083 Bacteria 1306
1177 Ga0495595_0000437 3300053084 Bacteria 15807
1178 Ga0495595_0037333 3300053084 Bacteria 2208
1179 Ga0495595_0075238 3300053084 Bacteria 1601
1180 Ga0495595_0089325 3300053084 Bacteria 1477
1181 Ga0495619_0001386 3300053085 Bacteria 15942
1182 Ga0495619_0019949 3300053085 Bacteria 4265
1183 Ga0495619_0106067 3300053085 Bacteria 1916
1184 Ga0500578_0000124 3300053086 Bacteria 92437
1185 Ga0500578_0097862 3300053086 Bacteria 1859
1186 Ga0500643_000117 3300053087 Bacteria 82982
1187 Ga0500643_027479 3300053087 Bacteria 1769
1188 Ga0500651_0007987 3300053093 Bacteria 6192
1189 Ga0500651_0036263 3300053093 Bacteria 3107
1190 Ga0500566_0012564 3300053094 Bacteria 4982
1191 Ga0500640_016614 3300053095 Bacteria 3106
1192 Ga0500640_031016 3300053095 Bacteria 2342
1193 Ga0500641_0029521 3300053096 Bacteria 2149
1194 Ga0500641_0107514 3300053096 Bacteria 1199
1195 Ga0500648_086624 3300053097 Bacteria 1757
1196 Ga0500650_0000885 3300053098 Bacteria 8373
1197 Ga0500554_008277 3300053102 Bacteria 2436
1198 Ga0500554_018093 3300053102 Bacteria 1896
1199 Ga0500555_004649 3300053103 Bacteria 3897
1200 Ga0500556_0000019 3300053104 Bacteria 186017
1201 Ga0500556_0004025 3300053104 Bacteria 4231
1202 Ga0500556_0010261 3300053104 Bacteria 2744
1203 Ga0500556_0072231 3300053104 Bacteria 1291
1204 Ga0500557_000143 3300053105 Bacteria 16681
1205 Ga0500562_001270 3300053108 Bacteria 6232
1206 Ga0500569_005216 3300053109 Bacteria 2782
1207 Ga0500572_000955 3300053111 Bacteria 8762
1208 Ga0500572_025605 3300053111 Bacteria 1601
1209 Ga0500592_000579 3300053116 Bacteria 6028
1210 Ga0500592_014465 3300053116 Bacteria 1264
1211 Ga0500594_0000239 3300053118 Bacteria 13259
1212 Ga0500594_0011714 3300053118 Bacteria 2052
1213 Ga0500595_001903 3300053119 Bacteria 10754
1214 Ga0500595_002222 3300053119 Bacteria 9858
1215 Ga0500595_007252 3300053119 Bacteria 4607
1216 Ga0500595_008236 3300053119 Bacteria 4271
1217 Ga0500595_027287 3300053119 Bacteria 1957
1218 Ga0500595_044546 3300053119 Bacteria 1405
1219 Ga0500595_054382 3300053119 Bacteria 1229
1220 Ga0500607_095861 3300053121 Bacteria 1483
1221 Ga0500608_040872 3300053122 Bacteria 2223
1222 Ga0500614_012243 3300053123 Bacteria 1867
1223 Ga0500618_000093 3300053125 Bacteria 73010
1224 Ga0500642_0000048 3300053130 Bacteria 81787
1225 Ga0500642_0000137 3300053130 Bacteria 32609
1226 Ga0500642_0004012 3300053130 Bacteria 4545
1227 Ga0500652_005581 3300053131 Bacteria 3976
1228 Ga0500559_0000060 3300053136 Bacteria 87673
1229 Ga0500559_0001161 3300053136 Bacteria 15833
1230 Ga0500559_0004287 3300053136 Bacteria 6824
1231 Ga0500559_0008025 3300053136 Bacteria 4649
1232 Ga0500559_0013786 3300053136 Bacteria 3418
1233 Ga0500564_000502 3300053138 Bacteria 11537
1234 Ga0500568_0002172 3300053139 Bacteria 11820
1235 Ga0500568_0012112 3300053139 Bacteria 3976
1236 Ga0500568_0019114 3300053139 Bacteria 2985
1237 Ga0500568_0069123 3300053139 Bacteria 1355
1238 Ga0500573_0010850 3300053140 Bacteria 5089
1239 Ga0500573_0200219 3300053140 Bacteria 1061
1240 Ga0500586_005266 3300053145 Bacteria 3259
1241 Ga0500590_069628 3300053148 Bacteria 1751
1242 Ga0500590_084246 3300053148 Bacteria 1556
1243 Ga0500603_002291 3300053150 Bacteria 4206
1244 Ga0500616_0000038 3300053153 Bacteria 386801
1245 Ga0500616_0000059 3300053153 Bacteria 259741
1246 Ga0500616_0025571 3300053153 Bacteria 3273
1247 Ga0500622_0000995 3300053156 Bacteria 23890
1248 Ga0500622_0002106 3300053156 Bacteria 14828
1249 Ga0500622_0004401 3300053156 Bacteria 8868
1250 Ga0500622_0005729 3300053156 Bacteria 7381
1251 Ga0500622_0009444 3300053156 Bacteria 5396
1252 Ga0500622_0051451 3300053156 Bacteria 2120
1253 Ga0500624_006663 3300053157 Bacteria 1568
1254 Ga0500627_0016814 3300053158 Bacteria 2861
1255 Ga0500634_0025972 3300053161 Bacteria 3189
1256 Ga0500638_046986 3300053162 Bacteria 2091
1257 Ga0500639_017206 3300053163 Bacteria 3813
1258 Ga0500636_0001114 3300053177 Bacteria 14397
1259 Ga0500636_0008789 3300053177 Bacteria 5860
1260 Ga0500636_0092519 3300053177 Bacteria 1730
1261 Ga0500636_0101943 3300053177 Bacteria 1631
1262 Ga0500637_0000500 3300053178 Bacteria 15189
1263 Ga0500637_0028532 3300053178 Bacteria 3088
1264 Ga0500576_009372 3300053725 Bacteria 4296
1265 Ga0500611_008909 3300053727 Bacteria 1570
1266 Ga0500625_013646 3300053729 Bacteria 3738
1267 Ga0500645_000484 3300053730 Bacteria 26930
1268 Ga0500609_000477 3300053731 Bacteria 5968
1269 Ga0500609_005115 3300053731 Bacteria 1795
1270 Ga0500596_006542 3300053735 Bacteria 1964
1271 Ga0500596_009396 3300053735 Bacteria 1527
1272 Ga0500601_000813 3300053737 Bacteria 3879
1273 Ga0500601_001894 3300053737 Bacteria 2246
1274 Ga0501084_0012721 3300054114 Bacteria 6970
1275 Ga0501084_0075126 3300054114 Bacteria 2831
1276 Ga0500661_000621 3300055283 Bacteria 6620
1277 Ga0501082_0003420 3300060353 Bacteria 13858
1278 Ga0501082_0018039 3300060353 Bacteria 6078
1279 Ga0501082_0086418 3300060353 Bacteria 2705
1280 Ga0501082_0207213 3300060353 Bacteria 1706
1281 Ga0501082_0238928 3300060353 Bacteria 1581
1282 Ga0466962_0000142 3300061719 Bacteria 29518
1283 2513700424 2513237102 Bacteria 7703324
1284 2507505623 2507262055 Bacteria 8048963
1285 2508539516 2508501009 Bacteria 7784016
1286 2508695886 2508501042 Bacteria 8719808
1287 2509079133 2508501114 Bacteria 7082538
1288 2509150142 2508501128 Bacteria 8613869
1289 2511121662 2510917020 Bacteria 5657507
1290 2511401107 2511231028 Bacteria 8046582
1291 2513628921 2513237092 Bacteria 8341956
1292 2513642263 2513237094 Bacteria 8789602
1293 2513652799 2513237095 Bacteria 8976980
1294 2513661881 2513237096 Bacteria 8722461
1295 2513694024 2513237101 Bacteria 7952346
1296 2513718829 2513237104 Bacteria 10034502
1297 2513862539 2513237137 Bacteria 9558895
1298 2513876929 2513237139 Bacteria 8737671
1299 2513890479 2513237141 Bacteria 8496279
1300 2513919110 2513237145 Bacteria 8979722
1301 2514016091 2513237161 Bacteria 8871253
1302 2515624024 2515154112 Bacteria 8294334
1303 2517105888 2517093001 Bacteria 9002274
1304 2517888428 2517572143 Bacteria 9484767
1305 2524440067 2524023205 Bacteria 8918781
1306 2524468379 2524023210 Bacteria 9029266
1307 2524535263 2524023228 Bacteria 10118060
1308 2528852077 2528768022 Bacteria 10457665
1309 2585147844 2582581279 Bacteria 4980720
1310 2585151564 2582581280 Bacteria 5994497
1311 2585195562 2582581293 Bacteria 5907401
1312 2603861709 2602042107 Bacteria 6226103
1313 2617353255 2617270735 Bacteria 9163226
1314 2617377293 2617270741 Bacteria 8201522
1315 2643749273 2643221545 Bacteria 5083237
1316 2643781394 2643221552 Bacteria 5708754
1317 2643922986 2643221583 Bacteria 5218014
1318 2643929133 2643221584 Bacteria 5511711
1319 2644508953 2643221691 Bacteria 5093099
1320 2644728799 2643221733 Bacteria 5690728
1321 2644734187 2643221734 Bacteria 5365412
1322 2671123633 2667528175 Bacteria 7532676
1323 2723849327 2721755755 Bacteria 8322773
1324 2728752065 2728368998 Bacteria 8720350
1325 2739792302 2739367756 Bacteria 4553612
1326 2745077821 2744054633 Bacteria 8678936
1327 2793065644 2791355196 Bacteria 7323613
1328 2793065915 2791355196 Bacteria 7323613
1329 2793067245 2791355197 Bacteria 8420563
1330 2793077107
1331 2805921277 2802429603 Bacteria 8777136
1332 2818239252 2816332527 Bacteria 8933356
1333 2819536374 2818991435 Bacteria 5433759
1334 2819644629 2818991454 Bacteria 5563326
1335 2824607499 2824600985 Bacteria 8488197
1336 2824617549 2824609381 Bacteria 8672835
1337 2824624910 2824617872 Bacteria 8814715
1338 2824631738 2824626560 Bacteria 8813858
1339 2824643206 2824635225 Bacteria 8785348
1340 2824652309 2824644064 Bacteria 8743947
1341 2824660963 2824653114 Bacteria 8493680
1342 2824670739 2824661429 Bacteria 9877870
1343 2824678637 2824671348 Bacteria 8369588
1344 2824686947 2824679649 Bacteria 8248951
1345 2824695082 2824687955 Bacteria 8360029
1346 2824703434 2824696289 Bacteria 8335049
1347 2824712920 2824704595 Bacteria 9667483
1348 2824721555 2824714736 Bacteria 8717648
1349 2824731485 2824723954 Bacteria 8758240
1350 2824740008 2824732956 Bacteria 7810675
1351 2824753558 2824746037 Bacteria 7911610
1352 2824762108 2824753945 Bacteria 9787441
1353 2824772397 2824763712 Bacteria 9792355
1354 2824777518 2824773399 Bacteria 8360218
1355 2838125754 2838122688 Bacteria 8803140
1356 2841920176 2841917233 Bacteria 6173500
1357 2841947965 2841941048 Bacteria 8688029
1358 2841957062 2841949485 Bacteria 8680857
1359 2841965124 2841957949 Bacteria 8652217
1360 2841972793 2841966195 Bacteria 8673214
1361 2841977570 2841974524 Bacteria 8931498
1362 2841984872 2841983080 Bacteria 8395090
1363 2842041374 2842038055 Bacteria 8002051
1364 2842049416 2842045827 Bacteria 8006841
1365 2844315857 2844315083 Bacteria 8138177
1366 2847930718 2847930680 Bacteria 9342022
1367 2847942680 2847939898 Bacteria 8606328
1368 2849083425 2849076700 Bacteria 7039503
1369 2857515630 2857509624 Bacteria 7472071
1370 2857525897 2857524615 Bacteria 6615449
1371 2874593255 2874590934 Bacteria 8299676
1372 2874608441 2874604998 Bacteria 7834745
1373 2874617146 2874612657 Bacteria 8252029
1374 2874621377 2874620515 Bacteria 8290088
1375 2874636766 2874628541 Bacteria 8630250
1376 2874647768 2874645413 Bacteria 8214782
1377 2876762904 2876761206 Bacteria 10111113
1378 2876773295 2876771140 Bacteria 8287509
1379 2876818922 2876818435 Bacteria 8274608
1380 2879075374 2879074833 Bacteria 8279565
1381 2879089860 2879083081 Bacteria 8587928
1382 2879106704 2879099564 Bacteria 10442239
1383 2879112796 2879110137 Bacteria 8907982
1384 2879134118 2879127579 Bacteria 8294491
1385 2879145569 2879142872 Bacteria 8267021
1386 2881367140 2881364244 Bacteria 7710352
1387 2881668416 2881665667 Bacteria 8175609
1388 2885368719 2885366525 Bacteria 8326213
1389 2885379862 2885374607 Bacteria 8927485
1390 2885384667 2885383462 Bacteria 9473874
1391 2885411183 2885409591 Bacteria 9235467
1392 2888379115 2888378607 Bacteria 9652610
1393 2888390291 2888388044 Bacteria 7304136
1394 2888427511 2888419890 Bacteria 7857137
1395 2889035878 2889033259 Bacteria 9099371
1396 2891091149 2891088606 Bacteria 4762464
1397 2893067821 2893066018 Bacteria 6158120
1398 2903731807 2903727486 Bacteria 8281579
1399 2903777945 2903768456 Bacteria 9749579
1400 2904668047 2904666416 Bacteria 8226587
1401 2904699280 2904690495 Bacteria 9412302
1402 2904707832
1403 2904714178 2904711408 Bacteria 9771557
1404 2906603666 2906602504 Bacteria 8295279
1405 2906614209
1406 2906633210 2906626472 Bacteria 8826946
1407 2906638818 2906635258 Bacteria 8601019
1408 2906648040 2906643746 Bacteria 8722424
1409 2906660919 2906660503 Bacteria 8595048
1410 2908746962 2908739725 Bacteria 8628932
1411 2908758877 2908756301 Bacteria 8864324
1412 2908775808 2908775508 Bacteria 8092255
1413 2917703302 2917699015 Bacteria 7043791
1414 2919074242 2919073203 Bacteria 6531949
1415 2922364355 2922361189 Bacteria 7436256
1416 2922369151
1417 2922389052 2922386360 Bacteria 7017218
1418 2922400763 2922393267 Bacteria 8285685
1419 2922426031
1420 2929619005 2929615660 Bacteria 9193770
1421 2929631082 2929624759 Bacteria 9339455
1422 2932789047 2932784394 Bacteria 9704911
1423 2932801322 2932794094 Bacteria 7915132
1424 2932808835 2932801729 Bacteria 7987968
1425 2932814316 2932809354 Bacteria 9135765
1426 2932820442 2932818245 Bacteria 9955613
1427 2932834474 2932828146 Bacteria 9745859
1428 2933580285 2933577622 Bacteria 9116884
1429 2935614679 2935608549 Bacteria 8203142
1430 2935624457 2935616580 Bacteria 9032984
1431 2935632451 2935630451 Bacteria 8169952
1432 2935645847 2935638405 Bacteria 10015038
1433 2935649069 2935648319 Bacteria 8801166
1434 2935658159 2935656913 Bacteria 8965014
1435 2935673414 2935665750 Bacteria 9571747
1436 2935682591 2935675223 Bacteria 9928132
1437 2935686795 2935684952 Bacteria 9590419
1438 2935701525 2935694250 Bacteria 9291695
1439 2935710500 2935703347 Bacteria 10242284
1440 2935716483 2935713505 Bacteria 9608509
1441 2935723392 2935722832 Bacteria 9608746
1442 2935734948 2935732158 Bacteria 9706831
1443 2935744261 2935741537 Bacteria 9707219
1444 2935752761 2935750917 Bacteria 9590372
1445 2935764692 2935760218 Bacteria 9817913
1446 2935774671 2935769743 Bacteria 7878163
1447 2935783758 2935777560 Bacteria 8077691
1448 2935789814 2935785616 Bacteria 7962367
1449 2935797818 2935793552 Bacteria 8012592
1450 2935806197 2935801545 Bacteria 9301974
1451 2935816969 2935810662 Bacteria 9401221
1452 2935826280 2935819856 Bacteria 8261050
1453 2935835252 2935827899 Bacteria 10038562
1454 2935841366 2935837841 Bacteria 9454360
1455 2935853776 2935847175 Bacteria 8228321
1456 2935863066 2935855204 Bacteria 9035059
1457 2935871876 2935864058 Bacteria 9784707
1458 2935882233 2935873716 Bacteria 9632195
1459 2935883294 2935883170 Bacteria 7964738
1460 2935910997 2935908558 Bacteria 8568796
1461 2935924158 2935916978 Bacteria 9113783
1462 2935932789 2935926038 Bacteria 8601059
1463 2935937352 2935934488 Bacteria 8602579
1464 2935949447 2935942939 Bacteria 8599779
1465 2935958154 2935951376 Bacteria 8602333
1466 2935967245 2935959822 Bacteria 7869783
1467 2935971191 2935967501 Bacteria 8603075
1468 2935982216 2935975950 Bacteria 8347125
1469 2935985354 2935984226 Bacteria 8302647
1470 2936000196 2935992306 Bacteria 9802711
1471 2936010110 2936002035 Bacteria 9362176
1472 2936012378 2936011229 Bacteria 8801034
1473 2936020541 2936019824 Bacteria 8804134
1474 2936029671 2936028420 Bacteria 8965941
1475 2936043960 2936037263 Bacteria 9446081
1476 2936051864 2936046547 Bacteria 8903709
1477 2936056882 2936055302 Bacteria 8785755
1478 2940558674 2940556831 Bacteria 9590747
1479 2941508886 2941507105 Bacteria 8166816
1480 2941516715 2941515067 Bacteria 8166720
1481 2941524268 2941523033 Bacteria 8169134
1482 2941535707 2941531003 Bacteria 7653939
1483 2941543592 2941538514 Bacteria 9402094
1484 3005486376 3005483717 Bacteria 7877331
1485 3005506284 3005506211 Bacteria 6943378
1486 3005589064 3005587118 Bacteria 7794411
1487 3005595441 3005594810 Bacteria 8716512
1488 3005711401 3005710791 Bacteria 7622528
1489 3005718676 3005718088 Bacteria 8283608
1490 8006931209 8006926726 Bacteria 6749210
1491 8006936731 8006933436 Bacteria 10410654
1492 8006967862 8006964411 Bacteria 8966052
1493 8006976701 8006973647 Bacteria 10679141
1494 8006992458 8006984368 Bacteria 9651211
1495 8006998528 8006994254 Bacteria 8309700
1496 8016517755 8016511872 Bacteria 9921665
1497 8016525810 8016522445 Bacteria 8156687
1498 8016539409 8016530956 Bacteria 8155261
1499 8016558013 8016557553 Bacteria 8154380
1500 8016569104 8016566248 Bacteria 8158151
1501 8016581739 8016575299 Bacteria 8154085
1502 8016585928 8016583857 Bacteria 10421953
1503 8016596027 8016595262 Bacteria 8149947
1504 8016606902 8016603502 Bacteria 8731218
1505 8016618810 8016613128 Bacteria 8794220
1506 8016622726 8016622563 Bacteria 7999408
1507 8016635220 8016630954 Bacteria 9217207
1508 8017058875 8017057580 Bacteria 10023680
1509 8019540891 8019538911 Bacteria 7872763
1510 8019549723 8019547302 Bacteria 7996444
1511 8019561968 8019555841 Bacteria 9642137
1512 8019576775 8019576017 Bacteria 10049540
1513 8019594832 8019586578 Bacteria 10212056
1514 8019606908 8019597564 Bacteria 10041141
1515 8019611600 8019608314 Bacteria 10042931
1516 8019623365 8019619141 Bacteria 9218857
1517 8019629729 8019629233 Bacteria 8687553
1518 8019640887 8019638758 Bacteria 9062356
1519 8019666573 8019659431 Bacteria 8577854
1520 8019676267 8019668869 Bacteria 8791617
1521 8019679717 8019678201 Bacteria 8863603
1522 8019695783 8019687851 Bacteria 8712826
1523 8055742854 8055742211 Bacteria 9226248
1524 8056676293 8056673599 Bacteria 7871253
1525 8056683210 8056681323 Bacteria 8472857
1526 8056693994 8056689827 Bacteria 6712655
1527 8056970847 8056967851 Bacteria 9038162
1528 JGI24740J21852_10009104
1529 JGI24739J22299_10051274
1530 JGI25151J46595_10000339
1531 JGI25151J46595_10000511
1532 JGI25406J46586_10000037
1533 JGI25406J46586_10011025
1534 JGI25165J46597_1010949
1535 JGI25165J46597_1011014
1536 JGI25153J46596_10017912
1537 JGI25160J50197_1001469
1538 JGI25160J50197_1006549
1539 JGI25161J50226_1011108
1540 JGI25404J52841_10009407
1541 Ga0055526_1003688
1542 Ga0055526_1017843
1543 Ga0055526_1019303
1544 Ga0055537_1003689
1545 Ga0055528_1012512
1546 Ga0055531_10001877
1547 Ga0055543_1020848
1548 Ga0065165_1001029
1549 Ga0065165_1001154
1550 Ga0065165_1002192
1551 Ga0065165_1036438
1552 Ga0070658_10013187
1553 Ga0070658_10084612
1554 Ga0070683_100030576
1555 Ga0070683_100105357
1556 Ga0070683_100209347
1557 Ga0070670_100012038
1558 Ga0068869_100117711
1559 Ga0070680_100010838
1560 Ga0070680_100054220
1561 Ga0070680_100159319
1562 Ga0070682_100142269
1563 Ga0070682_100155993
1564 Ga0068868_100184941
1565 Ga0068868_100285209
1566 Ga0070660_100045764
1567 Ga0070660_100126166
1568 Ga0070660_100305969
1569 Ga0070689_100092651
1570 Ga0070689_100107729
1571 Ga0070691_10148549
1572 Ga0070687_100020363
1573 Ga0070661_100021771
1574 Ga0070661_100053350
1575 Ga0070661_100103174
1576 Ga0070669_100019282
1577 Ga0070669_100114802
1578 Ga0070671_100198882
1579 Ga0070674_100014497
1580 Ga0070674_100151333
1581 Ga0070688_100069361
1582 Ga0070688_100127480
1583 Ga0070659_100189375
1584 Ga0070667_100366666
1585 Ga0070709_10004068
1586 Ga0070709_10007215
1587 Ga0070709_10167440
1588 Ga0070714_100002014
1589 Ga0070714_100101837
1590 Ga0070713_100004390
1591 Ga0070713_100022427
1592 Ga0070713_100358163
1593 Ga0070710_10001042
1594 Ga0070710_10001151
1595 Ga0070710_10003221
1596 Ga0070710_10096486
1597 Ga0070701_10073112
1598 Ga0070711_100006813
1599 Ga0070711_100021205
1600 Ga0070711_100033555
1601 Ga0070711_100287129
1602 Ga0070700_100030000
1603 Ga0070663_100011844
1604 Ga0070663_100018623
1605 Ga0070663_100079114
1606 Ga0070663_100086319
1607 Ga0070663_100096317
1608 Ga0070663_100101611
1609 Ga0070678_100199754
1610 Ga0070662_100007653
1611 Ga0070662_100441925
1612 Ga0070681_10005467
1613 Ga0070681_10005807
1614 Ga0070681_10090767
1615 Ga0068867_100018925
1616 Ga0068867_100024373
1617 Ga0070685_10008823
1618 Ga0070698_100149838
1619 Ga0070679_100167416
1620 Ga0070679_100204651
1621 Ga0070684_100010049
1622 Ga0070684_100036442
1623 Ga0070684_100105675
1624 Ga0068853_100000394
1625 Ga0068853_100037399
1626 Ga0068853_100088582
1627 Ga0068853_100247886
1628 Ga0068853_100321887
1629 Ga0070672_100035524
1630 Ga0070672_100118458
1631 Ga0070672_100165647
1632 Ga0070686_100026130
1633 Ga0070665_100015225
1634 Ga0070665_100026195
1635 Ga0070665_100036826
1636 Ga0070665_100057997
1637 Ga0070665_100067534
1638 Ga0070665_100107799
1639 Ga0070665_100161918
1640 Ga0070665_100202518
1641 Ga0068855_100160160
1642 Ga0068855_100160864
1643 Ga0068855_100200378
1644 Ga0068855_100212068
1645 Ga0068855_100232792
1646 Ga0068855_100237584
1647 Ga0070664_100132579
1648 Ga0070664_100193038
1649 Ga0068857_100023868
1650 Ga0068857_100061244
1651 Ga0068857_100093922
1652 Ga0068857_100113188
1653 Ga0068857_100188973
1654 Ga0068857_100271465
1655 Ga0068857_100285121
1656 Ga0068854_100011204
1657 Ga0068856_100000905
1658 Ga0068856_100002885
1659 Ga0068856_100164263
1660 Ga0068856_100184861
1661 Ga0068856_100237104
1662 Ga0068856_100293010
1663 Ga0068856_100494579
1664 Ga0070702_100022702
1665 Ga0070702_100121076
1666 Ga0068852_100014713
1667 Ga0068852_100236269
1668 Ga0068859_100085781
1669 Ga0068859_100162077
1670 Ga0068859_100307388
1671 Ga0068864_100155422
1672 Ga0068864_100156373
1673 Ga0068864_100243019
1674 Ga0068861_100192402
1675 Ga0068851_10004128
1676 Ga0068851_10023841
1677 Ga0068870_10018341
1678 Ga0068863_100168195
1679 Ga0068863_100183208
1680 Ga0068863_100198187
1681 Ga0068858_100117270
1682 Ga0068858_100147996
1683 Ga0068860_100000840
1684 Ga0068860_100013212
1685 Ga0068860_100023212
1686 Ga0068860_100190751
1687 Ga0068862_100174421
1688 Ga0068862_100254431
1689 Ga0081455_10022044
1690 Ga0081455_10032010
1691 Ga0081455_10035974
1692 Ga0081455_10043817
1693 Ga0081455_10049455
1694 Ga0081538_10035922
1695 Ga0081540_1003518
1696 Ga0081540_1007804
1697 Ga0081540_1018183
1698 Ga0081540_1034156
1699 Ga0081540_1073564
1700 Ga0081539_10000129
1701 Ga0081539_10001014
1702 Ga0081539_10013531
1703 Ga0070717_10001143
1704 Ga0070717_10008317
1705 Ga0070717_10208823
1706 Ga0075365_10010667
1707 Ga0075365_10023623
1708 Ga0075365_10184713
1709 Ga0075365_10187110
1710 Ga0075363_100000174
1711 Ga0075363_100016650
1712 Ga0075363_100239604
1713 Ga0075364_10000925
1714 Ga0075364_10104086
1715 Ga0075364_10148103
1716 Ga0070715_10004589
1717 Ga0070716_100000855
1718 Ga0070716_100001543
1719 Ga0070716_100140567
1720 Ga0070716_100170752
1721 Ga0070712_100002401
1722 Ga0070712_100014160
1723 Ga0070712_100023032
1724 Ga0070712_100027911
1725 Ga0070712_100231121
1726 Ga0075362_10065646
1727 Ga0075367_10032163
1728 Ga0075367_10148236
1729 Ga0075369_10026154
1730 Ga0097621_100123307
1731 Ga0097621_100124709
1732 Ga0075370_10105155
1733 Ga0075370_10164575
1734 Ga0068871_100062766
1735 Ga0075428_100017893
1736 Ga0075428_100060675
1737 Ga0075428_100087121
1738 Ga0075430_100076366
1739 Ga0075430_100103191
1740 Ga0075431_100064819
1741 Ga0075431_100074655
1742 Ga0075431_100182975
1743 Ga0075433_10415822
1744 Ga0075434_100073828
1745 Ga0068865_100057395
1746 Ga0068865_100066160
1747 Ga0097620_100085777
1748 Ga0097620_100162075
1749 Ga0097620_100307383
1750 Ga0099824_1005437
1751 Ga0099824_1019303
1752 Ga0099823_1021543
1753 Ga0099794_10092105
1754 Ga0105240_10003827
1755 Ga0105240_10019441
1756 Ga0105240_10341685
1757 Ga0111539_10076597
1758 Ga0111539_10241498
1759 Ga0105245_10154763
1760 Ga0105245_10237695
1761 Ga0105245_10249088
1762 Ga0105247_10011850
1763 Ga0105247_10045923
1764 Ga0114129_10005063
1765 Ga0114129_10098068
1766 Ga0114129_10294007
1767 Ga0114129_10526533
1768 Ga0105243_10057159
1769 Ga0105243_10140789
1770 Ga0105241_10000556
1771 Ga0105241_10044147
1772 Ga0105241_10061791
1773 Ga0105241_10135187
1774 Ga0105241_10413717
1775 Ga0105248_10058261
1776 Ga0105248_10141182
1777 Ga0105248_10272296
1778 Ga0105248_10755432
1779 Ga0105237_10017741
1780 Ga0105237_10026514
1781 Ga0105237_10059686
1782 Ga0105237_10073147
1783 Ga0105237_10159141
1784 Ga0105238_10001118
1785 Ga0105238_10344110
1786 Ga0105239_10003377
1787 Ga0105239_10010894
1788 Ga0105239_10034448
1789 Ga0105239_10059927
1790 Ga0105239_10152353
1791 Ga0105239_10189763
1792 Ga0105239_10199396
1793 Ga0105239_10349306
1794 Ga0105246_10070789
1795 Ga0157373_10020152
1796 Ga0157373_10335880
1797 Ga0157370_10061898
1798 Ga0157370_10073237
1799 Ga0157370_10133128
1800 Ga0157370_10390335
1801 Ga0157369_10074086
1802 Ga0157369_10111585
1803 Ga0171462_1024
1804 Ga0157374_10025168
1805 Ga0157374_10068395
1806 Ga0157374_10251918
1807 Ga0157374_10384031
1808 Ga0157378_10048834
1809 Ga0163162_10025657
1810 Ga0163162_10308733
1811 Ga0157375_10296004
1812 Ga0157380_10180227
1813 Ga0157377_10020563
1814 Ga0157379_10158582
1815 Ga0157376_10245231
1816 Ga0157376_10247854
1817 Ga0157376_10268446
1818 Ga0163161_10161517
1819 Ga0214544_1000087
1820 Ga0214542_1000018
1821 Ga0214545_1000009
1822 Ga0214543_1000037
1823 Ga0213873_10017573
1824 Ga0213872_10029426
1825 Ga0213876_10000506
1826 Ga0213876_10085240
1827 Ga0213871_10014861
1828 Ga0209563_102656
1829 Ga0209677_100279
1830 Ga0209677_101823
1831 Ga0209148_1000743
1832 Ga0209233_1002530
1833 Ga0209233_1020556
1834 Ga0209565_1000234
1835 Ga0209673_1001141
1836 Ga0209673_1016587
1837 Ga0209675_1005480
1838 Ga0209025_1000017
1839 Ga0209564_1000044
1840 Ga0209564_1001508
1841 Ga0209564_1001652
1842 Ga0209758_1000030
1843 Ga0209758_1000884
1844 Ga0209758_1000949
1845 Ga0209758_1001021
1846 Ga0209758_1003078
1847 Ga0209758_1003950
1848 Ga0209758_1004035
1849 Ga0209758_1013339
1850 Ga0209758_1031502
1851 Ga0209256_1001055
1852 Ga0209256_1005633
1853 Ga0207426_1002551
1854 Ga0207426_1008813
1855 Ga0209257_1000246
1856 Ga0209257_1001419
1857 Ga0207656_10000874
1858 Ga0207656_10025611
1859 Ga0207653_10010152
1860 Ga0207692_10015708
1861 Ga0207692_10019740
1862 Ga0207692_10053400
1863 Ga0207710_10024653
1864 Ga0207688_10003085
1865 Ga0207688_10054536
1866 Ga0207647_10001617
1867 Ga0207647_10009026
1868 Ga0207647_10055203
1869 Ga0207685_10004594
1870 Ga0207699_10000614
1871 Ga0207699_10012377
1872 Ga0207699_10013219
1873 Ga0207699_10015252
1874 Ga0207645_10004656
1875 Ga0207643_10024474
1876 Ga0207643_10211894
1877 Ga0207705_10033296
1878 Ga0207705_10088600
1879 Ga0207705_10091227
1880 Ga0207654_10029065
1881 Ga0207654_10030270
1882 Ga0207654_10054556
1883 Ga0207707_10000507
1884 Ga0207707_10004195
1885 Ga0207707_10051011
1886 Ga0207695_10000059
1887 Ga0207695_10000366
1888 Ga0207695_10152138
1889 Ga0207695_10167673
1890 Ga0207671_10012190
1891 Ga0207671_10049183
1892 Ga0207671_10058501
1893 Ga0207671_10091293
1894 Ga0207671_10116613
1895 Ga0207671_10146678
1896 Ga0207693_10000073
1897 Ga0207693_10006707
1898 Ga0207693_10008050
1899 Ga0207693_10203660
1900 Ga0207663_10003754
1901 Ga0207663_10102911
1902 Ga0207660_10016060
1903 Ga0207660_10033087
1904 Ga0207662_10005397
1905 Ga0207657_10005397
1906 Ga0207657_10114625
1907 Ga0207657_10130648
1908 Ga0207657_10191881
1909 Ga0207657_10196434
1910 Ga0207649_10021159
1911 Ga0207649_10078684
1912 Ga0207652_10004176
1913 Ga0207681_10196596
1914 Ga0207694_10001314
1915 Ga0207650_10032958
1916 Ga0207650_10351681
1917 Ga0207687_10019263
1918 Ga0207687_10136956
1919 Ga0207700_10018518
1920 Ga0207700_10044222
1921 Ga0207700_10049231
1922 Ga0207700_10051688
1923 Ga0207700_10083105
1924 Ga0207700_10162917
1925 Ga0207700_10274425
1926 Ga0207664_10029373
1927 Ga0207664_10060869
1928 Ga0207664_10092204
1929 Ga0207664_10182671
1930 Ga0207664_10261712
1931 Ga0207706_10007519
1932 Ga0207706_10025021
1933 Ga0207706_10064020
1934 Ga0207706_10234414
1935 Ga0207709_10151369
1936 Ga0207665_10000629
1937 Ga0207665_10029050
1938 Ga0207665_10110878
1939 Ga0207691_10058700
1940 Ga0207691_10381644
1941 Ga0207711_10073672
1942 Ga0207711_10087064
1943 Ga0207711_10452457
1944 Ga0207689_10008326
1945 Ga0207689_10010026
1946 Ga0207661_10067769
1947 Ga0207661_10077070
1948 Ga0207661_10342179
1949 Ga0207679_10063418
1950 Ga0207667_10002298
1951 Ga0207667_10013554
1952 Ga0207667_10030667
1953 Ga0207667_10137864
1954 Ga0207667_10155155
1955 Ga0207667_10234286
1956 Ga0207712_10003482
1957 Ga0207712_10094761
1958 Ga0207668_10018573
1959 Ga0207640_10005225
1960 Ga0207640_10007537
1961 Ga0207640_10015748
1962 Ga0207658_10062745
1963 Ga0207658_10191381
1964 Ga0207658_10207632
1965 Ga0207677_10006929
1966 Ga0207677_10103142
1967 Ga0207677_10173295
1968 Ga0207703_10051866
1969 Ga0207703_10208547
1970 Ga0207703_10347467
1971 Ga0207639_10018749
1972 Ga0207639_10067837
1973 Ga0207639_10258180
1974 Ga0207639_10393497
1975 Ga0207678_10014114
1976 Ga0207678_10021891
1977 Ga0207678_10024742
1978 Ga0207678_10050636
1979 Ga0207678_10067301
1980 Ga0207678_10070754
1981 Ga0207678_10286285
1982 Ga0207708_10000628
1983 Ga0207708_10045582
1984 Ga0207708_10217563
1985 Ga0207702_10000090
1986 Ga0207702_10001808
1987 Ga0207702_10019738
1988 Ga0207702_10323527
1989 Ga0207641_10332373
1990 Ga0207648_10032162
1991 Ga0207648_10059696
1992 Ga0207648_10217876
1993 Ga0207648_10350338
1994 Ga0207676_10114012
1995 Ga0207674_10003131
1996 Ga0207674_10010715
1997 Ga0207674_10025881
1998 Ga0207674_10053308
1999 Ga0207674_10108340
2000 Ga0207674_10129512
2001 Ga0207675_100038377
2002 Ga0207675_100241620
2003 Ga0207675_100276403
2004 Ga0207683_10060969
2005 Ga0207683_10157970
2006 Ga0207683_10211137
2007 Ga0207683_10433859
2008 Ga0207698_10005567
2009 Ga0209389_1000300
2010 Ga0209389_1000600
2011 Ga0209589_1000026
2012 Ga0209589_1000103
2013 Ga0209489_100046
2014 Ga0209489_100304
2015 Ga0209489_105428
2016 Ga0209700_100047
2017 Ga0209700_104718
2018 Ga0209588_1047760
2019 Ga0207428_10232932
2020 Ga0268266_10002806
2021 Ga0268266_10017176
2022 Ga0268266_10047899
2023 Ga0268266_10085822
2024 Ga0268266_10190731
2025 Ga0268266_10309692
2026 Ga0268265_10071041
2027 Ga0268265_10141454
2028 Ga0268264_10000050
2029 Ga0268264_10068650
2030 Ga0268264_10116325
2031 Ga0265336_10007697
2032 Ga0307517_10001290
2033 Ga0307515_10021936
2034 Ga0307515_10054429
2035 Ga0307515_10124283
2036 Ga0307515_10144547
2037 Ga0265338_10000621
2038 Ga0307511_10033707
2039 Ga0265330_10017512
2040 Ga0265330_10035491
2041 Ga0265332_10017880
2042 Ga0265328_10002266
2043 Ga0265329_10039751
2044 Ga0265340_10017259
2045 Ga0265340_10026191
2046 Ga0265339_10019152
2047 Ga0265339_10053462
2048 Ga0265331_10002340
2049 Ga0265316_10023990
2050 Ga0307509_10052922
2051 Ga0307509_10062012
2052 Ga0307509_10066790
2053 Ga0307509_10188611
2054 Ga0307408_100029075
2055 Ga0307508_10000005
2056 Ga0307508_10039337
2057 Ga0265314_10004999
2058 Ga0265342_10006002
2059 Ga0265342_10071404
2060 Ga0307516_10018977
2061 Ga0307516_10163452
2062 Ga0307405_10125334
2063 Ga0307406_10293655
2064 Ga0307409_100111075
2065 Ga0307411_10065175
2066 Ga0307415_100035640
2067 Ga0307415_100114114
2068 Ga0307415_100158925
2069 Ga0307507_10028702
2070 Ga0307510_10017519
2071 Ga0307510_10109050
2072 Ga0307510_10129657
2073 Ga0307510_10184021
2074 Ga0315911_1000035
2075 Ga0373926_0013704
2076 Ga0373934_0006345
2077 Ga0373934_0021064
2078 Ga0373923_0000525
2079 Ga0373923_0020966
2080 Ga0373923_0065620
2081 Ga0373936_0003270
2082 Ga0373936_0023654
2083 Ga0373945_0015899
2084 Ga0373953_0000204
2085 Ga0373953_0018955
2086 Ga0373953_0080581
2087 Ga0373954_0001865
2088 Ga0373954_0011302
2089 Ga0373954_0015630
2090 Ga0373956_0002489
2091 Ga0373957_0000424
2092 Ga0373957_0000593
2093 Ga0373943_0021096
2094 Ga0373943_0021894
2095 Ga0373943_0062793
2096 Ga0373946_0001185
2097 Ga0373946_0009709
2098 Ga0373955_0000184
2099 Ga0373955_0004466
2100 Ga0373924_0005456
2101 Ga0373924_0012525
2102 Ga0373931_0017214
2103 Ga0373931_0058396
2104 Ga0373931_0079351
2105 Ga0373935_0003480
2106 Ga0373935_0211204
2107 Ga0373927_0000109
2108 Ga0373927_0018866
2109 Ga0373927_0023688
2110 Ga0373927_0046180
2111 Ga0373927_0077811
2112 Ga0373927_0127320
2113 Ga0373933_0000277
2114 Ga0373933_0000554
2115 Ga0373933_0029273
2116 Ga0373947_0001517
2117 Ga0373947_0037203
2118 Ga0373947_0039506
2119 Ga0373937_0002867
2120 Ga0373937_0046190
2121 Ga0373937_0069801
2122 Ga0373937_0154475
2123 Ga0373925_0009034
2124 Ga0373925_0014057
2125 Ga0373925_0036544
2126 Ga0373925_0137912
2127 Ga0395899_0000018
2128 Ga0395899_0014550
2129 Ga0395899_0094681
2130 Ga0395899_0109567
2131 Ga0395900_0000833
2132 Ga0395900_0044930
2133 Ga0395900_0075127
2134 Ga0395898_0094881
2135 Ga0395898_0141613
2136 Ga0395898_0277715
2137 Ga0395905_0000002
2138 Ga0395905_0014893
2139 Ga0395905_0018837
2140 Ga0395905_0068044
2141 Ga0395905_0376289
2142 Ga0436364_0608267
2143 Ga0395901_0005514
2144 Ga0395901_0063364
2145 Ga0395901_0311579
2146 Ga0395901_0501363
2147 Ga0436365_0870327
2148 Ga0436365_1327145
2149 Ga0436365_1639132
2150 Ga0436365_1885173
2151 Ga0436360_0188092
2152 Ga0436360_0192034
2153 Ga0436360_0216049
2154 Ga0436363_1623990
2155 Ga0436362_0669995
2156 Ga0439465_0005228
2157 Ga0439465_0077959
2158 Ga0451853_2565009
2159 Ga0439458_0011673
2160 Ga0466969_0088707
2161 Ga0466969_0089476
2162 Ga0466972_0000871
2163 Ga0466972_0070594
2164 Ga0466965_0019156
2165 Ga0466966_0000137
2166 Ga0466966_0081559
2167 Ga0466961_0000039
2168 Ga0466961_0000182
2169 Ga0466964_0045903
2170 Ga0466971_0000562
2171 Ga0466971_0059791
2172 Ga0466970_0015491
2173 Ga0466957_0002614
2174 Ga0466957_0113199
2175 Ga0466957_0178751
2176 Ga0466960_0023816
2177 Ga0466959_0000028
2178 Ga0466959_0002520
2179 Ga0466959_0065022
2180 Ga0466959_0079846
2181 Ga0466958_0000162
2182 Ga0466967_0035287
2183 Ga0495617_026398
2184 Ga0495627_002311
2185 Ga0495592_0000678
2186 Ga0495592_0046911
2187 Ga0495603_0000189
2188 Ga0495603_0033579
2189 Ga0495603_0040481
2190 Ga0495603_0054816
2191 Ga0495603_0143314
2192 Ga0495590_0008709
2193 Ga0495629_0000268
2194 Ga0495629_0150296
2195 Ga0495638_0002733
2196 Ga0495638_0003907
2197 Ga0495638_0004594
2198 Ga0495638_0006283
2199 Ga0495638_0037250
2200 Ga0495638_0043467
2201 Ga0495641_0008241
2202 Ga0495651_0002545
2203 Ga0495651_0004117
2204 Ga0495651_0134106
2205 Ga0495653_0001252
2206 Ga0495653_0050722
2207 Ga0495653_0104304
2208 Ga0495650_0000114
2209 Ga0495650_0019974
2210 Ga0495580_0002333
2211 Ga0495580_0025076
2212 Ga0495580_0067373
2213 Ga0495582_0000144
2214 Ga0495582_0009481
2215 Ga0495605_0021634
2216 Ga0495605_0031478
2217 Ga0495605_0117082
2218 Ga0495639_0000067
2219 Ga0495639_0014306
2220 Ga0495639_0014334
2221 Ga0495639_0071724
2222 Ga0495639_0103719
2223 Ga0495662_0000005
2224 Ga0495662_0065818
2225 Ga0495664_0003350
2226 Ga0495664_0004265
2227 Ga0495664_0075429
2228 Ga0495664_0088639
2229 Ga0495664_0094845
2230 Ga0495584_0103591
2231 Ga0495594_0027701
2232 Ga0495594_0073449
2233 Ga0495596_0066604
2234 Ga0495607_0029468
2235 Ga0495607_0076292
2236 Ga0495583_0000013
2237 Ga0495583_0069144
2238 Ga0495606_0000858
2239 Ga0495606_0028077
2240 Ga0495606_0035190
2241 Ga0495606_0060045
2242 Ga0495606_0166439
2243 Ga0495608_0000255
2244 Ga0495608_0003767
2245 Ga0495610_0008642
2246 Ga0495610_0024830
2247 Ga0495616_0000053
2248 Ga0495616_0023169
2249 Ga0495618_0039118
2250 Ga0495618_0077305
2251 Ga0495618_0093913
2252 Ga0495618_0216734
2253 Ga0495620_0020567
2254 Ga0495628_0014733
2255 Ga0495628_0139155
2256 Ga0495628_0249602
2257 Ga0495630_0015290
2258 Ga0495630_0020943
2259 Ga0495630_0117424
2260 Ga0495631_0001968
2261 Ga0495631_0025704
2262 Ga0495632_0000335
2263 Ga0495637_0008165
2264 Ga0495637_0018711
2265 Ga0495637_0019164
2266 Ga0495643_0022446
2267 Ga0495644_0047202
2268 Ga0495648_0000072
2269 Ga0495648_0000664
2270 Ga0495648_0028166
2271 Ga0495648_0041967
2272 Ga0495666_0046111
2273 Ga0495652_0006124
2274 Ga0495652_0007010
2275 Ga0495654_0000082
2276 Ga0495654_0027297
2277 Ga0495665_0001692
2278 Ga0495665_0031918
2279 Ga0495640_0002790
2280 Ga0495640_0012191
2281 Ga0495640_0013838
2282 Ga0495640_0016475
2283 Ga0495587_0002484
2284 Ga0495587_0033195
2285 Ga0495587_0123562
2286 Ga0495598_0060739
2287 Ga0495609_0050752
2288 Ga0495597_0007237
2289 Ga0495645_0004244
2290 Ga0495645_0006922
2291 Ga0495622_0011946
2292 Ga0495622_0017449
2293 Ga0495622_0046154
2294 Ga0495622_0059535
2295 Ga0495667_0000121
2296 Ga0495667_0006748
2297 Ga0495667_0096853
2298 Ga0495656_0012851
2299 Ga0495656_0015199
2300 Ga0495668_0026914
2301 Ga0495668_0047980
2302 Ga0495668_0049516
2303 Ga0495668_0131764
2304 Ga0495634_0001407
2305 Ga0495634_0009303
2306 Ga0495634_0013633
2307 Ga0495634_0068133
2308 Ga0495625_0000290
2309 Ga0495625_0016762
2310 Ga0495625_0019463
2311 Ga0495625_0049575
2312 Ga0495625_0100837
2313 Ga0495625_0144679
2314 Ga0495635_0000072
2315 Ga0495635_0002392
2316 Ga0495635_0007293
2317 Ga0495635_0022140
2318 Ga0495635_0125192
2319 Ga0495659_0017556
2320 Ga0495659_0109805
2321 Ga0495661_0026266
2322 Ga0495588_0022358
2323 Ga0495588_0045133
2324 Ga0495588_0052717
2325 Ga0495588_0052950
2326 Ga0495657_0004073
2327 Ga0495657_0014654
2328 Ga0495657_0127280
2329 Ga0495599_0000468
2330 Ga0495599_0026745
2331 Ga0495599_0045178
2332 Ga0495623_0022493
2333 Ga0495646_0005577
2334 Ga0495646_0029722
2335 Ga0495646_0041694
2336 Ga0495647_0014841
2337 Ga0495647_0014973
2338 Ga0495647_0046107
2339 Ga0495658_0001103
2340 Ga0495669_0002316
2341 Ga0495613_0018960
2342 Ga0495613_0079473
2343 Ga0495613_0093627
2344 Ga0495613_0154125
2345 Ga0495624_0000460
2346 Ga0495624_0035416
2347 Ga0495670_0036380
2348 Ga0495670_0043471
2349 Ga0495671_0036785
2350 Ga0495671_0051961
2351 Ga0495671_0067341
2352 Ga0495589_0031361
2353 Ga0495600_0001056
2354 Ga0495600_0006711
2355 Ga0495660_0025111
2356 Ga0495581_0000178
2357 Ga0495581_0076596
2358 Ga0495604_0002293
2359 Ga0495604_0013732
2360 Ga0495674_0004128
2361 Ga0495674_0016488
2362 Ga0495674_0314638
2363 Ga0495672_0013122
2364 Ga0495672_0018740
2365 Ga0495672_0047646
2366 Ga0495676_0093195
2367 Ga0495676_0097123
2368 Ga0495680_0001208
2369 Ga0495680_0012539
2370 Ga0495680_0085047
2371 Ga0495683_0061678
2372 Ga0495683_0112413
2373 Ga0495687_011216
2374 Ga0495675_0003178
2375 Ga0495677_0014791
2376 Ga0495679_006243
2377 Ga0495673_0000025
2378 Ga0495673_0015713
2379 Ga0495673_0036262
2380 Ga0495684_0002454
2381 Ga0495684_0026908
2382 Ga0495684_0242714
2383 Ga0495686_0003968
2384 Ga0495686_0037559
2385 Ga0495686_0064279
2386 Ga0495686_0090786
2387 Ga0495686_0131045
2388 Ga0495593_0000038
2389 Ga0495593_0000109
2390 Ga0495593_0012360
2391 Ga0495602_0008629
2392 Ga0495602_0024467
2393 Ga0495602_0138489
2394 Ga0495614_0058587
2395 Ga0495615_0016929
2396 Ga0495626_0024253
2397 Ga0495626_0113413
2398 Ga0496100_0004173
2399 Ga0496100_0022384
2400 Ga0496100_0053083
2401 Ga0496100_0114466
2402 Ga0496100_0169550
2403 Ga0496101_0005878
2404 Ga0496101_0025066
2405 Ga0496101_0181616
2406 Ga0496101_0250749
2407 Ga0496102_0008645
2408 Ga0496102_0024656
2409 Ga0496102_0031103
2410 Ga0496102_0076991
2411 Ga0496102_0094828
2412 Ga0496102_0113864
2413 Ga0496102_0251869
2414 Ga0496102_0281205
2415 Ga0496103_0015806
2416 Ga0496103_0023402
2417 Ga0496103_0156683
2418 Ga0496103_0230343
2419 Ga0496104_0013379
2420 Ga0496104_0015039
2421 Ga0496104_0015607
2422 Ga0496104_0019922
2423 Ga0496104_0046196
2424 Ga0496104_0169108
2425 Ga0496104_0202556
2426 Ga0496104_0403927
2427 Ga0496105_0007692
2428 Ga0496105_0119343
2429 Ga0496105_0144823
2430 Ga0496105_0170453
2431 Ga0496105_0170793
2432 Ga0496105_0312403
2433 Ga0496106_0043894
2434 Ga0496106_0079997
2435 Ga0496106_0113165
2436 Ga0496106_0217929
2437 Ga0496106_0288896
2438 Ga0496106_0311315
2439 Ga0496107_0000821
2440 Ga0496107_0009564
2441 Ga0496107_0010126
2442 Ga0496107_0017264
2443 Ga0496107_0035767
2444 Ga0496107_0091899
2445 Ga0496108_0000553
2446 Ga0496108_0040135
2447 Ga0496108_0043553
2448 Ga0496108_0153969
2449 Ga0496108_0165589
2450 Ga0496109_0000574
2451 Ga0496109_0014214
2452 Ga0496109_0014907
2453 Ga0496109_0067541
2454 Ga0496109_0164013
2455 Ga0496109_0188534
2456 Ga0496109_0250828
2457 Ga0496110_0015270
2458 Ga0496110_0022137
2459 Ga0496110_0022422
2460 Ga0496110_0024393
2461 Ga0496110_0031954
2462 Ga0496110_0047439
2463 Ga0496110_0260660
2464 Ga0496110_0574992
2465 Ga0496111_0000254
2466 Ga0496111_0038744
2467 Ga0496111_0114014
2468 Ga0496111_0226915
2469 Ga0496112_0000065
2470 Ga0496112_0005410
2471 Ga0496112_0009978
2472 Ga0496112_0011336
2473 Ga0496112_0034980
2474 Ga0496112_0057686
2475 Ga0496112_0059684
2476 Ga0496112_0118017
2477 Ga0496112_0134453
2478 Ga0496112_0251642
2479 Ga0496113_0000209
2480 Ga0496113_0017578
2481 Ga0496113_0099558
2482 Ga0496113_0100062
2483 Ga0496113_0218242
2484 Ga0496113_0240405
2485 Ga0496113_0251121
2486 Ga0496114_0007557
2487 Ga0496114_0156999
2488 Ga0496114_0233169
2489 Ga0496115_0003049
2490 Ga0496115_0027806
2491 Ga0496115_0058651
2492 Ga0496115_0078514
2493 Ga0496116_0003085
2494 Ga0496116_0160508
2495 Ga0496117_0007135
2496 Ga0496117_0024076
2497 Ga0496117_0072968
2498 Ga0496117_0163544
2499 Ga0496118_0005552
2500 Ga0496118_0015872
2501 Ga0496118_0017902
2502 Ga0496118_0033771
2503 Ga0496118_0135115
2504 Ga0496119_0044038
2505 Ga0496119_0090119
2506 Ga0496119_0100564
2507 Ga0496119_0107164
2508 Ga0496119_0136213
2509 Ga0496120_0005683
2510 Ga0496120_0010445
2511 Ga0496121_0000453
2512 Ga0496121_0002104
2513 Ga0496121_0002583
2514 Ga0496121_0006128
2515 Ga0496121_0016140
2516 Ga0496121_0021760
2517 Ga0496121_0043512
2518 Ga0496121_0052036
2519 Ga0496121_0056847
2520 Ga0496121_0074801
2521 Ga0496121_0097871
2522 Ga0496121_0099348
2523 Ga0496121_0235803
2524 Ga0496122_0051260
2525 Ga0496123_0106959
2526 Ga0496124_0002831
2527 Ga0496124_0020645
2528 Ga0496125_0003090
2529 Ga0496125_0005379
2530 Ga0496125_0016016
2531 Ga0496125_0069645
2532 Ga0496125_0120943
2533 Ga0496126_0002707
2534 Ga0496126_0012688
2535 Ga0496126_0021067
2536 Ga0496126_0032509
2537 Ga0496126_0042154
2538 Ga0496126_0053918
2539 Ga0496126_0150841
2540 Ga0496126_0160188
2541 Ga0496126_0165352
2542 Ga0496126_0167090
2543 Ga0496126_0170504
2544 Ga0496126_0225470
2545 Ga0495678_001114
2546 Ga0501031_0018544
2547 Ga0501031_0018611
2548 Ga0501031_0055908
2549 Ga0501032_0000309
2550 Ga0501032_0023936
2551 Ga0501032_0034437
2552 Ga0501032_0063456
2553 Ga0501032_0072665
2554 Ga0501033_0001437
2555 Ga0501033_0001792
2556 Ga0501033_0005552
2557 Ga0501033_0011464
2558 Ga0501033_0146852
2559 Ga0501034_0000082
2560 Ga0501034_0038159
2561 Ga0501034_0043255
2562 Ga0501034_0120069
2563 Ga0501034_0470216
2564 Ga0501036_0000121
2565 Ga0501036_0017730
2566 Ga0501036_0059762
2567 Ga0501036_0074431
2568 Ga0501036_0075582
2569 Ga0501036_0261572
2570 Ga0501037_0001873
2571 Ga0501037_0003883
2572 Ga0501037_0004517
2573 Ga0501037_0011302
2574 Ga0501037_0055880
2575 Ga0501037_0064072
2576 Ga0501038_0001766
2577 Ga0501038_0007655
2578 Ga0501038_0011654
2579 Ga0501038_0020734
2580 Ga0501038_0028126
2581 Ga0501038_0131751
2582 Ga0501038_0133621
2583 Ga0501039_0008300
2584 Ga0501039_0008973
2585 Ga0501039_0019231
2586 Ga0501039_0163379
2587 Ga0501039_0182526
2588 Ga0501039_0245128
2589 Ga0501039_0322592
2590 Ga0501040_0019588
2591 Ga0501041_0024090
2592 Ga0501042_0002459
2593 Ga0501042_0020947
2594 Ga0501043_0000109
2595 Ga0501043_0018022
2596 Ga0501043_0020967
2597 Ga0501043_0031418
2598 Ga0501043_0054188
2599 Ga0501043_0065893
2600 Ga0501043_0071423
2601 Ga0501043_0097384
2602 Ga0501043_0223631
2603 Ga0501046_0006125
2604 Ga0501046_0011755
2605 Ga0501046_0020055
2606 Ga0501046_0108527
2607 Ga0501046_0145287
2608 Ga0501046_0241597
2609 Ga0501047_0000331
2610 Ga0501047_0005862
2611 Ga0501047_0013763
2612 Ga0501047_0016114
2613 Ga0501047_0081308
2614 Ga0501047_0119800
2615 Ga0501048_0000124
2616 Ga0501048_0006242
2617 Ga0501048_0207138
2618 Ga0501048_0209467
2619 Ga0501067_0000754
2620 Ga0501067_0004772
2621 Ga0501068_0003061
2622 Ga0501068_0013934
2623 Ga0501069_0043468
2624 Ga0501069_0231905
2625 Ga0501070_0109696
2626 Ga0501070_0120997
2627 Ga0501071_0058511
2628 Ga0501072_0001910
2629 Ga0501072_0011811
2630 Ga0501073_0000101
2631 Ga0501073_0007671
2632 Ga0501073_0022798
2633 Ga0501074_0000673
2634 Ga0501074_0022078
2635 Ga0501076_0023212
2636 Ga0501076_0057238
2637 Ga0501077_0007464
2638 Ga0501079_0007287
2639 Ga0501079_0044414
2640 Ga0501079_0053524
2641 Ga0501080_0000151
2642 Ga0501080_0014075
2643 Ga0501080_0028786
2644 Ga0501080_0324447
2645 Ga0501080_0339089
2646 Ga0501083_0001467
2647 Ga0501083_0083002
2648 Ga0501083_0243988
2649 Ga0501035_0000150
2650 Ga0501035_0005831
2651 Ga0501035_0025197
2652 Ga0501035_0030637
2653 Ga0501035_0032463
2654 Ga0501035_0053293
2655 Ga0501035_0490784
2656 Ga0501044_0000247
2657 Ga0501044_0005266
2658 Ga0501044_0036813
2659 Ga0501044_0037013
2660 Ga0501044_0087334
2661 Ga0501044_0144108
2662 Ga0501044_0238803
2663 Ga0501044_0271729
2664 Ga0501045_0009953
2665 Ga0501045_0010576
2666 nmdc:mga03683_82989_c1
2667 nmdc:mga03n38_2959_c1
2668 nmdc:mga03n38_3537_c1
2669 nmdc:mga03n38_3664_c1
2670 nmdc:mga00v17_122202_c1
2671 nmdc:mga00v17_18034_c1
2672 nmdc:mga00v17_2135_c1
2673 nmdc:mga0yw44_11059_c1
2674 nmdc:mga0yw44_171210_c1
2675 nmdc:mga0yw44_17603_c1
2676 nmdc:mga0yw44_21959_c1
2677 nmdc:mga0yw44_70359_c1
2678 nmdc:mga0yw44_8315_c1
2679 nmdc:mga0yw44_83423_c1
2680 nmdc:mga06z11_67020_c1
2681 nmdc:mga06z11_97470_c1
2682 nmdc:mga04h51_40526_c1
2683 nmdc:mga07m45_33103_c1
2684 nmdc:mga05p37_27900_c1
2685 nmdc:mga05p37_48317_c1
2686 nmdc:mga0qj67_179491_c1
2687 nmdc:mga06r32_119041_c1
2688 nmdc:mga06r32_355300_c1
2689 nmdc:mga06r32_54021_c1
2690 nmdc:mga08y16_504615_c1
2691 nmdc:mga08y16_510493_c1
2692 nmdc:mga08y16_65363_c1
2693 nmdc:mga0rr50_162149_c1
2694 nmdc:mga0a205_318113_c1
2695 nmdc:mga0sz30_12253_c1
2696 Ga0495601_0005665
2697 Ga0495601_0022706
2698 Ga0495601_0044081
2699 Ga0495612_0012883
2700 Ga0495612_0016639
2701 Ga0500635_0006237
2702 Ga0500635_0058978
2703 Ga0495655_0030429
2704 Ga0495595_0000437
2705 Ga0495595_0037333
2706 Ga0495595_0075238
2707 Ga0495595_0089325
2708 Ga0495619_0001386
2709 Ga0495619_0019949
2710 Ga0495619_0106067
2711 Ga0500578_0000124
2712 Ga0500578_0097862
2713 Ga0500643_000117
2714 Ga0500643_027479
2715 Ga0500651_0007987
2716 Ga0500651_0036263
2717 Ga0500566_0012564
2718 Ga0500640_016614
2719 Ga0500640_031016
2720 Ga0500641_0029521
2721 Ga0500641_0107514
2722 Ga0500648_086624
2723 Ga0500650_0000885
2724 Ga0500554_008277
2725 Ga0500554_018093
2726 Ga0500555_004649
2727 Ga0500556_0000019
2728 Ga0500556_0004025
2729 Ga0500556_0010261
2730 Ga0500556_0072231
2731 Ga0500557_000143
2732 Ga0500562_001270
2733 Ga0500569_005216
2734 Ga0500572_000955
2735 Ga0500572_025605
2736 Ga0500592_000579
2737 Ga0500592_014465
2738 Ga0500594_0000239
2739 Ga0500594_0011714
2740 Ga0500595_001903
2741 Ga0500595_002222
2742 Ga0500595_007252
2743 Ga0500595_008236
2744 Ga0500595_027287
2745 Ga0500595_044546
2746 Ga0500595_054382
2747 Ga0500607_095861
2748 Ga0500608_040872
2749 Ga0500614_012243
2750 Ga0500618_000093
2751 Ga0500642_0000048
2752 Ga0500642_0000137
2753 Ga0500642_0004012
2754 Ga0500652_005581
2755 Ga0500559_0000060
2756 Ga0500559_0001161
2757 Ga0500559_0004287
2758 Ga0500559_0008025
2759 Ga0500559_0013786
2760 Ga0500564_000502
2761 Ga0500568_0002172
2762 Ga0500568_0012112
2763 Ga0500568_0019114
2764 Ga0500568_0069123
2765 Ga0500573_0010850
2766 Ga0500573_0200219
2767 Ga0500586_005266
2768 Ga0500590_069628
2769 Ga0500590_084246
2770 Ga0500603_002291
2771 Ga0500616_0000038
2772 Ga0500616_0000059
2773 Ga0500616_0025571
2774 Ga0500622_0000995
2775 Ga0500622_0002106
2776 Ga0500622_0004401
2777 Ga0500622_0005729
2778 Ga0500622_0009444
2779 Ga0500622_0051451
2780 Ga0500624_006663
2781 Ga0500627_0016814
2782 Ga0500634_0025972
2783 Ga0500638_046986
2784 Ga0500639_017206
2785 Ga0500636_0001114
2786 Ga0500636_0008789
2787 Ga0500636_0092519
2788 Ga0500636_0101943
2789 Ga0500637_0000500
2790 Ga0500637_0028532
2791 Ga0500576_009372
2792 Ga0500611_008909
2793 Ga0500625_013646
2794 Ga0500645_000484
2795 Ga0500609_000477
2796 Ga0500609_005115
2797 Ga0500596_006542
2798 Ga0500596_009396
2799 Ga0500601_000813
2800 Ga0500601_001894
2801 Ga0501084_0012721
2802 Ga0501084_0075126
2803 Ga0500661_000621
2804 Ga0501082_0003420
2805 Ga0501082_0018039
2806 Ga0501082_0086418
2807 Ga0501082_0207213
2808 Ga0501082_0238928
2809 Ga0466962_0000142
2810 2513700424
2811 2507505623
2812 2508539516
2813 2508695886
2814 2509079133
2815 2509150142
2816 2511121662
2817 2511401107
2818 2513628921
2819 2513642263
2820 2513652799
2821 2513661881
2822 2513694024
2823 2513718829
2824 2513862539
2825 2513876929
2826 2513890479
2827 2513919110
2828 2514016091
2829 2515624024
2830 2517105888
2831 2517888428
2832 2524440067
2833 2524468379
2834 2524535263
2835 2528852077
2836 2585147844
2837 2585151564
2838 2585195562
2839 2603861709
2840 2617353255
2841 2617377293
2842 2643749273
2843 2643781394
2844 2643922986
2845 2643929133
2846 2644508953
2847 2644728799
2848 2644734187
2849 2671123633
2850 2723849327
2851 2728752065
2852 2739792302
2853 2745077821
2854 2793065644
2855 2793065915
2856 2793067245
2857 2793077107
2858 2805921277
2859 2818239252
2860 2819536374
2861 2819644629
2862 2824607499
2863 2824617549
2864 2824624910
2865 2824631738
2866 2824643206
2867 2824652309
2868 2824660963
2869 2824670739
2870 2824678637
2871 2824686947
2872 2824695082
2873 2824703434
2874 2824712920
2875 2824721555
2876 2824731485
2877 2824740008
2878 2824753558
2879 2824762108
2880 2824772397
2881 2824777518
2882 2838125754
2883 2841920176
2884 2841947965
2885 2841957062
2886 2841965124
2887 2841972793
2888 2841977570
2889 2841984872
2890 2842041374
2891 2842049416
2892 2844315857
2893 2847930718
2894 2847942680
2895 2849083425
2896 2857515630
2897 2857525897
2898 2874593255
2899 2874608441
2900 2874617146
2901 2874621377
2902 2874636766
2903 2874647768
2904 2876762904
2905 2876773295
2906 2876818922
2907 2879075374
2908 2879089860
2909 2879106704
2910 2879112796
2911 2879134118
2912 2879145569
2913 2881367140
2914 2881668416
2915 2885368719
2916 2885379862
2917 2885384667
2918 2885411183
2919 2888379115
2920 2888390291
2921 2888427511
2922 2889035878
2923 2891091149
2924 2893067821
2925 2903731807
2926 2903777945
2927 2904668047
2928 2904699280
2929 2904707832
2930 2904714178
2931 2906603666
2932 2906614209
2933 2906633210
2934 2906638818
2935 2906648040
2936 2906660919
2937 2908746962
2938 2908758877
2939 2908775808
2940 2917703302
2941 2919074242
2942 2922364355
2943 2922369151
2944 2922389052
2945 2922400763
2946 2922426031
2947 2929619005
2948 2929631082
2949 2932789047
2950 2932801322
2951 2932808835
2952 2932814316
2953 2932820442
2954 2932834474
2955 2933580285
2956 2935614679
2957 2935624457
2958 2935632451
2959 2935645847
2960 2935649069
2961 2935658159
2962 2935673414
2963 2935682591
2964 2935686795
2965 2935701525
2966 2935710500
2967 2935716483
2968 2935723392
2969 2935734948
2970 2935744261
2971 2935752761
2972 2935764692
2973 2935774671
2974 2935783758
2975 2935789814
2976 2935797818
2977 2935806197
2978 2935816969
2979 2935826280
2980 2935835252
2981 2935841366
2982 2935853776
2983 2935863066
2984 2935871876
2985 2935882233
2986 2935883294
2987 2935910997
2988 2935924158
2989 2935932789
2990 2935937352
2991 2935949447
2992 2935958154
2993 2935967245
2994 2935971191
2995 2935982216
2996 2935985354
2997 2936000196
2998 2936010110
2999 2936012378
3000 2936020541
3001 2936029671
3002 2936043960
3003 2936051864
3004 2936056882
3005 2940558674
3006 2941508886
3007 2941516715
3008 2941524268
3009 2941535707
3010 2941543592
3011 3005486376
3012 3005506284
3013 3005589064
3014 3005595441
3015 3005711401
3016 3005718676
3017 8006931209
3018 8006936731
3019 8006967862
3020 8006976701
3021 8006992458
3022 8006998528
3023 8016517755
3024 8016525810
3025 8016539409
3026 8016558013
3027 8016569104
3028 8016581739
3029 8016585928
3030 8016596027
3031 8016606902
3032 8016618810
3033 8016622726
3034 8016635220
3035 8017058875
3036 8019540891
3037 8019549723
3038 8019561968
3039 8019576775
3040 8019594832
3041 8019606908
3042 8019611600
3043 8019623365
3044 8019629729
3045 8019640887
3046 8019666573
3047 8019676267
3048 8019679717
3049 8019695783
3050 8055742854
3051 8056676293
3052 8056683210
3053 8056693994
3054 8056970847

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF03255

ACCA

Acetyl co-enzyme A carboxylase carboxyltransferase-like

73

381

0.99

PF01039

Carboxyl_trans

Carboxyl transferase domain

149

361

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
2f9y-assembly1.cif.gz_A-2 the crystal structure of the carboxyltransferase subunit of acc from escherichia coli 0.9208 7 313
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9184 8 316
5kdr-assembly1.cif.gz_A-2 the crystal structure of carboxyltransferase from staphylococcus aureus bound to the antimicrobial agent moiramide b. 0.9113 9 316
2f9i-assembly1.cif.gz_C crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9037 8 316
2f9i-assembly1.cif.gz_A crystal structure of the carboxyltransferase subunit of acc from staphylococcus aureus 0.9034 3 316
ID Description Score Start End Superfamily
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9256 8 316 3.90.226.10
af_Q2FXM7_1_314_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9088 8 316 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.9029 56 320 3.90.226.10
af_P9WQH9_238_492_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.893 56 320 3.90.226.10
af_O53578_265_515_3.90.226.10 Alpha Beta;Alpha-Beta Complex;2-enoyl-CoA Hydratase; Chain A, domain 1;2-enoyl-CoA Hydratase; Chain A, domain 1 0.7382 69 285 3.90.226.10
ID Description Score Start End GO Terms
AF-A0A658S5V1-F1-model_v4 deleted 0.9627 214 316
AF-A0A4V1T4P3-F1-model_v4 acetyl-CoA carboxytransferase (EC 2.1.3.15) 0.961 5 120 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A4Y8C129-F1-model_v4 deleted 0.9586 213 313
AF-A0A562KXJ5-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9566 5 320 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295
AF-A0A1G8P132-F1-model_v4 Acetyl-coenzyme A carboxylase carboxyl transferase subunit alpha (ACCase subunit alpha) (Acetyl-CoA carboxylase carboxyltransferase subunit alpha) (EC 2.1.3.15) 0.9557 1 320 GO:0003989
GO:0005524
GO:0006633
GO:0009317
GO:0016743
GO:2001295

Map