F494566
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1526 | 403 | 3052 | 133 |
Family's Representative Sequence
| Representative Sequence | 3300006871|Ga0075434_100256131|Ga0075434_1002561312 |
| Length | 155 |
| Sequence | MTGRHLGRWQPTPLSAVASRGVEPRGIHHLGVAVVDLDEAVATYERLFGARVEHRETVPDQGVEAASLRIGAGRVELLASLGAETPVGKFLAKRGPGMHHVAYEVDDVGEALGELAAEGAELIDEHPKRGLFGLEVAFVHPDAVHGVLAEIVSDG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 2 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 3 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 4 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 5 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 8 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 18 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 19 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 22 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 25 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 32 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 36 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 84 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 88 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 89 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 94 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 107 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300012500 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 | Metagenome | Rhizosphere |
| 120 | 3300012505 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 | Metagenome | Rhizosphere |
| 121 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 206 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 207 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 208 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 209 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 210 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 211 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 212 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 213 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 214 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 215 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 216 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 219 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 220 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 221 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 222 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 223 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 224 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 225 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 226 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 227 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 228 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 229 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 231 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 232 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 234 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 235 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 236 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 237 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 238 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 239 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 240 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 241 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 242 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 243 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 244 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 245 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 246 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 247 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 248 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 249 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 250 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 251 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 252 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 253 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 254 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 255 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 256 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 257 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 258 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 259 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 260 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 261 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 262 | 3300042124 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 | Metagenome | Rhizosphere |
| 263 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 264 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 265 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 266 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 267 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 268 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 269 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 270 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 271 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 272 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 277 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 278 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 279 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 280 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 281 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 282 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 283 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 284 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 285 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 286 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 287 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 288 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 337 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 338 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 339 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 340 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 341 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 342 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 343 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 344 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 345 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 346 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 347 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 348 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 349 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 350 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 355 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 356 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 359 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 369 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 370 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 371 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 372 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 373 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 374 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 375 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049762 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control | Metagenome | Rhizosphere |
| 381 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 382 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 386 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 393 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 396 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 397 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 398 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 399 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 400 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 401 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 402 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 403 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.93 |
| Metatranscriptomes | 0.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.66 |
| Nodule | 0 |
| Rhizoplane | 9.63 |
| Rhizosphere | 88.86 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 9.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075434_100256131 | 3300006871 | Bacteria | 1769 |
| 2 | JGI24743J22301_10010841 | 3300001991 | Bacteria | 1632 |
| 3 | JGI24745J21846_1043417 | 3300002073 | Unclassified | 560 |
| 4 | JGI24749J21850_1012296 | 3300002076 | Bacteria | 1202 |
| 5 | JGI24744J21845_10047793 | 3300002077 | Bacteria | 792 |
| 6 | JGI24034J26672_10064824 | 3300002239 | Unclassified | 647 |
| 7 | JGI24742J22300_10007594 | 3300002244 | Bacteria | 1789 |
| 8 | JGI24751J29686_10020412 | 3300002459 | Bacteria | 1372 |
| 9 | Ga0070658_10248202 | 3300005327 | Bacteria | 1510 |
| 10 | Ga0070676_10218216 | 3300005328 | Bacteria | 1258 |
| 11 | Ga0070676_11130895 | 3300005328 | Bacteria | 593 |
| 12 | Ga0070683_100046479 | 3300005329 | Bacteria | 4011 |
| 13 | Ga0070683_100106976 | 3300005329 | Bacteria | 2637 |
| 14 | Ga0070683_100179331 | 3300005329 | Bacteria | 2010 |
| 15 | Ga0070683_100579252 | 3300005329 | Bacteria | 1073 |
| 16 | Ga0070690_100101444 | 3300005330 | Bacteria | 1909 |
| 17 | Ga0070690_100402220 | 3300005330 | Bacteria | 1006 |
| 18 | Ga0070670_100029151 | 3300005331 | Bacteria | 4749 |
| 19 | Ga0070670_100259835 | 3300005331 | Bacteria | 1514 |
| 20 | Ga0070670_100292769 | 3300005331 | Bacteria | 1423 |
| 21 | Ga0070670_101206496 | 3300005331 | Bacteria | 691 |
| 22 | Ga0070677_10160055 | 3300005333 | Bacteria | 1056 |
| 23 | Ga0070666_10406974 | 3300005335 | Unclassified | 979 |
| 24 | Ga0070680_100065165 | 3300005336 | Bacteria | 2986 |
| 25 | Ga0070680_100709580 | 3300005336 | Bacteria | 866 |
| 26 | Ga0070680_101723480 | 3300005336 | Bacteria | 543 |
| 27 | Ga0070682_100008552 | 3300005337 | Bacteria | 5776 |
| 28 | Ga0068868_100012777 | 3300005338 | Bacteria | 6143 |
| 29 | Ga0068868_100022899 | 3300005338 | Bacteria | 4723 |
| 30 | Ga0068868_100035079 | 3300005338 | Bacteria | 3876 |
| 31 | Ga0068868_100071883 | 3300005338 | Bacteria | 2759 |
| 32 | Ga0068868_100415646 | 3300005338 | Bacteria | 1163 |
| 33 | Ga0068868_101832619 | 3300005338 | Bacteria | 574 |
| 34 | Ga0068868_102401698 | 3300005338 | Bacteria | 503 |
| 35 | Ga0070660_100029591 | 3300005339 | Bacteria | 4106 |
| 36 | Ga0070660_100213850 | 3300005339 | Bacteria | 1565 |
| 37 | Ga0070689_100004985 | 3300005340 | Bacteria | 9017 |
| 38 | Ga0070689_100146536 | 3300005340 | Bacteria | 1902 |
| 39 | Ga0070691_10042904 | 3300005341 | Bacteria | 2141 |
| 40 | Ga0070687_100064201 | 3300005343 | Bacteria | 1950 |
| 41 | Ga0070687_100065601 | 3300005343 | Bacteria | 1932 |
| 42 | Ga0070687_100122202 | 3300005343 | Bacteria | 1491 |
| 43 | Ga0070661_100350614 | 3300005344 | Bacteria | 1158 |
| 44 | Ga0070661_100439590 | 3300005344 | Bacteria | 1036 |
| 45 | Ga0070692_10032483 | 3300005345 | Bacteria | 2624 |
| 46 | Ga0070692_10346329 | 3300005345 | Bacteria | 922 |
| 47 | Ga0070668_100021758 | 3300005347 | Bacteria | 4846 |
| 48 | Ga0070668_100024506 | 3300005347 | Bacteria | 4572 |
| 49 | Ga0070668_100285165 | 3300005347 | Bacteria | 1380 |
| 50 | Ga0070668_100443446 | 3300005347 | Unclassified | 1115 |
| 51 | Ga0070668_100609845 | 3300005347 | Bacteria | 956 |
| 52 | Ga0070668_100631344 | 3300005347 | Bacteria | 940 |
| 53 | Ga0070668_102075267 | 3300005347 | Bacteria | 525 |
| 54 | Ga0070669_100180029 | 3300005353 | Bacteria | 1653 |
| 55 | Ga0070669_100414767 | 3300005353 | Bacteria | 1104 |
| 56 | Ga0070669_100690790 | 3300005353 | Bacteria | 861 |
| 57 | Ga0070675_100015610 | 3300005354 | Bacteria | 6010 |
| 58 | Ga0070675_100382659 | 3300005354 | Bacteria | 1253 |
| 59 | Ga0070675_100471996 | 3300005354 | Bacteria | 1127 |
| 60 | Ga0070675_100595307 | 3300005354 | Bacteria | 1002 |
| 61 | Ga0070675_100890013 | 3300005354 | Bacteria | 816 |
| 62 | Ga0070671_100014272 | 3300005355 | Bacteria | 6414 |
| 63 | Ga0070671_100036375 | 3300005355 | Bacteria | 4083 |
| 64 | Ga0070671_100242198 | 3300005355 | Bacteria | 1531 |
| 65 | Ga0070671_100295555 | 3300005355 | Bacteria | 1379 |
| 66 | Ga0070671_100896773 | 3300005355 | Bacteria | 774 |
| 67 | Ga0070674_100004281 | 3300005356 | Bacteria | 8120 |
| 68 | Ga0070674_100043743 | 3300005356 | Bacteria | 3048 |
| 69 | Ga0070674_100071663 | 3300005356 | Bacteria | 2451 |
| 70 | Ga0070674_100205387 | 3300005356 | Bacteria | 1524 |
| 71 | Ga0070674_100590880 | 3300005356 | Bacteria | 937 |
| 72 | Ga0070674_100875005 | 3300005356 | Bacteria | 781 |
| 73 | Ga0070674_101756821 | 3300005356 | Unclassified | 562 |
| 74 | Ga0070673_100031861 | 3300005364 | Bacteria | 3961 |
| 75 | Ga0070673_100141131 | 3300005364 | Bacteria | 2032 |
| 76 | Ga0070673_100552157 | 3300005364 | Bacteria | 1046 |
| 77 | Ga0070688_100001495 | 3300005365 | Bacteria | 11645 |
| 78 | Ga0070688_100003161 | 3300005365 | Bacteria | 8431 |
| 79 | Ga0070688_100027769 | 3300005365 | Bacteria | 3372 |
| 80 | Ga0070688_100029478 | 3300005365 | Bacteria | 3286 |
| 81 | Ga0070659_100030294 | 3300005366 | Bacteria | 4187 |
| 82 | Ga0070659_100034767 | 3300005366 | Bacteria | 3921 |
| 83 | Ga0070659_100043599 | 3300005366 | Bacteria | 3508 |
| 84 | Ga0070659_100160643 | 3300005366 | Bacteria | 1837 |
| 85 | Ga0070667_100201187 | 3300005367 | Bacteria | 1768 |
| 86 | Ga0070667_100257313 | 3300005367 | Bacteria | 1562 |
| 87 | Ga0070667_100448735 | 3300005367 | Bacteria | 1178 |
| 88 | Ga0070667_100492359 | 3300005367 | Bacteria | 1123 |
| 89 | Ga0070667_102062573 | 3300005367 | Bacteria | 537 |
| 90 | Ga0070703_10056186 | 3300005406 | Bacteria | 1274 |
| 91 | Ga0070709_10101770 | 3300005434 | Bacteria | 1915 |
| 92 | Ga0070709_10110294 | 3300005434 | Bacteria | 1849 |
| 93 | Ga0070709_10130372 | 3300005434 | Bacteria | 1716 |
| 94 | Ga0070709_10358230 | 3300005434 | Bacteria | 1080 |
| 95 | Ga0070709_10438838 | 3300005434 | Unclassified | 982 |
| 96 | Ga0070714_100159551 | 3300005435 | Bacteria | 2039 |
| 97 | Ga0070714_100218017 | 3300005435 | Bacteria | 1752 |
| 98 | Ga0070714_100536880 | 3300005435 | Bacteria | 1118 |
| 99 | Ga0070714_100592944 | 3300005435 | Bacteria | 1064 |
| 100 | Ga0070713_100049133 | 3300005436 | Bacteria | 3478 |
| 101 | Ga0070713_100050037 | 3300005436 | Bacteria | 3450 |
| 102 | Ga0070713_100138058 | 3300005436 | Bacteria | 2156 |
| 103 | Ga0070710_10010380 | 3300005437 | Bacteria | 4574 |
| 104 | Ga0070710_10458067 | 3300005437 | Bacteria | 866 |
| 105 | Ga0070701_10003269 | 3300005438 | Bacteria | 6385 |
| 106 | Ga0070701_10016535 | 3300005438 | Bacteria | 3433 |
| 107 | Ga0070701_10016833 | 3300005438 | Bacteria | 3406 |
| 108 | Ga0070701_10035442 | 3300005438 | Bacteria | 2506 |
| 109 | Ga0070701_10068570 | 3300005438 | Bacteria | 1890 |
| 110 | Ga0070701_10524253 | 3300005438 | Bacteria | 773 |
| 111 | Ga0070711_100012760 | 3300005439 | Bacteria | 5260 |
| 112 | Ga0070711_100025198 | 3300005439 | Bacteria | 3888 |
| 113 | Ga0070711_100278350 | 3300005439 | Bacteria | 1323 |
| 114 | Ga0070711_100664614 | 3300005439 | Bacteria | 875 |
| 115 | Ga0070705_100015616 | 3300005440 | Bacteria | 3930 |
| 116 | Ga0070705_100087009 | 3300005440 | Bacteria | 1936 |
| 117 | Ga0070705_100152535 | 3300005440 | Bacteria | 1534 |
| 118 | Ga0070705_100202655 | 3300005440 | Bacteria | 1361 |
| 119 | Ga0070705_100252936 | 3300005440 | Bacteria | 1238 |
| 120 | Ga0070705_100332709 | 3300005440 | Bacteria | 1101 |
| 121 | Ga0070705_100626081 | 3300005440 | Bacteria | 836 |
| 122 | Ga0070705_100634864 | 3300005440 | Bacteria | 831 |
| 123 | Ga0070700_100002701 | 3300005441 | Bacteria | 9054 |
| 124 | Ga0070700_100006627 | 3300005441 | Bacteria | 6201 |
| 125 | Ga0070700_100126264 | 3300005441 | Bacteria | 1720 |
| 126 | Ga0070700_100141923 | 3300005441 | Bacteria | 1634 |
| 127 | Ga0070700_101089122 | 3300005441 | Bacteria | 662 |
| 128 | Ga0070694_100012886 | 3300005444 | Bacteria | 5213 |
| 129 | Ga0070694_100015105 | 3300005444 | Unclassified | 4842 |
| 130 | Ga0070694_100303805 | 3300005444 | Bacteria | 1223 |
| 131 | Ga0070708_100029267 | 3300005445 | Bacteria | 4748 |
| 132 | Ga0070708_100041036 | 3300005445 | Bacteria | 4056 |
| 133 | Ga0070708_100206206 | 3300005445 | Bacteria | 1841 |
| 134 | Ga0070708_100264388 | 3300005445 | Bacteria | 1617 |
| 135 | Ga0070708_100545444 | 3300005445 | Bacteria | 1094 |
| 136 | Ga0070708_101118543 | 3300005445 | Bacteria | 738 |
| 137 | Ga0070663_100004611 | 3300005455 | Bacteria | 8117 |
| 138 | Ga0070663_100025878 | 3300005455 | Bacteria | 3966 |
| 139 | Ga0070663_100214394 | 3300005455 | Bacteria | 1509 |
| 140 | Ga0070663_100676330 | 3300005455 | Bacteria | 875 |
| 141 | Ga0070678_100065453 | 3300005456 | Bacteria | 2699 |
| 142 | Ga0070678_100104449 | 3300005456 | Bacteria | 2203 |
| 143 | Ga0070678_100541032 | 3300005456 | Bacteria | 1033 |
| 144 | Ga0070678_100566222 | 3300005456 | Bacteria | 1010 |
| 145 | Ga0070678_101228358 | 3300005456 | Bacteria | 696 |
| 146 | Ga0070662_100006307 | 3300005457 | Bacteria | 7643 |
| 147 | Ga0070662_100152083 | 3300005457 | Bacteria | 1803 |
| 148 | Ga0070662_100191550 | 3300005457 | Bacteria | 1617 |
| 149 | Ga0070662_100513406 | 3300005457 | Bacteria | 1000 |
| 150 | Ga0070662_100601197 | 3300005457 | Bacteria | 925 |
| 151 | Ga0070681_10325955 | 3300005458 | Bacteria | 1445 |
| 152 | Ga0070681_10417248 | 3300005458 | Bacteria | 1254 |
| 153 | Ga0070681_10422047 | 3300005458 | Bacteria | 1246 |
| 154 | Ga0070681_10808714 | 3300005458 | Bacteria | 855 |
| 155 | Ga0070681_11121665 | 3300005458 | Bacteria | 708 |
| 156 | Ga0070681_11176058 | 3300005458 | Unclassified | 689 |
| 157 | Ga0068867_100022787 | 3300005459 | Archaea | 4480 |
| 158 | Ga0068867_100079655 | 3300005459 | Bacteria | 2465 |
| 159 | Ga0068867_100188716 | 3300005459 | Bacteria | 1643 |
| 160 | Ga0068867_100219770 | 3300005459 | Bacteria | 1531 |
| 161 | Ga0068867_100318065 | 3300005459 | Bacteria | 1288 |
| 162 | Ga0068867_100636499 | 3300005459 | Bacteria | 934 |
| 163 | Ga0068867_101640957 | 3300005459 | Bacteria | 602 |
| 164 | Ga0070685_10009789 | 3300005466 | Bacteria | 4969 |
| 165 | Ga0070685_10073045 | 3300005466 | Bacteria | 2038 |
| 166 | Ga0070685_10122912 | 3300005466 | Bacteria | 1614 |
| 167 | Ga0070685_10665862 | 3300005466 | Unclassified | 756 |
| 168 | Ga0070706_100031706 | 3300005467 | Bacteria | 4873 |
| 169 | Ga0070706_100137357 | 3300005467 | Bacteria | 2281 |
| 170 | Ga0070706_100178994 | 3300005467 | Bacteria | 1979 |
| 171 | Ga0070706_101396416 | 3300005467 | Bacteria | 641 |
| 172 | Ga0070707_100005156 | 3300005468 | Bacteria | 12238 |
| 173 | Ga0070707_100037476 | 3300005468 | Bacteria | 4627 |
| 174 | Ga0070707_100045684 | 3300005468 | Bacteria | 4191 |
| 175 | Ga0070707_100173772 | 3300005468 | Bacteria | 2099 |
| 176 | Ga0070698_100006705 | 3300005471 | Bacteria | 12489 |
| 177 | Ga0070698_100008530 | 3300005471 | Bacteria | 11060 |
| 178 | Ga0070698_100759562 | 3300005471 | Unclassified | 913 |
| 179 | Ga0070698_101305082 | 3300005471 | Bacteria | 676 |
| 180 | Ga0070699_100040412 | 3300005518 | Bacteria | 4039 |
| 181 | Ga0070699_100072136 | 3300005518 | Bacteria | 3003 |
| 182 | Ga0070699_100129759 | 3300005518 | Bacteria | 2222 |
| 183 | Ga0070699_100238214 | 3300005518 | Unclassified | 1623 |
| 184 | Ga0070699_100358885 | 3300005518 | Bacteria | 1314 |
| 185 | Ga0070679_100543347 | 3300005530 | Bacteria | 1106 |
| 186 | Ga0070684_100008777 | 3300005535 | Bacteria | 7925 |
| 187 | Ga0070684_100022227 | 3300005535 | Bacteria | 5287 |
| 188 | Ga0070684_100085782 | 3300005535 | Bacteria | 2793 |
| 189 | Ga0070684_100129299 | 3300005535 | Bacteria | 2277 |
| 190 | Ga0070684_100376778 | 3300005535 | Bacteria | 1307 |
| 191 | Ga0070684_100799662 | 3300005535 | Bacteria | 881 |
| 192 | Ga0070684_100911629 | 3300005535 | Bacteria | 823 |
| 193 | Ga0070684_100928344 | 3300005535 | Bacteria | 816 |
| 194 | Ga0070684_101459164 | 3300005535 | Bacteria | 644 |
| 195 | Ga0070697_100333536 | 3300005536 | Unclassified | 1308 |
| 196 | Ga0070697_100411042 | 3300005536 | Bacteria | 1175 |
| 197 | Ga0068853_100007124 | 3300005539 | Bacteria | 8941 |
| 198 | Ga0068853_100175147 | 3300005539 | Bacteria | 1943 |
| 199 | Ga0068853_101092206 | 3300005539 | Bacteria | 769 |
| 200 | Ga0070672_100154403 | 3300005543 | Bacteria | 1901 |
| 201 | Ga0070686_100011152 | 3300005544 | Bacteria | 5092 |
| 202 | Ga0070686_100024948 | 3300005544 | Bacteria | 3589 |
| 203 | Ga0070686_100028819 | 3300005544 | Bacteria | 3371 |
| 204 | Ga0070686_100038698 | 3300005544 | Bacteria | 2966 |
| 205 | Ga0070686_100059773 | 3300005544 | Bacteria | 2457 |
| 206 | Ga0070686_100520897 | 3300005544 | Bacteria | 926 |
| 207 | Ga0070695_100041791 | 3300005545 | Bacteria | 2907 |
| 208 | Ga0070695_100073483 | 3300005545 | Bacteria | 2244 |
| 209 | Ga0070695_100359855 | 3300005545 | Bacteria | 1092 |
| 210 | Ga0070696_100043709 | 3300005546 | Bacteria | 3100 |
| 211 | Ga0070696_100053430 | 3300005546 | Bacteria | 2812 |
| 212 | Ga0070696_100225880 | 3300005546 | Bacteria | 1407 |
| 213 | Ga0070693_100002537 | 3300005547 | Bacteria | 8416 |
| 214 | Ga0070693_100014448 | 3300005547 | Bacteria | 4046 |
| 215 | Ga0070693_100040336 | 3300005547 | Bacteria | 2621 |
| 216 | Ga0070693_100066641 | 3300005547 | Bacteria | 2108 |
| 217 | Ga0070693_100716707 | 3300005547 | Bacteria | 734 |
| 218 | Ga0070693_100755291 | 3300005547 | Bacteria | 717 |
| 219 | Ga0070693_101103628 | 3300005547 | Bacteria | 605 |
| 220 | Ga0070665_100076527 | 3300005548 | Bacteria | 3353 |
| 221 | Ga0070665_100717680 | 3300005548 | Bacteria | 1013 |
| 222 | Ga0070704_100070285 | 3300005549 | Bacteria | 2539 |
| 223 | Ga0070704_100154609 | 3300005549 | Bacteria | 1807 |
| 224 | Ga0070704_100173468 | 3300005549 | Bacteria | 1717 |
| 225 | Ga0070704_100258801 | 3300005549 | Bacteria | 1433 |
| 226 | Ga0070704_100262823 | 3300005549 | Bacteria | 1422 |
| 227 | Ga0070704_100267993 | 3300005549 | Unclassified | 1410 |
| 228 | Ga0070704_100365632 | 3300005549 | Unclassified | 1222 |
| 229 | Ga0068855_100070620 | 3300005563 | Bacteria | 4062 |
| 230 | Ga0068855_100099853 | 3300005563 | Bacteria | 3342 |
| 231 | Ga0068855_100104637 | 3300005563 | Bacteria | 3255 |
| 232 | Ga0068855_100187316 | 3300005563 | Bacteria | 2337 |
| 233 | Ga0068855_100424434 | 3300005563 | Bacteria | 1454 |
| 234 | Ga0068855_100536482 | 3300005563 | Unclassified | 1268 |
| 235 | Ga0070664_100110983 | 3300005564 | Bacteria | 2393 |
| 236 | Ga0070664_100291260 | 3300005564 | Bacteria | 1474 |
| 237 | Ga0070664_100315790 | 3300005564 | Bacteria | 1415 |
| 238 | Ga0070664_100430679 | 3300005564 | Bacteria | 1209 |
| 239 | Ga0070664_101578107 | 3300005564 | Bacteria | 621 |
| 240 | Ga0068857_100043075 | 3300005577 | Bacteria | 4004 |
| 241 | Ga0068857_101466281 | 3300005577 | Unclassified | 664 |
| 242 | Ga0068854_100106263 | 3300005578 | Bacteria | 2111 |
| 243 | Ga0068854_100136461 | 3300005578 | Bacteria | 1878 |
| 244 | Ga0068854_100189485 | 3300005578 | Bacteria | 1611 |
| 245 | Ga0068854_100217001 | 3300005578 | Bacteria | 1511 |
| 246 | Ga0068854_100457348 | 3300005578 | Bacteria | 1067 |
| 247 | Ga0068856_100043626 | 3300005614 | Bacteria | 4412 |
| 248 | Ga0068856_100293269 | 3300005614 | Bacteria | 1643 |
| 249 | Ga0068856_101172968 | 3300005614 | Bacteria | 785 |
| 250 | Ga0068856_101624293 | 3300005614 | Bacteria | 659 |
| 251 | Ga0070702_100005769 | 3300005615 | Bacteria | 5801 |
| 252 | Ga0070702_100170584 | 3300005615 | Bacteria | 1415 |
| 253 | Ga0070702_100191971 | 3300005615 | Bacteria | 1345 |
| 254 | Ga0070702_100239850 | 3300005615 | Bacteria | 1223 |
| 255 | Ga0070702_101693303 | 3300005615 | Bacteria | 525 |
| 256 | Ga0068852_100057319 | 3300005616 | Bacteria | 3370 |
| 257 | Ga0068852_100182238 | 3300005616 | Bacteria | 1976 |
| 258 | Ga0068852_102377821 | 3300005616 | Bacteria | 551 |
| 259 | Ga0068859_100143426 | 3300005617 | Bacteria | 2462 |
| 260 | Ga0068859_100275326 | 3300005617 | Bacteria | 1775 |
| 261 | Ga0068859_100686596 | 3300005617 | Bacteria | 1115 |
| 262 | Ga0068859_101172641 | 3300005617 | Bacteria | 846 |
| 263 | Ga0068864_100032617 | 3300005618 | Bacteria | 4426 |
| 264 | Ga0068864_100044531 | 3300005618 | Bacteria | 3804 |
| 265 | Ga0068864_100130598 | 3300005618 | Bacteria | 2256 |
| 266 | Ga0068864_100621651 | 3300005618 | Bacteria | 1050 |
| 267 | Ga0068866_10008580 | 3300005718 | Bacteria | 4314 |
| 268 | Ga0068866_10049089 | 3300005718 | Bacteria | 2136 |
| 269 | Ga0068866_10399327 | 3300005718 | Bacteria | 886 |
| 270 | Ga0068866_10759161 | 3300005718 | Bacteria | 671 |
| 271 | Ga0068866_10879717 | 3300005718 | Unclassified | 629 |
| 272 | Ga0068861_100020719 | 3300005719 | Bacteria | 4714 |
| 273 | Ga0068861_100034543 | 3300005719 | Bacteria | 3740 |
| 274 | Ga0068861_100058785 | 3300005719 | Bacteria | 2941 |
| 275 | Ga0068861_100093414 | 3300005719 | Bacteria | 2379 |
| 276 | Ga0068861_100155443 | 3300005719 | Bacteria | 1881 |
| 277 | Ga0068861_100350368 | 3300005719 | Unclassified | 1295 |
| 278 | Ga0068861_100351301 | 3300005719 | Bacteria | 1293 |
| 279 | Ga0068851_10004639 | 3300005834 | Bacteria | 6204 |
| 280 | Ga0068870_10002411 | 3300005840 | Bacteria | 7774 |
| 281 | Ga0068870_10080998 | 3300005840 | Bacteria | 1795 |
| 282 | Ga0068870_10776153 | 3300005840 | Bacteria | 668 |
| 283 | Ga0068863_100247655 | 3300005841 | Bacteria | 1721 |
| 284 | Ga0068863_100430024 | 3300005841 | Bacteria | 1294 |
| 285 | Ga0068863_100507572 | 3300005841 | Bacteria | 1188 |
| 286 | Ga0068858_100012205 | 3300005842 | Bacteria | 8099 |
| 287 | Ga0068860_100117410 | 3300005843 | Bacteria | 2546 |
| 288 | Ga0068860_100158294 | 3300005843 | Bacteria | 2183 |
| 289 | Ga0068860_100201266 | 3300005843 | Bacteria | 1930 |
| 290 | Ga0068860_100515837 | 3300005843 | Bacteria | 1195 |
| 291 | Ga0068860_100922744 | 3300005843 | Bacteria | 890 |
| 292 | Ga0068860_101034368 | 3300005843 | Bacteria | 840 |
| 293 | Ga0068860_101397184 | 3300005843 | Bacteria | 721 |
| 294 | Ga0068862_100141512 | 3300005844 | Bacteria | 2135 |
| 295 | Ga0068862_100189895 | 3300005844 | Bacteria | 1848 |
| 296 | Ga0068862_100220821 | 3300005844 | Bacteria | 1715 |
| 297 | Ga0068862_100448624 | 3300005844 | Bacteria | 1216 |
| 298 | Ga0068862_101368300 | 3300005844 | Unclassified | 710 |
| 299 | Ga0081455_10004114 | 3300005937 | Bacteria | 16459 |
| 300 | Ga0081455_10024464 | 3300005937 | Bacteria | 5591 |
| 301 | Ga0081455_10050772 | 3300005937 | Bacteria | 3563 |
| 302 | Ga0081455_10170601 | 3300005937 | Bacteria | 1658 |
| 303 | Ga0081455_10173791 | 3300005937 | Bacteria | 1638 |
| 304 | Ga0081455_10249845 | 3300005937 | Unclassified | 1298 |
| 305 | Ga0081455_10342795 | 3300005937 | Bacteria | 1057 |
| 306 | Ga0081540_1001751 | 3300005983 | Bacteria | 18248 |
| 307 | Ga0081540_1005933 | 3300005983 | Bacteria | 9017 |
| 308 | Ga0081539_10003629 | 3300005985 | Bacteria | 18589 |
| 309 | Ga0081539_10007824 | 3300005985 | Bacteria | 9556 |
| 310 | Ga0070717_10004499 | 3300006028 | Bacteria | 10074 |
| 311 | Ga0070717_10027533 | 3300006028 | Bacteria | 4544 |
| 312 | Ga0070717_10050375 | 3300006028 | Bacteria | 3422 |
| 313 | Ga0070717_10092524 | 3300006028 | Bacteria | 2555 |
| 314 | Ga0070717_10369721 | 3300006028 | Bacteria | 1284 |
| 315 | Ga0075365_10181819 | 3300006038 | Bacteria | 1470 |
| 316 | Ga0075365_10256621 | 3300006038 | Bacteria | 1229 |
| 317 | Ga0075365_10624394 | 3300006038 | Unclassified | 762 |
| 318 | Ga0075364_10025675 | 3300006051 | Bacteria | 3752 |
| 319 | Ga0075364_10505855 | 3300006051 | Bacteria | 826 |
| 320 | Ga0075432_10007366 | 3300006058 | Bacteria | 3746 |
| 321 | Ga0075432_10038258 | 3300006058 | Bacteria | 1671 |
| 322 | Ga0075432_10101231 | 3300006058 | Bacteria | 1065 |
| 323 | Ga0070715_10014142 | 3300006163 | Bacteria | 2948 |
| 324 | Ga0070716_100000663 | 3300006173 | Bacteria | 14622 |
| 325 | Ga0070716_100026835 | 3300006173 | Bacteria | 3087 |
| 326 | Ga0070716_100517089 | 3300006173 | Bacteria | 884 |
| 327 | Ga0070716_100780722 | 3300006173 | Bacteria | 738 |
| 328 | Ga0070712_100280728 | 3300006175 | Bacteria | 1341 |
| 329 | Ga0075427_10038165 | 3300006194 | Bacteria | 804 |
| 330 | Ga0097621_100140729 | 3300006237 | Bacteria | 2061 |
| 331 | Ga0097621_100226268 | 3300006237 | Bacteria | 1632 |
| 332 | Ga0097621_100238605 | 3300006237 | Bacteria | 1589 |
| 333 | Ga0097621_100726520 | 3300006237 | Bacteria | 916 |
| 334 | Ga0068871_100038742 | 3300006358 | Bacteria | 3809 |
| 335 | Ga0068871_100278901 | 3300006358 | Bacteria | 1462 |
| 336 | Ga0068871_100437060 | 3300006358 | Bacteria | 1171 |
| 337 | Ga0068871_100446537 | 3300006358 | Bacteria | 1158 |
| 338 | Ga0075428_100025876 | 3300006844 | Bacteria | 6498 |
| 339 | Ga0075428_100064762 | 3300006844 | Bacteria | 4004 |
| 340 | Ga0075428_100727339 | 3300006844 | Unclassified | 1057 |
| 341 | Ga0075430_100005301 | 3300006846 | Bacteria | 10878 |
| 342 | Ga0075430_100407673 | 3300006846 | Bacteria | 1122 |
| 343 | Ga0075431_100009313 | 3300006847 | Bacteria | 9853 |
| 344 | Ga0075431_100150180 | 3300006847 | Bacteria | 2399 |
| 345 | Ga0075431_100262961 | 3300006847 | Bacteria | 1750 |
| 346 | Ga0075431_100361367 | 3300006847 | Bacteria | 1458 |
| 347 | Ga0075431_100395249 | 3300006847 | Bacteria | 1384 |
| 348 | Ga0075433_10074552 | 3300006852 | Bacteria | 2986 |
| 349 | Ga0075434_100028252 | 3300006871 | Bacteria | 5509 |
| 350 | Ga0075434_100222981 | 3300006871 | Bacteria | 1905 |
| 351 | Ga0075434_100240998 | 3300006871 | Bacteria | 1828 |
| 352 | Ga0075434_100588560 | 3300006871 | Bacteria | 1132 |
| 353 | Ga0075434_101781791 | 3300006871 | Bacteria | 623 |
| 354 | Ga0075429_100027656 | 3300006880 | Bacteria | 4923 |
| 355 | Ga0075429_100028833 | 3300006880 | Bacteria | 4821 |
| 356 | Ga0075429_100249387 | 3300006880 | Bacteria | 1555 |
| 357 | Ga0075429_100329618 | 3300006880 | Unclassified | 1336 |
| 358 | Ga0075429_100460089 | 3300006880 | Bacteria | 1115 |
| 359 | Ga0068865_100008070 | 3300006881 | Bacteria | 6499 |
| 360 | Ga0068865_100049638 | 3300006881 | Bacteria | 2894 |
| 361 | Ga0068865_100061453 | 3300006881 | Bacteria | 2634 |
| 362 | Ga0068865_100114803 | 3300006881 | Bacteria | 1992 |
| 363 | Ga0068865_100216104 | 3300006881 | Bacteria | 1496 |
| 364 | Ga0068865_100460840 | 3300006881 | Bacteria | 1053 |
| 365 | Ga0068865_100768938 | 3300006881 | Bacteria | 829 |
| 366 | Ga0097620_100143433 | 3300006931 | Bacteria | 2462 |
| 367 | Ga0097620_100275336 | 3300006931 | Bacteria | 1775 |
| 368 | Ga0097620_100686751 | 3300006931 | Bacteria | 1115 |
| 369 | Ga0097620_101172540 | 3300006931 | Bacteria | 846 |
| 370 | Ga0075435_100002120 | 3300007076 | Bacteria | 13067 |
| 371 | Ga0075435_100038520 | 3300007076 | Bacteria | 3811 |
| 372 | Ga0075435_100432484 | 3300007076 | Bacteria | 1134 |
| 373 | Ga0075435_100448504 | 3300007076 | Unclassified | 1112 |
| 374 | Ga0075435_101490363 | 3300007076 | Unclassified | 593 |
| 375 | Ga0105251_10158903 | 3300009011 | Unclassified | 1019 |
| 376 | Ga0105240_10272672 | 3300009093 | Bacteria | 1947 |
| 377 | Ga0105240_12418306 | 3300009093 | Bacteria | 544 |
| 378 | Ga0111539_10001300 | 3300009094 | Bacteria | 33359 |
| 379 | Ga0111539_10026624 | 3300009094 | Bacteria | 7069 |
| 380 | Ga0111539_10062606 | 3300009094 | Bacteria | 4403 |
| 381 | Ga0111539_10070924 | 3300009094 | Bacteria | 4112 |
| 382 | Ga0111539_10086896 | 3300009094 | Bacteria | 3674 |
| 383 | Ga0111539_10360120 | 3300009094 | Bacteria | 1693 |
| 384 | Ga0111539_10391808 | 3300009094 | Bacteria | 1618 |
| 385 | Ga0111539_10415259 | 3300009094 | Bacteria | 1567 |
| 386 | Ga0111539_10613930 | 3300009094 | Bacteria | 1266 |
| 387 | Ga0111539_10638007 | 3300009094 | Bacteria | 1240 |
| 388 | Ga0111539_11733765 | 3300009094 | Bacteria | 724 |
| 389 | Ga0105245_10005009 | 3300009098 | Bacteria | 11643 |
| 390 | Ga0105245_10006850 | 3300009098 | Bacteria | 9994 |
| 391 | Ga0105245_10007026 | 3300009098 | Bacteria | 9879 |
| 392 | Ga0105245_10011927 | 3300009098 | Bacteria | 7556 |
| 393 | Ga0105245_10023010 | 3300009098 | Bacteria | 5467 |
| 394 | Ga0105245_10029924 | 3300009098 | Bacteria | 4815 |
| 395 | Ga0105245_10058255 | 3300009098 | Bacteria | 3477 |
| 396 | Ga0105245_10080889 | 3300009098 | Bacteria | 2968 |
| 397 | Ga0105245_10129850 | 3300009098 | Bacteria | 2362 |
| 398 | Ga0105245_10155239 | 3300009098 | Bacteria | 2167 |
| 399 | Ga0105245_10190067 | 3300009098 | Bacteria | 1966 |
| 400 | Ga0105245_10903135 | 3300009098 | Bacteria | 925 |
| 401 | Ga0105245_11162393 | 3300009098 | Bacteria | 819 |
| 402 | Ga0105247_10038579 | 3300009101 | Bacteria | 2917 |
| 403 | Ga0105247_10039881 | 3300009101 | Bacteria | 2870 |
| 404 | Ga0114129_10017948 | 3300009147 | Bacteria | 10075 |
| 405 | Ga0114129_10025388 | 3300009147 | Bacteria | 8395 |
| 406 | Ga0114129_10221016 | 3300009147 | Bacteria | 2555 |
| 407 | Ga0114129_10250599 | 3300009147 | Bacteria | 2377 |
| 408 | Ga0114129_10262875 | 3300009147 | Bacteria | 2312 |
| 409 | Ga0114129_10367673 | 3300009147 | Bacteria | 1902 |
| 410 | Ga0114129_10427919 | 3300009147 | Bacteria | 1740 |
| 411 | Ga0114129_10441889 | 3300009147 | Unclassified | 1707 |
| 412 | Ga0114129_10635608 | 3300009147 | Bacteria | 1379 |
| 413 | Ga0114129_11411463 | 3300009147 | Bacteria | 859 |
| 414 | Ga0114129_11588031 | 3300009147 | Bacteria | 801 |
| 415 | Ga0114129_11601796 | 3300009147 | Bacteria | 797 |
| 416 | Ga0114129_12127753 | 3300009147 | Unclassified | 676 |
| 417 | Ga0114129_12564375 | 3300009147 | Bacteria | 609 |
| 418 | Ga0114129_13474414 | 3300009147 | Unclassified | 504 |
| 419 | Ga0105243_10016980 | 3300009148 | Bacteria | 5503 |
| 420 | Ga0105243_10018403 | 3300009148 | Bacteria | 5291 |
| 421 | Ga0105243_10020309 | 3300009148 | Bacteria | 5037 |
| 422 | Ga0105243_10120478 | 3300009148 | Bacteria | 2211 |
| 423 | Ga0105243_10231886 | 3300009148 | Bacteria | 1638 |
| 424 | Ga0105243_10299535 | 3300009148 | Bacteria | 1457 |
| 425 | Ga0105243_10417362 | 3300009148 | Bacteria | 1251 |
| 426 | Ga0105243_10578083 | 3300009148 | Bacteria | 1078 |
| 427 | Ga0105243_11962433 | 3300009148 | Bacteria | 619 |
| 428 | Ga0105241_10025150 | 3300009174 | Bacteria | 4425 |
| 429 | Ga0105241_10085677 | 3300009174 | Bacteria | 2476 |
| 430 | Ga0105241_10194519 | 3300009174 | Unclassified | 1690 |
| 431 | Ga0105241_10264996 | 3300009174 | Bacteria | 1461 |
| 432 | Ga0105241_11245208 | 3300009174 | Unclassified | 706 |
| 433 | Ga0105242_10054489 | 3300009176 | Bacteria | 3269 |
| 434 | Ga0105242_10057114 | 3300009176 | Bacteria | 3195 |
| 435 | Ga0105242_10090548 | 3300009176 | Bacteria | 2573 |
| 436 | Ga0105242_10228509 | 3300009176 | Bacteria | 1666 |
| 437 | Ga0105242_10261080 | 3300009176 | Bacteria | 1565 |
| 438 | Ga0105242_10275626 | 3300009176 | Bacteria | 1526 |
| 439 | Ga0105242_10291678 | 3300009176 | Bacteria | 1486 |
| 440 | Ga0105242_10489243 | 3300009176 | Unclassified | 1168 |
| 441 | Ga0105242_10502618 | 3300009176 | Bacteria | 1153 |
| 442 | Ga0105248_10059696 | 3300009177 | Bacteria | 4284 |
| 443 | Ga0105248_10192729 | 3300009177 | Bacteria | 2297 |
| 444 | Ga0105248_10263635 | 3300009177 | Bacteria | 1940 |
| 445 | Ga0105248_10523506 | 3300009177 | Bacteria | 1337 |
| 446 | Ga0105248_11227193 | 3300009177 | Bacteria | 848 |
| 447 | Ga0105248_12526910 | 3300009177 | Bacteria | 585 |
| 448 | Ga0105237_10772838 | 3300009545 | Bacteria | 967 |
| 449 | Ga0105238_10046555 | 3300009551 | Bacteria | 4376 |
| 450 | Ga0105249_10022421 | 3300009553 | Bacteria | 5656 |
| 451 | Ga0105249_10042394 | 3300009553 | Bacteria | 4139 |
| 452 | Ga0105249_10106711 | 3300009553 | Bacteria | 2643 |
| 453 | Ga0105249_10118880 | 3300009553 | Bacteria | 2509 |
| 454 | Ga0105249_10155091 | 3300009553 | Bacteria | 2208 |
| 455 | Ga0105249_10212688 | 3300009553 | Bacteria | 1898 |
| 456 | Ga0105239_10054011 | 3300010375 | Unclassified | 4405 |
| 457 | Ga0105239_10682275 | 3300010375 | Bacteria | 1174 |
| 458 | Ga0105239_10772101 | 3300010375 | Bacteria | 1100 |
| 459 | Ga0105239_11052229 | 3300010375 | Bacteria | 936 |
| 460 | Ga0105246_10008409 | 3300011119 | Bacteria | 6344 |
| 461 | Ga0105246_10020264 | 3300011119 | Bacteria | 4263 |
| 462 | Ga0105246_10032448 | 3300011119 | Bacteria | 3463 |
| 463 | Ga0105246_10157983 | 3300011119 | Bacteria | 1724 |
| 464 | Ga0105246_10436670 | 3300011119 | Bacteria | 1097 |
| 465 | Ga0105246_10941796 | 3300011119 | Bacteria | 778 |
| 466 | Ga0157314_1005294 | 3300012500 | Bacteria | 976 |
| 467 | Ga0157339_1033690 | 3300012505 | Bacteria | 612 |
| 468 | Ga0157371_10100598 | 3300013102 | Bacteria | 2050 |
| 469 | Ga0157371_10163072 | 3300013102 | Bacteria | 1592 |
| 470 | Ga0157371_10214330 | 3300013102 | Bacteria | 1382 |
| 471 | Ga0157371_11488747 | 3300013102 | Bacteria | 528 |
| 472 | Ga0157370_10072748 | 3300013104 | Bacteria | 3243 |
| 473 | Ga0157369_10116690 | 3300013105 | Bacteria | 2834 |
| 474 | Ga0157369_10328377 | 3300013105 | Bacteria | 1589 |
| 475 | Ga0157369_10798741 | 3300013105 | Bacteria | 970 |
| 476 | Ga0157369_12141966 | 3300013105 | Bacteria | 567 |
| 477 | Ga0157374_10006679 | 3300013296 | Bacteria | 9803 |
| 478 | Ga0157374_10090651 | 3300013296 | Bacteria | 2914 |
| 479 | Ga0157374_10100997 | 3300013296 | Bacteria | 2766 |
| 480 | Ga0157374_10160625 | 3300013296 | Bacteria | 2189 |
| 481 | Ga0157374_10316502 | 3300013296 | Bacteria | 1546 |
| 482 | Ga0157374_10581655 | 3300013296 | Bacteria | 1129 |
| 483 | Ga0157374_12089078 | 3300013296 | Unclassified | 593 |
| 484 | Ga0157378_10030477 | 3300013297 | Bacteria | 4767 |
| 485 | Ga0157378_10640768 | 3300013297 | Bacteria | 1077 |
| 486 | Ga0157378_11096424 | 3300013297 | Bacteria | 833 |
| 487 | Ga0163162_10015163 | 3300013306 | Bacteria | 7527 |
| 488 | Ga0163162_10062392 | 3300013306 | Bacteria | 3767 |
| 489 | Ga0163162_10167749 | 3300013306 | Unclassified | 2319 |
| 490 | Ga0163162_10817772 | 3300013306 | Bacteria | 1048 |
| 491 | Ga0157372_10164556 | 3300013307 | Bacteria | 2564 |
| 492 | Ga0157372_10400861 | 3300013307 | Bacteria | 1599 |
| 493 | Ga0157372_10739771 | 3300013307 | Bacteria | 1144 |
| 494 | Ga0157372_13366590 | 3300013307 | Bacteria | 509 |
| 495 | Ga0157375_10028862 | 3300013308 | Bacteria | 5208 |
| 496 | Ga0157375_10043912 | 3300013308 | Bacteria | 4337 |
| 497 | Ga0157375_10283694 | 3300013308 | Unclassified | 1819 |
| 498 | Ga0157375_10362507 | 3300013308 | Bacteria | 1616 |
| 499 | Ga0157375_10446781 | 3300013308 | Bacteria | 1458 |
| 500 | Ga0157375_11035639 | 3300013308 | Unclassified | 959 |
| 501 | Ga0163163_10004711 | 3300014325 | Bacteria | 11685 |
| 502 | Ga0163163_10005098 | 3300014325 | Bacteria | 11324 |
| 503 | Ga0163163_11191612 | 3300014325 | Bacteria | 824 |
| 504 | Ga0157380_10000820 | 3300014326 | Bacteria | 19481 |
| 505 | Ga0157380_10078485 | 3300014326 | Bacteria | 2693 |
| 506 | Ga0157380_10258387 | 3300014326 | Bacteria | 1581 |
| 507 | Ga0157380_11022686 | 3300014326 | Bacteria | 861 |
| 508 | Ga0157380_11422974 | 3300014326 | Bacteria | 744 |
| 509 | Ga0157380_12652401 | 3300014326 | Bacteria | 567 |
| 510 | Ga0157377_10012869 | 3300014745 | Bacteria | 4218 |
| 511 | Ga0157377_10025499 | 3300014745 | Bacteria | 3154 |
| 512 | Ga0157377_10061866 | 3300014745 | Bacteria | 2141 |
| 513 | Ga0157377_10100202 | 3300014745 | Bacteria | 1725 |
| 514 | Ga0157377_10119201 | 3300014745 | Bacteria | 1597 |
| 515 | Ga0157377_10328004 | 3300014745 | Bacteria | 1019 |
| 516 | Ga0157377_11003628 | 3300014745 | Bacteria | 632 |
| 517 | Ga0157377_11200624 | 3300014745 | Unclassified | 587 |
| 518 | Ga0157379_10150788 | 3300014968 | Bacteria | 2097 |
| 519 | Ga0157379_10460288 | 3300014968 | Bacteria | 1175 |
| 520 | Ga0157379_11157721 | 3300014968 | Bacteria | 742 |
| 521 | Ga0157376_10003493 | 3300014969 | Bacteria | 10836 |
| 522 | Ga0157376_10014456 | 3300014969 | Bacteria | 5927 |
| 523 | Ga0157376_10055617 | 3300014969 | Bacteria | 3302 |
| 524 | Ga0157376_10196312 | 3300014969 | Bacteria | 1854 |
| 525 | Ga0157376_10431237 | 3300014969 | Bacteria | 1281 |
| 526 | Ga0157376_10475813 | 3300014969 | Bacteria | 1223 |
| 527 | Ga0157376_10990826 | 3300014969 | Bacteria | 862 |
| 528 | Ga0163161_10020279 | 3300017792 | Bacteria | 4664 |
| 529 | Ga0163161_10037167 | 3300017792 | Bacteria | 3490 |
| 530 | Ga0163161_10102290 | 3300017792 | Bacteria | 2134 |
| 531 | Ga0163161_10517554 | 3300017792 | Bacteria | 974 |
| 532 | Ga0163161_11667215 | 3300017792 | Bacteria | 564 |
| 533 | Ga0206353_10024931 | 3300020082 | Bacteria | 1209 |
| 534 | Ga0207697_10172200 | 3300025315 | Bacteria | 947 |
| 535 | Ga0207697_10218753 | 3300025315 | Bacteria | 840 |
| 536 | Ga0207656_10094726 | 3300025321 | Bacteria | 1360 |
| 537 | Ga0207692_10006470 | 3300025898 | Bacteria | 4749 |
| 538 | Ga0207692_10055620 | 3300025898 | Bacteria | 2027 |
| 539 | Ga0207642_10004754 | 3300025899 | Bacteria | 4387 |
| 540 | Ga0207642_10064284 | 3300025899 | Bacteria | 1720 |
| 541 | Ga0207642_10551027 | 3300025899 | Bacteria | 712 |
| 542 | Ga0207688_10005248 | 3300025901 | Bacteria | 7039 |
| 543 | Ga0207688_10009489 | 3300025901 | Bacteria | 5296 |
| 544 | Ga0207688_10014758 | 3300025901 | Bacteria | 4239 |
| 545 | Ga0207688_10035442 | 3300025901 | Bacteria | 2765 |
| 546 | Ga0207688_10055378 | 3300025901 | Bacteria | 2226 |
| 547 | Ga0207688_10056107 | 3300025901 | Bacteria | 2212 |
| 548 | Ga0207647_10120800 | 3300025904 | Bacteria | 1545 |
| 549 | Ga0207647_10122005 | 3300025904 | Bacteria | 1536 |
| 550 | Ga0207647_10450914 | 3300025904 | Unclassified | 721 |
| 551 | Ga0207685_10004888 | 3300025905 | Bacteria | 3468 |
| 552 | Ga0207685_10018092 | 3300025905 | Bacteria | 2293 |
| 553 | Ga0207685_10141903 | 3300025905 | Bacteria | 1078 |
| 554 | Ga0207685_10305143 | 3300025905 | Bacteria | 789 |
| 555 | Ga0207699_10092826 | 3300025906 | Bacteria | 1898 |
| 556 | Ga0207699_10096502 | 3300025906 | Bacteria | 1866 |
| 557 | Ga0207699_10855847 | 3300025906 | Bacteria | 670 |
| 558 | Ga0207699_10992185 | 3300025906 | Bacteria | 621 |
| 559 | Ga0207645_10025047 | 3300025907 | Bacteria | 3863 |
| 560 | Ga0207645_10115624 | 3300025907 | Bacteria | 1739 |
| 561 | Ga0207645_10244802 | 3300025907 | Bacteria | 1185 |
| 562 | Ga0207643_10070350 | 3300025908 | Bacteria | 2012 |
| 563 | Ga0207643_10283382 | 3300025908 | Bacteria | 1028 |
| 564 | Ga0207643_10331843 | 3300025908 | Bacteria | 952 |
| 565 | Ga0207643_10352515 | 3300025908 | Bacteria | 924 |
| 566 | Ga0207705_10338169 | 3300025909 | Bacteria | 1158 |
| 567 | Ga0207684_10014283 | 3300025910 | Bacteria | 6849 |
| 568 | Ga0207684_10131761 | 3300025910 | Bacteria | 2145 |
| 569 | Ga0207684_10206093 | 3300025910 | Bacteria | 1696 |
| 570 | Ga0207654_10063579 | 3300025911 | Bacteria | 2167 |
| 571 | Ga0207707_10151644 | 3300025912 | Bacteria | 2026 |
| 572 | Ga0207707_10335172 | 3300025912 | Bacteria | 1305 |
| 573 | Ga0207707_10613529 | 3300025912 | Bacteria | 920 |
| 574 | Ga0207695_10340146 | 3300025913 | Bacteria | 1388 |
| 575 | Ga0207671_10162534 | 3300025914 | Bacteria | 1730 |
| 576 | Ga0207671_11156606 | 3300025914 | Archaea | 606 |
| 577 | Ga0207693_10000468 | 3300025915 | Bacteria | 36863 |
| 578 | Ga0207693_10002699 | 3300025915 | Bacteria | 15380 |
| 579 | Ga0207693_10005673 | 3300025915 | Bacteria | 10376 |
| 580 | Ga0207693_10013206 | 3300025915 | Bacteria | 6664 |
| 581 | Ga0207693_10026932 | 3300025915 | Bacteria | 4547 |
| 582 | Ga0207693_10034674 | 3300025915 | Bacteria | 3981 |
| 583 | Ga0207693_10112075 | 3300025915 | Bacteria | 2140 |
| 584 | Ga0207663_10004759 | 3300025916 | Bacteria | 6780 |
| 585 | Ga0207663_10119254 | 3300025916 | Unclassified | 1803 |
| 586 | Ga0207663_10169674 | 3300025916 | Bacteria | 1549 |
| 587 | Ga0207663_10214793 | 3300025916 | Bacteria | 1396 |
| 588 | Ga0207660_10062759 | 3300025917 | Bacteria | 2678 |
| 589 | Ga0207660_10103287 | 3300025917 | Bacteria | 2132 |
| 590 | Ga0207660_10116295 | 3300025917 | Bacteria | 2020 |
| 591 | Ga0207660_10338680 | 3300025917 | Bacteria | 1204 |
| 592 | Ga0207660_10497649 | 3300025917 | Bacteria | 989 |
| 593 | Ga0207662_10056177 | 3300025918 | Bacteria | 2350 |
| 594 | Ga0207662_10074188 | 3300025918 | Bacteria | 2065 |
| 595 | Ga0207657_10001010 | 3300025919 | Bacteria | 29952 |
| 596 | Ga0207657_10062881 | 3300025919 | Bacteria | 3176 |
| 597 | Ga0207657_10095825 | 3300025919 | Bacteria | 2469 |
| 598 | Ga0207657_10119052 | 3300025919 | Unclassified | 2173 |
| 599 | Ga0207657_10712855 | 3300025919 | Unclassified | 779 |
| 600 | Ga0207649_10854879 | 3300025920 | Unclassified | 712 |
| 601 | Ga0207649_11116269 | 3300025920 | Bacteria | 622 |
| 602 | Ga0207652_10276867 | 3300025921 | Bacteria | 1514 |
| 603 | Ga0207646_10007769 | 3300025922 | Bacteria | 10853 |
| 604 | Ga0207646_10009003 | 3300025922 | Bacteria | 9924 |
| 605 | Ga0207646_10363970 | 3300025922 | Bacteria | 1306 |
| 606 | Ga0207681_10030241 | 3300025923 | Bacteria | 3529 |
| 607 | Ga0207681_10091381 | 3300025923 | Bacteria | 2175 |
| 608 | Ga0207681_10198511 | 3300025923 | Bacteria | 1539 |
| 609 | Ga0207681_10286095 | 3300025923 | Bacteria | 1300 |
| 610 | Ga0207681_10776915 | 3300025923 | Bacteria | 799 |
| 611 | Ga0207694_10026457 | 3300025924 | Bacteria | 4413 |
| 612 | Ga0207650_10014921 | 3300025925 | Bacteria | 5405 |
| 613 | Ga0207650_10030691 | 3300025925 | Bacteria | 3874 |
| 614 | Ga0207650_10240503 | 3300025925 | Bacteria | 1463 |
| 615 | Ga0207659_10022079 | 3300025926 | Bacteria | 4234 |
| 616 | Ga0207659_10311417 | 3300025926 | Bacteria | 1296 |
| 617 | Ga0207659_10365311 | 3300025926 | Bacteria | 1200 |
| 618 | Ga0207659_10372850 | 3300025926 | Bacteria | 1189 |
| 619 | Ga0207659_10470404 | 3300025926 | Bacteria | 1061 |
| 620 | Ga0207659_10603928 | 3300025926 | Bacteria | 936 |
| 621 | Ga0207687_10017159 | 3300025927 | Bacteria | 4760 |
| 622 | Ga0207687_10045339 | 3300025927 | Bacteria | 3039 |
| 623 | Ga0207687_10110337 | 3300025927 | Bacteria | 2040 |
| 624 | Ga0207687_10136192 | 3300025927 | Bacteria | 1857 |
| 625 | Ga0207687_10136707 | 3300025927 | Bacteria | 1854 |
| 626 | Ga0207687_10163594 | 3300025927 | Bacteria | 1710 |
| 627 | Ga0207687_10179796 | 3300025927 | Bacteria | 1638 |
| 628 | Ga0207687_10320444 | 3300025927 | Bacteria | 1255 |
| 629 | Ga0207687_10511191 | 3300025927 | Bacteria | 1004 |
| 630 | Ga0207687_10679087 | 3300025927 | Unclassified | 873 |
| 631 | Ga0207700_10149119 | 3300025928 | Bacteria | 1931 |
| 632 | Ga0207700_10186943 | 3300025928 | Bacteria | 1738 |
| 633 | Ga0207700_10254325 | 3300025928 | Bacteria | 1502 |
| 634 | Ga0207664_10015157 | 3300025929 | Bacteria | 5586 |
| 635 | Ga0207664_10028593 | 3300025929 | Bacteria | 4238 |
| 636 | Ga0207664_10431177 | 3300025929 | Unclassified | 1175 |
| 637 | Ga0207644_10046784 | 3300025931 | Bacteria | 3084 |
| 638 | Ga0207644_10151691 | 3300025931 | Bacteria | 1794 |
| 639 | Ga0207644_10185486 | 3300025931 | Bacteria | 1633 |
| 640 | Ga0207690_10116490 | 3300025932 | Bacteria | 1932 |
| 641 | Ga0207690_10350480 | 3300025932 | Bacteria | 1167 |
| 642 | Ga0207690_10743568 | 3300025932 | Bacteria | 808 |
| 643 | Ga0207690_10767466 | 3300025932 | Bacteria | 796 |
| 644 | Ga0207706_10003053 | 3300025933 | Bacteria | 16118 |
| 645 | Ga0207706_10029490 | 3300025933 | Bacteria | 4897 |
| 646 | Ga0207706_10037122 | 3300025933 | Archaea | 4327 |
| 647 | Ga0207706_10052872 | 3300025933 | Bacteria | 3586 |
| 648 | Ga0207706_10078082 | 3300025933 | Bacteria | 2912 |
| 649 | Ga0207706_10136076 | 3300025933 | Bacteria | 2162 |
| 650 | Ga0207706_10294619 | 3300025933 | Bacteria | 1414 |
| 651 | Ga0207706_10523556 | 3300025933 | Unclassified | 1022 |
| 652 | Ga0207706_10572431 | 3300025933 | Bacteria | 971 |
| 653 | Ga0207706_10605488 | 3300025933 | Unclassified | 941 |
| 654 | Ga0207686_10002592 | 3300025934 | Bacteria | 9812 |
| 655 | Ga0207686_10024437 | 3300025934 | Bacteria | 3502 |
| 656 | Ga0207686_10051819 | 3300025934 | Bacteria | 2558 |
| 657 | Ga0207686_10152740 | 3300025934 | Bacteria | 1609 |
| 658 | Ga0207686_10206348 | 3300025934 | Bacteria | 1410 |
| 659 | Ga0207686_10232702 | 3300025934 | Bacteria | 1337 |
| 660 | Ga0207686_10314152 | 3300025934 | Bacteria | 1168 |
| 661 | Ga0207709_10004481 | 3300025935 | Bacteria | 8063 |
| 662 | Ga0207709_10040521 | 3300025935 | Bacteria | 2789 |
| 663 | Ga0207709_10106688 | 3300025935 | Bacteria | 1864 |
| 664 | Ga0207709_10124695 | 3300025935 | Bacteria | 1745 |
| 665 | Ga0207709_10425075 | 3300025935 | Bacteria | 1021 |
| 666 | Ga0207670_10020602 | 3300025936 | Bacteria | 4055 |
| 667 | Ga0207670_10148695 | 3300025936 | Bacteria | 1735 |
| 668 | Ga0207669_10013142 | 3300025937 | Bacteria | 4101 |
| 669 | Ga0207669_10058883 | 3300025937 | Bacteria | 2346 |
| 670 | Ga0207669_10158783 | 3300025937 | Bacteria | 1594 |
| 671 | Ga0207669_10503455 | 3300025937 | Bacteria | 969 |
| 672 | Ga0207669_10857163 | 3300025937 | Bacteria | 756 |
| 673 | Ga0207704_10004272 | 3300025938 | Archaea | 6530 |
| 674 | Ga0207704_10190823 | 3300025938 | Bacteria | 1490 |
| 675 | Ga0207704_10311456 | 3300025938 | Unclassified | 1210 |
| 676 | Ga0207704_10569689 | 3300025938 | Bacteria | 923 |
| 677 | Ga0207704_11206536 | 3300025938 | Unclassified | 645 |
| 678 | Ga0207665_10005276 | 3300025939 | Bacteria | 8637 |
| 679 | Ga0207665_10016737 | 3300025939 | Bacteria | 4816 |
| 680 | Ga0207665_10019092 | 3300025939 | Bacteria | 4504 |
| 681 | Ga0207691_10004591 | 3300025940 | Bacteria | 13375 |
| 682 | Ga0207691_10024335 | 3300025940 | Bacteria | 5695 |
| 683 | Ga0207691_10033336 | 3300025940 | Bacteria | 4795 |
| 684 | Ga0207691_10254907 | 3300025940 | Bacteria | 1513 |
| 685 | Ga0207711_10231488 | 3300025941 | Bacteria | 1692 |
| 686 | Ga0207711_10319226 | 3300025941 | Bacteria | 1435 |
| 687 | Ga0207711_10403199 | 3300025941 | Bacteria | 1271 |
| 688 | Ga0207711_11855884 | 3300025941 | Bacteria | 546 |
| 689 | Ga0207689_10118363 | 3300025942 | Bacteria | 2179 |
| 690 | Ga0207689_10530708 | 3300025942 | Bacteria | 987 |
| 691 | Ga0207689_11092254 | 3300025942 | Unclassified | 672 |
| 692 | Ga0207661_10062508 | 3300025944 | Bacteria | 3013 |
| 693 | Ga0207661_10212962 | 3300025944 | Bacteria | 1704 |
| 694 | Ga0207661_10354344 | 3300025944 | Bacteria | 1324 |
| 695 | Ga0207661_10373693 | 3300025944 | Bacteria | 1289 |
| 696 | Ga0207661_10953893 | 3300025944 | Bacteria | 790 |
| 697 | Ga0207661_11171372 | 3300025944 | Bacteria | 707 |
| 698 | Ga0207679_10052810 | 3300025945 | Bacteria | 2983 |
| 699 | Ga0207679_10433856 | 3300025945 | Bacteria | 1162 |
| 700 | Ga0207679_11118912 | 3300025945 | Bacteria | 723 |
| 701 | Ga0207667_10122244 | 3300025949 | Bacteria | 2682 |
| 702 | Ga0207667_10130288 | 3300025949 | Bacteria | 2591 |
| 703 | Ga0207667_10409006 | 3300025949 | Bacteria | 1381 |
| 704 | Ga0207667_10464306 | 3300025949 | Unclassified | 1286 |
| 705 | Ga0207651_10058205 | 3300025960 | Bacteria | 2670 |
| 706 | Ga0207651_10060356 | 3300025960 | Bacteria | 2632 |
| 707 | Ga0207651_10081292 | 3300025960 | Bacteria | 2335 |
| 708 | Ga0207651_10301550 | 3300025960 | Bacteria | 1332 |
| 709 | Ga0207651_10312521 | 3300025960 | Bacteria | 1311 |
| 710 | Ga0207651_10614236 | 3300025960 | Bacteria | 952 |
| 711 | Ga0207712_10037905 | 3300025961 | Archaea | 3292 |
| 712 | Ga0207712_10066524 | 3300025961 | Bacteria | 2576 |
| 713 | Ga0207712_10251913 | 3300025961 | Bacteria | 1428 |
| 714 | Ga0207668_10065371 | 3300025972 | Bacteria | 2574 |
| 715 | Ga0207668_10143420 | 3300025972 | Bacteria | 1840 |
| 716 | Ga0207668_10512052 | 3300025972 | Bacteria | 1034 |
| 717 | Ga0207668_11772023 | 3300025972 | Unclassified | 557 |
| 718 | Ga0207640_10251955 | 3300025981 | Bacteria | 1371 |
| 719 | Ga0207640_10567292 | 3300025981 | Bacteria | 956 |
| 720 | Ga0207640_10754479 | 3300025981 | Bacteria | 839 |
| 721 | Ga0207640_11471608 | 3300025981 | Bacteria | 611 |
| 722 | Ga0207658_10340731 | 3300025986 | Bacteria | 1303 |
| 723 | Ga0207658_10653487 | 3300025986 | Bacteria | 948 |
| 724 | Ga0207677_10050647 | 3300026023 | Bacteria | 2810 |
| 725 | Ga0207677_10054351 | 3300026023 | Bacteria | 2732 |
| 726 | Ga0207677_10061821 | 3300026023 | Bacteria | 2595 |
| 727 | Ga0207677_10190351 | 3300026023 | Bacteria | 1622 |
| 728 | Ga0207677_10342949 | 3300026023 | Bacteria | 1249 |
| 729 | Ga0207639_10035329 | 3300026041 | Unclassified | 3698 |
| 730 | Ga0207639_10268205 | 3300026041 | Bacteria | 1496 |
| 731 | Ga0207678_10007870 | 3300026067 | Bacteria | 9404 |
| 732 | Ga0207678_10028896 | 3300026067 | Bacteria | 4839 |
| 733 | Ga0207678_10034547 | 3300026067 | Bacteria | 4403 |
| 734 | Ga0207678_10108329 | 3300026067 | Bacteria | 2370 |
| 735 | Ga0207678_11595420 | 3300026067 | Bacteria | 575 |
| 736 | Ga0207708_10000434 | 3300026075 | Bacteria | 32516 |
| 737 | Ga0207708_10006543 | 3300026075 | Bacteria | 8623 |
| 738 | Ga0207708_10010108 | 3300026075 | Bacteria | 7007 |
| 739 | Ga0207708_10259655 | 3300026075 | Bacteria | 1402 |
| 740 | Ga0207708_10612065 | 3300026075 | Bacteria | 924 |
| 741 | Ga0207708_10621758 | 3300026075 | Bacteria | 917 |
| 742 | Ga0207708_10983921 | 3300026075 | Bacteria | 732 |
| 743 | Ga0207702_10006809 | 3300026078 | Bacteria | 9802 |
| 744 | Ga0207702_10037538 | 3300026078 | Bacteria | 4056 |
| 745 | Ga0207702_10099432 | 3300026078 | Bacteria | 2564 |
| 746 | Ga0207702_10381755 | 3300026078 | Bacteria | 1355 |
| 747 | Ga0207702_10873666 | 3300026078 | Bacteria | 891 |
| 748 | Ga0207702_11109645 | 3300026078 | Bacteria | 785 |
| 749 | Ga0207702_12211051 | 3300026078 | Bacteria | 539 |
| 750 | Ga0207641_10391377 | 3300026088 | Bacteria | 1333 |
| 751 | Ga0207641_11340768 | 3300026088 | Bacteria | 716 |
| 752 | Ga0207648_10003561 | 3300026089 | Bacteria | 16283 |
| 753 | Ga0207648_10010611 | 3300026089 | Bacteria | 8711 |
| 754 | Ga0207648_10194727 | 3300026089 | Bacteria | 1797 |
| 755 | Ga0207648_10197230 | 3300026089 | Bacteria | 1785 |
| 756 | Ga0207648_10521671 | 3300026089 | Bacteria | 1089 |
| 757 | Ga0207648_10797361 | 3300026089 | Bacteria | 879 |
| 758 | Ga0207648_10860523 | 3300026089 | Bacteria | 846 |
| 759 | Ga0207676_10049792 | 3300026095 | Bacteria | 3262 |
| 760 | Ga0207676_10173590 | 3300026095 | Bacteria | 1880 |
| 761 | Ga0207676_10603859 | 3300026095 | Bacteria | 1054 |
| 762 | Ga0207674_10183829 | 3300026116 | Bacteria | 2041 |
| 763 | Ga0207674_11810939 | 3300026116 | Bacteria | 577 |
| 764 | Ga0207675_100000929 | 3300026118 | Bacteria | 29254 |
| 765 | Ga0207675_100022783 | 3300026118 | Bacteria | 5828 |
| 766 | Ga0207675_100042327 | 3300026118 | Bacteria | 4252 |
| 767 | Ga0207675_100061539 | 3300026118 | Bacteria | 3504 |
| 768 | Ga0207675_100125449 | 3300026118 | Bacteria | 2432 |
| 769 | Ga0207675_100145230 | 3300026118 | Bacteria | 2255 |
| 770 | Ga0207675_100906463 | 3300026118 | Bacteria | 898 |
| 771 | Ga0207675_100982677 | 3300026118 | Bacteria | 862 |
| 772 | Ga0207683_10008655 | 3300026121 | Bacteria | 8703 |
| 773 | Ga0207683_10014994 | 3300026121 | Bacteria | 6596 |
| 774 | Ga0207683_10016453 | 3300026121 | Bacteria | 6295 |
| 775 | Ga0207683_10022492 | 3300026121 | Bacteria | 5412 |
| 776 | Ga0207683_10083078 | 3300026121 | Bacteria | 2846 |
| 777 | Ga0207683_10123157 | 3300026121 | Bacteria | 2329 |
| 778 | Ga0207683_10194938 | 3300026121 | Bacteria | 1840 |
| 779 | Ga0207683_10322856 | 3300026121 | Bacteria | 1414 |
| 780 | Ga0207698_10104801 | 3300026142 | Bacteria | 2354 |
| 781 | Ga0207698_10133410 | 3300026142 | Bacteria | 2126 |
| 782 | Ga0207698_10158699 | 3300026142 | Bacteria | 1975 |
| 783 | Ga0209966_1127929 | 3300027695 | Bacteria | 585 |
| 784 | Ga0209974_10149298 | 3300027876 | Bacteria | 843 |
| 785 | Ga0207428_10016203 | 3300027907 | Bacteria | 6417 |
| 786 | Ga0207428_10017291 | 3300027907 | Bacteria | 6192 |
| 787 | Ga0207428_10030243 | 3300027907 | Bacteria | 4479 |
| 788 | Ga0207428_10041952 | 3300027907 | Bacteria | 3703 |
| 789 | Ga0207428_10059700 | 3300027907 | Bacteria | 3023 |
| 790 | Ga0207428_10237150 | 3300027907 | Unclassified | 1364 |
| 791 | Ga0207428_10258606 | 3300027907 | Bacteria | 1297 |
| 792 | Ga0207428_10499753 | 3300027907 | Bacteria | 883 |
| 793 | Ga0207428_10811977 | 3300027907 | Bacteria | 664 |
| 794 | Ga0268266_10132525 | 3300028379 | Bacteria | 2230 |
| 795 | Ga0268266_10713353 | 3300028379 | Bacteria | 967 |
| 796 | Ga0268266_10777332 | 3300028379 | Bacteria | 924 |
| 797 | Ga0268265_10427518 | 3300028380 | Bacteria | 1231 |
| 798 | Ga0268265_10575052 | 3300028380 | Bacteria | 1073 |
| 799 | Ga0268265_11732074 | 3300028380 | Viruses | 631 |
| 800 | Ga0268264_10165658 | 3300028381 | Bacteria | 1995 |
| 801 | Ga0268264_10181795 | 3300028381 | Bacteria | 1910 |
| 802 | Ga0268264_10620425 | 3300028381 | Bacteria | 1067 |
| 803 | Ga0268264_10791741 | 3300028381 | Bacteria | 947 |
| 804 | Ga0268264_11719274 | 3300028381 | Bacteria | 638 |
| 805 | Ga0307408_100026730 | 3300031548 | Bacteria | 3968 |
| 806 | Ga0307408_100142111 | 3300031548 | Bacteria | 1885 |
| 807 | Ga0307408_100646728 | 3300031548 | Bacteria | 945 |
| 808 | Ga0307413_10378179 | 3300031824 | Bacteria | 1102 |
| 809 | Ga0307410_10031890 | 3300031852 | Bacteria | 3386 |
| 810 | Ga0307406_10011043 | 3300031901 | Bacteria | 5115 |
| 811 | Ga0307406_10711386 | 3300031901 | Bacteria | 840 |
| 812 | Ga0307407_10245278 | 3300031903 | Bacteria | 1224 |
| 813 | Ga0307407_10628199 | 3300031903 | Bacteria | 802 |
| 814 | Ga0307409_100010374 | 3300031995 | Bacteria | 5789 |
| 815 | Ga0307409_100237172 | 3300031995 | Bacteria | 1658 |
| 816 | Ga0307409_100983768 | 3300031995 | Bacteria | 861 |
| 817 | Ga0307409_101509474 | 3300031995 | Bacteria | 699 |
| 818 | Ga0307416_100004219 | 3300032002 | Bacteria | 8628 |
| 819 | Ga0307416_100007736 | 3300032002 | Bacteria | 6868 |
| 820 | Ga0307416_100216609 | 3300032002 | Bacteria | 1832 |
| 821 | Ga0307416_100246630 | 3300032002 | Bacteria | 1735 |
| 822 | Ga0307414_12209359 | 3300032004 | Bacteria | 514 |
| 823 | Ga0307411_10089487 | 3300032005 | Bacteria | 2144 |
| 824 | Ga0307411_10228781 | 3300032005 | Bacteria | 1448 |
| 825 | Ga0307415_100000808 | 3300032126 | Bacteria | 14238 |
| 826 | Ga0307415_100021834 | 3300032126 | Bacteria | 3942 |
| 827 | Ga0307415_100195143 | 3300032126 | Bacteria | 1601 |
| 828 | Ga0307415_101005051 | 3300032126 | Bacteria | 775 |
| 829 | Ga0307415_102319889 | 3300032126 | Bacteria | 527 |
| 830 | Ga0373930_0110510 | 3300034816 | Bacteria | 661 |
| 831 | Ga0373930_0143986 | 3300034816 | Bacteria | 594 |
| 832 | Ga0373948_0094070 | 3300034817 | Bacteria | 699 |
| 833 | Ga0373950_0004977 | 3300034818 | Bacteria | 1968 |
| 834 | Ga0373959_0109728 | 3300034820 | Bacteria | 665 |
| 835 | Ga0373928_0014071 | 3300035084 | Bacteria | 1613 |
| 836 | Ga0373944_0001983 | 3300035089 | Bacteria | 5183 |
| 837 | Ga0373949_0005829 | 3300035090 | Bacteria | 2739 |
| 838 | Ga0373949_0089046 | 3300035090 | Bacteria | 832 |
| 839 | Ga0373952_0011491 | 3300035092 | Bacteria | 1728 |
| 840 | Ga0373932_0006265 | 3300035112 | Bacteria | 2811 |
| 841 | Ga0373932_0085299 | 3300035112 | Bacteria | 1005 |
| 842 | Ga0373932_0139901 | 3300035112 | Unclassified | 822 |
| 843 | Ga0373936_0470036 | 3300035113 | Bacteria | 583 |
| 844 | Ga0373939_0053385 | 3300035114 | Bacteria | 1262 |
| 845 | Ga0373939_0477311 | 3300035114 | Bacteria | 529 |
| 846 | Ga0373941_0018107 | 3300035115 | Bacteria | 1941 |
| 847 | Ga0373941_0237678 | 3300035115 | Bacteria | 706 |
| 848 | Ga0373960_0025142 | 3300035121 | Bacteria | 1616 |
| 849 | Ga0373960_0337527 | 3300035121 | Bacteria | 568 |
| 850 | Ga0373943_0000198 | 3300035170 | Bacteria | 24537 |
| 851 | Ga0373943_0090845 | 3300035170 | Bacteria | 1581 |
| 852 | Ga0373946_0123284 | 3300035171 | Bacteria | 1185 |
| 853 | Ga0373961_0030013 | 3300035241 | Bacteria | 1509 |
| 854 | Ga0373962_0101075 | 3300035242 | Bacteria | 899 |
| 855 | Ga0373931_0038872 | 3300035691 | Bacteria | 2491 |
| 856 | Ga0373931_0282214 | 3300035691 | Bacteria | 1020 |
| 857 | Ga0373931_0771393 | 3300035691 | Bacteria | 639 |
| 858 | Ga0373931_0876272 | 3300035691 | Bacteria | 602 |
| 859 | Ga0373935_0026470 | 3300035692 | Bacteria | 3580 |
| 860 | Ga0373935_1464746 | 3300035692 | Bacteria | 511 |
| 861 | Ga0373927_0196855 | 3300035695 | Bacteria | 1322 |
| 862 | Ga0373947_0004346 | 3300035725 | Bacteria | 8317 |
| 863 | Ga0373947_0238578 | 3300035725 | Bacteria | 1199 |
| 864 | Ga0373925_0024727 | 3300037068 | Bacteria | 4386 |
| 865 | Ga0395899_0000862 | 3300037312 | Bacteria | 28881 |
| 866 | Ga0395899_0007610 | 3300037312 | Bacteria | 8354 |
| 867 | Ga0395899_0010899 | 3300037312 | Bacteria | 6966 |
| 868 | Ga0395899_0017974 | 3300037312 | Bacteria | 5381 |
| 869 | Ga0395899_0023261 | 3300037312 | Bacteria | 4696 |
| 870 | Ga0395899_0033719 | 3300037312 | Bacteria | 3845 |
| 871 | Ga0395899_0040508 | 3300037312 | Bacteria | 3483 |
| 872 | Ga0395899_0049553 | 3300037312 | Bacteria | 3122 |
| 873 | Ga0395899_0061595 | 3300037312 | Bacteria | 2764 |
| 874 | Ga0395899_0609227 | 3300037312 | Archaea | 695 |
| 875 | Ga0395900_0001266 | 3300037418 | Bacteria | 30887 |
| 876 | Ga0395900_0002625 | 3300037418 | Bacteria | 19619 |
| 877 | Ga0395900_0002980 | 3300037418 | Bacteria | 18417 |
| 878 | Ga0395900_0005422 | 3300037418 | Bacteria | 13365 |
| 879 | Ga0395900_0007274 | 3300037418 | Bacteria | 11460 |
| 880 | Ga0395900_0027616 | 3300037418 | Bacteria | 5813 |
| 881 | Ga0395900_0035757 | 3300037418 | Bacteria | 5118 |
| 882 | Ga0395900_0054878 | 3300037418 | Bacteria | 4102 |
| 883 | Ga0395900_0080840 | 3300037418 | Bacteria | 3340 |
| 884 | Ga0395900_0096139 | 3300037418 | Bacteria | 3043 |
| 885 | Ga0395900_0140715 | 3300037418 | Unclassified | 2471 |
| 886 | Ga0395900_0186990 | 3300037418 | Bacteria | 2102 |
| 887 | Ga0395900_0277384 | 3300037418 | Bacteria | 1669 |
| 888 | Ga0395900_0280779 | 3300037418 | Bacteria | 1657 |
| 889 | Ga0395900_0316752 | 3300037418 | Bacteria | 1541 |
| 890 | Ga0395900_0542489 | 3300037418 | Unclassified | 1108 |
| 891 | Ga0395900_0608699 | 3300037418 | Unclassified | 1032 |
| 892 | Ga0395898_0002345 | 3300037466 | Bacteria | 22578 |
| 893 | Ga0395898_0002841 | 3300037466 | Bacteria | 19817 |
| 894 | Ga0395898_0003303 | 3300037466 | Bacteria | 18113 |
| 895 | Ga0395898_0003734 | 3300037466 | Bacteria | 16893 |
| 896 | Ga0395898_0007075 | 3300037466 | Bacteria | 11918 |
| 897 | Ga0395898_0008888 | 3300037466 | Bacteria | 10583 |
| 898 | Ga0395898_0014330 | 3300037466 | Bacteria | 8147 |
| 899 | Ga0395898_0015278 | 3300037466 | Bacteria | 7877 |
| 900 | Ga0395898_0045908 | 3300037466 | Bacteria | 4293 |
| 901 | Ga0395898_0051506 | 3300037466 | Bacteria | 4025 |
| 902 | Ga0395898_0063078 | 3300037466 | Bacteria | 3596 |
| 903 | Ga0395898_0069483 | 3300037466 | Bacteria | 3407 |
| 904 | Ga0395898_0084496 | 3300037466 | Bacteria | 3060 |
| 905 | Ga0395898_0089482 | 3300037466 | Bacteria | 2962 |
| 906 | Ga0395898_0196948 | 3300037466 | Bacteria | 1924 |
| 907 | Ga0395898_0340270 | 3300037466 | Bacteria | 1431 |
| 908 | Ga0395898_0385485 | 3300037466 | Bacteria | 1336 |
| 909 | Ga0395898_1163811 | 3300037466 | Bacteria | 703 |
| 910 | Ga0395898_1734498 | 3300037466 | Bacteria | 547 |
| 911 | Ga0395905_0001694 | 3300037471 | Bacteria | 25990 |
| 912 | Ga0395905_0003053 | 3300037471 | Bacteria | 18137 |
| 913 | Ga0395905_0003210 | 3300037471 | Bacteria | 17599 |
| 914 | Ga0395905_0009789 | 3300037471 | Bacteria | 9345 |
| 915 | Ga0395905_0013678 | 3300037471 | Bacteria | 7772 |
| 916 | Ga0395905_0017506 | 3300037471 | Bacteria | 6803 |
| 917 | Ga0395905_0020791 | 3300037471 | Bacteria | 6214 |
| 918 | Ga0395905_0026568 | 3300037471 | Bacteria | 5458 |
| 919 | Ga0395905_0046230 | 3300037471 | Bacteria | 4082 |
| 920 | Ga0395905_0050765 | 3300037471 | Bacteria | 3885 |
| 921 | Ga0395905_0051423 | 3300037471 | Bacteria | 3860 |
| 922 | Ga0395905_0063055 | 3300037471 | Bacteria | 3467 |
| 923 | Ga0395905_0245546 | 3300037471 | Unclassified | 1672 |
| 924 | Ga0395905_0259270 | 3300037471 | Bacteria | 1623 |
| 925 | Ga0395905_0689296 | 3300037471 | Unclassified | 924 |
| 926 | Ga0395905_1489220 | 3300037471 | Unclassified | 581 |
| 927 | Ga0395901_0001749 | 3300038443 | Bacteria | 22444 |
| 928 | Ga0395901_0002270 | 3300038443 | Bacteria | 19615 |
| 929 | Ga0395901_0003365 | 3300038443 | Bacteria | 16107 |
| 930 | Ga0395901_0004675 | 3300038443 | Bacteria | 13803 |
| 931 | Ga0395901_0005294 | 3300038443 | Bacteria | 13040 |
| 932 | Ga0395901_0012865 | 3300038443 | Bacteria | 8487 |
| 933 | Ga0395901_0014566 | 3300038443 | Bacteria | 7993 |
| 934 | Ga0395901_0018530 | 3300038443 | Bacteria | 7107 |
| 935 | Ga0395901_0092174 | 3300038443 | Bacteria | 3172 |
| 936 | Ga0395901_0104920 | 3300038443 | Bacteria | 2966 |
| 937 | Ga0395901_0130499 | 3300038443 | Bacteria | 2640 |
| 938 | Ga0395901_0139881 | 3300038443 | Bacteria | 2544 |
| 939 | Ga0395901_0169408 | 3300038443 | Bacteria | 2291 |
| 940 | Ga0395901_0305693 | 3300038443 | Bacteria | 1648 |
| 941 | Ga0395901_0338922 | 3300038443 | Bacteria | 1553 |
| 942 | Ga0395901_0358867 | 3300038443 | Bacteria | 1503 |
| 943 | Ga0395901_0389261 | 3300038443 | Bacteria | 1433 |
| 944 | Ga0395901_1232048 | 3300038443 | Unclassified | 713 |
| 945 | Ga0395901_1277704 | 3300038443 | Bacteria | 697 |
| 946 | Ga0242420_151020 | 3300038996 | Bacteria | 521 |
| 947 | Ga0436363_0708027 | 3300039450 | Unclassified | 523 |
| 948 | Ga0439461_0003188 | 3300041410 | Bacteria | 2683 |
| 949 | Ga0439461_0018750 | 3300041410 | Bacteria | 1357 |
| 950 | Ga0451789_0477297 | 3300041443 | Unclassified | 523 |
| 951 | Ga0451800_0214577 | 3300041459 | Bacteria | 1909 |
| 952 | Ga0451800_0969733 | 3300041459 | Unclassified | 626 |
| 953 | Ga0451802_1709161 | 3300041460 | Unclassified | 523 |
| 954 | Ga0451802_1723895 | 3300041460 | Bacteria | 884 |
| 955 | Ga0451804_0948022 | 3300041463 | Unclassified | 811 |
| 956 | Ga0451804_0973345 | 3300041463 | Unclassified | 926 |
| 957 | Ga0451835_0412301 | 3300041492 | Unclassified | 1287 |
| 958 | Ga0451839_0962805 | 3300041496 | Unclassified | 718 |
| 959 | Ga0451845_0454819 | 3300041501 | Unclassified | 1703 |
| 960 | Ga0451845_0915420 | 3300041501 | Bacteria | 661 |
| 961 | Ga0451847_0310254 | 3300041503 | Unclassified | 990 |
| 962 | Ga0451847_0524792 | 3300041503 | Bacteria | 550 |
| 963 | Ga0451849_1357471 | 3300041505 | Unclassified | 2377 |
| 964 | Ga0451855_0355001 | 3300041511 | Bacteria | 2125 |
| 965 | Ga0451855_1954170 | 3300041511 | Bacteria | 720 |
| 966 | Ga0451853_0563886 | 3300041512 | Unclassified | 2113 |
| 967 | Ga0451853_2940054 | 3300041512 | Unclassified | 804 |
| 968 | Ga0451853_3005281 | 3300041512 | Unclassified | 990 |
| 969 | Ga0439437_005057 | 3300042000 | Unclassified | 1447 |
| 970 | Ga0439448_0030442 | 3300042005 | Bacteria | 1712 |
| 971 | Ga0439448_0240698 | 3300042005 | Bacteria | 638 |
| 972 | Ga0439454_071322 | 3300042011 | Unclassified | 617 |
| 973 | Ga0439455_0156098 | 3300042012 | Unclassified | 651 |
| 974 | Ga0450914_019073 | 3300042118 | Bacteria | 750 |
| 975 | Ga0450920_006939 | 3300042122 | Bacteria | 2043 |
| 976 | Ga0450920_011792 | 3300042122 | Unclassified | 1632 |
| 977 | Ga0450922_043894 | 3300042124 | Bacteria | 511 |
| 978 | Ga0450902_004613 | 3300042137 | Bacteria | 2055 |
| 979 | Ga0450905_015958 | 3300042142 | Bacteria | 1080 |
| 980 | Ga0450906_033732 | 3300042145 | Bacteria | 905 |
| 981 | Ga0439446_0027233 | 3300042156 | Bacteria | 1640 |
| 982 | Ga0439446_0117384 | 3300042156 | Unclassified | 854 |
| 983 | Ga0450908_044627 | 3300042184 | Bacteria | 769 |
| 984 | Ga0439434_0019517 | 3300042435 | Bacteria | 2033 |
| 985 | Ga0439459_0083590 | 3300042438 | Bacteria | 757 |
| 986 | Ga0439459_0086809 | 3300042438 | Bacteria | 747 |
| 987 | Ga0439464_0067392 | 3300042439 | Bacteria | 1055 |
| 988 | Ga0439460_0289782 | 3300042461 | Bacteria | 571 |
| 989 | Ga0450918_109298 | 3300042531 | Bacteria | 546 |
| 990 | Ga0451577_0843213 | 3300042876 | Bacteria | 827 |
| 991 | Ga0466972_0142262 | 3300044658 | Bacteria | 1129 |
| 992 | Ga0466972_0281426 | 3300044658 | Bacteria | 777 |
| 993 | Ga0453683_0422057 | 3300044673 | Bacteria | 861 |
| 994 | Ga0466961_0207825 | 3300044693 | Bacteria | 1209 |
| 995 | Ga0466961_0670293 | 3300044693 | Unclassified | 622 |
| 996 | Ga0466963_0011685 | 3300044694 | Bacteria | 5350 |
| 997 | Ga0466964_0042314 | 3300044706 | Bacteria | 1845 |
| 998 | Ga0466964_0082046 | 3300044706 | Unclassified | 1386 |
| 999 | Ga0466964_0148485 | 3300044706 | Bacteria | 1084 |
| 1000 | Ga0466971_0362824 | 3300044719 | Bacteria | 702 |
| 1001 | Ga0466968_0329851 | 3300044735 | Bacteria | 738 |
| 1002 | Ga0466968_0719438 | 3300044735 | Bacteria | 511 |
| 1003 | Ga0466970_0554343 | 3300044765 | Unclassified | 664 |
| 1004 | Ga0466957_0035282 | 3300044842 | Bacteria | 3001 |
| 1005 | Ga0466957_0077290 | 3300044842 | Bacteria | 2068 |
| 1006 | Ga0466960_0191295 | 3300044901 | Bacteria | 1114 |
| 1007 | Ga0466960_0192038 | 3300044901 | Bacteria | 1112 |
| 1008 | Ga0466960_0365049 | 3300044901 | Unclassified | 826 |
| 1009 | Ga0466960_0389299 | 3300044901 | Bacteria | 801 |
| 1010 | Ga0466960_0630913 | 3300044901 | Bacteria | 638 |
| 1011 | Ga0466959_0111694 | 3300045049 | Bacteria | 1950 |
| 1012 | Ga0466959_0192441 | 3300045049 | Bacteria | 1423 |
| 1013 | Ga0466959_0296216 | 3300045049 | Bacteria | 1108 |
| 1014 | Ga0451576_0148554 | 3300045051 | Bacteria | 2444 |
| 1015 | Ga0451576_0204742 | 3300045051 | Bacteria | 2061 |
| 1016 | Ga0451576_1313640 | 3300045051 | Unclassified | 754 |
| 1017 | Ga0451576_2164806 | 3300045051 | Unclassified | 571 |
| 1018 | Ga0466958_0020190 | 3300045836 | Bacteria | 3884 |
| 1019 | Ga0466958_0361374 | 3300045836 | Bacteria | 935 |
| 1020 | Ga0466967_0065238 | 3300045976 | Bacteria | 3240 |
| 1021 | Ga0466967_0073266 | 3300045976 | Bacteria | 3072 |
| 1022 | Ga0466967_0180758 | 3300045976 | Bacteria | 1989 |
| 1023 | Ga0466967_0475316 | 3300045976 | Bacteria | 1224 |
| 1024 | Ga0466967_1025246 | 3300045976 | Bacteria | 822 |
| 1025 | Ga0495592_0717671 | 3300046454 | Archaea | 600 |
| 1026 | Ga0495603_0000081 | 3300046455 | Bacteria | 42501 |
| 1027 | Ga0495603_0188052 | 3300046455 | Unclassified | 1194 |
| 1028 | Ga0495603_0258146 | 3300046455 | Bacteria | 1003 |
| 1029 | Ga0495641_0003826 | 3300046461 | Bacteria | 10997 |
| 1030 | Ga0495641_0035403 | 3300046461 | Bacteria | 2354 |
| 1031 | Ga0495580_0349545 | 3300046472 | Unclassified | 1002 |
| 1032 | Ga0495582_0165072 | 3300046473 | Bacteria | 1260 |
| 1033 | Ga0495605_0023019 | 3300046474 | Bacteria | 3282 |
| 1034 | Ga0495605_0050247 | 3300046474 | Bacteria | 2035 |
| 1035 | Ga0495605_0104950 | 3300046474 | Bacteria | 1295 |
| 1036 | Ga0495605_0138218 | 3300046474 | Bacteria | 1095 |
| 1037 | Ga0495605_0143667 | 3300046474 | Bacteria | 1069 |
| 1038 | Ga0495639_0072725 | 3300046475 | Bacteria | 1590 |
| 1039 | Ga0495584_0029628 | 3300046491 | Bacteria | 2775 |
| 1040 | Ga0495584_0150972 | 3300046491 | Bacteria | 1180 |
| 1041 | Ga0495584_0267847 | 3300046491 | Bacteria | 868 |
| 1042 | Ga0495584_0274749 | 3300046491 | Unclassified | 856 |
| 1043 | Ga0495584_0467788 | 3300046491 | Unclassified | 642 |
| 1044 | Ga0495584_0687324 | 3300046491 | Bacteria | 522 |
| 1045 | Ga0495585_0167026 | 3300046492 | Unclassified | 1139 |
| 1046 | Ga0495594_0000307 | 3300046499 | Bacteria | 24065 |
| 1047 | Ga0495596_0059567 | 3300046500 | Bacteria | 1488 |
| 1048 | Ga0495596_0090141 | 3300046500 | Bacteria | 1190 |
| 1049 | Ga0495583_0136470 | 3300046506 | Unclassified | 1024 |
| 1050 | Ga0495616_0064042 | 3300046513 | Bacteria | 1795 |
| 1051 | Ga0495616_0084325 | 3300046513 | Bacteria | 1515 |
| 1052 | Ga0495630_0047100 | 3300046517 | Bacteria | 3224 |
| 1053 | Ga0495630_0210783 | 3300046517 | Bacteria | 1483 |
| 1054 | Ga0495630_0271128 | 3300046517 | Bacteria | 1297 |
| 1055 | Ga0495630_0285681 | 3300046517 | Bacteria | 1260 |
| 1056 | Ga0495631_0307634 | 3300046518 | Unclassified | 674 |
| 1057 | Ga0495631_0397354 | 3300046518 | Bacteria | 587 |
| 1058 | Ga0495637_0099539 | 3300046520 | Unclassified | 1138 |
| 1059 | Ga0495637_0220124 | 3300046520 | Bacteria | 691 |
| 1060 | Ga0495644_0156525 | 3300046523 | Unclassified | 873 |
| 1061 | Ga0495663_0012292 | 3300046525 | Bacteria | 2386 |
| 1062 | Ga0495663_0099889 | 3300046525 | Unclassified | 954 |
| 1063 | Ga0495663_0160878 | 3300046525 | Bacteria | 770 |
| 1064 | Ga0495666_0007871 | 3300046526 | Bacteria | 5338 |
| 1065 | Ga0495642_0021874 | 3300046528 | Bacteria | 2517 |
| 1066 | Ga0495642_0109330 | 3300046528 | Bacteria | 1181 |
| 1067 | Ga0495642_0120457 | 3300046528 | Bacteria | 1126 |
| 1068 | Ga0495642_0522668 | 3300046528 | Bacteria | 526 |
| 1069 | Ga0495654_0249553 | 3300046530 | Unclassified | 740 |
| 1070 | Ga0495665_0055694 | 3300046531 | Bacteria | 2088 |
| 1071 | Ga0495598_0202370 | 3300046537 | Unclassified | 718 |
| 1072 | Ga0495609_0120468 | 3300046538 | Bacteria | 1128 |
| 1073 | Ga0495609_0125780 | 3300046538 | Bacteria | 1100 |
| 1074 | Ga0495609_0289395 | 3300046538 | Bacteria | 669 |
| 1075 | Ga0495656_0021635 | 3300046615 | Bacteria | 2506 |
| 1076 | Ga0495656_0159202 | 3300046615 | Bacteria | 1096 |
| 1077 | Ga0495656_0308243 | 3300046615 | Unclassified | 813 |
| 1078 | Ga0495668_0051443 | 3300046616 | Bacteria | 2281 |
| 1079 | Ga0495668_0713824 | 3300046616 | Unclassified | 555 |
| 1080 | Ga0495611_0114409 | 3300046648 | Bacteria | 1257 |
| 1081 | Ga0495611_0474427 | 3300046648 | Unclassified | 569 |
| 1082 | Ga0495635_0220333 | 3300046663 | Bacteria | 1283 |
| 1083 | Ga0495659_0075246 | 3300046664 | Bacteria | 1272 |
| 1084 | Ga0495659_0124975 | 3300046664 | Bacteria | 1016 |
| 1085 | Ga0495659_0270981 | 3300046664 | Bacteria | 711 |
| 1086 | Ga0495659_0346160 | 3300046664 | Unclassified | 634 |
| 1087 | Ga0495661_0360603 | 3300046665 | Unclassified | 714 |
| 1088 | Ga0495588_0001033 | 3300046674 | Bacteria | 12111 |
| 1089 | Ga0495588_0243944 | 3300046674 | Unclassified | 947 |
| 1090 | Ga0495647_0017415 | 3300046681 | Bacteria | 2542 |
| 1091 | Ga0495647_0062545 | 3300046681 | Bacteria | 1472 |
| 1092 | Ga0495658_0105872 | 3300046683 | Bacteria | 1685 |
| 1093 | Ga0495658_0413230 | 3300046683 | Bacteria | 861 |
| 1094 | Ga0495658_0750194 | 3300046683 | Bacteria | 625 |
| 1095 | Ga0495670_0198029 | 3300046691 | Unclassified | 1063 |
| 1096 | Ga0495670_0304280 | 3300046691 | Bacteria | 855 |
| 1097 | Ga0495671_0141170 | 3300046692 | Bacteria | 1174 |
| 1098 | Ga0495671_0165160 | 3300046692 | Bacteria | 1077 |
| 1099 | Ga0495589_0093005 | 3300046794 | Unclassified | 1464 |
| 1100 | Ga0495589_0120612 | 3300046794 | Bacteria | 1263 |
| 1101 | Ga0495589_0142604 | 3300046794 | Bacteria | 1147 |
| 1102 | Ga0495589_0176138 | 3300046794 | Bacteria | 1016 |
| 1103 | Ga0495589_0193396 | 3300046794 | Bacteria | 962 |
| 1104 | Ga0495600_0240509 | 3300046809 | Bacteria | 1154 |
| 1105 | Ga0495660_0330879 | 3300046810 | Bacteria | 682 |
| 1106 | Ga0495581_0033481 | 3300047315 | Bacteria | 2974 |
| 1107 | Ga0495581_0134370 | 3300047315 | Unclassified | 1442 |
| 1108 | Ga0495581_0309913 | 3300047315 | Bacteria | 922 |
| 1109 | Ga0495604_0706902 | 3300047317 | Bacteria | 640 |
| 1110 | Ga0495604_0892693 | 3300047317 | Bacteria | 556 |
| 1111 | Ga0495674_0689238 | 3300047319 | Bacteria | 803 |
| 1112 | Ga0495676_0004078 | 3300047321 | Bacteria | 13311 |
| 1113 | Ga0495676_0047807 | 3300047321 | Bacteria | 3455 |
| 1114 | Ga0495676_0068170 | 3300047321 | Bacteria | 2750 |
| 1115 | Ga0495676_0753182 | 3300047321 | Bacteria | 629 |
| 1116 | Ga0495683_0132957 | 3300047323 | Unclassified | 1172 |
| 1117 | Ga0495683_0137812 | 3300047323 | Bacteria | 1146 |
| 1118 | Ga0495679_070677 | 3300047446 | Unclassified | 1006 |
| 1119 | Ga0495679_126618 | 3300047446 | Unclassified | 695 |
| 1120 | Ga0495602_0258315 | 3300048088 | Bacteria | 1294 |
| 1121 | Ga0495602_0668633 | 3300048088 | Bacteria | 708 |
| 1122 | Ga0495626_0230681 | 3300048091 | Unclassified | 749 |
| 1123 | Ga0495626_0246477 | 3300048091 | Unclassified | 718 |
| 1124 | Ga0496100_0007377 | 3300048903 | Bacteria | 6063 |
| 1125 | Ga0496100_0009219 | 3300048903 | Bacteria | 5538 |
| 1126 | Ga0496100_0094399 | 3300048903 | Bacteria | 2049 |
| 1127 | Ga0496100_0182188 | 3300048903 | Bacteria | 1519 |
| 1128 | Ga0496100_0299854 | 3300048903 | Bacteria | 1202 |
| 1129 | Ga0496100_0559705 | 3300048903 | Bacteria | 885 |
| 1130 | Ga0496100_0743459 | 3300048903 | Unclassified | 767 |
| 1131 | Ga0496100_1548704 | 3300048903 | Unclassified | 524 |
| 1132 | Ga0496101_0002103 | 3300048904 | Bacteria | 12138 |
| 1133 | Ga0496101_0029183 | 3300048904 | Bacteria | 3858 |
| 1134 | Ga0496101_0078649 | 3300048904 | Unclassified | 2433 |
| 1135 | Ga0496101_0211505 | 3300048904 | Bacteria | 1502 |
| 1136 | Ga0496101_0327336 | 3300048904 | Bacteria | 1202 |
| 1137 | Ga0496101_0625234 | 3300048904 | Bacteria | 851 |
| 1138 | Ga0496101_0674625 | 3300048904 | Bacteria | 816 |
| 1139 | Ga0496101_0721210 | 3300048904 | Bacteria | 787 |
| 1140 | Ga0496101_1010773 | 3300048904 | Bacteria | 654 |
| 1141 | Ga0496102_0013820 | 3300048905 | Bacteria | 7006 |
| 1142 | Ga0496102_0050210 | 3300048905 | Bacteria | 3797 |
| 1143 | Ga0496102_0198984 | 3300048905 | Bacteria | 1888 |
| 1144 | Ga0496102_0269575 | 3300048905 | Bacteria | 1605 |
| 1145 | Ga0496102_0380170 | 3300048905 | Bacteria | 1329 |
| 1146 | Ga0496102_0487945 | 3300048905 | Unclassified | 1154 |
| 1147 | Ga0496102_1015854 | 3300048905 | Bacteria | 750 |
| 1148 | Ga0496103_0030702 | 3300048906 | Archaea | 3271 |
| 1149 | Ga0496103_0071231 | 3300048906 | Bacteria | 2175 |
| 1150 | Ga0496103_0078196 | 3300048906 | Bacteria | 2077 |
| 1151 | Ga0496103_0183524 | 3300048906 | Bacteria | 1345 |
| 1152 | Ga0496103_0200777 | 3300048906 | Bacteria | 1282 |
| 1153 | Ga0496103_1036078 | 3300048906 | Bacteria | 510 |
| 1154 | Ga0496104_0000584 | 3300048907 | Bacteria | 31102 |
| 1155 | Ga0496104_0041334 | 3300048907 | Archaea | 4323 |
| 1156 | Ga0496104_0044880 | 3300048907 | Bacteria | 4154 |
| 1157 | Ga0496104_0227856 | 3300048907 | Bacteria | 1776 |
| 1158 | Ga0496104_0428200 | 3300048907 | Bacteria | 1235 |
| 1159 | Ga0496104_1005166 | 3300048907 | Unclassified | 738 |
| 1160 | Ga0496105_0003054 | 3300048908 | Bacteria | 12300 |
| 1161 | Ga0496105_0011626 | 3300048908 | Bacteria | 6964 |
| 1162 | Ga0496105_0037996 | 3300048908 | Bacteria | 3966 |
| 1163 | Ga0496105_0081251 | 3300048908 | Bacteria | 2677 |
| 1164 | Ga0496105_0103234 | 3300048908 | Bacteria | 2354 |
| 1165 | Ga0496105_0109809 | 3300048908 | Bacteria | 2277 |
| 1166 | Ga0496106_0028268 | 3300048909 | Bacteria | 4176 |
| 1167 | Ga0496106_0115148 | 3300048909 | Bacteria | 2096 |
| 1168 | Ga0496106_0138204 | 3300048909 | Bacteria | 1915 |
| 1169 | Ga0496106_0174792 | 3300048909 | Bacteria | 1703 |
| 1170 | Ga0496106_0598900 | 3300048909 | Unclassified | 883 |
| 1171 | Ga0496106_0650374 | 3300048909 | Bacteria | 842 |
| 1172 | Ga0496106_0659127 | 3300048909 | Bacteria | 836 |
| 1173 | Ga0496107_0004908 | 3300048910 | Bacteria | 9092 |
| 1174 | Ga0496107_0022326 | 3300048910 | Bacteria | 4472 |
| 1175 | Ga0496107_0032156 | 3300048910 | Bacteria | 3749 |
| 1176 | Ga0496107_0149041 | 3300048910 | Unclassified | 1730 |
| 1177 | Ga0496107_0280587 | 3300048910 | Bacteria | 1240 |
| 1178 | Ga0496108_0004843 | 3300048911 | Bacteria | 10862 |
| 1179 | Ga0496108_0021690 | 3300048911 | Bacteria | 5280 |
| 1180 | Ga0496108_0028435 | 3300048911 | Bacteria | 4626 |
| 1181 | Ga0496108_0054920 | 3300048911 | Bacteria | 3343 |
| 1182 | Ga0496108_0070458 | 3300048911 | Bacteria | 2950 |
| 1183 | Ga0496108_0159892 | 3300048911 | Bacteria | 1946 |
| 1184 | Ga0496108_0250905 | 3300048911 | Unclassified | 1539 |
| 1185 | Ga0496108_0329368 | 3300048911 | Bacteria | 1332 |
| 1186 | Ga0496108_0479185 | 3300048911 | Bacteria | 1087 |
| 1187 | Ga0496108_0657737 | 3300048911 | Bacteria | 911 |
| 1188 | Ga0496109_0005961 | 3300048912 | Bacteria | 10233 |
| 1189 | Ga0496109_0007456 | 3300048912 | Bacteria | 9261 |
| 1190 | Ga0496109_0010340 | 3300048912 | Bacteria | 7970 |
| 1191 | Ga0496109_0037837 | 3300048912 | Bacteria | 4360 |
| 1192 | Ga0496109_0077215 | 3300048912 | Bacteria | 3064 |
| 1193 | Ga0496109_0083134 | 3300048912 | Unclassified | 2952 |
| 1194 | Ga0496109_0093225 | 3300048912 | Bacteria | 2787 |
| 1195 | Ga0496109_0128380 | 3300048912 | Bacteria | 2365 |
| 1196 | Ga0496109_0280480 | 3300048912 | Bacteria | 1570 |
| 1197 | Ga0496109_0462953 | 3300048912 | Bacteria | 1197 |
| 1198 | Ga0496109_0557047 | 3300048912 | Bacteria | 1081 |
| 1199 | Ga0496109_0719688 | 3300048912 | Bacteria | 936 |
| 1200 | Ga0496109_1018558 | 3300048912 | Bacteria | 766 |
| 1201 | Ga0496110_0000277 | 3300048913 | Bacteria | 33321 |
| 1202 | Ga0496110_0024958 | 3300048913 | Bacteria | 5102 |
| 1203 | Ga0496110_0040205 | 3300048913 | Bacteria | 4075 |
| 1204 | Ga0496110_0064768 | 3300048913 | Bacteria | 3231 |
| 1205 | Ga0496110_0067059 | 3300048913 | Bacteria | 3175 |
| 1206 | Ga0496110_0196361 | 3300048913 | Bacteria | 1833 |
| 1207 | Ga0496110_0198318 | 3300048913 | Bacteria | 1823 |
| 1208 | Ga0496110_0275587 | 3300048913 | Bacteria | 1532 |
| 1209 | Ga0496110_0288688 | 3300048913 | Bacteria | 1494 |
| 1210 | Ga0496110_0338861 | 3300048913 | Bacteria | 1370 |
| 1211 | Ga0496110_0397319 | 3300048913 | Unclassified | 1257 |
| 1212 | Ga0496110_0809496 | 3300048913 | Bacteria | 841 |
| 1213 | Ga0496110_0881807 | 3300048913 | Bacteria | 800 |
| 1214 | Ga0496111_0000676 | 3300048914 | Bacteria | 17925 |
| 1215 | Ga0496111_0005855 | 3300048914 | Bacteria | 7928 |
| 1216 | Ga0496111_0010107 | 3300048914 | Bacteria | 6318 |
| 1217 | Ga0496111_0012451 | 3300048914 | Bacteria | 5759 |
| 1218 | Ga0496111_0036718 | 3300048914 | Bacteria | 3505 |
| 1219 | Ga0496111_0114490 | 3300048914 | Bacteria | 1988 |
| 1220 | Ga0496111_0194115 | 3300048914 | Bacteria | 1509 |
| 1221 | Ga0496111_0228680 | 3300048914 | Bacteria | 1382 |
| 1222 | Ga0496111_0361321 | 3300048914 | Bacteria | 1074 |
| 1223 | Ga0496111_0676710 | 3300048914 | Bacteria | 752 |
| 1224 | Ga0496112_0000434 | 3300048915 | Bacteria | 27667 |
| 1225 | Ga0496112_0001332 | 3300048915 | Bacteria | 18774 |
| 1226 | Ga0496112_0081758 | 3300048915 | Bacteria | 3195 |
| 1227 | Ga0496112_0089043 | 3300048915 | Bacteria | 3054 |
| 1228 | Ga0496112_0112397 | 3300048915 | Bacteria | 2694 |
| 1229 | Ga0496112_0199560 | 3300048915 | Bacteria | 1960 |
| 1230 | Ga0496112_0395399 | 3300048915 | Archaea | 1322 |
| 1231 | Ga0496112_0549638 | 3300048915 | Bacteria | 1088 |
| 1232 | Ga0496112_0610270 | 3300048915 | Bacteria | 1022 |
| 1233 | Ga0496112_1101134 | 3300048915 | Bacteria | 712 |
| 1234 | Ga0496112_1168491 | 3300048915 | Bacteria | 687 |
| 1235 | Ga0496112_1512916 | 3300048915 | Bacteria | 585 |
| 1236 | Ga0496113_0002971 | 3300048916 | Bacteria | 10030 |
| 1237 | Ga0496113_0014924 | 3300048916 | Bacteria | 5317 |
| 1238 | Ga0496113_0019937 | 3300048916 | Bacteria | 4703 |
| 1239 | Ga0496113_0050905 | 3300048916 | Bacteria | 3089 |
| 1240 | Ga0496113_0165666 | 3300048916 | Bacteria | 1749 |
| 1241 | Ga0496113_0166080 | 3300048916 | Bacteria | 1746 |
| 1242 | Ga0496113_0184703 | 3300048916 | Bacteria | 1653 |
| 1243 | Ga0496113_0277967 | 3300048916 | Bacteria | 1338 |
| 1244 | Ga0496113_0452065 | 3300048916 | Bacteria | 1032 |
| 1245 | Ga0496113_0485510 | 3300048916 | Unclassified | 992 |
| 1246 | Ga0496114_0004422 | 3300048917 | Bacteria | 10907 |
| 1247 | Ga0496114_0015083 | 3300048917 | Bacteria | 6213 |
| 1248 | Ga0496114_0022506 | 3300048917 | Bacteria | 5137 |
| 1249 | Ga0496114_0108447 | 3300048917 | Bacteria | 2377 |
| 1250 | Ga0496114_0119330 | 3300048917 | Bacteria | 2267 |
| 1251 | Ga0496114_0125811 | 3300048917 | Bacteria | 2209 |
| 1252 | Ga0496114_0206185 | 3300048917 | Bacteria | 1723 |
| 1253 | Ga0496114_0463550 | 3300048917 | Bacteria | 1122 |
| 1254 | Ga0496114_0595974 | 3300048917 | Bacteria | 975 |
| 1255 | Ga0496114_0718716 | 3300048917 | Bacteria | 875 |
| 1256 | Ga0496115_0015485 | 3300048918 | Bacteria | 5785 |
| 1257 | Ga0496115_0033327 | 3300048918 | Bacteria | 4066 |
| 1258 | Ga0496115_0038699 | 3300048918 | Bacteria | 3785 |
| 1259 | Ga0496115_0065990 | 3300048918 | Bacteria | 2924 |
| 1260 | Ga0496115_0237466 | 3300048918 | Bacteria | 1502 |
| 1261 | Ga0496115_0353056 | 3300048918 | Bacteria | 1199 |
| 1262 | Ga0496115_0551889 | 3300048918 | Bacteria | 921 |
| 1263 | Ga0496115_0574919 | 3300048918 | Archaea | 898 |
| 1264 | Ga0501031_0005847 | 3300049568 | Bacteria | 8015 |
| 1265 | Ga0501031_0040078 | 3300049568 | Bacteria | 3058 |
| 1266 | Ga0501031_0042795 | 3300049568 | Bacteria | 2956 |
| 1267 | Ga0501031_0183095 | 3300049568 | Bacteria | 1368 |
| 1268 | Ga0501031_0226484 | 3300049568 | Bacteria | 1217 |
| 1269 | Ga0501032_0003181 | 3300049569 | Bacteria | 12640 |
| 1270 | Ga0501032_0197258 | 3300049569 | Bacteria | 1314 |
| 1271 | Ga0501033_0003631 | 3300049570 | Bacteria | 12582 |
| 1272 | Ga0501033_0090759 | 3300049570 | Bacteria | 2235 |
| 1273 | Ga0501033_0146044 | 3300049570 | Bacteria | 1708 |
| 1274 | Ga0501033_0213796 | 3300049570 | Bacteria | 1374 |
| 1275 | Ga0501034_0027634 | 3300049571 | Bacteria | 5770 |
| 1276 | Ga0501034_0414420 | 3300049571 | Unclassified | 1269 |
| 1277 | Ga0501036_0018221 | 3300049572 | Bacteria | 5879 |
| 1278 | Ga0501036_0053357 | 3300049572 | Bacteria | 3424 |
| 1279 | Ga0501036_0123710 | 3300049572 | Bacteria | 2184 |
| 1280 | Ga0501036_0145466 | 3300049572 | Bacteria | 1999 |
| 1281 | Ga0501036_1505648 | 3300049572 | Bacteria | 544 |
| 1282 | Ga0501037_0005371 | 3300049573 | Bacteria | 9325 |
| 1283 | Ga0501037_0014431 | 3300049573 | Bacteria | 5815 |
| 1284 | Ga0501038_0019492 | 3300049574 | Bacteria | 6113 |
| 1285 | Ga0501038_0044651 | 3300049574 | Bacteria | 3848 |
| 1286 | Ga0501038_0163136 | 3300049574 | Bacteria | 1809 |
| 1287 | Ga0501038_0416856 | 3300049574 | Bacteria | 1037 |
| 1288 | Ga0501038_0502671 | 3300049574 | Bacteria | 927 |
| 1289 | Ga0501039_0006661 | 3300049575 | Bacteria | 8778 |
| 1290 | Ga0501039_0020432 | 3300049575 | Bacteria | 5075 |
| 1291 | Ga0501039_0037336 | 3300049575 | Bacteria | 3749 |
| 1292 | Ga0501039_0200224 | 3300049575 | Bacteria | 1570 |
| 1293 | Ga0501039_0552365 | 3300049575 | Bacteria | 904 |
| 1294 | Ga0501039_0669645 | 3300049575 | Bacteria | 812 |
| 1295 | Ga0501039_0754384 | 3300049575 | Bacteria | 760 |
| 1296 | Ga0501039_1250734 | 3300049575 | Unclassified | 573 |
| 1297 | Ga0501040_0016156 | 3300049576 | Bacteria | 4936 |
| 1298 | Ga0501040_0102911 | 3300049576 | Bacteria | 1993 |
| 1299 | Ga0501040_0123069 | 3300049576 | Bacteria | 1821 |
| 1300 | Ga0501040_0130177 | 3300049576 | Bacteria | 1769 |
| 1301 | Ga0501040_0328705 | 3300049576 | Unclassified | 1094 |
| 1302 | Ga0501040_0338884 | 3300049576 | Bacteria | 1076 |
| 1303 | Ga0501040_0803995 | 3300049576 | Bacteria | 680 |
| 1304 | Ga0501041_0013404 | 3300049577 | Bacteria | 4858 |
| 1305 | Ga0501041_0076253 | 3300049577 | Bacteria | 2062 |
| 1306 | Ga0501041_0107328 | 3300049577 | Bacteria | 1731 |
| 1307 | Ga0501041_0398556 | 3300049577 | Bacteria | 871 |
| 1308 | Ga0501042_0010417 | 3300049578 | Bacteria | 6234 |
| 1309 | Ga0501042_0019226 | 3300049578 | Bacteria | 4741 |
| 1310 | Ga0501042_0029262 | 3300049578 | Bacteria | 3884 |
| 1311 | Ga0501042_0030665 | 3300049578 | Bacteria | 3800 |
| 1312 | Ga0501042_0091720 | 3300049578 | Bacteria | 2181 |
| 1313 | Ga0501042_0272242 | 3300049578 | Bacteria | 1223 |
| 1314 | Ga0501042_0323432 | 3300049578 | Bacteria | 1114 |
| 1315 | Ga0501042_0950031 | 3300049578 | Bacteria | 626 |
| 1316 | Ga0501042_0958007 | 3300049578 | Bacteria | 623 |
| 1317 | Ga0501043_0014107 | 3300049579 | Bacteria | 6251 |
| 1318 | Ga0501043_0028485 | 3300049579 | Bacteria | 4385 |
| 1319 | Ga0501043_0530761 | 3300049579 | Bacteria | 876 |
| 1320 | Ga0501046_0013235 | 3300049580 | Bacteria | 6991 |
| 1321 | Ga0501046_0017331 | 3300049580 | Bacteria | 6014 |
| 1322 | Ga0501046_0423826 | 3300049580 | Bacteria | 959 |
| 1323 | Ga0501047_0031837 | 3300049581 | Bacteria | 5089 |
| 1324 | Ga0501048_0008057 | 3300049582 | Bacteria | 7980 |
| 1325 | Ga0501048_0008511 | 3300049582 | Bacteria | 7756 |
| 1326 | Ga0501048_0185977 | 3300049582 | Bacteria | 1472 |
| 1327 | Ga0501067_0015893 | 3300049583 | Bacteria | 4163 |
| 1328 | Ga0501067_0160142 | 3300049583 | Bacteria | 1253 |
| 1329 | Ga0501068_0001367 | 3300049584 | Bacteria | 12953 |
| 1330 | Ga0501068_0007185 | 3300049584 | Bacteria | 6168 |
| 1331 | Ga0501068_0028085 | 3300049584 | Bacteria | 3325 |
| 1332 | Ga0501068_0083302 | 3300049584 | Bacteria | 1965 |
| 1333 | Ga0501068_0196367 | 3300049584 | Unclassified | 1279 |
| 1334 | Ga0501068_0330152 | 3300049584 | Bacteria | 978 |
| 1335 | Ga0501069_0005535 | 3300049585 | Bacteria | 6574 |
| 1336 | Ga0501069_0010559 | 3300049585 | Bacteria | 4891 |
| 1337 | Ga0501069_0067767 | 3300049585 | Bacteria | 1997 |
| 1338 | Ga0501069_0134542 | 3300049585 | Bacteria | 1416 |
| 1339 | Ga0501070_0065677 | 3300049586 | Bacteria | 3004 |
| 1340 | Ga0501070_0173529 | 3300049586 | Bacteria | 1775 |
| 1341 | Ga0501070_0531025 | 3300049586 | Bacteria | 943 |
| 1342 | Ga0501070_1178742 | 3300049586 | Bacteria | 588 |
| 1343 | Ga0501071_0003656 | 3300049587 | Bacteria | 9649 |
| 1344 | Ga0501071_0007072 | 3300049587 | Bacteria | 7332 |
| 1345 | Ga0501071_0042051 | 3300049587 | Bacteria | 3272 |
| 1346 | Ga0501071_0083783 | 3300049587 | Bacteria | 2336 |
| 1347 | Ga0501071_0385247 | 3300049587 | Bacteria | 1069 |
| 1348 | Ga0501071_0508468 | 3300049587 | Bacteria | 924 |
| 1349 | Ga0501071_0745571 | 3300049587 | Bacteria | 754 |
| 1350 | Ga0501071_0943612 | 3300049587 | Bacteria | 666 |
| 1351 | Ga0501072_0008341 | 3300049588 | Bacteria | 7868 |
| 1352 | Ga0501072_0012103 | 3300049588 | Bacteria | 6592 |
| 1353 | Ga0501072_0018673 | 3300049588 | Bacteria | 5345 |
| 1354 | Ga0501072_0019083 | 3300049588 | Bacteria | 5295 |
| 1355 | Ga0501072_0080255 | 3300049588 | Bacteria | 2584 |
| 1356 | Ga0501072_0146259 | 3300049588 | Bacteria | 1884 |
| 1357 | Ga0501072_0213515 | 3300049588 | Bacteria | 1538 |
| 1358 | Ga0501072_0309095 | 3300049588 | Bacteria | 1257 |
| 1359 | Ga0501072_0342783 | 3300049588 | Bacteria | 1187 |
| 1360 | Ga0501072_0633013 | 3300049588 | Bacteria | 842 |
| 1361 | Ga0501072_0803996 | 3300049588 | Unclassified | 736 |
| 1362 | Ga0501073_0026968 | 3300049589 | Bacteria | 4112 |
| 1363 | Ga0501073_0231813 | 3300049589 | Bacteria | 1275 |
| 1364 | Ga0501073_0349445 | 3300049589 | Bacteria | 1021 |
| 1365 | Ga0501073_1006698 | 3300049589 | Bacteria | 573 |
| 1366 | Ga0501074_0086741 | 3300049590 | Bacteria | 2242 |
| 1367 | Ga0501074_0106265 | 3300049590 | Bacteria | 2009 |
| 1368 | Ga0501074_0132367 | 3300049590 | Bacteria | 1784 |
| 1369 | Ga0501074_0199165 | 3300049590 | Bacteria | 1427 |
| 1370 | Ga0501074_0449178 | 3300049590 | Bacteria | 914 |
| 1371 | Ga0501074_0613112 | 3300049590 | Unclassified | 769 |
| 1372 | Ga0501075_0008156 | 3300049591 | Bacteria | 7290 |
| 1373 | Ga0501075_0016438 | 3300049591 | Bacteria | 5331 |
| 1374 | Ga0501075_0035375 | 3300049591 | Bacteria | 3724 |
| 1375 | Ga0501075_0046038 | 3300049591 | Bacteria | 3277 |
| 1376 | Ga0501075_0051526 | 3300049591 | Bacteria | 3095 |
| 1377 | Ga0501075_0129176 | 3300049591 | Bacteria | 1925 |
| 1378 | Ga0501076_0009449 | 3300049592 | Bacteria | 7202 |
| 1379 | Ga0501076_0010440 | 3300049592 | Bacteria | 6896 |
| 1380 | Ga0501076_0036137 | 3300049592 | Bacteria | 3869 |
| 1381 | Ga0501076_0079464 | 3300049592 | Bacteria | 2632 |
| 1382 | Ga0501076_0086960 | 3300049592 | Bacteria | 2512 |
| 1383 | Ga0501076_0112029 | 3300049592 | Bacteria | 2206 |
| 1384 | Ga0501076_0305484 | 3300049592 | Bacteria | 1304 |
| 1385 | Ga0501077_0003076 | 3300049593 | Bacteria | 10023 |
| 1386 | Ga0501077_0003918 | 3300049593 | Bacteria | 8964 |
| 1387 | Ga0501077_0006605 | 3300049593 | Bacteria | 7119 |
| 1388 | Ga0501077_0049104 | 3300049593 | Bacteria | 2681 |
| 1389 | Ga0501077_0087686 | 3300049593 | Bacteria | 1972 |
| 1390 | Ga0501077_0701709 | 3300049593 | Bacteria | 650 |
| 1391 | Ga0501079_0005224 | 3300049741 | Bacteria | 9649 |
| 1392 | Ga0501079_0014622 | 3300049741 | Bacteria | 5985 |
| 1393 | Ga0501079_0039043 | 3300049741 | Bacteria | 3661 |
| 1394 | Ga0501079_0213244 | 3300049741 | Bacteria | 1508 |
| 1395 | Ga0501079_0340475 | 3300049741 | Bacteria | 1175 |
| 1396 | Ga0501079_0389856 | 3300049741 | Bacteria | 1092 |
| 1397 | Ga0501079_0622230 | 3300049741 | Bacteria | 850 |
| 1398 | Ga0501080_0010471 | 3300049742 | Bacteria | 8489 |
| 1399 | Ga0501080_0027221 | 3300049742 | Bacteria | 5317 |
| 1400 | Ga0501080_0198282 | 3300049742 | Bacteria | 1843 |
| 1401 | Ga0501080_0239941 | 3300049742 | Bacteria | 1655 |
| 1402 | Ga0501080_0543158 | 3300049742 | Bacteria | 1036 |
| 1403 | Ga0501080_0663161 | 3300049742 | Bacteria | 922 |
| 1404 | Ga0501081_0007569 | 3300049743 | Bacteria | 7042 |
| 1405 | Ga0501081_0046709 | 3300049743 | Bacteria | 2977 |
| 1406 | Ga0501081_0049864 | 3300049743 | Bacteria | 2884 |
| 1407 | Ga0501081_0231203 | 3300049743 | Bacteria | 1347 |
| 1408 | Ga0501081_0246443 | 3300049743 | Bacteria | 1303 |
| 1409 | Ga0501081_0262901 | 3300049743 | Bacteria | 1261 |
| 1410 | Ga0501081_0494660 | 3300049743 | Bacteria | 911 |
| 1411 | Ga0501081_0542476 | 3300049743 | Unclassified | 868 |
| 1412 | Ga0501081_0551513 | 3300049743 | Bacteria | 861 |
| 1413 | Ga0501081_0682495 | 3300049743 | Bacteria | 771 |
| 1414 | Ga0501081_0811227 | 3300049743 | Unclassified | 704 |
| 1415 | Ga0501083_0008656 | 3300049744 | Bacteria | 7179 |
| 1416 | Ga0501083_0068625 | 3300049744 | Bacteria | 2359 |
| 1417 | Ga0501083_0280393 | 3300049744 | Bacteria | 1084 |
| 1418 | Ga0501265_060616 | 3300049762 | Bacteria | 617 |
| 1419 | Ga0501279_077695 | 3300049775 | Bacteria | 568 |
| 1420 | Ga0501035_0005105 | 3300049822 | Bacteria | 12434 |
| 1421 | Ga0501035_0023034 | 3300049822 | Bacteria | 5716 |
| 1422 | Ga0501035_0372520 | 3300049822 | Bacteria | 1192 |
| 1423 | Ga0501044_0055545 | 3300049823 | Bacteria | 4067 |
| 1424 | Ga0501044_0150492 | 3300049823 | Bacteria | 2310 |
| 1425 | Ga0501045_0007285 | 3300049824 | Bacteria | 7684 |
| 1426 | Ga0501045_0087443 | 3300049824 | Bacteria | 2301 |
| 1427 | Ga0501045_0111745 | 3300049824 | Bacteria | 2026 |
| 1428 | Ga0501045_0152045 | 3300049824 | Bacteria | 1722 |
| 1429 | Ga0501045_0333768 | 3300049824 | Bacteria | 1128 |
| 1430 | Ga0501045_0397798 | 3300049824 | Bacteria | 1025 |
| 1431 | nmdc:mga0yw44_212398_c1 | 3300050492 | Bacteria | 1280 |
| 1432 | nmdc:mga0yw44_255592_c1 | 3300050492 | Bacteria | 1167 |
| 1433 | nmdc:mga0yw44_40267_c1 | 3300050492 | Bacteria | 2775 |
| 1434 | nmdc:mga0yw44_50647_c1 | 3300050492 | Bacteria | 2512 |
| 1435 | nmdc:mga0yw44_678455_c1 | 3300050492 | Unclassified | 700 |
| 1436 | nmdc:mga05p37_104554_c1 | 3300050507 | Bacteria | 3484 |
| 1437 | nmdc:mga05p37_108180_c1 | 3300050507 | Bacteria | 3420 |
| 1438 | nmdc:mga05p37_1226434_c1 | 3300050507 | Bacteria | 772 |
| 1439 | nmdc:mga05p37_342792_c1 | 3300050507 | Bacteria | 1762 |
| 1440 | nmdc:mga05p37_412455_c1 | 3300050507 | Unclassified | 1574 |
| 1441 | nmdc:mga05p37_446260_c1 | 3300050507 | Unclassified | 1499 |
| 1442 | nmdc:mga05p37_718810_c1 | 3300050507 | Bacteria | 1106 |
| 1443 | nmdc:mga09592_236405_c1 | 3300050508 | Bacteria | 1583 |
| 1444 | nmdc:mga09592_444986_c1 | 3300050508 | Unclassified | 1118 |
| 1445 | nmdc:mga09592_44866_c1 | 3300050508 | Bacteria | 3722 |
| 1446 | nmdc:mga09592_528418_c1 | 3300050508 | Bacteria | 1014 |
| 1447 | nmdc:mga09592_531826_c1 | 3300050508 | Bacteria | 1010 |
| 1448 | nmdc:mga09592_771954_c1 | 3300050508 | Bacteria | 814 |
| 1449 | nmdc:mga09592_959655_c1 | 3300050508 | Bacteria | 716 |
| 1450 | nmdc:mga0qj67_178237_c1 | 3300050509 | Bacteria | 1726 |
| 1451 | nmdc:mga06r32_232795_c1 | 3300050510 | Bacteria | 1830 |
| 1452 | nmdc:mga06r32_26472_c1 | 3300050510 | Bacteria | 5407 |
| 1453 | nmdc:mga06r32_268714_c1 | 3300050510 | Bacteria | 1693 |
| 1454 | nmdc:mga06r32_353026_c1 | 3300050510 | Bacteria | 1455 |
| 1455 | nmdc:mga08y16_199057_c1 | 3300050511 | Bacteria | 2076 |
| 1456 | nmdc:mga08y16_24029_c1 | 3300050511 | Bacteria | 6436 |
| 1457 | nmdc:mga08y16_263246_c1 | 3300050511 | Bacteria | 1781 |
| 1458 | nmdc:mga08y16_33292_c1 | 3300050511 | Bacteria | 5412 |
| 1459 | nmdc:mga08y16_354689_c1 | 3300050511 | Bacteria | 1506 |
| 1460 | nmdc:mga08y16_466925_c1 | 3300050511 | Bacteria | 1285 |
| 1461 | nmdc:mga08y16_479356_c1 | 3300050511 | Bacteria | 1266 |
| 1462 | nmdc:mga08y16_488990_c1 | 3300050511 | Bacteria | 1252 |
| 1463 | nmdc:mga08y16_508159_c1 | 3300050511 | Bacteria | 1224 |
| 1464 | nmdc:mga08y16_51029_c1 | 3300050511 | Bacteria | 4328 |
| 1465 | nmdc:mga08y16_682846_c1 | 3300050511 | Unclassified | 1028 |
| 1466 | nmdc:mga08y16_72168_c1 | 3300050511 | Bacteria | 3598 |
| 1467 | nmdc:mga08y16_81682_c1 | 3300050511 | Bacteria | 3369 |
| 1468 | nmdc:mga08y16_96769_c1 | 3300050511 | Bacteria | 3074 |
| 1469 | nmdc:mga0n895_1012532_c1 | 3300050512 | Bacteria | 811 |
| 1470 | nmdc:mga0n895_11434_c1 | 3300050512 | Bacteria | 7919 |
| 1471 | nmdc:mga0n895_1627_c1 | 3300050512 | Bacteria | 16958 |
| 1472 | nmdc:mga0n895_258585_c1 | 3300050512 | Bacteria | 1767 |
| 1473 | nmdc:mga0n895_405892_c1 | 3300050512 | Bacteria | 1378 |
| 1474 | nmdc:mga0n895_754496_c1 | 3300050512 | Bacteria | 966 |
| 1475 | nmdc:mga0n895_87775_c1 | 3300050512 | Bacteria | 3109 |
| 1476 | nmdc:mga0rr50_117778_c1 | 3300050513 | Bacteria | 2110 |
| 1477 | nmdc:mga0rr50_162335_c1 | 3300050513 | Bacteria | 1814 |
| 1478 | nmdc:mga0rr50_206761_c1 | 3300050513 | Unclassified | 1616 |
| 1479 | nmdc:mga0rr50_301600_c1 | 3300050513 | Bacteria | 1340 |
| 1480 | nmdc:mga0rr50_3028_c1 | 3300050513 | Bacteria | 9614 |
| 1481 | nmdc:mga0rr50_8967_c1 | 3300050513 | Bacteria | 6256 |
| 1482 | nmdc:mga08x19_18530_c1 | 3300050514 | Bacteria | 4266 |
| 1483 | nmdc:mga08x19_467604_c1 | 3300050514 | Bacteria | 888 |
| 1484 | nmdc:mga08x19_46825_c1 | 3300050514 | Bacteria | 2767 |
| 1485 | nmdc:mga08x19_65419_c1 | 3300050514 | Bacteria | 2361 |
| 1486 | nmdc:mga08x19_8369_c1 | 3300050514 | Bacteria | 6160 |
| 1487 | nmdc:mga08x19_859986_c1 | 3300050514 | Unclassified | 644 |
| 1488 | nmdc:mga0a205_1196_c1 | 3300050515 | Bacteria | 21690 |
| 1489 | nmdc:mga0a205_142201_c1 | 3300050515 | Bacteria | 2299 |
| 1490 | nmdc:mga0a205_183065_c1 | 3300050515 | Bacteria | 1989 |
| 1491 | nmdc:mga0a205_328258_c1 | 3300050515 | Bacteria | 1400 |
| 1492 | nmdc:mga0a205_346192_c1 | 3300050515 | Unclassified | 1354 |
| 1493 | nmdc:mga0a205_485986_c1 | 3300050515 | Unclassified | 1093 |
| 1494 | nmdc:mga0a205_85499_c1 | 3300050515 | Bacteria | 3046 |
| 1495 | Ga0495612_0139372 | 3300053078 | Bacteria | 1051 |
| 1496 | Ga0495655_0017138 | 3300053083 | Bacteria | 1573 |
| 1497 | Ga0495619_0431170 | 3300053085 | Bacteria | 909 |
| 1498 | Ga0501084_0009058 | 3300054114 | Bacteria | 8235 |
| 1499 | Ga0501084_0026876 | 3300054114 | Bacteria | 4807 |
| 1500 | Ga0501084_0040607 | 3300054114 | Bacteria | 3892 |
| 1501 | Ga0501084_0059551 | 3300054114 | Bacteria | 3196 |
| 1502 | Ga0501084_0241147 | 3300054114 | Bacteria | 1526 |
| 1503 | Ga0501084_0272920 | 3300054114 | Bacteria | 1428 |
| 1504 | Ga0501084_0475379 | 3300054114 | Bacteria | 1056 |
| 1505 | Ga0501084_0688939 | 3300054114 | Bacteria | 862 |
| 1506 | Ga0501084_0983155 | 3300054114 | Bacteria | 709 |
| 1507 | Ga0590075_003995 | 3300059424 | Bacteria | 3492 |
| 1508 | Ga0590075_086626 | 3300059424 | Unclassified | 812 |
| 1509 | Ga0590077_009077 | 3300059426 | Bacteria | 2036 |
| 1510 | Ga0590077_023594 | 3300059426 | Unclassified | 1318 |
| 1511 | Ga0590077_073003 | 3300059426 | Unclassified | 785 |
| 1512 | Ga0501082_0005543 | 3300060353 | Bacteria | 10959 |
| 1513 | Ga0501082_0018883 | 3300060353 | Bacteria | 5939 |
| 1514 | Ga0501082_0033764 | 3300060353 | Bacteria | 4413 |
| 1515 | Ga0501082_0049904 | 3300060353 | Bacteria | 3608 |
| 1516 | Ga0501082_0157280 | 3300060353 | Bacteria | 1974 |
| 1517 | Ga0501082_0584293 | 3300060353 | Bacteria | 977 |
| 1518 | Ga0501082_0896797 | 3300060353 | Bacteria | 775 |
| 1519 | Ga0501082_1201300 | 3300060353 | Bacteria | 663 |
| 1520 | Ga0501082_1305043 | 3300060353 | Bacteria | 634 |
| 1521 | Ga0466962_0016768 | 3300061719 | Bacteria | 3531 |
| 1522 | Ga0466962_0100061 | 3300061719 | Unclassified | 1392 |
| 1523 | Ga0530510_0035868 | 3300061734 | Bacteria | 3575 |
| 1524 | Ga0530510_0395116 | 3300061734 | Bacteria | 1042 |
| 1525 | Ga0530510_0443566 | 3300061734 | Bacteria | 981 |
| 1526 | Ga0530510_1176402 | 3300061734 | Bacteria | 588 |
| 1527 | Ga0075434_100256131 | |||
| 1528 | JGI24743J22301_10010841 | |||
| 1529 | JGI24745J21846_1043417 | |||
| 1530 | JGI24749J21850_1012296 | |||
| 1531 | JGI24744J21845_10047793 | |||
| 1532 | JGI24034J26672_10064824 | |||
| 1533 | JGI24742J22300_10007594 | |||
| 1534 | JGI24751J29686_10020412 | |||
| 1535 | Ga0070658_10248202 | |||
| 1536 | Ga0070676_10218216 | |||
| 1537 | Ga0070676_11130895 | |||
| 1538 | Ga0070683_100046479 | |||
| 1539 | Ga0070683_100106976 | |||
| 1540 | Ga0070683_100179331 | |||
| 1541 | Ga0070683_100579252 | |||
| 1542 | Ga0070690_100101444 | |||
| 1543 | Ga0070690_100402220 | |||
| 1544 | Ga0070670_100029151 | |||
| 1545 | Ga0070670_100259835 | |||
| 1546 | Ga0070670_100292769 | |||
| 1547 | Ga0070670_101206496 | |||
| 1548 | Ga0070677_10160055 | |||
| 1549 | Ga0070666_10406974 | |||
| 1550 | Ga0070680_100065165 | |||
| 1551 | Ga0070680_100709580 | |||
| 1552 | Ga0070680_101723480 | |||
| 1553 | Ga0070682_100008552 | |||
| 1554 | Ga0068868_100012777 | |||
| 1555 | Ga0068868_100022899 | |||
| 1556 | Ga0068868_100035079 | |||
| 1557 | Ga0068868_100071883 | |||
| 1558 | Ga0068868_100415646 | |||
| 1559 | Ga0068868_101832619 | |||
| 1560 | Ga0068868_102401698 | |||
| 1561 | Ga0070660_100029591 | |||
| 1562 | Ga0070660_100213850 | |||
| 1563 | Ga0070689_100004985 | |||
| 1564 | Ga0070689_100146536 | |||
| 1565 | Ga0070691_10042904 | |||
| 1566 | Ga0070687_100064201 | |||
| 1567 | Ga0070687_100065601 | |||
| 1568 | Ga0070687_100122202 | |||
| 1569 | Ga0070661_100350614 | |||
| 1570 | Ga0070661_100439590 | |||
| 1571 | Ga0070692_10032483 | |||
| 1572 | Ga0070692_10346329 | |||
| 1573 | Ga0070668_100021758 | |||
| 1574 | Ga0070668_100024506 | |||
| 1575 | Ga0070668_100285165 | |||
| 1576 | Ga0070668_100443446 | |||
| 1577 | Ga0070668_100609845 | |||
| 1578 | Ga0070668_100631344 | |||
| 1579 | Ga0070668_102075267 | |||
| 1580 | Ga0070669_100180029 | |||
| 1581 | Ga0070669_100414767 | |||
| 1582 | Ga0070669_100690790 | |||
| 1583 | Ga0070675_100015610 | |||
| 1584 | Ga0070675_100382659 | |||
| 1585 | Ga0070675_100471996 | |||
| 1586 | Ga0070675_100595307 | |||
| 1587 | Ga0070675_100890013 | |||
| 1588 | Ga0070671_100014272 | |||
| 1589 | Ga0070671_100036375 | |||
| 1590 | Ga0070671_100242198 | |||
| 1591 | Ga0070671_100295555 | |||
| 1592 | Ga0070671_100896773 | |||
| 1593 | Ga0070674_100004281 | |||
| 1594 | Ga0070674_100043743 | |||
| 1595 | Ga0070674_100071663 | |||
| 1596 | Ga0070674_100205387 | |||
| 1597 | Ga0070674_100590880 | |||
| 1598 | Ga0070674_100875005 | |||
| 1599 | Ga0070674_101756821 | |||
| 1600 | Ga0070673_100031861 | |||
| 1601 | Ga0070673_100141131 | |||
| 1602 | Ga0070673_100552157 | |||
| 1603 | Ga0070688_100001495 | |||
| 1604 | Ga0070688_100003161 | |||
| 1605 | Ga0070688_100027769 | |||
| 1606 | Ga0070688_100029478 | |||
| 1607 | Ga0070659_100030294 | |||
| 1608 | Ga0070659_100034767 | |||
| 1609 | Ga0070659_100043599 | |||
| 1610 | Ga0070659_100160643 | |||
| 1611 | Ga0070667_100201187 | |||
| 1612 | Ga0070667_100257313 | |||
| 1613 | Ga0070667_100448735 | |||
| 1614 | Ga0070667_100492359 | |||
| 1615 | Ga0070667_102062573 | |||
| 1616 | Ga0070703_10056186 | |||
| 1617 | Ga0070709_10101770 | |||
| 1618 | Ga0070709_10110294 | |||
| 1619 | Ga0070709_10130372 | |||
| 1620 | Ga0070709_10358230 | |||
| 1621 | Ga0070709_10438838 | |||
| 1622 | Ga0070714_100159551 | |||
| 1623 | Ga0070714_100218017 | |||
| 1624 | Ga0070714_100536880 | |||
| 1625 | Ga0070714_100592944 | |||
| 1626 | Ga0070713_100049133 | |||
| 1627 | Ga0070713_100050037 | |||
| 1628 | Ga0070713_100138058 | |||
| 1629 | Ga0070710_10010380 | |||
| 1630 | Ga0070710_10458067 | |||
| 1631 | Ga0070701_10003269 | |||
| 1632 | Ga0070701_10016535 | |||
| 1633 | Ga0070701_10016833 | |||
| 1634 | Ga0070701_10035442 | |||
| 1635 | Ga0070701_10068570 | |||
| 1636 | Ga0070701_10524253 | |||
| 1637 | Ga0070711_100012760 | |||
| 1638 | Ga0070711_100025198 | |||
| 1639 | Ga0070711_100278350 | |||
| 1640 | Ga0070711_100664614 | |||
| 1641 | Ga0070705_100015616 | |||
| 1642 | Ga0070705_100087009 | |||
| 1643 | Ga0070705_100152535 | |||
| 1644 | Ga0070705_100202655 | |||
| 1645 | Ga0070705_100252936 | |||
| 1646 | Ga0070705_100332709 | |||
| 1647 | Ga0070705_100626081 | |||
| 1648 | Ga0070705_100634864 | |||
| 1649 | Ga0070700_100002701 | |||
| 1650 | Ga0070700_100006627 | |||
| 1651 | Ga0070700_100126264 | |||
| 1652 | Ga0070700_100141923 | |||
| 1653 | Ga0070700_101089122 | |||
| 1654 | Ga0070694_100012886 | |||
| 1655 | Ga0070694_100015105 | |||
| 1656 | Ga0070694_100303805 | |||
| 1657 | Ga0070708_100029267 | |||
| 1658 | Ga0070708_100041036 | |||
| 1659 | Ga0070708_100206206 | |||
| 1660 | Ga0070708_100264388 | |||
| 1661 | Ga0070708_100545444 | |||
| 1662 | Ga0070708_101118543 | |||
| 1663 | Ga0070663_100004611 | |||
| 1664 | Ga0070663_100025878 | |||
| 1665 | Ga0070663_100214394 | |||
| 1666 | Ga0070663_100676330 | |||
| 1667 | Ga0070678_100065453 | |||
| 1668 | Ga0070678_100104449 | |||
| 1669 | Ga0070678_100541032 | |||
| 1670 | Ga0070678_100566222 | |||
| 1671 | Ga0070678_101228358 | |||
| 1672 | Ga0070662_100006307 | |||
| 1673 | Ga0070662_100152083 | |||
| 1674 | Ga0070662_100191550 | |||
| 1675 | Ga0070662_100513406 | |||
| 1676 | Ga0070662_100601197 | |||
| 1677 | Ga0070681_10325955 | |||
| 1678 | Ga0070681_10417248 | |||
| 1679 | Ga0070681_10422047 | |||
| 1680 | Ga0070681_10808714 | |||
| 1681 | Ga0070681_11121665 | |||
| 1682 | Ga0070681_11176058 | |||
| 1683 | Ga0068867_100022787 | |||
| 1684 | Ga0068867_100079655 | |||
| 1685 | Ga0068867_100188716 | |||
| 1686 | Ga0068867_100219770 | |||
| 1687 | Ga0068867_100318065 | |||
| 1688 | Ga0068867_100636499 | |||
| 1689 | Ga0068867_101640957 | |||
| 1690 | Ga0070685_10009789 | |||
| 1691 | Ga0070685_10073045 | |||
| 1692 | Ga0070685_10122912 | |||
| 1693 | Ga0070685_10665862 | |||
| 1694 | Ga0070706_100031706 | |||
| 1695 | Ga0070706_100137357 | |||
| 1696 | Ga0070706_100178994 | |||
| 1697 | Ga0070706_101396416 | |||
| 1698 | Ga0070707_100005156 | |||
| 1699 | Ga0070707_100037476 | |||
| 1700 | Ga0070707_100045684 | |||
| 1701 | Ga0070707_100173772 | |||
| 1702 | Ga0070698_100006705 | |||
| 1703 | Ga0070698_100008530 | |||
| 1704 | Ga0070698_100759562 | |||
| 1705 | Ga0070698_101305082 | |||
| 1706 | Ga0070699_100040412 | |||
| 1707 | Ga0070699_100072136 | |||
| 1708 | Ga0070699_100129759 | |||
| 1709 | Ga0070699_100238214 | |||
| 1710 | Ga0070699_100358885 | |||
| 1711 | Ga0070679_100543347 | |||
| 1712 | Ga0070684_100008777 | |||
| 1713 | Ga0070684_100022227 | |||
| 1714 | Ga0070684_100085782 | |||
| 1715 | Ga0070684_100129299 | |||
| 1716 | Ga0070684_100376778 | |||
| 1717 | Ga0070684_100799662 | |||
| 1718 | Ga0070684_100911629 | |||
| 1719 | Ga0070684_100928344 | |||
| 1720 | Ga0070684_101459164 | |||
| 1721 | Ga0070697_100333536 | |||
| 1722 | Ga0070697_100411042 | |||
| 1723 | Ga0068853_100007124 | |||
| 1724 | Ga0068853_100175147 | |||
| 1725 | Ga0068853_101092206 | |||
| 1726 | Ga0070672_100154403 | |||
| 1727 | Ga0070686_100011152 | |||
| 1728 | Ga0070686_100024948 | |||
| 1729 | Ga0070686_100028819 | |||
| 1730 | Ga0070686_100038698 | |||
| 1731 | Ga0070686_100059773 | |||
| 1732 | Ga0070686_100520897 | |||
| 1733 | Ga0070695_100041791 | |||
| 1734 | Ga0070695_100073483 | |||
| 1735 | Ga0070695_100359855 | |||
| 1736 | Ga0070696_100043709 | |||
| 1737 | Ga0070696_100053430 | |||
| 1738 | Ga0070696_100225880 | |||
| 1739 | Ga0070693_100002537 | |||
| 1740 | Ga0070693_100014448 | |||
| 1741 | Ga0070693_100040336 | |||
| 1742 | Ga0070693_100066641 | |||
| 1743 | Ga0070693_100716707 | |||
| 1744 | Ga0070693_100755291 | |||
| 1745 | Ga0070693_101103628 | |||
| 1746 | Ga0070665_100076527 | |||
| 1747 | Ga0070665_100717680 | |||
| 1748 | Ga0070704_100070285 | |||
| 1749 | Ga0070704_100154609 | |||
| 1750 | Ga0070704_100173468 | |||
| 1751 | Ga0070704_100258801 | |||
| 1752 | Ga0070704_100262823 | |||
| 1753 | Ga0070704_100267993 | |||
| 1754 | Ga0070704_100365632 | |||
| 1755 | Ga0068855_100070620 | |||
| 1756 | Ga0068855_100099853 | |||
| 1757 | Ga0068855_100104637 | |||
| 1758 | Ga0068855_100187316 | |||
| 1759 | Ga0068855_100424434 | |||
| 1760 | Ga0068855_100536482 | |||
| 1761 | Ga0070664_100110983 | |||
| 1762 | Ga0070664_100291260 | |||
| 1763 | Ga0070664_100315790 | |||
| 1764 | Ga0070664_100430679 | |||
| 1765 | Ga0070664_101578107 | |||
| 1766 | Ga0068857_100043075 | |||
| 1767 | Ga0068857_101466281 | |||
| 1768 | Ga0068854_100106263 | |||
| 1769 | Ga0068854_100136461 | |||
| 1770 | Ga0068854_100189485 | |||
| 1771 | Ga0068854_100217001 | |||
| 1772 | Ga0068854_100457348 | |||
| 1773 | Ga0068856_100043626 | |||
| 1774 | Ga0068856_100293269 | |||
| 1775 | Ga0068856_101172968 | |||
| 1776 | Ga0068856_101624293 | |||
| 1777 | Ga0070702_100005769 | |||
| 1778 | Ga0070702_100170584 | |||
| 1779 | Ga0070702_100191971 | |||
| 1780 | Ga0070702_100239850 | |||
| 1781 | Ga0070702_101693303 | |||
| 1782 | Ga0068852_100057319 | |||
| 1783 | Ga0068852_100182238 | |||
| 1784 | Ga0068852_102377821 | |||
| 1785 | Ga0068859_100143426 | |||
| 1786 | Ga0068859_100275326 | |||
| 1787 | Ga0068859_100686596 | |||
| 1788 | Ga0068859_101172641 | |||
| 1789 | Ga0068864_100032617 | |||
| 1790 | Ga0068864_100044531 | |||
| 1791 | Ga0068864_100130598 | |||
| 1792 | Ga0068864_100621651 | |||
| 1793 | Ga0068866_10008580 | |||
| 1794 | Ga0068866_10049089 | |||
| 1795 | Ga0068866_10399327 | |||
| 1796 | Ga0068866_10759161 | |||
| 1797 | Ga0068866_10879717 | |||
| 1798 | Ga0068861_100020719 | |||
| 1799 | Ga0068861_100034543 | |||
| 1800 | Ga0068861_100058785 | |||
| 1801 | Ga0068861_100093414 | |||
| 1802 | Ga0068861_100155443 | |||
| 1803 | Ga0068861_100350368 | |||
| 1804 | Ga0068861_100351301 | |||
| 1805 | Ga0068851_10004639 | |||
| 1806 | Ga0068870_10002411 | |||
| 1807 | Ga0068870_10080998 | |||
| 1808 | Ga0068870_10776153 | |||
| 1809 | Ga0068863_100247655 | |||
| 1810 | Ga0068863_100430024 | |||
| 1811 | Ga0068863_100507572 | |||
| 1812 | Ga0068858_100012205 | |||
| 1813 | Ga0068860_100117410 | |||
| 1814 | Ga0068860_100158294 | |||
| 1815 | Ga0068860_100201266 | |||
| 1816 | Ga0068860_100515837 | |||
| 1817 | Ga0068860_100922744 | |||
| 1818 | Ga0068860_101034368 | |||
| 1819 | Ga0068860_101397184 | |||
| 1820 | Ga0068862_100141512 | |||
| 1821 | Ga0068862_100189895 | |||
| 1822 | Ga0068862_100220821 | |||
| 1823 | Ga0068862_100448624 | |||
| 1824 | Ga0068862_101368300 | |||
| 1825 | Ga0081455_10004114 | |||
| 1826 | Ga0081455_10024464 | |||
| 1827 | Ga0081455_10050772 | |||
| 1828 | Ga0081455_10170601 | |||
| 1829 | Ga0081455_10173791 | |||
| 1830 | Ga0081455_10249845 | |||
| 1831 | Ga0081455_10342795 | |||
| 1832 | Ga0081540_1001751 | |||
| 1833 | Ga0081540_1005933 | |||
| 1834 | Ga0081539_10003629 | |||
| 1835 | Ga0081539_10007824 | |||
| 1836 | Ga0070717_10004499 | |||
| 1837 | Ga0070717_10027533 | |||
| 1838 | Ga0070717_10050375 | |||
| 1839 | Ga0070717_10092524 | |||
| 1840 | Ga0070717_10369721 | |||
| 1841 | Ga0075365_10181819 | |||
| 1842 | Ga0075365_10256621 | |||
| 1843 | Ga0075365_10624394 | |||
| 1844 | Ga0075364_10025675 | |||
| 1845 | Ga0075364_10505855 | |||
| 1846 | Ga0075432_10007366 | |||
| 1847 | Ga0075432_10038258 | |||
| 1848 | Ga0075432_10101231 | |||
| 1849 | Ga0070715_10014142 | |||
| 1850 | Ga0070716_100000663 | |||
| 1851 | Ga0070716_100026835 | |||
| 1852 | Ga0070716_100517089 | |||
| 1853 | Ga0070716_100780722 | |||
| 1854 | Ga0070712_100280728 | |||
| 1855 | Ga0075427_10038165 | |||
| 1856 | Ga0097621_100140729 | |||
| 1857 | Ga0097621_100226268 | |||
| 1858 | Ga0097621_100238605 | |||
| 1859 | Ga0097621_100726520 | |||
| 1860 | Ga0068871_100038742 | |||
| 1861 | Ga0068871_100278901 | |||
| 1862 | Ga0068871_100437060 | |||
| 1863 | Ga0068871_100446537 | |||
| 1864 | Ga0075428_100025876 | |||
| 1865 | Ga0075428_100064762 | |||
| 1866 | Ga0075428_100727339 | |||
| 1867 | Ga0075430_100005301 | |||
| 1868 | Ga0075430_100407673 | |||
| 1869 | Ga0075431_100009313 | |||
| 1870 | Ga0075431_100150180 | |||
| 1871 | Ga0075431_100262961 | |||
| 1872 | Ga0075431_100361367 | |||
| 1873 | Ga0075431_100395249 | |||
| 1874 | Ga0075433_10074552 | |||
| 1875 | Ga0075434_100028252 | |||
| 1876 | Ga0075434_100222981 | |||
| 1877 | Ga0075434_100240998 | |||
| 1878 | Ga0075434_100588560 | |||
| 1879 | Ga0075434_101781791 | |||
| 1880 | Ga0075429_100027656 | |||
| 1881 | Ga0075429_100028833 | |||
| 1882 | Ga0075429_100249387 | |||
| 1883 | Ga0075429_100329618 | |||
| 1884 | Ga0075429_100460089 | |||
| 1885 | Ga0068865_100008070 | |||
| 1886 | Ga0068865_100049638 | |||
| 1887 | Ga0068865_100061453 | |||
| 1888 | Ga0068865_100114803 | |||
| 1889 | Ga0068865_100216104 | |||
| 1890 | Ga0068865_100460840 | |||
| 1891 | Ga0068865_100768938 | |||
| 1892 | Ga0097620_100143433 | |||
| 1893 | Ga0097620_100275336 | |||
| 1894 | Ga0097620_100686751 | |||
| 1895 | Ga0097620_101172540 | |||
| 1896 | Ga0075435_100002120 | |||
| 1897 | Ga0075435_100038520 | |||
| 1898 | Ga0075435_100432484 | |||
| 1899 | Ga0075435_100448504 | |||
| 1900 | Ga0075435_101490363 | |||
| 1901 | Ga0105251_10158903 | |||
| 1902 | Ga0105240_10272672 | |||
| 1903 | Ga0105240_12418306 | |||
| 1904 | Ga0111539_10001300 | |||
| 1905 | Ga0111539_10026624 | |||
| 1906 | Ga0111539_10062606 | |||
| 1907 | Ga0111539_10070924 | |||
| 1908 | Ga0111539_10086896 | |||
| 1909 | Ga0111539_10360120 | |||
| 1910 | Ga0111539_10391808 | |||
| 1911 | Ga0111539_10415259 | |||
| 1912 | Ga0111539_10613930 | |||
| 1913 | Ga0111539_10638007 | |||
| 1914 | Ga0111539_11733765 | |||
| 1915 | Ga0105245_10005009 | |||
| 1916 | Ga0105245_10006850 | |||
| 1917 | Ga0105245_10007026 | |||
| 1918 | Ga0105245_10011927 | |||
| 1919 | Ga0105245_10023010 | |||
| 1920 | Ga0105245_10029924 | |||
| 1921 | Ga0105245_10058255 | |||
| 1922 | Ga0105245_10080889 | |||
| 1923 | Ga0105245_10129850 | |||
| 1924 | Ga0105245_10155239 | |||
| 1925 | Ga0105245_10190067 | |||
| 1926 | Ga0105245_10903135 | |||
| 1927 | Ga0105245_11162393 | |||
| 1928 | Ga0105247_10038579 | |||
| 1929 | Ga0105247_10039881 | |||
| 1930 | Ga0114129_10017948 | |||
| 1931 | Ga0114129_10025388 | |||
| 1932 | Ga0114129_10221016 | |||
| 1933 | Ga0114129_10250599 | |||
| 1934 | Ga0114129_10262875 | |||
| 1935 | Ga0114129_10367673 | |||
| 1936 | Ga0114129_10427919 | |||
| 1937 | Ga0114129_10441889 | |||
| 1938 | Ga0114129_10635608 | |||
| 1939 | Ga0114129_11411463 | |||
| 1940 | Ga0114129_11588031 | |||
| 1941 | Ga0114129_11601796 | |||
| 1942 | Ga0114129_12127753 | |||
| 1943 | Ga0114129_12564375 | |||
| 1944 | Ga0114129_13474414 | |||
| 1945 | Ga0105243_10016980 | |||
| 1946 | Ga0105243_10018403 | |||
| 1947 | Ga0105243_10020309 | |||
| 1948 | Ga0105243_10120478 | |||
| 1949 | Ga0105243_10231886 | |||
| 1950 | Ga0105243_10299535 | |||
| 1951 | Ga0105243_10417362 | |||
| 1952 | Ga0105243_10578083 | |||
| 1953 | Ga0105243_11962433 | |||
| 1954 | Ga0105241_10025150 | |||
| 1955 | Ga0105241_10085677 | |||
| 1956 | Ga0105241_10194519 | |||
| 1957 | Ga0105241_10264996 | |||
| 1958 | Ga0105241_11245208 | |||
| 1959 | Ga0105242_10054489 | |||
| 1960 | Ga0105242_10057114 | |||
| 1961 | Ga0105242_10090548 | |||
| 1962 | Ga0105242_10228509 | |||
| 1963 | Ga0105242_10261080 | |||
| 1964 | Ga0105242_10275626 | |||
| 1965 | Ga0105242_10291678 | |||
| 1966 | Ga0105242_10489243 | |||
| 1967 | Ga0105242_10502618 | |||
| 1968 | Ga0105248_10059696 | |||
| 1969 | Ga0105248_10192729 | |||
| 1970 | Ga0105248_10263635 | |||
| 1971 | Ga0105248_10523506 | |||
| 1972 | Ga0105248_11227193 | |||
| 1973 | Ga0105248_12526910 | |||
| 1974 | Ga0105237_10772838 | |||
| 1975 | Ga0105238_10046555 | |||
| 1976 | Ga0105249_10022421 | |||
| 1977 | Ga0105249_10042394 | |||
| 1978 | Ga0105249_10106711 | |||
| 1979 | Ga0105249_10118880 | |||
| 1980 | Ga0105249_10155091 | |||
| 1981 | Ga0105249_10212688 | |||
| 1982 | Ga0105239_10054011 | |||
| 1983 | Ga0105239_10682275 | |||
| 1984 | Ga0105239_10772101 | |||
| 1985 | Ga0105239_11052229 | |||
| 1986 | Ga0105246_10008409 | |||
| 1987 | Ga0105246_10020264 | |||
| 1988 | Ga0105246_10032448 | |||
| 1989 | Ga0105246_10157983 | |||
| 1990 | Ga0105246_10436670 | |||
| 1991 | Ga0105246_10941796 | |||
| 1992 | Ga0157314_1005294 | |||
| 1993 | Ga0157339_1033690 | |||
| 1994 | Ga0157371_10100598 | |||
| 1995 | Ga0157371_10163072 | |||
| 1996 | Ga0157371_10214330 | |||
| 1997 | Ga0157371_11488747 | |||
| 1998 | Ga0157370_10072748 | |||
| 1999 | Ga0157369_10116690 | |||
| 2000 | Ga0157369_10328377 | |||
| 2001 | Ga0157369_10798741 | |||
| 2002 | Ga0157369_12141966 | |||
| 2003 | Ga0157374_10006679 | |||
| 2004 | Ga0157374_10090651 | |||
| 2005 | Ga0157374_10100997 | |||
| 2006 | Ga0157374_10160625 | |||
| 2007 | Ga0157374_10316502 | |||
| 2008 | Ga0157374_10581655 | |||
| 2009 | Ga0157374_12089078 | |||
| 2010 | Ga0157378_10030477 | |||
| 2011 | Ga0157378_10640768 | |||
| 2012 | Ga0157378_11096424 | |||
| 2013 | Ga0163162_10015163 | |||
| 2014 | Ga0163162_10062392 | |||
| 2015 | Ga0163162_10167749 | |||
| 2016 | Ga0163162_10817772 | |||
| 2017 | Ga0157372_10164556 | |||
| 2018 | Ga0157372_10400861 | |||
| 2019 | Ga0157372_10739771 | |||
| 2020 | Ga0157372_13366590 | |||
| 2021 | Ga0157375_10028862 | |||
| 2022 | Ga0157375_10043912 | |||
| 2023 | Ga0157375_10283694 | |||
| 2024 | Ga0157375_10362507 | |||
| 2025 | Ga0157375_10446781 | |||
| 2026 | Ga0157375_11035639 | |||
| 2027 | Ga0163163_10004711 | |||
| 2028 | Ga0163163_10005098 | |||
| 2029 | Ga0163163_11191612 | |||
| 2030 | Ga0157380_10000820 | |||
| 2031 | Ga0157380_10078485 | |||
| 2032 | Ga0157380_10258387 | |||
| 2033 | Ga0157380_11022686 | |||
| 2034 | Ga0157380_11422974 | |||
| 2035 | Ga0157380_12652401 | |||
| 2036 | Ga0157377_10012869 | |||
| 2037 | Ga0157377_10025499 | |||
| 2038 | Ga0157377_10061866 | |||
| 2039 | Ga0157377_10100202 | |||
| 2040 | Ga0157377_10119201 | |||
| 2041 | Ga0157377_10328004 | |||
| 2042 | Ga0157377_11003628 | |||
| 2043 | Ga0157377_11200624 | |||
| 2044 | Ga0157379_10150788 | |||
| 2045 | Ga0157379_10460288 | |||
| 2046 | Ga0157379_11157721 | |||
| 2047 | Ga0157376_10003493 | |||
| 2048 | Ga0157376_10014456 | |||
| 2049 | Ga0157376_10055617 | |||
| 2050 | Ga0157376_10196312 | |||
| 2051 | Ga0157376_10431237 | |||
| 2052 | Ga0157376_10475813 | |||
| 2053 | Ga0157376_10990826 | |||
| 2054 | Ga0163161_10020279 | |||
| 2055 | Ga0163161_10037167 | |||
| 2056 | Ga0163161_10102290 | |||
| 2057 | Ga0163161_10517554 | |||
| 2058 | Ga0163161_11667215 | |||
| 2059 | Ga0206353_10024931 | |||
| 2060 | Ga0207697_10172200 | |||
| 2061 | Ga0207697_10218753 | |||
| 2062 | Ga0207656_10094726 | |||
| 2063 | Ga0207692_10006470 | |||
| 2064 | Ga0207692_10055620 | |||
| 2065 | Ga0207642_10004754 | |||
| 2066 | Ga0207642_10064284 | |||
| 2067 | Ga0207642_10551027 | |||
| 2068 | Ga0207688_10005248 | |||
| 2069 | Ga0207688_10009489 | |||
| 2070 | Ga0207688_10014758 | |||
| 2071 | Ga0207688_10035442 | |||
| 2072 | Ga0207688_10055378 | |||
| 2073 | Ga0207688_10056107 | |||
| 2074 | Ga0207647_10120800 | |||
| 2075 | Ga0207647_10122005 | |||
| 2076 | Ga0207647_10450914 | |||
| 2077 | Ga0207685_10004888 | |||
| 2078 | Ga0207685_10018092 | |||
| 2079 | Ga0207685_10141903 | |||
| 2080 | Ga0207685_10305143 | |||
| 2081 | Ga0207699_10092826 | |||
| 2082 | Ga0207699_10096502 | |||
| 2083 | Ga0207699_10855847 | |||
| 2084 | Ga0207699_10992185 | |||
| 2085 | Ga0207645_10025047 | |||
| 2086 | Ga0207645_10115624 | |||
| 2087 | Ga0207645_10244802 | |||
| 2088 | Ga0207643_10070350 | |||
| 2089 | Ga0207643_10283382 | |||
| 2090 | Ga0207643_10331843 | |||
| 2091 | Ga0207643_10352515 | |||
| 2092 | Ga0207705_10338169 | |||
| 2093 | Ga0207684_10014283 | |||
| 2094 | Ga0207684_10131761 | |||
| 2095 | Ga0207684_10206093 | |||
| 2096 | Ga0207654_10063579 | |||
| 2097 | Ga0207707_10151644 | |||
| 2098 | Ga0207707_10335172 | |||
| 2099 | Ga0207707_10613529 | |||
| 2100 | Ga0207695_10340146 | |||
| 2101 | Ga0207671_10162534 | |||
| 2102 | Ga0207671_11156606 | |||
| 2103 | Ga0207693_10000468 | |||
| 2104 | Ga0207693_10002699 | |||
| 2105 | Ga0207693_10005673 | |||
| 2106 | Ga0207693_10013206 | |||
| 2107 | Ga0207693_10026932 | |||
| 2108 | Ga0207693_10034674 | |||
| 2109 | Ga0207693_10112075 | |||
| 2110 | Ga0207663_10004759 | |||
| 2111 | Ga0207663_10119254 | |||
| 2112 | Ga0207663_10169674 | |||
| 2113 | Ga0207663_10214793 | |||
| 2114 | Ga0207660_10062759 | |||
| 2115 | Ga0207660_10103287 | |||
| 2116 | Ga0207660_10116295 | |||
| 2117 | Ga0207660_10338680 | |||
| 2118 | Ga0207660_10497649 | |||
| 2119 | Ga0207662_10056177 | |||
| 2120 | Ga0207662_10074188 | |||
| 2121 | Ga0207657_10001010 | |||
| 2122 | Ga0207657_10062881 | |||
| 2123 | Ga0207657_10095825 | |||
| 2124 | Ga0207657_10119052 | |||
| 2125 | Ga0207657_10712855 | |||
| 2126 | Ga0207649_10854879 | |||
| 2127 | Ga0207649_11116269 | |||
| 2128 | Ga0207652_10276867 | |||
| 2129 | Ga0207646_10007769 | |||
| 2130 | Ga0207646_10009003 | |||
| 2131 | Ga0207646_10363970 | |||
| 2132 | Ga0207681_10030241 | |||
| 2133 | Ga0207681_10091381 | |||
| 2134 | Ga0207681_10198511 | |||
| 2135 | Ga0207681_10286095 | |||
| 2136 | Ga0207681_10776915 | |||
| 2137 | Ga0207694_10026457 | |||
| 2138 | Ga0207650_10014921 | |||
| 2139 | Ga0207650_10030691 | |||
| 2140 | Ga0207650_10240503 | |||
| 2141 | Ga0207659_10022079 | |||
| 2142 | Ga0207659_10311417 | |||
| 2143 | Ga0207659_10365311 | |||
| 2144 | Ga0207659_10372850 | |||
| 2145 | Ga0207659_10470404 | |||
| 2146 | Ga0207659_10603928 | |||
| 2147 | Ga0207687_10017159 | |||
| 2148 | Ga0207687_10045339 | |||
| 2149 | Ga0207687_10110337 | |||
| 2150 | Ga0207687_10136192 | |||
| 2151 | Ga0207687_10136707 | |||
| 2152 | Ga0207687_10163594 | |||
| 2153 | Ga0207687_10179796 | |||
| 2154 | Ga0207687_10320444 | |||
| 2155 | Ga0207687_10511191 | |||
| 2156 | Ga0207687_10679087 | |||
| 2157 | Ga0207700_10149119 | |||
| 2158 | Ga0207700_10186943 | |||
| 2159 | Ga0207700_10254325 | |||
| 2160 | Ga0207664_10015157 | |||
| 2161 | Ga0207664_10028593 | |||
| 2162 | Ga0207664_10431177 | |||
| 2163 | Ga0207644_10046784 | |||
| 2164 | Ga0207644_10151691 | |||
| 2165 | Ga0207644_10185486 | |||
| 2166 | Ga0207690_10116490 | |||
| 2167 | Ga0207690_10350480 | |||
| 2168 | Ga0207690_10743568 | |||
| 2169 | Ga0207690_10767466 | |||
| 2170 | Ga0207706_10003053 | |||
| 2171 | Ga0207706_10029490 | |||
| 2172 | Ga0207706_10037122 | |||
| 2173 | Ga0207706_10052872 | |||
| 2174 | Ga0207706_10078082 | |||
| 2175 | Ga0207706_10136076 | |||
| 2176 | Ga0207706_10294619 | |||
| 2177 | Ga0207706_10523556 | |||
| 2178 | Ga0207706_10572431 | |||
| 2179 | Ga0207706_10605488 | |||
| 2180 | Ga0207686_10002592 | |||
| 2181 | Ga0207686_10024437 | |||
| 2182 | Ga0207686_10051819 | |||
| 2183 | Ga0207686_10152740 | |||
| 2184 | Ga0207686_10206348 | |||
| 2185 | Ga0207686_10232702 | |||
| 2186 | Ga0207686_10314152 | |||
| 2187 | Ga0207709_10004481 | |||
| 2188 | Ga0207709_10040521 | |||
| 2189 | Ga0207709_10106688 | |||
| 2190 | Ga0207709_10124695 | |||
| 2191 | Ga0207709_10425075 | |||
| 2192 | Ga0207670_10020602 | |||
| 2193 | Ga0207670_10148695 | |||
| 2194 | Ga0207669_10013142 | |||
| 2195 | Ga0207669_10058883 | |||
| 2196 | Ga0207669_10158783 | |||
| 2197 | Ga0207669_10503455 | |||
| 2198 | Ga0207669_10857163 | |||
| 2199 | Ga0207704_10004272 | |||
| 2200 | Ga0207704_10190823 | |||
| 2201 | Ga0207704_10311456 | |||
| 2202 | Ga0207704_10569689 | |||
| 2203 | Ga0207704_11206536 | |||
| 2204 | Ga0207665_10005276 | |||
| 2205 | Ga0207665_10016737 | |||
| 2206 | Ga0207665_10019092 | |||
| 2207 | Ga0207691_10004591 | |||
| 2208 | Ga0207691_10024335 | |||
| 2209 | Ga0207691_10033336 | |||
| 2210 | Ga0207691_10254907 | |||
| 2211 | Ga0207711_10231488 | |||
| 2212 | Ga0207711_10319226 | |||
| 2213 | Ga0207711_10403199 | |||
| 2214 | Ga0207711_11855884 | |||
| 2215 | Ga0207689_10118363 | |||
| 2216 | Ga0207689_10530708 | |||
| 2217 | Ga0207689_11092254 | |||
| 2218 | Ga0207661_10062508 | |||
| 2219 | Ga0207661_10212962 | |||
| 2220 | Ga0207661_10354344 | |||
| 2221 | Ga0207661_10373693 | |||
| 2222 | Ga0207661_10953893 | |||
| 2223 | Ga0207661_11171372 | |||
| 2224 | Ga0207679_10052810 | |||
| 2225 | Ga0207679_10433856 | |||
| 2226 | Ga0207679_11118912 | |||
| 2227 | Ga0207667_10122244 | |||
| 2228 | Ga0207667_10130288 | |||
| 2229 | Ga0207667_10409006 | |||
| 2230 | Ga0207667_10464306 | |||
| 2231 | Ga0207651_10058205 | |||
| 2232 | Ga0207651_10060356 | |||
| 2233 | Ga0207651_10081292 | |||
| 2234 | Ga0207651_10301550 | |||
| 2235 | Ga0207651_10312521 | |||
| 2236 | Ga0207651_10614236 | |||
| 2237 | Ga0207712_10037905 | |||
| 2238 | Ga0207712_10066524 | |||
| 2239 | Ga0207712_10251913 | |||
| 2240 | Ga0207668_10065371 | |||
| 2241 | Ga0207668_10143420 | |||
| 2242 | Ga0207668_10512052 | |||
| 2243 | Ga0207668_11772023 | |||
| 2244 | Ga0207640_10251955 | |||
| 2245 | Ga0207640_10567292 | |||
| 2246 | Ga0207640_10754479 | |||
| 2247 | Ga0207640_11471608 | |||
| 2248 | Ga0207658_10340731 | |||
| 2249 | Ga0207658_10653487 | |||
| 2250 | Ga0207677_10050647 | |||
| 2251 | Ga0207677_10054351 | |||
| 2252 | Ga0207677_10061821 | |||
| 2253 | Ga0207677_10190351 | |||
| 2254 | Ga0207677_10342949 | |||
| 2255 | Ga0207639_10035329 | |||
| 2256 | Ga0207639_10268205 | |||
| 2257 | Ga0207678_10007870 | |||
| 2258 | Ga0207678_10028896 | |||
| 2259 | Ga0207678_10034547 | |||
| 2260 | Ga0207678_10108329 | |||
| 2261 | Ga0207678_11595420 | |||
| 2262 | Ga0207708_10000434 | |||
| 2263 | Ga0207708_10006543 | |||
| 2264 | Ga0207708_10010108 | |||
| 2265 | Ga0207708_10259655 | |||
| 2266 | Ga0207708_10612065 | |||
| 2267 | Ga0207708_10621758 | |||
| 2268 | Ga0207708_10983921 | |||
| 2269 | Ga0207702_10006809 | |||
| 2270 | Ga0207702_10037538 | |||
| 2271 | Ga0207702_10099432 | |||
| 2272 | Ga0207702_10381755 | |||
| 2273 | Ga0207702_10873666 | |||
| 2274 | Ga0207702_11109645 | |||
| 2275 | Ga0207702_12211051 | |||
| 2276 | Ga0207641_10391377 | |||
| 2277 | Ga0207641_11340768 | |||
| 2278 | Ga0207648_10003561 | |||
| 2279 | Ga0207648_10010611 | |||
| 2280 | Ga0207648_10194727 | |||
| 2281 | Ga0207648_10197230 | |||
| 2282 | Ga0207648_10521671 | |||
| 2283 | Ga0207648_10797361 | |||
| 2284 | Ga0207648_10860523 | |||
| 2285 | Ga0207676_10049792 | |||
| 2286 | Ga0207676_10173590 | |||
| 2287 | Ga0207676_10603859 | |||
| 2288 | Ga0207674_10183829 | |||
| 2289 | Ga0207674_11810939 | |||
| 2290 | Ga0207675_100000929 | |||
| 2291 | Ga0207675_100022783 | |||
| 2292 | Ga0207675_100042327 | |||
| 2293 | Ga0207675_100061539 | |||
| 2294 | Ga0207675_100125449 | |||
| 2295 | Ga0207675_100145230 | |||
| 2296 | Ga0207675_100906463 | |||
| 2297 | Ga0207675_100982677 | |||
| 2298 | Ga0207683_10008655 | |||
| 2299 | Ga0207683_10014994 | |||
| 2300 | Ga0207683_10016453 | |||
| 2301 | Ga0207683_10022492 | |||
| 2302 | Ga0207683_10083078 | |||
| 2303 | Ga0207683_10123157 | |||
| 2304 | Ga0207683_10194938 | |||
| 2305 | Ga0207683_10322856 | |||
| 2306 | Ga0207698_10104801 | |||
| 2307 | Ga0207698_10133410 | |||
| 2308 | Ga0207698_10158699 | |||
| 2309 | Ga0209966_1127929 | |||
| 2310 | Ga0209974_10149298 | |||
| 2311 | Ga0207428_10016203 | |||
| 2312 | Ga0207428_10017291 | |||
| 2313 | Ga0207428_10030243 | |||
| 2314 | Ga0207428_10041952 | |||
| 2315 | Ga0207428_10059700 | |||
| 2316 | Ga0207428_10237150 | |||
| 2317 | Ga0207428_10258606 | |||
| 2318 | Ga0207428_10499753 | |||
| 2319 | Ga0207428_10811977 | |||
| 2320 | Ga0268266_10132525 | |||
| 2321 | Ga0268266_10713353 | |||
| 2322 | Ga0268266_10777332 | |||
| 2323 | Ga0268265_10427518 | |||
| 2324 | Ga0268265_10575052 | |||
| 2325 | Ga0268265_11732074 | |||
| 2326 | Ga0268264_10165658 | |||
| 2327 | Ga0268264_10181795 | |||
| 2328 | Ga0268264_10620425 | |||
| 2329 | Ga0268264_10791741 | |||
| 2330 | Ga0268264_11719274 | |||
| 2331 | Ga0307408_100026730 | |||
| 2332 | Ga0307408_100142111 | |||
| 2333 | Ga0307408_100646728 | |||
| 2334 | Ga0307413_10378179 | |||
| 2335 | Ga0307410_10031890 | |||
| 2336 | Ga0307406_10011043 | |||
| 2337 | Ga0307406_10711386 | |||
| 2338 | Ga0307407_10245278 | |||
| 2339 | Ga0307407_10628199 | |||
| 2340 | Ga0307409_100010374 | |||
| 2341 | Ga0307409_100237172 | |||
| 2342 | Ga0307409_100983768 | |||
| 2343 | Ga0307409_101509474 | |||
| 2344 | Ga0307416_100004219 | |||
| 2345 | Ga0307416_100007736 | |||
| 2346 | Ga0307416_100216609 | |||
| 2347 | Ga0307416_100246630 | |||
| 2348 | Ga0307414_12209359 | |||
| 2349 | Ga0307411_10089487 | |||
| 2350 | Ga0307411_10228781 | |||
| 2351 | Ga0307415_100000808 | |||
| 2352 | Ga0307415_100021834 | |||
| 2353 | Ga0307415_100195143 | |||
| 2354 | Ga0307415_101005051 | |||
| 2355 | Ga0307415_102319889 | |||
| 2356 | Ga0373930_0110510 | |||
| 2357 | Ga0373930_0143986 | |||
| 2358 | Ga0373948_0094070 | |||
| 2359 | Ga0373950_0004977 | |||
| 2360 | Ga0373959_0109728 | |||
| 2361 | Ga0373928_0014071 | |||
| 2362 | Ga0373944_0001983 | |||
| 2363 | Ga0373949_0005829 | |||
| 2364 | Ga0373949_0089046 | |||
| 2365 | Ga0373952_0011491 | |||
| 2366 | Ga0373932_0006265 | |||
| 2367 | Ga0373932_0085299 | |||
| 2368 | Ga0373932_0139901 | |||
| 2369 | Ga0373936_0470036 | |||
| 2370 | Ga0373939_0053385 | |||
| 2371 | Ga0373939_0477311 | |||
| 2372 | Ga0373941_0018107 | |||
| 2373 | Ga0373941_0237678 | |||
| 2374 | Ga0373960_0025142 | |||
| 2375 | Ga0373960_0337527 | |||
| 2376 | Ga0373943_0000198 | |||
| 2377 | Ga0373943_0090845 | |||
| 2378 | Ga0373946_0123284 | |||
| 2379 | Ga0373961_0030013 | |||
| 2380 | Ga0373962_0101075 | |||
| 2381 | Ga0373931_0038872 | |||
| 2382 | Ga0373931_0282214 | |||
| 2383 | Ga0373931_0771393 | |||
| 2384 | Ga0373931_0876272 | |||
| 2385 | Ga0373935_0026470 | |||
| 2386 | Ga0373935_1464746 | |||
| 2387 | Ga0373927_0196855 | |||
| 2388 | Ga0373947_0004346 | |||
| 2389 | Ga0373947_0238578 | |||
| 2390 | Ga0373925_0024727 | |||
| 2391 | Ga0395899_0000862 | |||
| 2392 | Ga0395899_0007610 | |||
| 2393 | Ga0395899_0010899 | |||
| 2394 | Ga0395899_0017974 | |||
| 2395 | Ga0395899_0023261 | |||
| 2396 | Ga0395899_0033719 | |||
| 2397 | Ga0395899_0040508 | |||
| 2398 | Ga0395899_0049553 | |||
| 2399 | Ga0395899_0061595 | |||
| 2400 | Ga0395899_0609227 | |||
| 2401 | Ga0395900_0001266 | |||
| 2402 | Ga0395900_0002625 | |||
| 2403 | Ga0395900_0002980 | |||
| 2404 | Ga0395900_0005422 | |||
| 2405 | Ga0395900_0007274 | |||
| 2406 | Ga0395900_0027616 | |||
| 2407 | Ga0395900_0035757 | |||
| 2408 | Ga0395900_0054878 | |||
| 2409 | Ga0395900_0080840 | |||
| 2410 | Ga0395900_0096139 | |||
| 2411 | Ga0395900_0140715 | |||
| 2412 | Ga0395900_0186990 | |||
| 2413 | Ga0395900_0277384 | |||
| 2414 | Ga0395900_0280779 | |||
| 2415 | Ga0395900_0316752 | |||
| 2416 | Ga0395900_0542489 | |||
| 2417 | Ga0395900_0608699 | |||
| 2418 | Ga0395898_0002345 | |||
| 2419 | Ga0395898_0002841 | |||
| 2420 | Ga0395898_0003303 | |||
| 2421 | Ga0395898_0003734 | |||
| 2422 | Ga0395898_0007075 | |||
| 2423 | Ga0395898_0008888 | |||
| 2424 | Ga0395898_0014330 | |||
| 2425 | Ga0395898_0015278 | |||
| 2426 | Ga0395898_0045908 | |||
| 2427 | Ga0395898_0051506 | |||
| 2428 | Ga0395898_0063078 | |||
| 2429 | Ga0395898_0069483 | |||
| 2430 | Ga0395898_0084496 | |||
| 2431 | Ga0395898_0089482 | |||
| 2432 | Ga0395898_0196948 | |||
| 2433 | Ga0395898_0340270 | |||
| 2434 | Ga0395898_0385485 | |||
| 2435 | Ga0395898_1163811 | |||
| 2436 | Ga0395898_1734498 | |||
| 2437 | Ga0395905_0001694 | |||
| 2438 | Ga0395905_0003053 | |||
| 2439 | Ga0395905_0003210 | |||
| 2440 | Ga0395905_0009789 | |||
| 2441 | Ga0395905_0013678 | |||
| 2442 | Ga0395905_0017506 | |||
| 2443 | Ga0395905_0020791 | |||
| 2444 | Ga0395905_0026568 | |||
| 2445 | Ga0395905_0046230 | |||
| 2446 | Ga0395905_0050765 | |||
| 2447 | Ga0395905_0051423 | |||
| 2448 | Ga0395905_0063055 | |||
| 2449 | Ga0395905_0245546 | |||
| 2450 | Ga0395905_0259270 | |||
| 2451 | Ga0395905_0689296 | |||
| 2452 | Ga0395905_1489220 | |||
| 2453 | Ga0395901_0001749 | |||
| 2454 | Ga0395901_0002270 | |||
| 2455 | Ga0395901_0003365 | |||
| 2456 | Ga0395901_0004675 | |||
| 2457 | Ga0395901_0005294 | |||
| 2458 | Ga0395901_0012865 | |||
| 2459 | Ga0395901_0014566 | |||
| 2460 | Ga0395901_0018530 | |||
| 2461 | Ga0395901_0092174 | |||
| 2462 | Ga0395901_0104920 | |||
| 2463 | Ga0395901_0130499 | |||
| 2464 | Ga0395901_0139881 | |||
| 2465 | Ga0395901_0169408 | |||
| 2466 | Ga0395901_0305693 | |||
| 2467 | Ga0395901_0338922 | |||
| 2468 | Ga0395901_0358867 | |||
| 2469 | Ga0395901_0389261 | |||
| 2470 | Ga0395901_1232048 | |||
| 2471 | Ga0395901_1277704 | |||
| 2472 | Ga0242420_151020 | |||
| 2473 | Ga0436363_0708027 | |||
| 2474 | Ga0439461_0003188 | |||
| 2475 | Ga0439461_0018750 | |||
| 2476 | Ga0451789_0477297 | |||
| 2477 | Ga0451800_0214577 | |||
| 2478 | Ga0451800_0969733 | |||
| 2479 | Ga0451802_1709161 | |||
| 2480 | Ga0451802_1723895 | |||
| 2481 | Ga0451804_0948022 | |||
| 2482 | Ga0451804_0973345 | |||
| 2483 | Ga0451835_0412301 | |||
| 2484 | Ga0451839_0962805 | |||
| 2485 | Ga0451845_0454819 | |||
| 2486 | Ga0451845_0915420 | |||
| 2487 | Ga0451847_0310254 | |||
| 2488 | Ga0451847_0524792 | |||
| 2489 | Ga0451849_1357471 | |||
| 2490 | Ga0451855_0355001 | |||
| 2491 | Ga0451855_1954170 | |||
| 2492 | Ga0451853_0563886 | |||
| 2493 | Ga0451853_2940054 | |||
| 2494 | Ga0451853_3005281 | |||
| 2495 | Ga0439437_005057 | |||
| 2496 | Ga0439448_0030442 | |||
| 2497 | Ga0439448_0240698 | |||
| 2498 | Ga0439454_071322 | |||
| 2499 | Ga0439455_0156098 | |||
| 2500 | Ga0450914_019073 | |||
| 2501 | Ga0450920_006939 | |||
| 2502 | Ga0450920_011792 | |||
| 2503 | Ga0450922_043894 | |||
| 2504 | Ga0450902_004613 | |||
| 2505 | Ga0450905_015958 | |||
| 2506 | Ga0450906_033732 | |||
| 2507 | Ga0439446_0027233 | |||
| 2508 | Ga0439446_0117384 | |||
| 2509 | Ga0450908_044627 | |||
| 2510 | Ga0439434_0019517 | |||
| 2511 | Ga0439459_0083590 | |||
| 2512 | Ga0439459_0086809 | |||
| 2513 | Ga0439464_0067392 | |||
| 2514 | Ga0439460_0289782 | |||
| 2515 | Ga0450918_109298 | |||
| 2516 | Ga0451577_0843213 | |||
| 2517 | Ga0466972_0142262 | |||
| 2518 | Ga0466972_0281426 | |||
| 2519 | Ga0453683_0422057 | |||
| 2520 | Ga0466961_0207825 | |||
| 2521 | Ga0466961_0670293 | |||
| 2522 | Ga0466963_0011685 | |||
| 2523 | Ga0466964_0042314 | |||
| 2524 | Ga0466964_0082046 | |||
| 2525 | Ga0466964_0148485 | |||
| 2526 | Ga0466971_0362824 | |||
| 2527 | Ga0466968_0329851 | |||
| 2528 | Ga0466968_0719438 | |||
| 2529 | Ga0466970_0554343 | |||
| 2530 | Ga0466957_0035282 | |||
| 2531 | Ga0466957_0077290 | |||
| 2532 | Ga0466960_0191295 | |||
| 2533 | Ga0466960_0192038 | |||
| 2534 | Ga0466960_0365049 | |||
| 2535 | Ga0466960_0389299 | |||
| 2536 | Ga0466960_0630913 | |||
| 2537 | Ga0466959_0111694 | |||
| 2538 | Ga0466959_0192441 | |||
| 2539 | Ga0466959_0296216 | |||
| 2540 | Ga0451576_0148554 | |||
| 2541 | Ga0451576_0204742 | |||
| 2542 | Ga0451576_1313640 | |||
| 2543 | Ga0451576_2164806 | |||
| 2544 | Ga0466958_0020190 | |||
| 2545 | Ga0466958_0361374 | |||
| 2546 | Ga0466967_0065238 | |||
| 2547 | Ga0466967_0073266 | |||
| 2548 | Ga0466967_0180758 | |||
| 2549 | Ga0466967_0475316 | |||
| 2550 | Ga0466967_1025246 | |||
| 2551 | Ga0495592_0717671 | |||
| 2552 | Ga0495603_0000081 | |||
| 2553 | Ga0495603_0188052 | |||
| 2554 | Ga0495603_0258146 | |||
| 2555 | Ga0495641_0003826 | |||
| 2556 | Ga0495641_0035403 | |||
| 2557 | Ga0495580_0349545 | |||
| 2558 | Ga0495582_0165072 | |||
| 2559 | Ga0495605_0023019 | |||
| 2560 | Ga0495605_0050247 | |||
| 2561 | Ga0495605_0104950 | |||
| 2562 | Ga0495605_0138218 | |||
| 2563 | Ga0495605_0143667 | |||
| 2564 | Ga0495639_0072725 | |||
| 2565 | Ga0495584_0029628 | |||
| 2566 | Ga0495584_0150972 | |||
| 2567 | Ga0495584_0267847 | |||
| 2568 | Ga0495584_0274749 | |||
| 2569 | Ga0495584_0467788 | |||
| 2570 | Ga0495584_0687324 | |||
| 2571 | Ga0495585_0167026 | |||
| 2572 | Ga0495594_0000307 | |||
| 2573 | Ga0495596_0059567 | |||
| 2574 | Ga0495596_0090141 | |||
| 2575 | Ga0495583_0136470 | |||
| 2576 | Ga0495616_0064042 | |||
| 2577 | Ga0495616_0084325 | |||
| 2578 | Ga0495630_0047100 | |||
| 2579 | Ga0495630_0210783 | |||
| 2580 | Ga0495630_0271128 | |||
| 2581 | Ga0495630_0285681 | |||
| 2582 | Ga0495631_0307634 | |||
| 2583 | Ga0495631_0397354 | |||
| 2584 | Ga0495637_0099539 | |||
| 2585 | Ga0495637_0220124 | |||
| 2586 | Ga0495644_0156525 | |||
| 2587 | Ga0495663_0012292 | |||
| 2588 | Ga0495663_0099889 | |||
| 2589 | Ga0495663_0160878 | |||
| 2590 | Ga0495666_0007871 | |||
| 2591 | Ga0495642_0021874 | |||
| 2592 | Ga0495642_0109330 | |||
| 2593 | Ga0495642_0120457 | |||
| 2594 | Ga0495642_0522668 | |||
| 2595 | Ga0495654_0249553 | |||
| 2596 | Ga0495665_0055694 | |||
| 2597 | Ga0495598_0202370 | |||
| 2598 | Ga0495609_0120468 | |||
| 2599 | Ga0495609_0125780 | |||
| 2600 | Ga0495609_0289395 | |||
| 2601 | Ga0495656_0021635 | |||
| 2602 | Ga0495656_0159202 | |||
| 2603 | Ga0495656_0308243 | |||
| 2604 | Ga0495668_0051443 | |||
| 2605 | Ga0495668_0713824 | |||
| 2606 | Ga0495611_0114409 | |||
| 2607 | Ga0495611_0474427 | |||
| 2608 | Ga0495635_0220333 | |||
| 2609 | Ga0495659_0075246 | |||
| 2610 | Ga0495659_0124975 | |||
| 2611 | Ga0495659_0270981 | |||
| 2612 | Ga0495659_0346160 | |||
| 2613 | Ga0495661_0360603 | |||
| 2614 | Ga0495588_0001033 | |||
| 2615 | Ga0495588_0243944 | |||
| 2616 | Ga0495647_0017415 | |||
| 2617 | Ga0495647_0062545 | |||
| 2618 | Ga0495658_0105872 | |||
| 2619 | Ga0495658_0413230 | |||
| 2620 | Ga0495658_0750194 | |||
| 2621 | Ga0495670_0198029 | |||
| 2622 | Ga0495670_0304280 | |||
| 2623 | Ga0495671_0141170 | |||
| 2624 | Ga0495671_0165160 | |||
| 2625 | Ga0495589_0093005 | |||
| 2626 | Ga0495589_0120612 | |||
| 2627 | Ga0495589_0142604 | |||
| 2628 | Ga0495589_0176138 | |||
| 2629 | Ga0495589_0193396 | |||
| 2630 | Ga0495600_0240509 | |||
| 2631 | Ga0495660_0330879 | |||
| 2632 | Ga0495581_0033481 | |||
| 2633 | Ga0495581_0134370 | |||
| 2634 | Ga0495581_0309913 | |||
| 2635 | Ga0495604_0706902 | |||
| 2636 | Ga0495604_0892693 | |||
| 2637 | Ga0495674_0689238 | |||
| 2638 | Ga0495676_0004078 | |||
| 2639 | Ga0495676_0047807 | |||
| 2640 | Ga0495676_0068170 | |||
| 2641 | Ga0495676_0753182 | |||
| 2642 | Ga0495683_0132957 | |||
| 2643 | Ga0495683_0137812 | |||
| 2644 | Ga0495679_070677 | |||
| 2645 | Ga0495679_126618 | |||
| 2646 | Ga0495602_0258315 | |||
| 2647 | Ga0495602_0668633 | |||
| 2648 | Ga0495626_0230681 | |||
| 2649 | Ga0495626_0246477 | |||
| 2650 | Ga0496100_0007377 | |||
| 2651 | Ga0496100_0009219 | |||
| 2652 | Ga0496100_0094399 | |||
| 2653 | Ga0496100_0182188 | |||
| 2654 | Ga0496100_0299854 | |||
| 2655 | Ga0496100_0559705 | |||
| 2656 | Ga0496100_0743459 | |||
| 2657 | Ga0496100_1548704 | |||
| 2658 | Ga0496101_0002103 | |||
| 2659 | Ga0496101_0029183 | |||
| 2660 | Ga0496101_0078649 | |||
| 2661 | Ga0496101_0211505 | |||
| 2662 | Ga0496101_0327336 | |||
| 2663 | Ga0496101_0625234 | |||
| 2664 | Ga0496101_0674625 | |||
| 2665 | Ga0496101_0721210 | |||
| 2666 | Ga0496101_1010773 | |||
| 2667 | Ga0496102_0013820 | |||
| 2668 | Ga0496102_0050210 | |||
| 2669 | Ga0496102_0198984 | |||
| 2670 | Ga0496102_0269575 | |||
| 2671 | Ga0496102_0380170 | |||
| 2672 | Ga0496102_0487945 | |||
| 2673 | Ga0496102_1015854 | |||
| 2674 | Ga0496103_0030702 | |||
| 2675 | Ga0496103_0071231 | |||
| 2676 | Ga0496103_0078196 | |||
| 2677 | Ga0496103_0183524 | |||
| 2678 | Ga0496103_0200777 | |||
| 2679 | Ga0496103_1036078 | |||
| 2680 | Ga0496104_0000584 | |||
| 2681 | Ga0496104_0041334 | |||
| 2682 | Ga0496104_0044880 | |||
| 2683 | Ga0496104_0227856 | |||
| 2684 | Ga0496104_0428200 | |||
| 2685 | Ga0496104_1005166 | |||
| 2686 | Ga0496105_0003054 | |||
| 2687 | Ga0496105_0011626 | |||
| 2688 | Ga0496105_0037996 | |||
| 2689 | Ga0496105_0081251 | |||
| 2690 | Ga0496105_0103234 | |||
| 2691 | Ga0496105_0109809 | |||
| 2692 | Ga0496106_0028268 | |||
| 2693 | Ga0496106_0115148 | |||
| 2694 | Ga0496106_0138204 | |||
| 2695 | Ga0496106_0174792 | |||
| 2696 | Ga0496106_0598900 | |||
| 2697 | Ga0496106_0650374 | |||
| 2698 | Ga0496106_0659127 | |||
| 2699 | Ga0496107_0004908 | |||
| 2700 | Ga0496107_0022326 | |||
| 2701 | Ga0496107_0032156 | |||
| 2702 | Ga0496107_0149041 | |||
| 2703 | Ga0496107_0280587 | |||
| 2704 | Ga0496108_0004843 | |||
| 2705 | Ga0496108_0021690 | |||
| 2706 | Ga0496108_0028435 | |||
| 2707 | Ga0496108_0054920 | |||
| 2708 | Ga0496108_0070458 | |||
| 2709 | Ga0496108_0159892 | |||
| 2710 | Ga0496108_0250905 | |||
| 2711 | Ga0496108_0329368 | |||
| 2712 | Ga0496108_0479185 | |||
| 2713 | Ga0496108_0657737 | |||
| 2714 | Ga0496109_0005961 | |||
| 2715 | Ga0496109_0007456 | |||
| 2716 | Ga0496109_0010340 | |||
| 2717 | Ga0496109_0037837 | |||
| 2718 | Ga0496109_0077215 | |||
| 2719 | Ga0496109_0083134 | |||
| 2720 | Ga0496109_0093225 | |||
| 2721 | Ga0496109_0128380 | |||
| 2722 | Ga0496109_0280480 | |||
| 2723 | Ga0496109_0462953 | |||
| 2724 | Ga0496109_0557047 | |||
| 2725 | Ga0496109_0719688 | |||
| 2726 | Ga0496109_1018558 | |||
| 2727 | Ga0496110_0000277 | |||
| 2728 | Ga0496110_0024958 | |||
| 2729 | Ga0496110_0040205 | |||
| 2730 | Ga0496110_0064768 | |||
| 2731 | Ga0496110_0067059 | |||
| 2732 | Ga0496110_0196361 | |||
| 2733 | Ga0496110_0198318 | |||
| 2734 | Ga0496110_0275587 | |||
| 2735 | Ga0496110_0288688 | |||
| 2736 | Ga0496110_0338861 | |||
| 2737 | Ga0496110_0397319 | |||
| 2738 | Ga0496110_0809496 | |||
| 2739 | Ga0496110_0881807 | |||
| 2740 | Ga0496111_0000676 | |||
| 2741 | Ga0496111_0005855 | |||
| 2742 | Ga0496111_0010107 | |||
| 2743 | Ga0496111_0012451 | |||
| 2744 | Ga0496111_0036718 | |||
| 2745 | Ga0496111_0114490 | |||
| 2746 | Ga0496111_0194115 | |||
| 2747 | Ga0496111_0228680 | |||
| 2748 | Ga0496111_0361321 | |||
| 2749 | Ga0496111_0676710 | |||
| 2750 | Ga0496112_0000434 | |||
| 2751 | Ga0496112_0001332 | |||
| 2752 | Ga0496112_0081758 | |||
| 2753 | Ga0496112_0089043 | |||
| 2754 | Ga0496112_0112397 | |||
| 2755 | Ga0496112_0199560 | |||
| 2756 | Ga0496112_0395399 | |||
| 2757 | Ga0496112_0549638 | |||
| 2758 | Ga0496112_0610270 | |||
| 2759 | Ga0496112_1101134 | |||
| 2760 | Ga0496112_1168491 | |||
| 2761 | Ga0496112_1512916 | |||
| 2762 | Ga0496113_0002971 | |||
| 2763 | Ga0496113_0014924 | |||
| 2764 | Ga0496113_0019937 | |||
| 2765 | Ga0496113_0050905 | |||
| 2766 | Ga0496113_0165666 | |||
| 2767 | Ga0496113_0166080 | |||
| 2768 | Ga0496113_0184703 | |||
| 2769 | Ga0496113_0277967 | |||
| 2770 | Ga0496113_0452065 | |||
| 2771 | Ga0496113_0485510 | |||
| 2772 | Ga0496114_0004422 | |||
| 2773 | Ga0496114_0015083 | |||
| 2774 | Ga0496114_0022506 | |||
| 2775 | Ga0496114_0108447 | |||
| 2776 | Ga0496114_0119330 | |||
| 2777 | Ga0496114_0125811 | |||
| 2778 | Ga0496114_0206185 | |||
| 2779 | Ga0496114_0463550 | |||
| 2780 | Ga0496114_0595974 | |||
| 2781 | Ga0496114_0718716 | |||
| 2782 | Ga0496115_0015485 | |||
| 2783 | Ga0496115_0033327 | |||
| 2784 | Ga0496115_0038699 | |||
| 2785 | Ga0496115_0065990 | |||
| 2786 | Ga0496115_0237466 | |||
| 2787 | Ga0496115_0353056 | |||
| 2788 | Ga0496115_0551889 | |||
| 2789 | Ga0496115_0574919 | |||
| 2790 | Ga0501031_0005847 | |||
| 2791 | Ga0501031_0040078 | |||
| 2792 | Ga0501031_0042795 | |||
| 2793 | Ga0501031_0183095 | |||
| 2794 | Ga0501031_0226484 | |||
| 2795 | Ga0501032_0003181 | |||
| 2796 | Ga0501032_0197258 | |||
| 2797 | Ga0501033_0003631 | |||
| 2798 | Ga0501033_0090759 | |||
| 2799 | Ga0501033_0146044 | |||
| 2800 | Ga0501033_0213796 | |||
| 2801 | Ga0501034_0027634 | |||
| 2802 | Ga0501034_0414420 | |||
| 2803 | Ga0501036_0018221 | |||
| 2804 | Ga0501036_0053357 | |||
| 2805 | Ga0501036_0123710 | |||
| 2806 | Ga0501036_0145466 | |||
| 2807 | Ga0501036_1505648 | |||
| 2808 | Ga0501037_0005371 | |||
| 2809 | Ga0501037_0014431 | |||
| 2810 | Ga0501038_0019492 | |||
| 2811 | Ga0501038_0044651 | |||
| 2812 | Ga0501038_0163136 | |||
| 2813 | Ga0501038_0416856 | |||
| 2814 | Ga0501038_0502671 | |||
| 2815 | Ga0501039_0006661 | |||
| 2816 | Ga0501039_0020432 | |||
| 2817 | Ga0501039_0037336 | |||
| 2818 | Ga0501039_0200224 | |||
| 2819 | Ga0501039_0552365 | |||
| 2820 | Ga0501039_0669645 | |||
| 2821 | Ga0501039_0754384 | |||
| 2822 | Ga0501039_1250734 | |||
| 2823 | Ga0501040_0016156 | |||
| 2824 | Ga0501040_0102911 | |||
| 2825 | Ga0501040_0123069 | |||
| 2826 | Ga0501040_0130177 | |||
| 2827 | Ga0501040_0328705 | |||
| 2828 | Ga0501040_0338884 | |||
| 2829 | Ga0501040_0803995 | |||
| 2830 | Ga0501041_0013404 | |||
| 2831 | Ga0501041_0076253 | |||
| 2832 | Ga0501041_0107328 | |||
| 2833 | Ga0501041_0398556 | |||
| 2834 | Ga0501042_0010417 | |||
| 2835 | Ga0501042_0019226 | |||
| 2836 | Ga0501042_0029262 | |||
| 2837 | Ga0501042_0030665 | |||
| 2838 | Ga0501042_0091720 | |||
| 2839 | Ga0501042_0272242 | |||
| 2840 | Ga0501042_0323432 | |||
| 2841 | Ga0501042_0950031 | |||
| 2842 | Ga0501042_0958007 | |||
| 2843 | Ga0501043_0014107 | |||
| 2844 | Ga0501043_0028485 | |||
| 2845 | Ga0501043_0530761 | |||
| 2846 | Ga0501046_0013235 | |||
| 2847 | Ga0501046_0017331 | |||
| 2848 | Ga0501046_0423826 | |||
| 2849 | Ga0501047_0031837 | |||
| 2850 | Ga0501048_0008057 | |||
| 2851 | Ga0501048_0008511 | |||
| 2852 | Ga0501048_0185977 | |||
| 2853 | Ga0501067_0015893 | |||
| 2854 | Ga0501067_0160142 | |||
| 2855 | Ga0501068_0001367 | |||
| 2856 | Ga0501068_0007185 | |||
| 2857 | Ga0501068_0028085 | |||
| 2858 | Ga0501068_0083302 | |||
| 2859 | Ga0501068_0196367 | |||
| 2860 | Ga0501068_0330152 | |||
| 2861 | Ga0501069_0005535 | |||
| 2862 | Ga0501069_0010559 | |||
| 2863 | Ga0501069_0067767 | |||
| 2864 | Ga0501069_0134542 | |||
| 2865 | Ga0501070_0065677 | |||
| 2866 | Ga0501070_0173529 | |||
| 2867 | Ga0501070_0531025 | |||
| 2868 | Ga0501070_1178742 | |||
| 2869 | Ga0501071_0003656 | |||
| 2870 | Ga0501071_0007072 | |||
| 2871 | Ga0501071_0042051 | |||
| 2872 | Ga0501071_0083783 | |||
| 2873 | Ga0501071_0385247 | |||
| 2874 | Ga0501071_0508468 | |||
| 2875 | Ga0501071_0745571 | |||
| 2876 | Ga0501071_0943612 | |||
| 2877 | Ga0501072_0008341 | |||
| 2878 | Ga0501072_0012103 | |||
| 2879 | Ga0501072_0018673 | |||
| 2880 | Ga0501072_0019083 | |||
| 2881 | Ga0501072_0080255 | |||
| 2882 | Ga0501072_0146259 | |||
| 2883 | Ga0501072_0213515 | |||
| 2884 | Ga0501072_0309095 | |||
| 2885 | Ga0501072_0342783 | |||
| 2886 | Ga0501072_0633013 | |||
| 2887 | Ga0501072_0803996 | |||
| 2888 | Ga0501073_0026968 | |||
| 2889 | Ga0501073_0231813 | |||
| 2890 | Ga0501073_0349445 | |||
| 2891 | Ga0501073_1006698 | |||
| 2892 | Ga0501074_0086741 | |||
| 2893 | Ga0501074_0106265 | |||
| 2894 | Ga0501074_0132367 | |||
| 2895 | Ga0501074_0199165 | |||
| 2896 | Ga0501074_0449178 | |||
| 2897 | Ga0501074_0613112 | |||
| 2898 | Ga0501075_0008156 | |||
| 2899 | Ga0501075_0016438 | |||
| 2900 | Ga0501075_0035375 | |||
| 2901 | Ga0501075_0046038 | |||
| 2902 | Ga0501075_0051526 | |||
| 2903 | Ga0501075_0129176 | |||
| 2904 | Ga0501076_0009449 | |||
| 2905 | Ga0501076_0010440 | |||
| 2906 | Ga0501076_0036137 | |||
| 2907 | Ga0501076_0079464 | |||
| 2908 | Ga0501076_0086960 | |||
| 2909 | Ga0501076_0112029 | |||
| 2910 | Ga0501076_0305484 | |||
| 2911 | Ga0501077_0003076 | |||
| 2912 | Ga0501077_0003918 | |||
| 2913 | Ga0501077_0006605 | |||
| 2914 | Ga0501077_0049104 | |||
| 2915 | Ga0501077_0087686 | |||
| 2916 | Ga0501077_0701709 | |||
| 2917 | Ga0501079_0005224 | |||
| 2918 | Ga0501079_0014622 | |||
| 2919 | Ga0501079_0039043 | |||
| 2920 | Ga0501079_0213244 | |||
| 2921 | Ga0501079_0340475 | |||
| 2922 | Ga0501079_0389856 | |||
| 2923 | Ga0501079_0622230 | |||
| 2924 | Ga0501080_0010471 | |||
| 2925 | Ga0501080_0027221 | |||
| 2926 | Ga0501080_0198282 | |||
| 2927 | Ga0501080_0239941 | |||
| 2928 | Ga0501080_0543158 | |||
| 2929 | Ga0501080_0663161 | |||
| 2930 | Ga0501081_0007569 | |||
| 2931 | Ga0501081_0046709 | |||
| 2932 | Ga0501081_0049864 | |||
| 2933 | Ga0501081_0231203 | |||
| 2934 | Ga0501081_0246443 | |||
| 2935 | Ga0501081_0262901 | |||
| 2936 | Ga0501081_0494660 | |||
| 2937 | Ga0501081_0542476 | |||
| 2938 | Ga0501081_0551513 | |||
| 2939 | Ga0501081_0682495 | |||
| 2940 | Ga0501081_0811227 | |||
| 2941 | Ga0501083_0008656 | |||
| 2942 | Ga0501083_0068625 | |||
| 2943 | Ga0501083_0280393 | |||
| 2944 | Ga0501265_060616 | |||
| 2945 | Ga0501279_077695 | |||
| 2946 | Ga0501035_0005105 | |||
| 2947 | Ga0501035_0023034 | |||
| 2948 | Ga0501035_0372520 | |||
| 2949 | Ga0501044_0055545 | |||
| 2950 | Ga0501044_0150492 | |||
| 2951 | Ga0501045_0007285 | |||
| 2952 | Ga0501045_0087443 | |||
| 2953 | Ga0501045_0111745 | |||
| 2954 | Ga0501045_0152045 | |||
| 2955 | Ga0501045_0333768 | |||
| 2956 | Ga0501045_0397798 | |||
| 2957 | nmdc:mga0yw44_212398_c1 | |||
| 2958 | nmdc:mga0yw44_255592_c1 | |||
| 2959 | nmdc:mga0yw44_40267_c1 | |||
| 2960 | nmdc:mga0yw44_50647_c1 | |||
| 2961 | nmdc:mga0yw44_678455_c1 | |||
| 2962 | nmdc:mga05p37_104554_c1 | |||
| 2963 | nmdc:mga05p37_108180_c1 | |||
| 2964 | nmdc:mga05p37_1226434_c1 | |||
| 2965 | nmdc:mga05p37_342792_c1 | |||
| 2966 | nmdc:mga05p37_412455_c1 | |||
| 2967 | nmdc:mga05p37_446260_c1 | |||
| 2968 | nmdc:mga05p37_718810_c1 | |||
| 2969 | nmdc:mga09592_236405_c1 | |||
| 2970 | nmdc:mga09592_444986_c1 | |||
| 2971 | nmdc:mga09592_44866_c1 | |||
| 2972 | nmdc:mga09592_528418_c1 | |||
| 2973 | nmdc:mga09592_531826_c1 | |||
| 2974 | nmdc:mga09592_771954_c1 | |||
| 2975 | nmdc:mga09592_959655_c1 | |||
| 2976 | nmdc:mga0qj67_178237_c1 | |||
| 2977 | nmdc:mga06r32_232795_c1 | |||
| 2978 | nmdc:mga06r32_26472_c1 | |||
| 2979 | nmdc:mga06r32_268714_c1 | |||
| 2980 | nmdc:mga06r32_353026_c1 | |||
| 2981 | nmdc:mga08y16_199057_c1 | |||
| 2982 | nmdc:mga08y16_24029_c1 | |||
| 2983 | nmdc:mga08y16_263246_c1 | |||
| 2984 | nmdc:mga08y16_33292_c1 | |||
| 2985 | nmdc:mga08y16_354689_c1 | |||
| 2986 | nmdc:mga08y16_466925_c1 | |||
| 2987 | nmdc:mga08y16_479356_c1 | |||
| 2988 | nmdc:mga08y16_488990_c1 | |||
| 2989 | nmdc:mga08y16_508159_c1 | |||
| 2990 | nmdc:mga08y16_51029_c1 | |||
| 2991 | nmdc:mga08y16_682846_c1 | |||
| 2992 | nmdc:mga08y16_72168_c1 | |||
| 2993 | nmdc:mga08y16_81682_c1 | |||
| 2994 | nmdc:mga08y16_96769_c1 | |||
| 2995 | nmdc:mga0n895_1012532_c1 | |||
| 2996 | nmdc:mga0n895_11434_c1 | |||
| 2997 | nmdc:mga0n895_1627_c1 | |||
| 2998 | nmdc:mga0n895_258585_c1 | |||
| 2999 | nmdc:mga0n895_405892_c1 | |||
| 3000 | nmdc:mga0n895_754496_c1 | |||
| 3001 | nmdc:mga0n895_87775_c1 | |||
| 3002 | nmdc:mga0rr50_117778_c1 | |||
| 3003 | nmdc:mga0rr50_162335_c1 | |||
| 3004 | nmdc:mga0rr50_206761_c1 | |||
| 3005 | nmdc:mga0rr50_301600_c1 | |||
| 3006 | nmdc:mga0rr50_3028_c1 | |||
| 3007 | nmdc:mga0rr50_8967_c1 | |||
| 3008 | nmdc:mga08x19_18530_c1 | |||
| 3009 | nmdc:mga08x19_467604_c1 | |||
| 3010 | nmdc:mga08x19_46825_c1 | |||
| 3011 | nmdc:mga08x19_65419_c1 | |||
| 3012 | nmdc:mga08x19_8369_c1 | |||
| 3013 | nmdc:mga08x19_859986_c1 | |||
| 3014 | nmdc:mga0a205_1196_c1 | |||
| 3015 | nmdc:mga0a205_142201_c1 | |||
| 3016 | nmdc:mga0a205_183065_c1 | |||
| 3017 | nmdc:mga0a205_328258_c1 | |||
| 3018 | nmdc:mga0a205_346192_c1 | |||
| 3019 | nmdc:mga0a205_485986_c1 | |||
| 3020 | nmdc:mga0a205_85499_c1 | |||
| 3021 | Ga0495612_0139372 | |||
| 3022 | Ga0495655_0017138 | |||
| 3023 | Ga0495619_0431170 | |||
| 3024 | Ga0501084_0009058 | |||
| 3025 | Ga0501084_0026876 | |||
| 3026 | Ga0501084_0040607 | |||
| 3027 | Ga0501084_0059551 | |||
| 3028 | Ga0501084_0241147 | |||
| 3029 | Ga0501084_0272920 | |||
| 3030 | Ga0501084_0475379 | |||
| 3031 | Ga0501084_0688939 | |||
| 3032 | Ga0501084_0983155 | |||
| 3033 | Ga0590075_003995 | |||
| 3034 | Ga0590075_086626 | |||
| 3035 | Ga0590077_009077 | |||
| 3036 | Ga0590077_023594 | |||
| 3037 | Ga0590077_073003 | |||
| 3038 | Ga0501082_0005543 | |||
| 3039 | Ga0501082_0018883 | |||
| 3040 | Ga0501082_0033764 | |||
| 3041 | Ga0501082_0049904 | |||
| 3042 | Ga0501082_0157280 | |||
| 3043 | Ga0501082_0584293 | |||
| 3044 | Ga0501082_0896797 | |||
| 3045 | Ga0501082_1201300 | |||
| 3046 | Ga0501082_1305043 | |||
| 3047 | Ga0466962_0016768 | |||
| 3048 | Ga0466962_0100061 | |||
| 3049 | Ga0530510_0035868 | |||
| 3050 | Ga0530510_0395116 | |||
| 3051 | Ga0530510_0443566 | |||
| 3052 | Ga0530510_1176402 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3oa4-assembly1.cif.gz_A-2 | crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 | 0.9434 | 5 | 132 |
| 6xbr-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (e43l) in complex with 2-nitronate-propionyl-coa | 0.9291 | 2 | 132 |
| 6xbv-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa | 0.9288 | 2 | 132 |
| 6wf7-assembly1.cif.gz_A | methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ | 0.9278 | 2 | 132 |
| 6xbs-assembly1.cif.gz_A-2 | streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa | 0.9253 | 2 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3oa4A01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9434 | 5 | 132 | 3.10.180.10 |
| af_L7N6B1_8_152_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9342 | 3 | 134 | 3.10.180.10 |
| af_L7N6B1_8_152_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9144 | 3 | 134 | 3.10.180.10 |
| 3oa4A01 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.9029 | 5 | 132 | 3.10.180.10 |
| af_A0A1X7YDR8_31_97_3.10.180.10 | Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 | 0.8857 | 4 | 58 | 3.10.180.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A538A076-F1-model_v4 | Methylmalonyl-CoA epimerase (EC 5.1.99.1) | 0.9677 | 7 | 133 |
GO:0004493
GO:0046491 GO:0046872 |
| AF-A0A6J6XET1-F1-model_v4 | Unannotated protein | 0.966 | 3 | 134 |
GO:0004493
GO:0046491 GO:0046872 |
| AF-A0A7V9C1Z3-F1-model_v4 | Methylmalonyl-CoA epimerase (EC 5.1.99.1) | 0.9647 | 7 | 131 |
GO:0004493
GO:0046491 GO:0046872 |
| AF-A0A7W1H355-F1-model_v4 | Methylmalonyl-CoA epimerase (EC 5.1.99.1) | 0.964 | 1 | 132 |
GO:0004493
GO:0046491 GO:0046872 |
| AF-A0A538FWW5-F1-model_v4 | Methylmalonyl-CoA epimerase (EC 5.1.99.1) | 0.9622 | 1 | 132 |
GO:0004493
GO:0046491 GO:0046872 |