F494566

General Info

Members Datasets Scaffolds Average Seq Length
1526 403 3052 133

Family's Representative Sequence

Representative Sequence 3300006871|Ga0075434_100256131|Ga0075434_1002561312
Length 155
Sequence MTGRHLGRWQPTPLSAVASRGVEPRGIHHLGVAVVDLDEAVATYERLFGARVEHRETVPDQGVEAASLRIGAGRVELLASLGAETPVGKFLAKRGPGMHHVAYEVDDVGEALGELAAEGAELIDEHPKRGLFGLEVAFVHPDAVHGVLAEIVSDG

Samples

Sample ID Description Type Environment
1 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
2 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
3 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
4 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
5 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
25 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
26 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
27 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
28 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
29 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
30 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
31 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
32 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
33 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
34 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
35 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
36 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
37 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
38 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
39 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
40 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
41 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
42 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
43 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
44 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
45 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
46 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
47 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
48 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
49 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
50 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
51 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
52 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
53 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
54 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
57 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
58 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
59 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
60 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
61 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
62 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
63 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
64 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
65 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
84 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
88 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
89 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
94 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300012500 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.old.080610 Metagenome Rhizosphere
120 3300012505 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.10.yng.090610 Metagenome Rhizosphere
121 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
122 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
123 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
124 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
125 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
126 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
127 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
128 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
129 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
130 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
131 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
132 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
133 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
134 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
206 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
207 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
208 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
209 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
210 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
211 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
212 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
213 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
214 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
215 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
216 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
219 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
220 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
221 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
222 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
223 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
224 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
225 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
226 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
227 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
228 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
229 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
230 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
231 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
232 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
233 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
235 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
236 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
237 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
238 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
239 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
240 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
241 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
242 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
243 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
244 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
245 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
246 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
247 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
248 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
249 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
250 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
251 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
252 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
253 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
254 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
255 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
256 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
257 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
258 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
259 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
260 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
261 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
262 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
263 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
264 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
265 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
266 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
267 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
270 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
271 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
272 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
277 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
278 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
279 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
280 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
281 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
282 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
283 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
284 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
285 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
286 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
287 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
288 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
289 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
290 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
291 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
292 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
293 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
294 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
295 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
296 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
297 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
298 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
301 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
302 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
303 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
304 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
305 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
306 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
309 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
310 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
314 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
315 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
316 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
317 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
318 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
319 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
320 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
321 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
322 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
323 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
324 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
325 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
326 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
327 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
328 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
329 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
330 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
331 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
332 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
333 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
334 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
335 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
336 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
337 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
338 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
339 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
340 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
341 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
342 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
343 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
344 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
345 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
346 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
347 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
348 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
349 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
350 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
355 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
356 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
357 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
358 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
359 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
361 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
362 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
365 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
366 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
367 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
368 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
369 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
370 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
371 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
372 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
373 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
374 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
375 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
376 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
377 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
378 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
379 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
380 3300049762 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E11_A_4_control Metagenome Rhizosphere
381 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
382 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
383 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
384 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
385 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
386 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
387 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
388 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
389 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
390 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
391 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
392 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
393 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
394 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
395 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
396 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
397 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
398 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
399 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
400 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
401 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
402 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
403 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.66
Nodule 0
Rhizoplane 9.63
Rhizosphere 88.86
Stem 0
Stem Tuber 0
Unclassified 9.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075434_100256131 3300006871 Bacteria 1769
2 JGI24743J22301_10010841 3300001991 Bacteria 1632
3 JGI24745J21846_1043417 3300002073 Unclassified 560
4 JGI24749J21850_1012296 3300002076 Bacteria 1202
5 JGI24744J21845_10047793 3300002077 Bacteria 792
6 JGI24034J26672_10064824 3300002239 Unclassified 647
7 JGI24742J22300_10007594 3300002244 Bacteria 1789
8 JGI24751J29686_10020412 3300002459 Bacteria 1372
9 Ga0070658_10248202 3300005327 Bacteria 1510
10 Ga0070676_10218216 3300005328 Bacteria 1258
11 Ga0070676_11130895 3300005328 Bacteria 593
12 Ga0070683_100046479 3300005329 Bacteria 4011
13 Ga0070683_100106976 3300005329 Bacteria 2637
14 Ga0070683_100179331 3300005329 Bacteria 2010
15 Ga0070683_100579252 3300005329 Bacteria 1073
16 Ga0070690_100101444 3300005330 Bacteria 1909
17 Ga0070690_100402220 3300005330 Bacteria 1006
18 Ga0070670_100029151 3300005331 Bacteria 4749
19 Ga0070670_100259835 3300005331 Bacteria 1514
20 Ga0070670_100292769 3300005331 Bacteria 1423
21 Ga0070670_101206496 3300005331 Bacteria 691
22 Ga0070677_10160055 3300005333 Bacteria 1056
23 Ga0070666_10406974 3300005335 Unclassified 979
24 Ga0070680_100065165 3300005336 Bacteria 2986
25 Ga0070680_100709580 3300005336 Bacteria 866
26 Ga0070680_101723480 3300005336 Bacteria 543
27 Ga0070682_100008552 3300005337 Bacteria 5776
28 Ga0068868_100012777 3300005338 Bacteria 6143
29 Ga0068868_100022899 3300005338 Bacteria 4723
30 Ga0068868_100035079 3300005338 Bacteria 3876
31 Ga0068868_100071883 3300005338 Bacteria 2759
32 Ga0068868_100415646 3300005338 Bacteria 1163
33 Ga0068868_101832619 3300005338 Bacteria 574
34 Ga0068868_102401698 3300005338 Bacteria 503
35 Ga0070660_100029591 3300005339 Bacteria 4106
36 Ga0070660_100213850 3300005339 Bacteria 1565
37 Ga0070689_100004985 3300005340 Bacteria 9017
38 Ga0070689_100146536 3300005340 Bacteria 1902
39 Ga0070691_10042904 3300005341 Bacteria 2141
40 Ga0070687_100064201 3300005343 Bacteria 1950
41 Ga0070687_100065601 3300005343 Bacteria 1932
42 Ga0070687_100122202 3300005343 Bacteria 1491
43 Ga0070661_100350614 3300005344 Bacteria 1158
44 Ga0070661_100439590 3300005344 Bacteria 1036
45 Ga0070692_10032483 3300005345 Bacteria 2624
46 Ga0070692_10346329 3300005345 Bacteria 922
47 Ga0070668_100021758 3300005347 Bacteria 4846
48 Ga0070668_100024506 3300005347 Bacteria 4572
49 Ga0070668_100285165 3300005347 Bacteria 1380
50 Ga0070668_100443446 3300005347 Unclassified 1115
51 Ga0070668_100609845 3300005347 Bacteria 956
52 Ga0070668_100631344 3300005347 Bacteria 940
53 Ga0070668_102075267 3300005347 Bacteria 525
54 Ga0070669_100180029 3300005353 Bacteria 1653
55 Ga0070669_100414767 3300005353 Bacteria 1104
56 Ga0070669_100690790 3300005353 Bacteria 861
57 Ga0070675_100015610 3300005354 Bacteria 6010
58 Ga0070675_100382659 3300005354 Bacteria 1253
59 Ga0070675_100471996 3300005354 Bacteria 1127
60 Ga0070675_100595307 3300005354 Bacteria 1002
61 Ga0070675_100890013 3300005354 Bacteria 816
62 Ga0070671_100014272 3300005355 Bacteria 6414
63 Ga0070671_100036375 3300005355 Bacteria 4083
64 Ga0070671_100242198 3300005355 Bacteria 1531
65 Ga0070671_100295555 3300005355 Bacteria 1379
66 Ga0070671_100896773 3300005355 Bacteria 774
67 Ga0070674_100004281 3300005356 Bacteria 8120
68 Ga0070674_100043743 3300005356 Bacteria 3048
69 Ga0070674_100071663 3300005356 Bacteria 2451
70 Ga0070674_100205387 3300005356 Bacteria 1524
71 Ga0070674_100590880 3300005356 Bacteria 937
72 Ga0070674_100875005 3300005356 Bacteria 781
73 Ga0070674_101756821 3300005356 Unclassified 562
74 Ga0070673_100031861 3300005364 Bacteria 3961
75 Ga0070673_100141131 3300005364 Bacteria 2032
76 Ga0070673_100552157 3300005364 Bacteria 1046
77 Ga0070688_100001495 3300005365 Bacteria 11645
78 Ga0070688_100003161 3300005365 Bacteria 8431
79 Ga0070688_100027769 3300005365 Bacteria 3372
80 Ga0070688_100029478 3300005365 Bacteria 3286
81 Ga0070659_100030294 3300005366 Bacteria 4187
82 Ga0070659_100034767 3300005366 Bacteria 3921
83 Ga0070659_100043599 3300005366 Bacteria 3508
84 Ga0070659_100160643 3300005366 Bacteria 1837
85 Ga0070667_100201187 3300005367 Bacteria 1768
86 Ga0070667_100257313 3300005367 Bacteria 1562
87 Ga0070667_100448735 3300005367 Bacteria 1178
88 Ga0070667_100492359 3300005367 Bacteria 1123
89 Ga0070667_102062573 3300005367 Bacteria 537
90 Ga0070703_10056186 3300005406 Bacteria 1274
91 Ga0070709_10101770 3300005434 Bacteria 1915
92 Ga0070709_10110294 3300005434 Bacteria 1849
93 Ga0070709_10130372 3300005434 Bacteria 1716
94 Ga0070709_10358230 3300005434 Bacteria 1080
95 Ga0070709_10438838 3300005434 Unclassified 982
96 Ga0070714_100159551 3300005435 Bacteria 2039
97 Ga0070714_100218017 3300005435 Bacteria 1752
98 Ga0070714_100536880 3300005435 Bacteria 1118
99 Ga0070714_100592944 3300005435 Bacteria 1064
100 Ga0070713_100049133 3300005436 Bacteria 3478
101 Ga0070713_100050037 3300005436 Bacteria 3450
102 Ga0070713_100138058 3300005436 Bacteria 2156
103 Ga0070710_10010380 3300005437 Bacteria 4574
104 Ga0070710_10458067 3300005437 Bacteria 866
105 Ga0070701_10003269 3300005438 Bacteria 6385
106 Ga0070701_10016535 3300005438 Bacteria 3433
107 Ga0070701_10016833 3300005438 Bacteria 3406
108 Ga0070701_10035442 3300005438 Bacteria 2506
109 Ga0070701_10068570 3300005438 Bacteria 1890
110 Ga0070701_10524253 3300005438 Bacteria 773
111 Ga0070711_100012760 3300005439 Bacteria 5260
112 Ga0070711_100025198 3300005439 Bacteria 3888
113 Ga0070711_100278350 3300005439 Bacteria 1323
114 Ga0070711_100664614 3300005439 Bacteria 875
115 Ga0070705_100015616 3300005440 Bacteria 3930
116 Ga0070705_100087009 3300005440 Bacteria 1936
117 Ga0070705_100152535 3300005440 Bacteria 1534
118 Ga0070705_100202655 3300005440 Bacteria 1361
119 Ga0070705_100252936 3300005440 Bacteria 1238
120 Ga0070705_100332709 3300005440 Bacteria 1101
121 Ga0070705_100626081 3300005440 Bacteria 836
122 Ga0070705_100634864 3300005440 Bacteria 831
123 Ga0070700_100002701 3300005441 Bacteria 9054
124 Ga0070700_100006627 3300005441 Bacteria 6201
125 Ga0070700_100126264 3300005441 Bacteria 1720
126 Ga0070700_100141923 3300005441 Bacteria 1634
127 Ga0070700_101089122 3300005441 Bacteria 662
128 Ga0070694_100012886 3300005444 Bacteria 5213
129 Ga0070694_100015105 3300005444 Unclassified 4842
130 Ga0070694_100303805 3300005444 Bacteria 1223
131 Ga0070708_100029267 3300005445 Bacteria 4748
132 Ga0070708_100041036 3300005445 Bacteria 4056
133 Ga0070708_100206206 3300005445 Bacteria 1841
134 Ga0070708_100264388 3300005445 Bacteria 1617
135 Ga0070708_100545444 3300005445 Bacteria 1094
136 Ga0070708_101118543 3300005445 Bacteria 738
137 Ga0070663_100004611 3300005455 Bacteria 8117
138 Ga0070663_100025878 3300005455 Bacteria 3966
139 Ga0070663_100214394 3300005455 Bacteria 1509
140 Ga0070663_100676330 3300005455 Bacteria 875
141 Ga0070678_100065453 3300005456 Bacteria 2699
142 Ga0070678_100104449 3300005456 Bacteria 2203
143 Ga0070678_100541032 3300005456 Bacteria 1033
144 Ga0070678_100566222 3300005456 Bacteria 1010
145 Ga0070678_101228358 3300005456 Bacteria 696
146 Ga0070662_100006307 3300005457 Bacteria 7643
147 Ga0070662_100152083 3300005457 Bacteria 1803
148 Ga0070662_100191550 3300005457 Bacteria 1617
149 Ga0070662_100513406 3300005457 Bacteria 1000
150 Ga0070662_100601197 3300005457 Bacteria 925
151 Ga0070681_10325955 3300005458 Bacteria 1445
152 Ga0070681_10417248 3300005458 Bacteria 1254
153 Ga0070681_10422047 3300005458 Bacteria 1246
154 Ga0070681_10808714 3300005458 Bacteria 855
155 Ga0070681_11121665 3300005458 Bacteria 708
156 Ga0070681_11176058 3300005458 Unclassified 689
157 Ga0068867_100022787 3300005459 Archaea 4480
158 Ga0068867_100079655 3300005459 Bacteria 2465
159 Ga0068867_100188716 3300005459 Bacteria 1643
160 Ga0068867_100219770 3300005459 Bacteria 1531
161 Ga0068867_100318065 3300005459 Bacteria 1288
162 Ga0068867_100636499 3300005459 Bacteria 934
163 Ga0068867_101640957 3300005459 Bacteria 602
164 Ga0070685_10009789 3300005466 Bacteria 4969
165 Ga0070685_10073045 3300005466 Bacteria 2038
166 Ga0070685_10122912 3300005466 Bacteria 1614
167 Ga0070685_10665862 3300005466 Unclassified 756
168 Ga0070706_100031706 3300005467 Bacteria 4873
169 Ga0070706_100137357 3300005467 Bacteria 2281
170 Ga0070706_100178994 3300005467 Bacteria 1979
171 Ga0070706_101396416 3300005467 Bacteria 641
172 Ga0070707_100005156 3300005468 Bacteria 12238
173 Ga0070707_100037476 3300005468 Bacteria 4627
174 Ga0070707_100045684 3300005468 Bacteria 4191
175 Ga0070707_100173772 3300005468 Bacteria 2099
176 Ga0070698_100006705 3300005471 Bacteria 12489
177 Ga0070698_100008530 3300005471 Bacteria 11060
178 Ga0070698_100759562 3300005471 Unclassified 913
179 Ga0070698_101305082 3300005471 Bacteria 676
180 Ga0070699_100040412 3300005518 Bacteria 4039
181 Ga0070699_100072136 3300005518 Bacteria 3003
182 Ga0070699_100129759 3300005518 Bacteria 2222
183 Ga0070699_100238214 3300005518 Unclassified 1623
184 Ga0070699_100358885 3300005518 Bacteria 1314
185 Ga0070679_100543347 3300005530 Bacteria 1106
186 Ga0070684_100008777 3300005535 Bacteria 7925
187 Ga0070684_100022227 3300005535 Bacteria 5287
188 Ga0070684_100085782 3300005535 Bacteria 2793
189 Ga0070684_100129299 3300005535 Bacteria 2277
190 Ga0070684_100376778 3300005535 Bacteria 1307
191 Ga0070684_100799662 3300005535 Bacteria 881
192 Ga0070684_100911629 3300005535 Bacteria 823
193 Ga0070684_100928344 3300005535 Bacteria 816
194 Ga0070684_101459164 3300005535 Bacteria 644
195 Ga0070697_100333536 3300005536 Unclassified 1308
196 Ga0070697_100411042 3300005536 Bacteria 1175
197 Ga0068853_100007124 3300005539 Bacteria 8941
198 Ga0068853_100175147 3300005539 Bacteria 1943
199 Ga0068853_101092206 3300005539 Bacteria 769
200 Ga0070672_100154403 3300005543 Bacteria 1901
201 Ga0070686_100011152 3300005544 Bacteria 5092
202 Ga0070686_100024948 3300005544 Bacteria 3589
203 Ga0070686_100028819 3300005544 Bacteria 3371
204 Ga0070686_100038698 3300005544 Bacteria 2966
205 Ga0070686_100059773 3300005544 Bacteria 2457
206 Ga0070686_100520897 3300005544 Bacteria 926
207 Ga0070695_100041791 3300005545 Bacteria 2907
208 Ga0070695_100073483 3300005545 Bacteria 2244
209 Ga0070695_100359855 3300005545 Bacteria 1092
210 Ga0070696_100043709 3300005546 Bacteria 3100
211 Ga0070696_100053430 3300005546 Bacteria 2812
212 Ga0070696_100225880 3300005546 Bacteria 1407
213 Ga0070693_100002537 3300005547 Bacteria 8416
214 Ga0070693_100014448 3300005547 Bacteria 4046
215 Ga0070693_100040336 3300005547 Bacteria 2621
216 Ga0070693_100066641 3300005547 Bacteria 2108
217 Ga0070693_100716707 3300005547 Bacteria 734
218 Ga0070693_100755291 3300005547 Bacteria 717
219 Ga0070693_101103628 3300005547 Bacteria 605
220 Ga0070665_100076527 3300005548 Bacteria 3353
221 Ga0070665_100717680 3300005548 Bacteria 1013
222 Ga0070704_100070285 3300005549 Bacteria 2539
223 Ga0070704_100154609 3300005549 Bacteria 1807
224 Ga0070704_100173468 3300005549 Bacteria 1717
225 Ga0070704_100258801 3300005549 Bacteria 1433
226 Ga0070704_100262823 3300005549 Bacteria 1422
227 Ga0070704_100267993 3300005549 Unclassified 1410
228 Ga0070704_100365632 3300005549 Unclassified 1222
229 Ga0068855_100070620 3300005563 Bacteria 4062
230 Ga0068855_100099853 3300005563 Bacteria 3342
231 Ga0068855_100104637 3300005563 Bacteria 3255
232 Ga0068855_100187316 3300005563 Bacteria 2337
233 Ga0068855_100424434 3300005563 Bacteria 1454
234 Ga0068855_100536482 3300005563 Unclassified 1268
235 Ga0070664_100110983 3300005564 Bacteria 2393
236 Ga0070664_100291260 3300005564 Bacteria 1474
237 Ga0070664_100315790 3300005564 Bacteria 1415
238 Ga0070664_100430679 3300005564 Bacteria 1209
239 Ga0070664_101578107 3300005564 Bacteria 621
240 Ga0068857_100043075 3300005577 Bacteria 4004
241 Ga0068857_101466281 3300005577 Unclassified 664
242 Ga0068854_100106263 3300005578 Bacteria 2111
243 Ga0068854_100136461 3300005578 Bacteria 1878
244 Ga0068854_100189485 3300005578 Bacteria 1611
245 Ga0068854_100217001 3300005578 Bacteria 1511
246 Ga0068854_100457348 3300005578 Bacteria 1067
247 Ga0068856_100043626 3300005614 Bacteria 4412
248 Ga0068856_100293269 3300005614 Bacteria 1643
249 Ga0068856_101172968 3300005614 Bacteria 785
250 Ga0068856_101624293 3300005614 Bacteria 659
251 Ga0070702_100005769 3300005615 Bacteria 5801
252 Ga0070702_100170584 3300005615 Bacteria 1415
253 Ga0070702_100191971 3300005615 Bacteria 1345
254 Ga0070702_100239850 3300005615 Bacteria 1223
255 Ga0070702_101693303 3300005615 Bacteria 525
256 Ga0068852_100057319 3300005616 Bacteria 3370
257 Ga0068852_100182238 3300005616 Bacteria 1976
258 Ga0068852_102377821 3300005616 Bacteria 551
259 Ga0068859_100143426 3300005617 Bacteria 2462
260 Ga0068859_100275326 3300005617 Bacteria 1775
261 Ga0068859_100686596 3300005617 Bacteria 1115
262 Ga0068859_101172641 3300005617 Bacteria 846
263 Ga0068864_100032617 3300005618 Bacteria 4426
264 Ga0068864_100044531 3300005618 Bacteria 3804
265 Ga0068864_100130598 3300005618 Bacteria 2256
266 Ga0068864_100621651 3300005618 Bacteria 1050
267 Ga0068866_10008580 3300005718 Bacteria 4314
268 Ga0068866_10049089 3300005718 Bacteria 2136
269 Ga0068866_10399327 3300005718 Bacteria 886
270 Ga0068866_10759161 3300005718 Bacteria 671
271 Ga0068866_10879717 3300005718 Unclassified 629
272 Ga0068861_100020719 3300005719 Bacteria 4714
273 Ga0068861_100034543 3300005719 Bacteria 3740
274 Ga0068861_100058785 3300005719 Bacteria 2941
275 Ga0068861_100093414 3300005719 Bacteria 2379
276 Ga0068861_100155443 3300005719 Bacteria 1881
277 Ga0068861_100350368 3300005719 Unclassified 1295
278 Ga0068861_100351301 3300005719 Bacteria 1293
279 Ga0068851_10004639 3300005834 Bacteria 6204
280 Ga0068870_10002411 3300005840 Bacteria 7774
281 Ga0068870_10080998 3300005840 Bacteria 1795
282 Ga0068870_10776153 3300005840 Bacteria 668
283 Ga0068863_100247655 3300005841 Bacteria 1721
284 Ga0068863_100430024 3300005841 Bacteria 1294
285 Ga0068863_100507572 3300005841 Bacteria 1188
286 Ga0068858_100012205 3300005842 Bacteria 8099
287 Ga0068860_100117410 3300005843 Bacteria 2546
288 Ga0068860_100158294 3300005843 Bacteria 2183
289 Ga0068860_100201266 3300005843 Bacteria 1930
290 Ga0068860_100515837 3300005843 Bacteria 1195
291 Ga0068860_100922744 3300005843 Bacteria 890
292 Ga0068860_101034368 3300005843 Bacteria 840
293 Ga0068860_101397184 3300005843 Bacteria 721
294 Ga0068862_100141512 3300005844 Bacteria 2135
295 Ga0068862_100189895 3300005844 Bacteria 1848
296 Ga0068862_100220821 3300005844 Bacteria 1715
297 Ga0068862_100448624 3300005844 Bacteria 1216
298 Ga0068862_101368300 3300005844 Unclassified 710
299 Ga0081455_10004114 3300005937 Bacteria 16459
300 Ga0081455_10024464 3300005937 Bacteria 5591
301 Ga0081455_10050772 3300005937 Bacteria 3563
302 Ga0081455_10170601 3300005937 Bacteria 1658
303 Ga0081455_10173791 3300005937 Bacteria 1638
304 Ga0081455_10249845 3300005937 Unclassified 1298
305 Ga0081455_10342795 3300005937 Bacteria 1057
306 Ga0081540_1001751 3300005983 Bacteria 18248
307 Ga0081540_1005933 3300005983 Bacteria 9017
308 Ga0081539_10003629 3300005985 Bacteria 18589
309 Ga0081539_10007824 3300005985 Bacteria 9556
310 Ga0070717_10004499 3300006028 Bacteria 10074
311 Ga0070717_10027533 3300006028 Bacteria 4544
312 Ga0070717_10050375 3300006028 Bacteria 3422
313 Ga0070717_10092524 3300006028 Bacteria 2555
314 Ga0070717_10369721 3300006028 Bacteria 1284
315 Ga0075365_10181819 3300006038 Bacteria 1470
316 Ga0075365_10256621 3300006038 Bacteria 1229
317 Ga0075365_10624394 3300006038 Unclassified 762
318 Ga0075364_10025675 3300006051 Bacteria 3752
319 Ga0075364_10505855 3300006051 Bacteria 826
320 Ga0075432_10007366 3300006058 Bacteria 3746
321 Ga0075432_10038258 3300006058 Bacteria 1671
322 Ga0075432_10101231 3300006058 Bacteria 1065
323 Ga0070715_10014142 3300006163 Bacteria 2948
324 Ga0070716_100000663 3300006173 Bacteria 14622
325 Ga0070716_100026835 3300006173 Bacteria 3087
326 Ga0070716_100517089 3300006173 Bacteria 884
327 Ga0070716_100780722 3300006173 Bacteria 738
328 Ga0070712_100280728 3300006175 Bacteria 1341
329 Ga0075427_10038165 3300006194 Bacteria 804
330 Ga0097621_100140729 3300006237 Bacteria 2061
331 Ga0097621_100226268 3300006237 Bacteria 1632
332 Ga0097621_100238605 3300006237 Bacteria 1589
333 Ga0097621_100726520 3300006237 Bacteria 916
334 Ga0068871_100038742 3300006358 Bacteria 3809
335 Ga0068871_100278901 3300006358 Bacteria 1462
336 Ga0068871_100437060 3300006358 Bacteria 1171
337 Ga0068871_100446537 3300006358 Bacteria 1158
338 Ga0075428_100025876 3300006844 Bacteria 6498
339 Ga0075428_100064762 3300006844 Bacteria 4004
340 Ga0075428_100727339 3300006844 Unclassified 1057
341 Ga0075430_100005301 3300006846 Bacteria 10878
342 Ga0075430_100407673 3300006846 Bacteria 1122
343 Ga0075431_100009313 3300006847 Bacteria 9853
344 Ga0075431_100150180 3300006847 Bacteria 2399
345 Ga0075431_100262961 3300006847 Bacteria 1750
346 Ga0075431_100361367 3300006847 Bacteria 1458
347 Ga0075431_100395249 3300006847 Bacteria 1384
348 Ga0075433_10074552 3300006852 Bacteria 2986
349 Ga0075434_100028252 3300006871 Bacteria 5509
350 Ga0075434_100222981 3300006871 Bacteria 1905
351 Ga0075434_100240998 3300006871 Bacteria 1828
352 Ga0075434_100588560 3300006871 Bacteria 1132
353 Ga0075434_101781791 3300006871 Bacteria 623
354 Ga0075429_100027656 3300006880 Bacteria 4923
355 Ga0075429_100028833 3300006880 Bacteria 4821
356 Ga0075429_100249387 3300006880 Bacteria 1555
357 Ga0075429_100329618 3300006880 Unclassified 1336
358 Ga0075429_100460089 3300006880 Bacteria 1115
359 Ga0068865_100008070 3300006881 Bacteria 6499
360 Ga0068865_100049638 3300006881 Bacteria 2894
361 Ga0068865_100061453 3300006881 Bacteria 2634
362 Ga0068865_100114803 3300006881 Bacteria 1992
363 Ga0068865_100216104 3300006881 Bacteria 1496
364 Ga0068865_100460840 3300006881 Bacteria 1053
365 Ga0068865_100768938 3300006881 Bacteria 829
366 Ga0097620_100143433 3300006931 Bacteria 2462
367 Ga0097620_100275336 3300006931 Bacteria 1775
368 Ga0097620_100686751 3300006931 Bacteria 1115
369 Ga0097620_101172540 3300006931 Bacteria 846
370 Ga0075435_100002120 3300007076 Bacteria 13067
371 Ga0075435_100038520 3300007076 Bacteria 3811
372 Ga0075435_100432484 3300007076 Bacteria 1134
373 Ga0075435_100448504 3300007076 Unclassified 1112
374 Ga0075435_101490363 3300007076 Unclassified 593
375 Ga0105251_10158903 3300009011 Unclassified 1019
376 Ga0105240_10272672 3300009093 Bacteria 1947
377 Ga0105240_12418306 3300009093 Bacteria 544
378 Ga0111539_10001300 3300009094 Bacteria 33359
379 Ga0111539_10026624 3300009094 Bacteria 7069
380 Ga0111539_10062606 3300009094 Bacteria 4403
381 Ga0111539_10070924 3300009094 Bacteria 4112
382 Ga0111539_10086896 3300009094 Bacteria 3674
383 Ga0111539_10360120 3300009094 Bacteria 1693
384 Ga0111539_10391808 3300009094 Bacteria 1618
385 Ga0111539_10415259 3300009094 Bacteria 1567
386 Ga0111539_10613930 3300009094 Bacteria 1266
387 Ga0111539_10638007 3300009094 Bacteria 1240
388 Ga0111539_11733765 3300009094 Bacteria 724
389 Ga0105245_10005009 3300009098 Bacteria 11643
390 Ga0105245_10006850 3300009098 Bacteria 9994
391 Ga0105245_10007026 3300009098 Bacteria 9879
392 Ga0105245_10011927 3300009098 Bacteria 7556
393 Ga0105245_10023010 3300009098 Bacteria 5467
394 Ga0105245_10029924 3300009098 Bacteria 4815
395 Ga0105245_10058255 3300009098 Bacteria 3477
396 Ga0105245_10080889 3300009098 Bacteria 2968
397 Ga0105245_10129850 3300009098 Bacteria 2362
398 Ga0105245_10155239 3300009098 Bacteria 2167
399 Ga0105245_10190067 3300009098 Bacteria 1966
400 Ga0105245_10903135 3300009098 Bacteria 925
401 Ga0105245_11162393 3300009098 Bacteria 819
402 Ga0105247_10038579 3300009101 Bacteria 2917
403 Ga0105247_10039881 3300009101 Bacteria 2870
404 Ga0114129_10017948 3300009147 Bacteria 10075
405 Ga0114129_10025388 3300009147 Bacteria 8395
406 Ga0114129_10221016 3300009147 Bacteria 2555
407 Ga0114129_10250599 3300009147 Bacteria 2377
408 Ga0114129_10262875 3300009147 Bacteria 2312
409 Ga0114129_10367673 3300009147 Bacteria 1902
410 Ga0114129_10427919 3300009147 Bacteria 1740
411 Ga0114129_10441889 3300009147 Unclassified 1707
412 Ga0114129_10635608 3300009147 Bacteria 1379
413 Ga0114129_11411463 3300009147 Bacteria 859
414 Ga0114129_11588031 3300009147 Bacteria 801
415 Ga0114129_11601796 3300009147 Bacteria 797
416 Ga0114129_12127753 3300009147 Unclassified 676
417 Ga0114129_12564375 3300009147 Bacteria 609
418 Ga0114129_13474414 3300009147 Unclassified 504
419 Ga0105243_10016980 3300009148 Bacteria 5503
420 Ga0105243_10018403 3300009148 Bacteria 5291
421 Ga0105243_10020309 3300009148 Bacteria 5037
422 Ga0105243_10120478 3300009148 Bacteria 2211
423 Ga0105243_10231886 3300009148 Bacteria 1638
424 Ga0105243_10299535 3300009148 Bacteria 1457
425 Ga0105243_10417362 3300009148 Bacteria 1251
426 Ga0105243_10578083 3300009148 Bacteria 1078
427 Ga0105243_11962433 3300009148 Bacteria 619
428 Ga0105241_10025150 3300009174 Bacteria 4425
429 Ga0105241_10085677 3300009174 Bacteria 2476
430 Ga0105241_10194519 3300009174 Unclassified 1690
431 Ga0105241_10264996 3300009174 Bacteria 1461
432 Ga0105241_11245208 3300009174 Unclassified 706
433 Ga0105242_10054489 3300009176 Bacteria 3269
434 Ga0105242_10057114 3300009176 Bacteria 3195
435 Ga0105242_10090548 3300009176 Bacteria 2573
436 Ga0105242_10228509 3300009176 Bacteria 1666
437 Ga0105242_10261080 3300009176 Bacteria 1565
438 Ga0105242_10275626 3300009176 Bacteria 1526
439 Ga0105242_10291678 3300009176 Bacteria 1486
440 Ga0105242_10489243 3300009176 Unclassified 1168
441 Ga0105242_10502618 3300009176 Bacteria 1153
442 Ga0105248_10059696 3300009177 Bacteria 4284
443 Ga0105248_10192729 3300009177 Bacteria 2297
444 Ga0105248_10263635 3300009177 Bacteria 1940
445 Ga0105248_10523506 3300009177 Bacteria 1337
446 Ga0105248_11227193 3300009177 Bacteria 848
447 Ga0105248_12526910 3300009177 Bacteria 585
448 Ga0105237_10772838 3300009545 Bacteria 967
449 Ga0105238_10046555 3300009551 Bacteria 4376
450 Ga0105249_10022421 3300009553 Bacteria 5656
451 Ga0105249_10042394 3300009553 Bacteria 4139
452 Ga0105249_10106711 3300009553 Bacteria 2643
453 Ga0105249_10118880 3300009553 Bacteria 2509
454 Ga0105249_10155091 3300009553 Bacteria 2208
455 Ga0105249_10212688 3300009553 Bacteria 1898
456 Ga0105239_10054011 3300010375 Unclassified 4405
457 Ga0105239_10682275 3300010375 Bacteria 1174
458 Ga0105239_10772101 3300010375 Bacteria 1100
459 Ga0105239_11052229 3300010375 Bacteria 936
460 Ga0105246_10008409 3300011119 Bacteria 6344
461 Ga0105246_10020264 3300011119 Bacteria 4263
462 Ga0105246_10032448 3300011119 Bacteria 3463
463 Ga0105246_10157983 3300011119 Bacteria 1724
464 Ga0105246_10436670 3300011119 Bacteria 1097
465 Ga0105246_10941796 3300011119 Bacteria 778
466 Ga0157314_1005294 3300012500 Bacteria 976
467 Ga0157339_1033690 3300012505 Bacteria 612
468 Ga0157371_10100598 3300013102 Bacteria 2050
469 Ga0157371_10163072 3300013102 Bacteria 1592
470 Ga0157371_10214330 3300013102 Bacteria 1382
471 Ga0157371_11488747 3300013102 Bacteria 528
472 Ga0157370_10072748 3300013104 Bacteria 3243
473 Ga0157369_10116690 3300013105 Bacteria 2834
474 Ga0157369_10328377 3300013105 Bacteria 1589
475 Ga0157369_10798741 3300013105 Bacteria 970
476 Ga0157369_12141966 3300013105 Bacteria 567
477 Ga0157374_10006679 3300013296 Bacteria 9803
478 Ga0157374_10090651 3300013296 Bacteria 2914
479 Ga0157374_10100997 3300013296 Bacteria 2766
480 Ga0157374_10160625 3300013296 Bacteria 2189
481 Ga0157374_10316502 3300013296 Bacteria 1546
482 Ga0157374_10581655 3300013296 Bacteria 1129
483 Ga0157374_12089078 3300013296 Unclassified 593
484 Ga0157378_10030477 3300013297 Bacteria 4767
485 Ga0157378_10640768 3300013297 Bacteria 1077
486 Ga0157378_11096424 3300013297 Bacteria 833
487 Ga0163162_10015163 3300013306 Bacteria 7527
488 Ga0163162_10062392 3300013306 Bacteria 3767
489 Ga0163162_10167749 3300013306 Unclassified 2319
490 Ga0163162_10817772 3300013306 Bacteria 1048
491 Ga0157372_10164556 3300013307 Bacteria 2564
492 Ga0157372_10400861 3300013307 Bacteria 1599
493 Ga0157372_10739771 3300013307 Bacteria 1144
494 Ga0157372_13366590 3300013307 Bacteria 509
495 Ga0157375_10028862 3300013308 Bacteria 5208
496 Ga0157375_10043912 3300013308 Bacteria 4337
497 Ga0157375_10283694 3300013308 Unclassified 1819
498 Ga0157375_10362507 3300013308 Bacteria 1616
499 Ga0157375_10446781 3300013308 Bacteria 1458
500 Ga0157375_11035639 3300013308 Unclassified 959
501 Ga0163163_10004711 3300014325 Bacteria 11685
502 Ga0163163_10005098 3300014325 Bacteria 11324
503 Ga0163163_11191612 3300014325 Bacteria 824
504 Ga0157380_10000820 3300014326 Bacteria 19481
505 Ga0157380_10078485 3300014326 Bacteria 2693
506 Ga0157380_10258387 3300014326 Bacteria 1581
507 Ga0157380_11022686 3300014326 Bacteria 861
508 Ga0157380_11422974 3300014326 Bacteria 744
509 Ga0157380_12652401 3300014326 Bacteria 567
510 Ga0157377_10012869 3300014745 Bacteria 4218
511 Ga0157377_10025499 3300014745 Bacteria 3154
512 Ga0157377_10061866 3300014745 Bacteria 2141
513 Ga0157377_10100202 3300014745 Bacteria 1725
514 Ga0157377_10119201 3300014745 Bacteria 1597
515 Ga0157377_10328004 3300014745 Bacteria 1019
516 Ga0157377_11003628 3300014745 Bacteria 632
517 Ga0157377_11200624 3300014745 Unclassified 587
518 Ga0157379_10150788 3300014968 Bacteria 2097
519 Ga0157379_10460288 3300014968 Bacteria 1175
520 Ga0157379_11157721 3300014968 Bacteria 742
521 Ga0157376_10003493 3300014969 Bacteria 10836
522 Ga0157376_10014456 3300014969 Bacteria 5927
523 Ga0157376_10055617 3300014969 Bacteria 3302
524 Ga0157376_10196312 3300014969 Bacteria 1854
525 Ga0157376_10431237 3300014969 Bacteria 1281
526 Ga0157376_10475813 3300014969 Bacteria 1223
527 Ga0157376_10990826 3300014969 Bacteria 862
528 Ga0163161_10020279 3300017792 Bacteria 4664
529 Ga0163161_10037167 3300017792 Bacteria 3490
530 Ga0163161_10102290 3300017792 Bacteria 2134
531 Ga0163161_10517554 3300017792 Bacteria 974
532 Ga0163161_11667215 3300017792 Bacteria 564
533 Ga0206353_10024931 3300020082 Bacteria 1209
534 Ga0207697_10172200 3300025315 Bacteria 947
535 Ga0207697_10218753 3300025315 Bacteria 840
536 Ga0207656_10094726 3300025321 Bacteria 1360
537 Ga0207692_10006470 3300025898 Bacteria 4749
538 Ga0207692_10055620 3300025898 Bacteria 2027
539 Ga0207642_10004754 3300025899 Bacteria 4387
540 Ga0207642_10064284 3300025899 Bacteria 1720
541 Ga0207642_10551027 3300025899 Bacteria 712
542 Ga0207688_10005248 3300025901 Bacteria 7039
543 Ga0207688_10009489 3300025901 Bacteria 5296
544 Ga0207688_10014758 3300025901 Bacteria 4239
545 Ga0207688_10035442 3300025901 Bacteria 2765
546 Ga0207688_10055378 3300025901 Bacteria 2226
547 Ga0207688_10056107 3300025901 Bacteria 2212
548 Ga0207647_10120800 3300025904 Bacteria 1545
549 Ga0207647_10122005 3300025904 Bacteria 1536
550 Ga0207647_10450914 3300025904 Unclassified 721
551 Ga0207685_10004888 3300025905 Bacteria 3468
552 Ga0207685_10018092 3300025905 Bacteria 2293
553 Ga0207685_10141903 3300025905 Bacteria 1078
554 Ga0207685_10305143 3300025905 Bacteria 789
555 Ga0207699_10092826 3300025906 Bacteria 1898
556 Ga0207699_10096502 3300025906 Bacteria 1866
557 Ga0207699_10855847 3300025906 Bacteria 670
558 Ga0207699_10992185 3300025906 Bacteria 621
559 Ga0207645_10025047 3300025907 Bacteria 3863
560 Ga0207645_10115624 3300025907 Bacteria 1739
561 Ga0207645_10244802 3300025907 Bacteria 1185
562 Ga0207643_10070350 3300025908 Bacteria 2012
563 Ga0207643_10283382 3300025908 Bacteria 1028
564 Ga0207643_10331843 3300025908 Bacteria 952
565 Ga0207643_10352515 3300025908 Bacteria 924
566 Ga0207705_10338169 3300025909 Bacteria 1158
567 Ga0207684_10014283 3300025910 Bacteria 6849
568 Ga0207684_10131761 3300025910 Bacteria 2145
569 Ga0207684_10206093 3300025910 Bacteria 1696
570 Ga0207654_10063579 3300025911 Bacteria 2167
571 Ga0207707_10151644 3300025912 Bacteria 2026
572 Ga0207707_10335172 3300025912 Bacteria 1305
573 Ga0207707_10613529 3300025912 Bacteria 920
574 Ga0207695_10340146 3300025913 Bacteria 1388
575 Ga0207671_10162534 3300025914 Bacteria 1730
576 Ga0207671_11156606 3300025914 Archaea 606
577 Ga0207693_10000468 3300025915 Bacteria 36863
578 Ga0207693_10002699 3300025915 Bacteria 15380
579 Ga0207693_10005673 3300025915 Bacteria 10376
580 Ga0207693_10013206 3300025915 Bacteria 6664
581 Ga0207693_10026932 3300025915 Bacteria 4547
582 Ga0207693_10034674 3300025915 Bacteria 3981
583 Ga0207693_10112075 3300025915 Bacteria 2140
584 Ga0207663_10004759 3300025916 Bacteria 6780
585 Ga0207663_10119254 3300025916 Unclassified 1803
586 Ga0207663_10169674 3300025916 Bacteria 1549
587 Ga0207663_10214793 3300025916 Bacteria 1396
588 Ga0207660_10062759 3300025917 Bacteria 2678
589 Ga0207660_10103287 3300025917 Bacteria 2132
590 Ga0207660_10116295 3300025917 Bacteria 2020
591 Ga0207660_10338680 3300025917 Bacteria 1204
592 Ga0207660_10497649 3300025917 Bacteria 989
593 Ga0207662_10056177 3300025918 Bacteria 2350
594 Ga0207662_10074188 3300025918 Bacteria 2065
595 Ga0207657_10001010 3300025919 Bacteria 29952
596 Ga0207657_10062881 3300025919 Bacteria 3176
597 Ga0207657_10095825 3300025919 Bacteria 2469
598 Ga0207657_10119052 3300025919 Unclassified 2173
599 Ga0207657_10712855 3300025919 Unclassified 779
600 Ga0207649_10854879 3300025920 Unclassified 712
601 Ga0207649_11116269 3300025920 Bacteria 622
602 Ga0207652_10276867 3300025921 Bacteria 1514
603 Ga0207646_10007769 3300025922 Bacteria 10853
604 Ga0207646_10009003 3300025922 Bacteria 9924
605 Ga0207646_10363970 3300025922 Bacteria 1306
606 Ga0207681_10030241 3300025923 Bacteria 3529
607 Ga0207681_10091381 3300025923 Bacteria 2175
608 Ga0207681_10198511 3300025923 Bacteria 1539
609 Ga0207681_10286095 3300025923 Bacteria 1300
610 Ga0207681_10776915 3300025923 Bacteria 799
611 Ga0207694_10026457 3300025924 Bacteria 4413
612 Ga0207650_10014921 3300025925 Bacteria 5405
613 Ga0207650_10030691 3300025925 Bacteria 3874
614 Ga0207650_10240503 3300025925 Bacteria 1463
615 Ga0207659_10022079 3300025926 Bacteria 4234
616 Ga0207659_10311417 3300025926 Bacteria 1296
617 Ga0207659_10365311 3300025926 Bacteria 1200
618 Ga0207659_10372850 3300025926 Bacteria 1189
619 Ga0207659_10470404 3300025926 Bacteria 1061
620 Ga0207659_10603928 3300025926 Bacteria 936
621 Ga0207687_10017159 3300025927 Bacteria 4760
622 Ga0207687_10045339 3300025927 Bacteria 3039
623 Ga0207687_10110337 3300025927 Bacteria 2040
624 Ga0207687_10136192 3300025927 Bacteria 1857
625 Ga0207687_10136707 3300025927 Bacteria 1854
626 Ga0207687_10163594 3300025927 Bacteria 1710
627 Ga0207687_10179796 3300025927 Bacteria 1638
628 Ga0207687_10320444 3300025927 Bacteria 1255
629 Ga0207687_10511191 3300025927 Bacteria 1004
630 Ga0207687_10679087 3300025927 Unclassified 873
631 Ga0207700_10149119 3300025928 Bacteria 1931
632 Ga0207700_10186943 3300025928 Bacteria 1738
633 Ga0207700_10254325 3300025928 Bacteria 1502
634 Ga0207664_10015157 3300025929 Bacteria 5586
635 Ga0207664_10028593 3300025929 Bacteria 4238
636 Ga0207664_10431177 3300025929 Unclassified 1175
637 Ga0207644_10046784 3300025931 Bacteria 3084
638 Ga0207644_10151691 3300025931 Bacteria 1794
639 Ga0207644_10185486 3300025931 Bacteria 1633
640 Ga0207690_10116490 3300025932 Bacteria 1932
641 Ga0207690_10350480 3300025932 Bacteria 1167
642 Ga0207690_10743568 3300025932 Bacteria 808
643 Ga0207690_10767466 3300025932 Bacteria 796
644 Ga0207706_10003053 3300025933 Bacteria 16118
645 Ga0207706_10029490 3300025933 Bacteria 4897
646 Ga0207706_10037122 3300025933 Archaea 4327
647 Ga0207706_10052872 3300025933 Bacteria 3586
648 Ga0207706_10078082 3300025933 Bacteria 2912
649 Ga0207706_10136076 3300025933 Bacteria 2162
650 Ga0207706_10294619 3300025933 Bacteria 1414
651 Ga0207706_10523556 3300025933 Unclassified 1022
652 Ga0207706_10572431 3300025933 Bacteria 971
653 Ga0207706_10605488 3300025933 Unclassified 941
654 Ga0207686_10002592 3300025934 Bacteria 9812
655 Ga0207686_10024437 3300025934 Bacteria 3502
656 Ga0207686_10051819 3300025934 Bacteria 2558
657 Ga0207686_10152740 3300025934 Bacteria 1609
658 Ga0207686_10206348 3300025934 Bacteria 1410
659 Ga0207686_10232702 3300025934 Bacteria 1337
660 Ga0207686_10314152 3300025934 Bacteria 1168
661 Ga0207709_10004481 3300025935 Bacteria 8063
662 Ga0207709_10040521 3300025935 Bacteria 2789
663 Ga0207709_10106688 3300025935 Bacteria 1864
664 Ga0207709_10124695 3300025935 Bacteria 1745
665 Ga0207709_10425075 3300025935 Bacteria 1021
666 Ga0207670_10020602 3300025936 Bacteria 4055
667 Ga0207670_10148695 3300025936 Bacteria 1735
668 Ga0207669_10013142 3300025937 Bacteria 4101
669 Ga0207669_10058883 3300025937 Bacteria 2346
670 Ga0207669_10158783 3300025937 Bacteria 1594
671 Ga0207669_10503455 3300025937 Bacteria 969
672 Ga0207669_10857163 3300025937 Bacteria 756
673 Ga0207704_10004272 3300025938 Archaea 6530
674 Ga0207704_10190823 3300025938 Bacteria 1490
675 Ga0207704_10311456 3300025938 Unclassified 1210
676 Ga0207704_10569689 3300025938 Bacteria 923
677 Ga0207704_11206536 3300025938 Unclassified 645
678 Ga0207665_10005276 3300025939 Bacteria 8637
679 Ga0207665_10016737 3300025939 Bacteria 4816
680 Ga0207665_10019092 3300025939 Bacteria 4504
681 Ga0207691_10004591 3300025940 Bacteria 13375
682 Ga0207691_10024335 3300025940 Bacteria 5695
683 Ga0207691_10033336 3300025940 Bacteria 4795
684 Ga0207691_10254907 3300025940 Bacteria 1513
685 Ga0207711_10231488 3300025941 Bacteria 1692
686 Ga0207711_10319226 3300025941 Bacteria 1435
687 Ga0207711_10403199 3300025941 Bacteria 1271
688 Ga0207711_11855884 3300025941 Bacteria 546
689 Ga0207689_10118363 3300025942 Bacteria 2179
690 Ga0207689_10530708 3300025942 Bacteria 987
691 Ga0207689_11092254 3300025942 Unclassified 672
692 Ga0207661_10062508 3300025944 Bacteria 3013
693 Ga0207661_10212962 3300025944 Bacteria 1704
694 Ga0207661_10354344 3300025944 Bacteria 1324
695 Ga0207661_10373693 3300025944 Bacteria 1289
696 Ga0207661_10953893 3300025944 Bacteria 790
697 Ga0207661_11171372 3300025944 Bacteria 707
698 Ga0207679_10052810 3300025945 Bacteria 2983
699 Ga0207679_10433856 3300025945 Bacteria 1162
700 Ga0207679_11118912 3300025945 Bacteria 723
701 Ga0207667_10122244 3300025949 Bacteria 2682
702 Ga0207667_10130288 3300025949 Bacteria 2591
703 Ga0207667_10409006 3300025949 Bacteria 1381
704 Ga0207667_10464306 3300025949 Unclassified 1286
705 Ga0207651_10058205 3300025960 Bacteria 2670
706 Ga0207651_10060356 3300025960 Bacteria 2632
707 Ga0207651_10081292 3300025960 Bacteria 2335
708 Ga0207651_10301550 3300025960 Bacteria 1332
709 Ga0207651_10312521 3300025960 Bacteria 1311
710 Ga0207651_10614236 3300025960 Bacteria 952
711 Ga0207712_10037905 3300025961 Archaea 3292
712 Ga0207712_10066524 3300025961 Bacteria 2576
713 Ga0207712_10251913 3300025961 Bacteria 1428
714 Ga0207668_10065371 3300025972 Bacteria 2574
715 Ga0207668_10143420 3300025972 Bacteria 1840
716 Ga0207668_10512052 3300025972 Bacteria 1034
717 Ga0207668_11772023 3300025972 Unclassified 557
718 Ga0207640_10251955 3300025981 Bacteria 1371
719 Ga0207640_10567292 3300025981 Bacteria 956
720 Ga0207640_10754479 3300025981 Bacteria 839
721 Ga0207640_11471608 3300025981 Bacteria 611
722 Ga0207658_10340731 3300025986 Bacteria 1303
723 Ga0207658_10653487 3300025986 Bacteria 948
724 Ga0207677_10050647 3300026023 Bacteria 2810
725 Ga0207677_10054351 3300026023 Bacteria 2732
726 Ga0207677_10061821 3300026023 Bacteria 2595
727 Ga0207677_10190351 3300026023 Bacteria 1622
728 Ga0207677_10342949 3300026023 Bacteria 1249
729 Ga0207639_10035329 3300026041 Unclassified 3698
730 Ga0207639_10268205 3300026041 Bacteria 1496
731 Ga0207678_10007870 3300026067 Bacteria 9404
732 Ga0207678_10028896 3300026067 Bacteria 4839
733 Ga0207678_10034547 3300026067 Bacteria 4403
734 Ga0207678_10108329 3300026067 Bacteria 2370
735 Ga0207678_11595420 3300026067 Bacteria 575
736 Ga0207708_10000434 3300026075 Bacteria 32516
737 Ga0207708_10006543 3300026075 Bacteria 8623
738 Ga0207708_10010108 3300026075 Bacteria 7007
739 Ga0207708_10259655 3300026075 Bacteria 1402
740 Ga0207708_10612065 3300026075 Bacteria 924
741 Ga0207708_10621758 3300026075 Bacteria 917
742 Ga0207708_10983921 3300026075 Bacteria 732
743 Ga0207702_10006809 3300026078 Bacteria 9802
744 Ga0207702_10037538 3300026078 Bacteria 4056
745 Ga0207702_10099432 3300026078 Bacteria 2564
746 Ga0207702_10381755 3300026078 Bacteria 1355
747 Ga0207702_10873666 3300026078 Bacteria 891
748 Ga0207702_11109645 3300026078 Bacteria 785
749 Ga0207702_12211051 3300026078 Bacteria 539
750 Ga0207641_10391377 3300026088 Bacteria 1333
751 Ga0207641_11340768 3300026088 Bacteria 716
752 Ga0207648_10003561 3300026089 Bacteria 16283
753 Ga0207648_10010611 3300026089 Bacteria 8711
754 Ga0207648_10194727 3300026089 Bacteria 1797
755 Ga0207648_10197230 3300026089 Bacteria 1785
756 Ga0207648_10521671 3300026089 Bacteria 1089
757 Ga0207648_10797361 3300026089 Bacteria 879
758 Ga0207648_10860523 3300026089 Bacteria 846
759 Ga0207676_10049792 3300026095 Bacteria 3262
760 Ga0207676_10173590 3300026095 Bacteria 1880
761 Ga0207676_10603859 3300026095 Bacteria 1054
762 Ga0207674_10183829 3300026116 Bacteria 2041
763 Ga0207674_11810939 3300026116 Bacteria 577
764 Ga0207675_100000929 3300026118 Bacteria 29254
765 Ga0207675_100022783 3300026118 Bacteria 5828
766 Ga0207675_100042327 3300026118 Bacteria 4252
767 Ga0207675_100061539 3300026118 Bacteria 3504
768 Ga0207675_100125449 3300026118 Bacteria 2432
769 Ga0207675_100145230 3300026118 Bacteria 2255
770 Ga0207675_100906463 3300026118 Bacteria 898
771 Ga0207675_100982677 3300026118 Bacteria 862
772 Ga0207683_10008655 3300026121 Bacteria 8703
773 Ga0207683_10014994 3300026121 Bacteria 6596
774 Ga0207683_10016453 3300026121 Bacteria 6295
775 Ga0207683_10022492 3300026121 Bacteria 5412
776 Ga0207683_10083078 3300026121 Bacteria 2846
777 Ga0207683_10123157 3300026121 Bacteria 2329
778 Ga0207683_10194938 3300026121 Bacteria 1840
779 Ga0207683_10322856 3300026121 Bacteria 1414
780 Ga0207698_10104801 3300026142 Bacteria 2354
781 Ga0207698_10133410 3300026142 Bacteria 2126
782 Ga0207698_10158699 3300026142 Bacteria 1975
783 Ga0209966_1127929 3300027695 Bacteria 585
784 Ga0209974_10149298 3300027876 Bacteria 843
785 Ga0207428_10016203 3300027907 Bacteria 6417
786 Ga0207428_10017291 3300027907 Bacteria 6192
787 Ga0207428_10030243 3300027907 Bacteria 4479
788 Ga0207428_10041952 3300027907 Bacteria 3703
789 Ga0207428_10059700 3300027907 Bacteria 3023
790 Ga0207428_10237150 3300027907 Unclassified 1364
791 Ga0207428_10258606 3300027907 Bacteria 1297
792 Ga0207428_10499753 3300027907 Bacteria 883
793 Ga0207428_10811977 3300027907 Bacteria 664
794 Ga0268266_10132525 3300028379 Bacteria 2230
795 Ga0268266_10713353 3300028379 Bacteria 967
796 Ga0268266_10777332 3300028379 Bacteria 924
797 Ga0268265_10427518 3300028380 Bacteria 1231
798 Ga0268265_10575052 3300028380 Bacteria 1073
799 Ga0268265_11732074 3300028380 Viruses 631
800 Ga0268264_10165658 3300028381 Bacteria 1995
801 Ga0268264_10181795 3300028381 Bacteria 1910
802 Ga0268264_10620425 3300028381 Bacteria 1067
803 Ga0268264_10791741 3300028381 Bacteria 947
804 Ga0268264_11719274 3300028381 Bacteria 638
805 Ga0307408_100026730 3300031548 Bacteria 3968
806 Ga0307408_100142111 3300031548 Bacteria 1885
807 Ga0307408_100646728 3300031548 Bacteria 945
808 Ga0307413_10378179 3300031824 Bacteria 1102
809 Ga0307410_10031890 3300031852 Bacteria 3386
810 Ga0307406_10011043 3300031901 Bacteria 5115
811 Ga0307406_10711386 3300031901 Bacteria 840
812 Ga0307407_10245278 3300031903 Bacteria 1224
813 Ga0307407_10628199 3300031903 Bacteria 802
814 Ga0307409_100010374 3300031995 Bacteria 5789
815 Ga0307409_100237172 3300031995 Bacteria 1658
816 Ga0307409_100983768 3300031995 Bacteria 861
817 Ga0307409_101509474 3300031995 Bacteria 699
818 Ga0307416_100004219 3300032002 Bacteria 8628
819 Ga0307416_100007736 3300032002 Bacteria 6868
820 Ga0307416_100216609 3300032002 Bacteria 1832
821 Ga0307416_100246630 3300032002 Bacteria 1735
822 Ga0307414_12209359 3300032004 Bacteria 514
823 Ga0307411_10089487 3300032005 Bacteria 2144
824 Ga0307411_10228781 3300032005 Bacteria 1448
825 Ga0307415_100000808 3300032126 Bacteria 14238
826 Ga0307415_100021834 3300032126 Bacteria 3942
827 Ga0307415_100195143 3300032126 Bacteria 1601
828 Ga0307415_101005051 3300032126 Bacteria 775
829 Ga0307415_102319889 3300032126 Bacteria 527
830 Ga0373930_0110510 3300034816 Bacteria 661
831 Ga0373930_0143986 3300034816 Bacteria 594
832 Ga0373948_0094070 3300034817 Bacteria 699
833 Ga0373950_0004977 3300034818 Bacteria 1968
834 Ga0373959_0109728 3300034820 Bacteria 665
835 Ga0373928_0014071 3300035084 Bacteria 1613
836 Ga0373944_0001983 3300035089 Bacteria 5183
837 Ga0373949_0005829 3300035090 Bacteria 2739
838 Ga0373949_0089046 3300035090 Bacteria 832
839 Ga0373952_0011491 3300035092 Bacteria 1728
840 Ga0373932_0006265 3300035112 Bacteria 2811
841 Ga0373932_0085299 3300035112 Bacteria 1005
842 Ga0373932_0139901 3300035112 Unclassified 822
843 Ga0373936_0470036 3300035113 Bacteria 583
844 Ga0373939_0053385 3300035114 Bacteria 1262
845 Ga0373939_0477311 3300035114 Bacteria 529
846 Ga0373941_0018107 3300035115 Bacteria 1941
847 Ga0373941_0237678 3300035115 Bacteria 706
848 Ga0373960_0025142 3300035121 Bacteria 1616
849 Ga0373960_0337527 3300035121 Bacteria 568
850 Ga0373943_0000198 3300035170 Bacteria 24537
851 Ga0373943_0090845 3300035170 Bacteria 1581
852 Ga0373946_0123284 3300035171 Bacteria 1185
853 Ga0373961_0030013 3300035241 Bacteria 1509
854 Ga0373962_0101075 3300035242 Bacteria 899
855 Ga0373931_0038872 3300035691 Bacteria 2491
856 Ga0373931_0282214 3300035691 Bacteria 1020
857 Ga0373931_0771393 3300035691 Bacteria 639
858 Ga0373931_0876272 3300035691 Bacteria 602
859 Ga0373935_0026470 3300035692 Bacteria 3580
860 Ga0373935_1464746 3300035692 Bacteria 511
861 Ga0373927_0196855 3300035695 Bacteria 1322
862 Ga0373947_0004346 3300035725 Bacteria 8317
863 Ga0373947_0238578 3300035725 Bacteria 1199
864 Ga0373925_0024727 3300037068 Bacteria 4386
865 Ga0395899_0000862 3300037312 Bacteria 28881
866 Ga0395899_0007610 3300037312 Bacteria 8354
867 Ga0395899_0010899 3300037312 Bacteria 6966
868 Ga0395899_0017974 3300037312 Bacteria 5381
869 Ga0395899_0023261 3300037312 Bacteria 4696
870 Ga0395899_0033719 3300037312 Bacteria 3845
871 Ga0395899_0040508 3300037312 Bacteria 3483
872 Ga0395899_0049553 3300037312 Bacteria 3122
873 Ga0395899_0061595 3300037312 Bacteria 2764
874 Ga0395899_0609227 3300037312 Archaea 695
875 Ga0395900_0001266 3300037418 Bacteria 30887
876 Ga0395900_0002625 3300037418 Bacteria 19619
877 Ga0395900_0002980 3300037418 Bacteria 18417
878 Ga0395900_0005422 3300037418 Bacteria 13365
879 Ga0395900_0007274 3300037418 Bacteria 11460
880 Ga0395900_0027616 3300037418 Bacteria 5813
881 Ga0395900_0035757 3300037418 Bacteria 5118
882 Ga0395900_0054878 3300037418 Bacteria 4102
883 Ga0395900_0080840 3300037418 Bacteria 3340
884 Ga0395900_0096139 3300037418 Bacteria 3043
885 Ga0395900_0140715 3300037418 Unclassified 2471
886 Ga0395900_0186990 3300037418 Bacteria 2102
887 Ga0395900_0277384 3300037418 Bacteria 1669
888 Ga0395900_0280779 3300037418 Bacteria 1657
889 Ga0395900_0316752 3300037418 Bacteria 1541
890 Ga0395900_0542489 3300037418 Unclassified 1108
891 Ga0395900_0608699 3300037418 Unclassified 1032
892 Ga0395898_0002345 3300037466 Bacteria 22578
893 Ga0395898_0002841 3300037466 Bacteria 19817
894 Ga0395898_0003303 3300037466 Bacteria 18113
895 Ga0395898_0003734 3300037466 Bacteria 16893
896 Ga0395898_0007075 3300037466 Bacteria 11918
897 Ga0395898_0008888 3300037466 Bacteria 10583
898 Ga0395898_0014330 3300037466 Bacteria 8147
899 Ga0395898_0015278 3300037466 Bacteria 7877
900 Ga0395898_0045908 3300037466 Bacteria 4293
901 Ga0395898_0051506 3300037466 Bacteria 4025
902 Ga0395898_0063078 3300037466 Bacteria 3596
903 Ga0395898_0069483 3300037466 Bacteria 3407
904 Ga0395898_0084496 3300037466 Bacteria 3060
905 Ga0395898_0089482 3300037466 Bacteria 2962
906 Ga0395898_0196948 3300037466 Bacteria 1924
907 Ga0395898_0340270 3300037466 Bacteria 1431
908 Ga0395898_0385485 3300037466 Bacteria 1336
909 Ga0395898_1163811 3300037466 Bacteria 703
910 Ga0395898_1734498 3300037466 Bacteria 547
911 Ga0395905_0001694 3300037471 Bacteria 25990
912 Ga0395905_0003053 3300037471 Bacteria 18137
913 Ga0395905_0003210 3300037471 Bacteria 17599
914 Ga0395905_0009789 3300037471 Bacteria 9345
915 Ga0395905_0013678 3300037471 Bacteria 7772
916 Ga0395905_0017506 3300037471 Bacteria 6803
917 Ga0395905_0020791 3300037471 Bacteria 6214
918 Ga0395905_0026568 3300037471 Bacteria 5458
919 Ga0395905_0046230 3300037471 Bacteria 4082
920 Ga0395905_0050765 3300037471 Bacteria 3885
921 Ga0395905_0051423 3300037471 Bacteria 3860
922 Ga0395905_0063055 3300037471 Bacteria 3467
923 Ga0395905_0245546 3300037471 Unclassified 1672
924 Ga0395905_0259270 3300037471 Bacteria 1623
925 Ga0395905_0689296 3300037471 Unclassified 924
926 Ga0395905_1489220 3300037471 Unclassified 581
927 Ga0395901_0001749 3300038443 Bacteria 22444
928 Ga0395901_0002270 3300038443 Bacteria 19615
929 Ga0395901_0003365 3300038443 Bacteria 16107
930 Ga0395901_0004675 3300038443 Bacteria 13803
931 Ga0395901_0005294 3300038443 Bacteria 13040
932 Ga0395901_0012865 3300038443 Bacteria 8487
933 Ga0395901_0014566 3300038443 Bacteria 7993
934 Ga0395901_0018530 3300038443 Bacteria 7107
935 Ga0395901_0092174 3300038443 Bacteria 3172
936 Ga0395901_0104920 3300038443 Bacteria 2966
937 Ga0395901_0130499 3300038443 Bacteria 2640
938 Ga0395901_0139881 3300038443 Bacteria 2544
939 Ga0395901_0169408 3300038443 Bacteria 2291
940 Ga0395901_0305693 3300038443 Bacteria 1648
941 Ga0395901_0338922 3300038443 Bacteria 1553
942 Ga0395901_0358867 3300038443 Bacteria 1503
943 Ga0395901_0389261 3300038443 Bacteria 1433
944 Ga0395901_1232048 3300038443 Unclassified 713
945 Ga0395901_1277704 3300038443 Bacteria 697
946 Ga0242420_151020 3300038996 Bacteria 521
947 Ga0436363_0708027 3300039450 Unclassified 523
948 Ga0439461_0003188 3300041410 Bacteria 2683
949 Ga0439461_0018750 3300041410 Bacteria 1357
950 Ga0451789_0477297 3300041443 Unclassified 523
951 Ga0451800_0214577 3300041459 Bacteria 1909
952 Ga0451800_0969733 3300041459 Unclassified 626
953 Ga0451802_1709161 3300041460 Unclassified 523
954 Ga0451802_1723895 3300041460 Bacteria 884
955 Ga0451804_0948022 3300041463 Unclassified 811
956 Ga0451804_0973345 3300041463 Unclassified 926
957 Ga0451835_0412301 3300041492 Unclassified 1287
958 Ga0451839_0962805 3300041496 Unclassified 718
959 Ga0451845_0454819 3300041501 Unclassified 1703
960 Ga0451845_0915420 3300041501 Bacteria 661
961 Ga0451847_0310254 3300041503 Unclassified 990
962 Ga0451847_0524792 3300041503 Bacteria 550
963 Ga0451849_1357471 3300041505 Unclassified 2377
964 Ga0451855_0355001 3300041511 Bacteria 2125
965 Ga0451855_1954170 3300041511 Bacteria 720
966 Ga0451853_0563886 3300041512 Unclassified 2113
967 Ga0451853_2940054 3300041512 Unclassified 804
968 Ga0451853_3005281 3300041512 Unclassified 990
969 Ga0439437_005057 3300042000 Unclassified 1447
970 Ga0439448_0030442 3300042005 Bacteria 1712
971 Ga0439448_0240698 3300042005 Bacteria 638
972 Ga0439454_071322 3300042011 Unclassified 617
973 Ga0439455_0156098 3300042012 Unclassified 651
974 Ga0450914_019073 3300042118 Bacteria 750
975 Ga0450920_006939 3300042122 Bacteria 2043
976 Ga0450920_011792 3300042122 Unclassified 1632
977 Ga0450922_043894 3300042124 Bacteria 511
978 Ga0450902_004613 3300042137 Bacteria 2055
979 Ga0450905_015958 3300042142 Bacteria 1080
980 Ga0450906_033732 3300042145 Bacteria 905
981 Ga0439446_0027233 3300042156 Bacteria 1640
982 Ga0439446_0117384 3300042156 Unclassified 854
983 Ga0450908_044627 3300042184 Bacteria 769
984 Ga0439434_0019517 3300042435 Bacteria 2033
985 Ga0439459_0083590 3300042438 Bacteria 757
986 Ga0439459_0086809 3300042438 Bacteria 747
987 Ga0439464_0067392 3300042439 Bacteria 1055
988 Ga0439460_0289782 3300042461 Bacteria 571
989 Ga0450918_109298 3300042531 Bacteria 546
990 Ga0451577_0843213 3300042876 Bacteria 827
991 Ga0466972_0142262 3300044658 Bacteria 1129
992 Ga0466972_0281426 3300044658 Bacteria 777
993 Ga0453683_0422057 3300044673 Bacteria 861
994 Ga0466961_0207825 3300044693 Bacteria 1209
995 Ga0466961_0670293 3300044693 Unclassified 622
996 Ga0466963_0011685 3300044694 Bacteria 5350
997 Ga0466964_0042314 3300044706 Bacteria 1845
998 Ga0466964_0082046 3300044706 Unclassified 1386
999 Ga0466964_0148485 3300044706 Bacteria 1084
1000 Ga0466971_0362824 3300044719 Bacteria 702
1001 Ga0466968_0329851 3300044735 Bacteria 738
1002 Ga0466968_0719438 3300044735 Bacteria 511
1003 Ga0466970_0554343 3300044765 Unclassified 664
1004 Ga0466957_0035282 3300044842 Bacteria 3001
1005 Ga0466957_0077290 3300044842 Bacteria 2068
1006 Ga0466960_0191295 3300044901 Bacteria 1114
1007 Ga0466960_0192038 3300044901 Bacteria 1112
1008 Ga0466960_0365049 3300044901 Unclassified 826
1009 Ga0466960_0389299 3300044901 Bacteria 801
1010 Ga0466960_0630913 3300044901 Bacteria 638
1011 Ga0466959_0111694 3300045049 Bacteria 1950
1012 Ga0466959_0192441 3300045049 Bacteria 1423
1013 Ga0466959_0296216 3300045049 Bacteria 1108
1014 Ga0451576_0148554 3300045051 Bacteria 2444
1015 Ga0451576_0204742 3300045051 Bacteria 2061
1016 Ga0451576_1313640 3300045051 Unclassified 754
1017 Ga0451576_2164806 3300045051 Unclassified 571
1018 Ga0466958_0020190 3300045836 Bacteria 3884
1019 Ga0466958_0361374 3300045836 Bacteria 935
1020 Ga0466967_0065238 3300045976 Bacteria 3240
1021 Ga0466967_0073266 3300045976 Bacteria 3072
1022 Ga0466967_0180758 3300045976 Bacteria 1989
1023 Ga0466967_0475316 3300045976 Bacteria 1224
1024 Ga0466967_1025246 3300045976 Bacteria 822
1025 Ga0495592_0717671 3300046454 Archaea 600
1026 Ga0495603_0000081 3300046455 Bacteria 42501
1027 Ga0495603_0188052 3300046455 Unclassified 1194
1028 Ga0495603_0258146 3300046455 Bacteria 1003
1029 Ga0495641_0003826 3300046461 Bacteria 10997
1030 Ga0495641_0035403 3300046461 Bacteria 2354
1031 Ga0495580_0349545 3300046472 Unclassified 1002
1032 Ga0495582_0165072 3300046473 Bacteria 1260
1033 Ga0495605_0023019 3300046474 Bacteria 3282
1034 Ga0495605_0050247 3300046474 Bacteria 2035
1035 Ga0495605_0104950 3300046474 Bacteria 1295
1036 Ga0495605_0138218 3300046474 Bacteria 1095
1037 Ga0495605_0143667 3300046474 Bacteria 1069
1038 Ga0495639_0072725 3300046475 Bacteria 1590
1039 Ga0495584_0029628 3300046491 Bacteria 2775
1040 Ga0495584_0150972 3300046491 Bacteria 1180
1041 Ga0495584_0267847 3300046491 Bacteria 868
1042 Ga0495584_0274749 3300046491 Unclassified 856
1043 Ga0495584_0467788 3300046491 Unclassified 642
1044 Ga0495584_0687324 3300046491 Bacteria 522
1045 Ga0495585_0167026 3300046492 Unclassified 1139
1046 Ga0495594_0000307 3300046499 Bacteria 24065
1047 Ga0495596_0059567 3300046500 Bacteria 1488
1048 Ga0495596_0090141 3300046500 Bacteria 1190
1049 Ga0495583_0136470 3300046506 Unclassified 1024
1050 Ga0495616_0064042 3300046513 Bacteria 1795
1051 Ga0495616_0084325 3300046513 Bacteria 1515
1052 Ga0495630_0047100 3300046517 Bacteria 3224
1053 Ga0495630_0210783 3300046517 Bacteria 1483
1054 Ga0495630_0271128 3300046517 Bacteria 1297
1055 Ga0495630_0285681 3300046517 Bacteria 1260
1056 Ga0495631_0307634 3300046518 Unclassified 674
1057 Ga0495631_0397354 3300046518 Bacteria 587
1058 Ga0495637_0099539 3300046520 Unclassified 1138
1059 Ga0495637_0220124 3300046520 Bacteria 691
1060 Ga0495644_0156525 3300046523 Unclassified 873
1061 Ga0495663_0012292 3300046525 Bacteria 2386
1062 Ga0495663_0099889 3300046525 Unclassified 954
1063 Ga0495663_0160878 3300046525 Bacteria 770
1064 Ga0495666_0007871 3300046526 Bacteria 5338
1065 Ga0495642_0021874 3300046528 Bacteria 2517
1066 Ga0495642_0109330 3300046528 Bacteria 1181
1067 Ga0495642_0120457 3300046528 Bacteria 1126
1068 Ga0495642_0522668 3300046528 Bacteria 526
1069 Ga0495654_0249553 3300046530 Unclassified 740
1070 Ga0495665_0055694 3300046531 Bacteria 2088
1071 Ga0495598_0202370 3300046537 Unclassified 718
1072 Ga0495609_0120468 3300046538 Bacteria 1128
1073 Ga0495609_0125780 3300046538 Bacteria 1100
1074 Ga0495609_0289395 3300046538 Bacteria 669
1075 Ga0495656_0021635 3300046615 Bacteria 2506
1076 Ga0495656_0159202 3300046615 Bacteria 1096
1077 Ga0495656_0308243 3300046615 Unclassified 813
1078 Ga0495668_0051443 3300046616 Bacteria 2281
1079 Ga0495668_0713824 3300046616 Unclassified 555
1080 Ga0495611_0114409 3300046648 Bacteria 1257
1081 Ga0495611_0474427 3300046648 Unclassified 569
1082 Ga0495635_0220333 3300046663 Bacteria 1283
1083 Ga0495659_0075246 3300046664 Bacteria 1272
1084 Ga0495659_0124975 3300046664 Bacteria 1016
1085 Ga0495659_0270981 3300046664 Bacteria 711
1086 Ga0495659_0346160 3300046664 Unclassified 634
1087 Ga0495661_0360603 3300046665 Unclassified 714
1088 Ga0495588_0001033 3300046674 Bacteria 12111
1089 Ga0495588_0243944 3300046674 Unclassified 947
1090 Ga0495647_0017415 3300046681 Bacteria 2542
1091 Ga0495647_0062545 3300046681 Bacteria 1472
1092 Ga0495658_0105872 3300046683 Bacteria 1685
1093 Ga0495658_0413230 3300046683 Bacteria 861
1094 Ga0495658_0750194 3300046683 Bacteria 625
1095 Ga0495670_0198029 3300046691 Unclassified 1063
1096 Ga0495670_0304280 3300046691 Bacteria 855
1097 Ga0495671_0141170 3300046692 Bacteria 1174
1098 Ga0495671_0165160 3300046692 Bacteria 1077
1099 Ga0495589_0093005 3300046794 Unclassified 1464
1100 Ga0495589_0120612 3300046794 Bacteria 1263
1101 Ga0495589_0142604 3300046794 Bacteria 1147
1102 Ga0495589_0176138 3300046794 Bacteria 1016
1103 Ga0495589_0193396 3300046794 Bacteria 962
1104 Ga0495600_0240509 3300046809 Bacteria 1154
1105 Ga0495660_0330879 3300046810 Bacteria 682
1106 Ga0495581_0033481 3300047315 Bacteria 2974
1107 Ga0495581_0134370 3300047315 Unclassified 1442
1108 Ga0495581_0309913 3300047315 Bacteria 922
1109 Ga0495604_0706902 3300047317 Bacteria 640
1110 Ga0495604_0892693 3300047317 Bacteria 556
1111 Ga0495674_0689238 3300047319 Bacteria 803
1112 Ga0495676_0004078 3300047321 Bacteria 13311
1113 Ga0495676_0047807 3300047321 Bacteria 3455
1114 Ga0495676_0068170 3300047321 Bacteria 2750
1115 Ga0495676_0753182 3300047321 Bacteria 629
1116 Ga0495683_0132957 3300047323 Unclassified 1172
1117 Ga0495683_0137812 3300047323 Bacteria 1146
1118 Ga0495679_070677 3300047446 Unclassified 1006
1119 Ga0495679_126618 3300047446 Unclassified 695
1120 Ga0495602_0258315 3300048088 Bacteria 1294
1121 Ga0495602_0668633 3300048088 Bacteria 708
1122 Ga0495626_0230681 3300048091 Unclassified 749
1123 Ga0495626_0246477 3300048091 Unclassified 718
1124 Ga0496100_0007377 3300048903 Bacteria 6063
1125 Ga0496100_0009219 3300048903 Bacteria 5538
1126 Ga0496100_0094399 3300048903 Bacteria 2049
1127 Ga0496100_0182188 3300048903 Bacteria 1519
1128 Ga0496100_0299854 3300048903 Bacteria 1202
1129 Ga0496100_0559705 3300048903 Bacteria 885
1130 Ga0496100_0743459 3300048903 Unclassified 767
1131 Ga0496100_1548704 3300048903 Unclassified 524
1132 Ga0496101_0002103 3300048904 Bacteria 12138
1133 Ga0496101_0029183 3300048904 Bacteria 3858
1134 Ga0496101_0078649 3300048904 Unclassified 2433
1135 Ga0496101_0211505 3300048904 Bacteria 1502
1136 Ga0496101_0327336 3300048904 Bacteria 1202
1137 Ga0496101_0625234 3300048904 Bacteria 851
1138 Ga0496101_0674625 3300048904 Bacteria 816
1139 Ga0496101_0721210 3300048904 Bacteria 787
1140 Ga0496101_1010773 3300048904 Bacteria 654
1141 Ga0496102_0013820 3300048905 Bacteria 7006
1142 Ga0496102_0050210 3300048905 Bacteria 3797
1143 Ga0496102_0198984 3300048905 Bacteria 1888
1144 Ga0496102_0269575 3300048905 Bacteria 1605
1145 Ga0496102_0380170 3300048905 Bacteria 1329
1146 Ga0496102_0487945 3300048905 Unclassified 1154
1147 Ga0496102_1015854 3300048905 Bacteria 750
1148 Ga0496103_0030702 3300048906 Archaea 3271
1149 Ga0496103_0071231 3300048906 Bacteria 2175
1150 Ga0496103_0078196 3300048906 Bacteria 2077
1151 Ga0496103_0183524 3300048906 Bacteria 1345
1152 Ga0496103_0200777 3300048906 Bacteria 1282
1153 Ga0496103_1036078 3300048906 Bacteria 510
1154 Ga0496104_0000584 3300048907 Bacteria 31102
1155 Ga0496104_0041334 3300048907 Archaea 4323
1156 Ga0496104_0044880 3300048907 Bacteria 4154
1157 Ga0496104_0227856 3300048907 Bacteria 1776
1158 Ga0496104_0428200 3300048907 Bacteria 1235
1159 Ga0496104_1005166 3300048907 Unclassified 738
1160 Ga0496105_0003054 3300048908 Bacteria 12300
1161 Ga0496105_0011626 3300048908 Bacteria 6964
1162 Ga0496105_0037996 3300048908 Bacteria 3966
1163 Ga0496105_0081251 3300048908 Bacteria 2677
1164 Ga0496105_0103234 3300048908 Bacteria 2354
1165 Ga0496105_0109809 3300048908 Bacteria 2277
1166 Ga0496106_0028268 3300048909 Bacteria 4176
1167 Ga0496106_0115148 3300048909 Bacteria 2096
1168 Ga0496106_0138204 3300048909 Bacteria 1915
1169 Ga0496106_0174792 3300048909 Bacteria 1703
1170 Ga0496106_0598900 3300048909 Unclassified 883
1171 Ga0496106_0650374 3300048909 Bacteria 842
1172 Ga0496106_0659127 3300048909 Bacteria 836
1173 Ga0496107_0004908 3300048910 Bacteria 9092
1174 Ga0496107_0022326 3300048910 Bacteria 4472
1175 Ga0496107_0032156 3300048910 Bacteria 3749
1176 Ga0496107_0149041 3300048910 Unclassified 1730
1177 Ga0496107_0280587 3300048910 Bacteria 1240
1178 Ga0496108_0004843 3300048911 Bacteria 10862
1179 Ga0496108_0021690 3300048911 Bacteria 5280
1180 Ga0496108_0028435 3300048911 Bacteria 4626
1181 Ga0496108_0054920 3300048911 Bacteria 3343
1182 Ga0496108_0070458 3300048911 Bacteria 2950
1183 Ga0496108_0159892 3300048911 Bacteria 1946
1184 Ga0496108_0250905 3300048911 Unclassified 1539
1185 Ga0496108_0329368 3300048911 Bacteria 1332
1186 Ga0496108_0479185 3300048911 Bacteria 1087
1187 Ga0496108_0657737 3300048911 Bacteria 911
1188 Ga0496109_0005961 3300048912 Bacteria 10233
1189 Ga0496109_0007456 3300048912 Bacteria 9261
1190 Ga0496109_0010340 3300048912 Bacteria 7970
1191 Ga0496109_0037837 3300048912 Bacteria 4360
1192 Ga0496109_0077215 3300048912 Bacteria 3064
1193 Ga0496109_0083134 3300048912 Unclassified 2952
1194 Ga0496109_0093225 3300048912 Bacteria 2787
1195 Ga0496109_0128380 3300048912 Bacteria 2365
1196 Ga0496109_0280480 3300048912 Bacteria 1570
1197 Ga0496109_0462953 3300048912 Bacteria 1197
1198 Ga0496109_0557047 3300048912 Bacteria 1081
1199 Ga0496109_0719688 3300048912 Bacteria 936
1200 Ga0496109_1018558 3300048912 Bacteria 766
1201 Ga0496110_0000277 3300048913 Bacteria 33321
1202 Ga0496110_0024958 3300048913 Bacteria 5102
1203 Ga0496110_0040205 3300048913 Bacteria 4075
1204 Ga0496110_0064768 3300048913 Bacteria 3231
1205 Ga0496110_0067059 3300048913 Bacteria 3175
1206 Ga0496110_0196361 3300048913 Bacteria 1833
1207 Ga0496110_0198318 3300048913 Bacteria 1823
1208 Ga0496110_0275587 3300048913 Bacteria 1532
1209 Ga0496110_0288688 3300048913 Bacteria 1494
1210 Ga0496110_0338861 3300048913 Bacteria 1370
1211 Ga0496110_0397319 3300048913 Unclassified 1257
1212 Ga0496110_0809496 3300048913 Bacteria 841
1213 Ga0496110_0881807 3300048913 Bacteria 800
1214 Ga0496111_0000676 3300048914 Bacteria 17925
1215 Ga0496111_0005855 3300048914 Bacteria 7928
1216 Ga0496111_0010107 3300048914 Bacteria 6318
1217 Ga0496111_0012451 3300048914 Bacteria 5759
1218 Ga0496111_0036718 3300048914 Bacteria 3505
1219 Ga0496111_0114490 3300048914 Bacteria 1988
1220 Ga0496111_0194115 3300048914 Bacteria 1509
1221 Ga0496111_0228680 3300048914 Bacteria 1382
1222 Ga0496111_0361321 3300048914 Bacteria 1074
1223 Ga0496111_0676710 3300048914 Bacteria 752
1224 Ga0496112_0000434 3300048915 Bacteria 27667
1225 Ga0496112_0001332 3300048915 Bacteria 18774
1226 Ga0496112_0081758 3300048915 Bacteria 3195
1227 Ga0496112_0089043 3300048915 Bacteria 3054
1228 Ga0496112_0112397 3300048915 Bacteria 2694
1229 Ga0496112_0199560 3300048915 Bacteria 1960
1230 Ga0496112_0395399 3300048915 Archaea 1322
1231 Ga0496112_0549638 3300048915 Bacteria 1088
1232 Ga0496112_0610270 3300048915 Bacteria 1022
1233 Ga0496112_1101134 3300048915 Bacteria 712
1234 Ga0496112_1168491 3300048915 Bacteria 687
1235 Ga0496112_1512916 3300048915 Bacteria 585
1236 Ga0496113_0002971 3300048916 Bacteria 10030
1237 Ga0496113_0014924 3300048916 Bacteria 5317
1238 Ga0496113_0019937 3300048916 Bacteria 4703
1239 Ga0496113_0050905 3300048916 Bacteria 3089
1240 Ga0496113_0165666 3300048916 Bacteria 1749
1241 Ga0496113_0166080 3300048916 Bacteria 1746
1242 Ga0496113_0184703 3300048916 Bacteria 1653
1243 Ga0496113_0277967 3300048916 Bacteria 1338
1244 Ga0496113_0452065 3300048916 Bacteria 1032
1245 Ga0496113_0485510 3300048916 Unclassified 992
1246 Ga0496114_0004422 3300048917 Bacteria 10907
1247 Ga0496114_0015083 3300048917 Bacteria 6213
1248 Ga0496114_0022506 3300048917 Bacteria 5137
1249 Ga0496114_0108447 3300048917 Bacteria 2377
1250 Ga0496114_0119330 3300048917 Bacteria 2267
1251 Ga0496114_0125811 3300048917 Bacteria 2209
1252 Ga0496114_0206185 3300048917 Bacteria 1723
1253 Ga0496114_0463550 3300048917 Bacteria 1122
1254 Ga0496114_0595974 3300048917 Bacteria 975
1255 Ga0496114_0718716 3300048917 Bacteria 875
1256 Ga0496115_0015485 3300048918 Bacteria 5785
1257 Ga0496115_0033327 3300048918 Bacteria 4066
1258 Ga0496115_0038699 3300048918 Bacteria 3785
1259 Ga0496115_0065990 3300048918 Bacteria 2924
1260 Ga0496115_0237466 3300048918 Bacteria 1502
1261 Ga0496115_0353056 3300048918 Bacteria 1199
1262 Ga0496115_0551889 3300048918 Bacteria 921
1263 Ga0496115_0574919 3300048918 Archaea 898
1264 Ga0501031_0005847 3300049568 Bacteria 8015
1265 Ga0501031_0040078 3300049568 Bacteria 3058
1266 Ga0501031_0042795 3300049568 Bacteria 2956
1267 Ga0501031_0183095 3300049568 Bacteria 1368
1268 Ga0501031_0226484 3300049568 Bacteria 1217
1269 Ga0501032_0003181 3300049569 Bacteria 12640
1270 Ga0501032_0197258 3300049569 Bacteria 1314
1271 Ga0501033_0003631 3300049570 Bacteria 12582
1272 Ga0501033_0090759 3300049570 Bacteria 2235
1273 Ga0501033_0146044 3300049570 Bacteria 1708
1274 Ga0501033_0213796 3300049570 Bacteria 1374
1275 Ga0501034_0027634 3300049571 Bacteria 5770
1276 Ga0501034_0414420 3300049571 Unclassified 1269
1277 Ga0501036_0018221 3300049572 Bacteria 5879
1278 Ga0501036_0053357 3300049572 Bacteria 3424
1279 Ga0501036_0123710 3300049572 Bacteria 2184
1280 Ga0501036_0145466 3300049572 Bacteria 1999
1281 Ga0501036_1505648 3300049572 Bacteria 544
1282 Ga0501037_0005371 3300049573 Bacteria 9325
1283 Ga0501037_0014431 3300049573 Bacteria 5815
1284 Ga0501038_0019492 3300049574 Bacteria 6113
1285 Ga0501038_0044651 3300049574 Bacteria 3848
1286 Ga0501038_0163136 3300049574 Bacteria 1809
1287 Ga0501038_0416856 3300049574 Bacteria 1037
1288 Ga0501038_0502671 3300049574 Bacteria 927
1289 Ga0501039_0006661 3300049575 Bacteria 8778
1290 Ga0501039_0020432 3300049575 Bacteria 5075
1291 Ga0501039_0037336 3300049575 Bacteria 3749
1292 Ga0501039_0200224 3300049575 Bacteria 1570
1293 Ga0501039_0552365 3300049575 Bacteria 904
1294 Ga0501039_0669645 3300049575 Bacteria 812
1295 Ga0501039_0754384 3300049575 Bacteria 760
1296 Ga0501039_1250734 3300049575 Unclassified 573
1297 Ga0501040_0016156 3300049576 Bacteria 4936
1298 Ga0501040_0102911 3300049576 Bacteria 1993
1299 Ga0501040_0123069 3300049576 Bacteria 1821
1300 Ga0501040_0130177 3300049576 Bacteria 1769
1301 Ga0501040_0328705 3300049576 Unclassified 1094
1302 Ga0501040_0338884 3300049576 Bacteria 1076
1303 Ga0501040_0803995 3300049576 Bacteria 680
1304 Ga0501041_0013404 3300049577 Bacteria 4858
1305 Ga0501041_0076253 3300049577 Bacteria 2062
1306 Ga0501041_0107328 3300049577 Bacteria 1731
1307 Ga0501041_0398556 3300049577 Bacteria 871
1308 Ga0501042_0010417 3300049578 Bacteria 6234
1309 Ga0501042_0019226 3300049578 Bacteria 4741
1310 Ga0501042_0029262 3300049578 Bacteria 3884
1311 Ga0501042_0030665 3300049578 Bacteria 3800
1312 Ga0501042_0091720 3300049578 Bacteria 2181
1313 Ga0501042_0272242 3300049578 Bacteria 1223
1314 Ga0501042_0323432 3300049578 Bacteria 1114
1315 Ga0501042_0950031 3300049578 Bacteria 626
1316 Ga0501042_0958007 3300049578 Bacteria 623
1317 Ga0501043_0014107 3300049579 Bacteria 6251
1318 Ga0501043_0028485 3300049579 Bacteria 4385
1319 Ga0501043_0530761 3300049579 Bacteria 876
1320 Ga0501046_0013235 3300049580 Bacteria 6991
1321 Ga0501046_0017331 3300049580 Bacteria 6014
1322 Ga0501046_0423826 3300049580 Bacteria 959
1323 Ga0501047_0031837 3300049581 Bacteria 5089
1324 Ga0501048_0008057 3300049582 Bacteria 7980
1325 Ga0501048_0008511 3300049582 Bacteria 7756
1326 Ga0501048_0185977 3300049582 Bacteria 1472
1327 Ga0501067_0015893 3300049583 Bacteria 4163
1328 Ga0501067_0160142 3300049583 Bacteria 1253
1329 Ga0501068_0001367 3300049584 Bacteria 12953
1330 Ga0501068_0007185 3300049584 Bacteria 6168
1331 Ga0501068_0028085 3300049584 Bacteria 3325
1332 Ga0501068_0083302 3300049584 Bacteria 1965
1333 Ga0501068_0196367 3300049584 Unclassified 1279
1334 Ga0501068_0330152 3300049584 Bacteria 978
1335 Ga0501069_0005535 3300049585 Bacteria 6574
1336 Ga0501069_0010559 3300049585 Bacteria 4891
1337 Ga0501069_0067767 3300049585 Bacteria 1997
1338 Ga0501069_0134542 3300049585 Bacteria 1416
1339 Ga0501070_0065677 3300049586 Bacteria 3004
1340 Ga0501070_0173529 3300049586 Bacteria 1775
1341 Ga0501070_0531025 3300049586 Bacteria 943
1342 Ga0501070_1178742 3300049586 Bacteria 588
1343 Ga0501071_0003656 3300049587 Bacteria 9649
1344 Ga0501071_0007072 3300049587 Bacteria 7332
1345 Ga0501071_0042051 3300049587 Bacteria 3272
1346 Ga0501071_0083783 3300049587 Bacteria 2336
1347 Ga0501071_0385247 3300049587 Bacteria 1069
1348 Ga0501071_0508468 3300049587 Bacteria 924
1349 Ga0501071_0745571 3300049587 Bacteria 754
1350 Ga0501071_0943612 3300049587 Bacteria 666
1351 Ga0501072_0008341 3300049588 Bacteria 7868
1352 Ga0501072_0012103 3300049588 Bacteria 6592
1353 Ga0501072_0018673 3300049588 Bacteria 5345
1354 Ga0501072_0019083 3300049588 Bacteria 5295
1355 Ga0501072_0080255 3300049588 Bacteria 2584
1356 Ga0501072_0146259 3300049588 Bacteria 1884
1357 Ga0501072_0213515 3300049588 Bacteria 1538
1358 Ga0501072_0309095 3300049588 Bacteria 1257
1359 Ga0501072_0342783 3300049588 Bacteria 1187
1360 Ga0501072_0633013 3300049588 Bacteria 842
1361 Ga0501072_0803996 3300049588 Unclassified 736
1362 Ga0501073_0026968 3300049589 Bacteria 4112
1363 Ga0501073_0231813 3300049589 Bacteria 1275
1364 Ga0501073_0349445 3300049589 Bacteria 1021
1365 Ga0501073_1006698 3300049589 Bacteria 573
1366 Ga0501074_0086741 3300049590 Bacteria 2242
1367 Ga0501074_0106265 3300049590 Bacteria 2009
1368 Ga0501074_0132367 3300049590 Bacteria 1784
1369 Ga0501074_0199165 3300049590 Bacteria 1427
1370 Ga0501074_0449178 3300049590 Bacteria 914
1371 Ga0501074_0613112 3300049590 Unclassified 769
1372 Ga0501075_0008156 3300049591 Bacteria 7290
1373 Ga0501075_0016438 3300049591 Bacteria 5331
1374 Ga0501075_0035375 3300049591 Bacteria 3724
1375 Ga0501075_0046038 3300049591 Bacteria 3277
1376 Ga0501075_0051526 3300049591 Bacteria 3095
1377 Ga0501075_0129176 3300049591 Bacteria 1925
1378 Ga0501076_0009449 3300049592 Bacteria 7202
1379 Ga0501076_0010440 3300049592 Bacteria 6896
1380 Ga0501076_0036137 3300049592 Bacteria 3869
1381 Ga0501076_0079464 3300049592 Bacteria 2632
1382 Ga0501076_0086960 3300049592 Bacteria 2512
1383 Ga0501076_0112029 3300049592 Bacteria 2206
1384 Ga0501076_0305484 3300049592 Bacteria 1304
1385 Ga0501077_0003076 3300049593 Bacteria 10023
1386 Ga0501077_0003918 3300049593 Bacteria 8964
1387 Ga0501077_0006605 3300049593 Bacteria 7119
1388 Ga0501077_0049104 3300049593 Bacteria 2681
1389 Ga0501077_0087686 3300049593 Bacteria 1972
1390 Ga0501077_0701709 3300049593 Bacteria 650
1391 Ga0501079_0005224 3300049741 Bacteria 9649
1392 Ga0501079_0014622 3300049741 Bacteria 5985
1393 Ga0501079_0039043 3300049741 Bacteria 3661
1394 Ga0501079_0213244 3300049741 Bacteria 1508
1395 Ga0501079_0340475 3300049741 Bacteria 1175
1396 Ga0501079_0389856 3300049741 Bacteria 1092
1397 Ga0501079_0622230 3300049741 Bacteria 850
1398 Ga0501080_0010471 3300049742 Bacteria 8489
1399 Ga0501080_0027221 3300049742 Bacteria 5317
1400 Ga0501080_0198282 3300049742 Bacteria 1843
1401 Ga0501080_0239941 3300049742 Bacteria 1655
1402 Ga0501080_0543158 3300049742 Bacteria 1036
1403 Ga0501080_0663161 3300049742 Bacteria 922
1404 Ga0501081_0007569 3300049743 Bacteria 7042
1405 Ga0501081_0046709 3300049743 Bacteria 2977
1406 Ga0501081_0049864 3300049743 Bacteria 2884
1407 Ga0501081_0231203 3300049743 Bacteria 1347
1408 Ga0501081_0246443 3300049743 Bacteria 1303
1409 Ga0501081_0262901 3300049743 Bacteria 1261
1410 Ga0501081_0494660 3300049743 Bacteria 911
1411 Ga0501081_0542476 3300049743 Unclassified 868
1412 Ga0501081_0551513 3300049743 Bacteria 861
1413 Ga0501081_0682495 3300049743 Bacteria 771
1414 Ga0501081_0811227 3300049743 Unclassified 704
1415 Ga0501083_0008656 3300049744 Bacteria 7179
1416 Ga0501083_0068625 3300049744 Bacteria 2359
1417 Ga0501083_0280393 3300049744 Bacteria 1084
1418 Ga0501265_060616 3300049762 Bacteria 617
1419 Ga0501279_077695 3300049775 Bacteria 568
1420 Ga0501035_0005105 3300049822 Bacteria 12434
1421 Ga0501035_0023034 3300049822 Bacteria 5716
1422 Ga0501035_0372520 3300049822 Bacteria 1192
1423 Ga0501044_0055545 3300049823 Bacteria 4067
1424 Ga0501044_0150492 3300049823 Bacteria 2310
1425 Ga0501045_0007285 3300049824 Bacteria 7684
1426 Ga0501045_0087443 3300049824 Bacteria 2301
1427 Ga0501045_0111745 3300049824 Bacteria 2026
1428 Ga0501045_0152045 3300049824 Bacteria 1722
1429 Ga0501045_0333768 3300049824 Bacteria 1128
1430 Ga0501045_0397798 3300049824 Bacteria 1025
1431 nmdc:mga0yw44_212398_c1 3300050492 Bacteria 1280
1432 nmdc:mga0yw44_255592_c1 3300050492 Bacteria 1167
1433 nmdc:mga0yw44_40267_c1 3300050492 Bacteria 2775
1434 nmdc:mga0yw44_50647_c1 3300050492 Bacteria 2512
1435 nmdc:mga0yw44_678455_c1 3300050492 Unclassified 700
1436 nmdc:mga05p37_104554_c1 3300050507 Bacteria 3484
1437 nmdc:mga05p37_108180_c1 3300050507 Bacteria 3420
1438 nmdc:mga05p37_1226434_c1 3300050507 Bacteria 772
1439 nmdc:mga05p37_342792_c1 3300050507 Bacteria 1762
1440 nmdc:mga05p37_412455_c1 3300050507 Unclassified 1574
1441 nmdc:mga05p37_446260_c1 3300050507 Unclassified 1499
1442 nmdc:mga05p37_718810_c1 3300050507 Bacteria 1106
1443 nmdc:mga09592_236405_c1 3300050508 Bacteria 1583
1444 nmdc:mga09592_444986_c1 3300050508 Unclassified 1118
1445 nmdc:mga09592_44866_c1 3300050508 Bacteria 3722
1446 nmdc:mga09592_528418_c1 3300050508 Bacteria 1014
1447 nmdc:mga09592_531826_c1 3300050508 Bacteria 1010
1448 nmdc:mga09592_771954_c1 3300050508 Bacteria 814
1449 nmdc:mga09592_959655_c1 3300050508 Bacteria 716
1450 nmdc:mga0qj67_178237_c1 3300050509 Bacteria 1726
1451 nmdc:mga06r32_232795_c1 3300050510 Bacteria 1830
1452 nmdc:mga06r32_26472_c1 3300050510 Bacteria 5407
1453 nmdc:mga06r32_268714_c1 3300050510 Bacteria 1693
1454 nmdc:mga06r32_353026_c1 3300050510 Bacteria 1455
1455 nmdc:mga08y16_199057_c1 3300050511 Bacteria 2076
1456 nmdc:mga08y16_24029_c1 3300050511 Bacteria 6436
1457 nmdc:mga08y16_263246_c1 3300050511 Bacteria 1781
1458 nmdc:mga08y16_33292_c1 3300050511 Bacteria 5412
1459 nmdc:mga08y16_354689_c1 3300050511 Bacteria 1506
1460 nmdc:mga08y16_466925_c1 3300050511 Bacteria 1285
1461 nmdc:mga08y16_479356_c1 3300050511 Bacteria 1266
1462 nmdc:mga08y16_488990_c1 3300050511 Bacteria 1252
1463 nmdc:mga08y16_508159_c1 3300050511 Bacteria 1224
1464 nmdc:mga08y16_51029_c1 3300050511 Bacteria 4328
1465 nmdc:mga08y16_682846_c1 3300050511 Unclassified 1028
1466 nmdc:mga08y16_72168_c1 3300050511 Bacteria 3598
1467 nmdc:mga08y16_81682_c1 3300050511 Bacteria 3369
1468 nmdc:mga08y16_96769_c1 3300050511 Bacteria 3074
1469 nmdc:mga0n895_1012532_c1 3300050512 Bacteria 811
1470 nmdc:mga0n895_11434_c1 3300050512 Bacteria 7919
1471 nmdc:mga0n895_1627_c1 3300050512 Bacteria 16958
1472 nmdc:mga0n895_258585_c1 3300050512 Bacteria 1767
1473 nmdc:mga0n895_405892_c1 3300050512 Bacteria 1378
1474 nmdc:mga0n895_754496_c1 3300050512 Bacteria 966
1475 nmdc:mga0n895_87775_c1 3300050512 Bacteria 3109
1476 nmdc:mga0rr50_117778_c1 3300050513 Bacteria 2110
1477 nmdc:mga0rr50_162335_c1 3300050513 Bacteria 1814
1478 nmdc:mga0rr50_206761_c1 3300050513 Unclassified 1616
1479 nmdc:mga0rr50_301600_c1 3300050513 Bacteria 1340
1480 nmdc:mga0rr50_3028_c1 3300050513 Bacteria 9614
1481 nmdc:mga0rr50_8967_c1 3300050513 Bacteria 6256
1482 nmdc:mga08x19_18530_c1 3300050514 Bacteria 4266
1483 nmdc:mga08x19_467604_c1 3300050514 Bacteria 888
1484 nmdc:mga08x19_46825_c1 3300050514 Bacteria 2767
1485 nmdc:mga08x19_65419_c1 3300050514 Bacteria 2361
1486 nmdc:mga08x19_8369_c1 3300050514 Bacteria 6160
1487 nmdc:mga08x19_859986_c1 3300050514 Unclassified 644
1488 nmdc:mga0a205_1196_c1 3300050515 Bacteria 21690
1489 nmdc:mga0a205_142201_c1 3300050515 Bacteria 2299
1490 nmdc:mga0a205_183065_c1 3300050515 Bacteria 1989
1491 nmdc:mga0a205_328258_c1 3300050515 Bacteria 1400
1492 nmdc:mga0a205_346192_c1 3300050515 Unclassified 1354
1493 nmdc:mga0a205_485986_c1 3300050515 Unclassified 1093
1494 nmdc:mga0a205_85499_c1 3300050515 Bacteria 3046
1495 Ga0495612_0139372 3300053078 Bacteria 1051
1496 Ga0495655_0017138 3300053083 Bacteria 1573
1497 Ga0495619_0431170 3300053085 Bacteria 909
1498 Ga0501084_0009058 3300054114 Bacteria 8235
1499 Ga0501084_0026876 3300054114 Bacteria 4807
1500 Ga0501084_0040607 3300054114 Bacteria 3892
1501 Ga0501084_0059551 3300054114 Bacteria 3196
1502 Ga0501084_0241147 3300054114 Bacteria 1526
1503 Ga0501084_0272920 3300054114 Bacteria 1428
1504 Ga0501084_0475379 3300054114 Bacteria 1056
1505 Ga0501084_0688939 3300054114 Bacteria 862
1506 Ga0501084_0983155 3300054114 Bacteria 709
1507 Ga0590075_003995 3300059424 Bacteria 3492
1508 Ga0590075_086626 3300059424 Unclassified 812
1509 Ga0590077_009077 3300059426 Bacteria 2036
1510 Ga0590077_023594 3300059426 Unclassified 1318
1511 Ga0590077_073003 3300059426 Unclassified 785
1512 Ga0501082_0005543 3300060353 Bacteria 10959
1513 Ga0501082_0018883 3300060353 Bacteria 5939
1514 Ga0501082_0033764 3300060353 Bacteria 4413
1515 Ga0501082_0049904 3300060353 Bacteria 3608
1516 Ga0501082_0157280 3300060353 Bacteria 1974
1517 Ga0501082_0584293 3300060353 Bacteria 977
1518 Ga0501082_0896797 3300060353 Bacteria 775
1519 Ga0501082_1201300 3300060353 Bacteria 663
1520 Ga0501082_1305043 3300060353 Bacteria 634
1521 Ga0466962_0016768 3300061719 Bacteria 3531
1522 Ga0466962_0100061 3300061719 Unclassified 1392
1523 Ga0530510_0035868 3300061734 Bacteria 3575
1524 Ga0530510_0395116 3300061734 Bacteria 1042
1525 Ga0530510_0443566 3300061734 Bacteria 981
1526 Ga0530510_1176402 3300061734 Bacteria 588
1527 Ga0075434_100256131
1528 JGI24743J22301_10010841
1529 JGI24745J21846_1043417
1530 JGI24749J21850_1012296
1531 JGI24744J21845_10047793
1532 JGI24034J26672_10064824
1533 JGI24742J22300_10007594
1534 JGI24751J29686_10020412
1535 Ga0070658_10248202
1536 Ga0070676_10218216
1537 Ga0070676_11130895
1538 Ga0070683_100046479
1539 Ga0070683_100106976
1540 Ga0070683_100179331
1541 Ga0070683_100579252
1542 Ga0070690_100101444
1543 Ga0070690_100402220
1544 Ga0070670_100029151
1545 Ga0070670_100259835
1546 Ga0070670_100292769
1547 Ga0070670_101206496
1548 Ga0070677_10160055
1549 Ga0070666_10406974
1550 Ga0070680_100065165
1551 Ga0070680_100709580
1552 Ga0070680_101723480
1553 Ga0070682_100008552
1554 Ga0068868_100012777
1555 Ga0068868_100022899
1556 Ga0068868_100035079
1557 Ga0068868_100071883
1558 Ga0068868_100415646
1559 Ga0068868_101832619
1560 Ga0068868_102401698
1561 Ga0070660_100029591
1562 Ga0070660_100213850
1563 Ga0070689_100004985
1564 Ga0070689_100146536
1565 Ga0070691_10042904
1566 Ga0070687_100064201
1567 Ga0070687_100065601
1568 Ga0070687_100122202
1569 Ga0070661_100350614
1570 Ga0070661_100439590
1571 Ga0070692_10032483
1572 Ga0070692_10346329
1573 Ga0070668_100021758
1574 Ga0070668_100024506
1575 Ga0070668_100285165
1576 Ga0070668_100443446
1577 Ga0070668_100609845
1578 Ga0070668_100631344
1579 Ga0070668_102075267
1580 Ga0070669_100180029
1581 Ga0070669_100414767
1582 Ga0070669_100690790
1583 Ga0070675_100015610
1584 Ga0070675_100382659
1585 Ga0070675_100471996
1586 Ga0070675_100595307
1587 Ga0070675_100890013
1588 Ga0070671_100014272
1589 Ga0070671_100036375
1590 Ga0070671_100242198
1591 Ga0070671_100295555
1592 Ga0070671_100896773
1593 Ga0070674_100004281
1594 Ga0070674_100043743
1595 Ga0070674_100071663
1596 Ga0070674_100205387
1597 Ga0070674_100590880
1598 Ga0070674_100875005
1599 Ga0070674_101756821
1600 Ga0070673_100031861
1601 Ga0070673_100141131
1602 Ga0070673_100552157
1603 Ga0070688_100001495
1604 Ga0070688_100003161
1605 Ga0070688_100027769
1606 Ga0070688_100029478
1607 Ga0070659_100030294
1608 Ga0070659_100034767
1609 Ga0070659_100043599
1610 Ga0070659_100160643
1611 Ga0070667_100201187
1612 Ga0070667_100257313
1613 Ga0070667_100448735
1614 Ga0070667_100492359
1615 Ga0070667_102062573
1616 Ga0070703_10056186
1617 Ga0070709_10101770
1618 Ga0070709_10110294
1619 Ga0070709_10130372
1620 Ga0070709_10358230
1621 Ga0070709_10438838
1622 Ga0070714_100159551
1623 Ga0070714_100218017
1624 Ga0070714_100536880
1625 Ga0070714_100592944
1626 Ga0070713_100049133
1627 Ga0070713_100050037
1628 Ga0070713_100138058
1629 Ga0070710_10010380
1630 Ga0070710_10458067
1631 Ga0070701_10003269
1632 Ga0070701_10016535
1633 Ga0070701_10016833
1634 Ga0070701_10035442
1635 Ga0070701_10068570
1636 Ga0070701_10524253
1637 Ga0070711_100012760
1638 Ga0070711_100025198
1639 Ga0070711_100278350
1640 Ga0070711_100664614
1641 Ga0070705_100015616
1642 Ga0070705_100087009
1643 Ga0070705_100152535
1644 Ga0070705_100202655
1645 Ga0070705_100252936
1646 Ga0070705_100332709
1647 Ga0070705_100626081
1648 Ga0070705_100634864
1649 Ga0070700_100002701
1650 Ga0070700_100006627
1651 Ga0070700_100126264
1652 Ga0070700_100141923
1653 Ga0070700_101089122
1654 Ga0070694_100012886
1655 Ga0070694_100015105
1656 Ga0070694_100303805
1657 Ga0070708_100029267
1658 Ga0070708_100041036
1659 Ga0070708_100206206
1660 Ga0070708_100264388
1661 Ga0070708_100545444
1662 Ga0070708_101118543
1663 Ga0070663_100004611
1664 Ga0070663_100025878
1665 Ga0070663_100214394
1666 Ga0070663_100676330
1667 Ga0070678_100065453
1668 Ga0070678_100104449
1669 Ga0070678_100541032
1670 Ga0070678_100566222
1671 Ga0070678_101228358
1672 Ga0070662_100006307
1673 Ga0070662_100152083
1674 Ga0070662_100191550
1675 Ga0070662_100513406
1676 Ga0070662_100601197
1677 Ga0070681_10325955
1678 Ga0070681_10417248
1679 Ga0070681_10422047
1680 Ga0070681_10808714
1681 Ga0070681_11121665
1682 Ga0070681_11176058
1683 Ga0068867_100022787
1684 Ga0068867_100079655
1685 Ga0068867_100188716
1686 Ga0068867_100219770
1687 Ga0068867_100318065
1688 Ga0068867_100636499
1689 Ga0068867_101640957
1690 Ga0070685_10009789
1691 Ga0070685_10073045
1692 Ga0070685_10122912
1693 Ga0070685_10665862
1694 Ga0070706_100031706
1695 Ga0070706_100137357
1696 Ga0070706_100178994
1697 Ga0070706_101396416
1698 Ga0070707_100005156
1699 Ga0070707_100037476
1700 Ga0070707_100045684
1701 Ga0070707_100173772
1702 Ga0070698_100006705
1703 Ga0070698_100008530
1704 Ga0070698_100759562
1705 Ga0070698_101305082
1706 Ga0070699_100040412
1707 Ga0070699_100072136
1708 Ga0070699_100129759
1709 Ga0070699_100238214
1710 Ga0070699_100358885
1711 Ga0070679_100543347
1712 Ga0070684_100008777
1713 Ga0070684_100022227
1714 Ga0070684_100085782
1715 Ga0070684_100129299
1716 Ga0070684_100376778
1717 Ga0070684_100799662
1718 Ga0070684_100911629
1719 Ga0070684_100928344
1720 Ga0070684_101459164
1721 Ga0070697_100333536
1722 Ga0070697_100411042
1723 Ga0068853_100007124
1724 Ga0068853_100175147
1725 Ga0068853_101092206
1726 Ga0070672_100154403
1727 Ga0070686_100011152
1728 Ga0070686_100024948
1729 Ga0070686_100028819
1730 Ga0070686_100038698
1731 Ga0070686_100059773
1732 Ga0070686_100520897
1733 Ga0070695_100041791
1734 Ga0070695_100073483
1735 Ga0070695_100359855
1736 Ga0070696_100043709
1737 Ga0070696_100053430
1738 Ga0070696_100225880
1739 Ga0070693_100002537
1740 Ga0070693_100014448
1741 Ga0070693_100040336
1742 Ga0070693_100066641
1743 Ga0070693_100716707
1744 Ga0070693_100755291
1745 Ga0070693_101103628
1746 Ga0070665_100076527
1747 Ga0070665_100717680
1748 Ga0070704_100070285
1749 Ga0070704_100154609
1750 Ga0070704_100173468
1751 Ga0070704_100258801
1752 Ga0070704_100262823
1753 Ga0070704_100267993
1754 Ga0070704_100365632
1755 Ga0068855_100070620
1756 Ga0068855_100099853
1757 Ga0068855_100104637
1758 Ga0068855_100187316
1759 Ga0068855_100424434
1760 Ga0068855_100536482
1761 Ga0070664_100110983
1762 Ga0070664_100291260
1763 Ga0070664_100315790
1764 Ga0070664_100430679
1765 Ga0070664_101578107
1766 Ga0068857_100043075
1767 Ga0068857_101466281
1768 Ga0068854_100106263
1769 Ga0068854_100136461
1770 Ga0068854_100189485
1771 Ga0068854_100217001
1772 Ga0068854_100457348
1773 Ga0068856_100043626
1774 Ga0068856_100293269
1775 Ga0068856_101172968
1776 Ga0068856_101624293
1777 Ga0070702_100005769
1778 Ga0070702_100170584
1779 Ga0070702_100191971
1780 Ga0070702_100239850
1781 Ga0070702_101693303
1782 Ga0068852_100057319
1783 Ga0068852_100182238
1784 Ga0068852_102377821
1785 Ga0068859_100143426
1786 Ga0068859_100275326
1787 Ga0068859_100686596
1788 Ga0068859_101172641
1789 Ga0068864_100032617
1790 Ga0068864_100044531
1791 Ga0068864_100130598
1792 Ga0068864_100621651
1793 Ga0068866_10008580
1794 Ga0068866_10049089
1795 Ga0068866_10399327
1796 Ga0068866_10759161
1797 Ga0068866_10879717
1798 Ga0068861_100020719
1799 Ga0068861_100034543
1800 Ga0068861_100058785
1801 Ga0068861_100093414
1802 Ga0068861_100155443
1803 Ga0068861_100350368
1804 Ga0068861_100351301
1805 Ga0068851_10004639
1806 Ga0068870_10002411
1807 Ga0068870_10080998
1808 Ga0068870_10776153
1809 Ga0068863_100247655
1810 Ga0068863_100430024
1811 Ga0068863_100507572
1812 Ga0068858_100012205
1813 Ga0068860_100117410
1814 Ga0068860_100158294
1815 Ga0068860_100201266
1816 Ga0068860_100515837
1817 Ga0068860_100922744
1818 Ga0068860_101034368
1819 Ga0068860_101397184
1820 Ga0068862_100141512
1821 Ga0068862_100189895
1822 Ga0068862_100220821
1823 Ga0068862_100448624
1824 Ga0068862_101368300
1825 Ga0081455_10004114
1826 Ga0081455_10024464
1827 Ga0081455_10050772
1828 Ga0081455_10170601
1829 Ga0081455_10173791
1830 Ga0081455_10249845
1831 Ga0081455_10342795
1832 Ga0081540_1001751
1833 Ga0081540_1005933
1834 Ga0081539_10003629
1835 Ga0081539_10007824
1836 Ga0070717_10004499
1837 Ga0070717_10027533
1838 Ga0070717_10050375
1839 Ga0070717_10092524
1840 Ga0070717_10369721
1841 Ga0075365_10181819
1842 Ga0075365_10256621
1843 Ga0075365_10624394
1844 Ga0075364_10025675
1845 Ga0075364_10505855
1846 Ga0075432_10007366
1847 Ga0075432_10038258
1848 Ga0075432_10101231
1849 Ga0070715_10014142
1850 Ga0070716_100000663
1851 Ga0070716_100026835
1852 Ga0070716_100517089
1853 Ga0070716_100780722
1854 Ga0070712_100280728
1855 Ga0075427_10038165
1856 Ga0097621_100140729
1857 Ga0097621_100226268
1858 Ga0097621_100238605
1859 Ga0097621_100726520
1860 Ga0068871_100038742
1861 Ga0068871_100278901
1862 Ga0068871_100437060
1863 Ga0068871_100446537
1864 Ga0075428_100025876
1865 Ga0075428_100064762
1866 Ga0075428_100727339
1867 Ga0075430_100005301
1868 Ga0075430_100407673
1869 Ga0075431_100009313
1870 Ga0075431_100150180
1871 Ga0075431_100262961
1872 Ga0075431_100361367
1873 Ga0075431_100395249
1874 Ga0075433_10074552
1875 Ga0075434_100028252
1876 Ga0075434_100222981
1877 Ga0075434_100240998
1878 Ga0075434_100588560
1879 Ga0075434_101781791
1880 Ga0075429_100027656
1881 Ga0075429_100028833
1882 Ga0075429_100249387
1883 Ga0075429_100329618
1884 Ga0075429_100460089
1885 Ga0068865_100008070
1886 Ga0068865_100049638
1887 Ga0068865_100061453
1888 Ga0068865_100114803
1889 Ga0068865_100216104
1890 Ga0068865_100460840
1891 Ga0068865_100768938
1892 Ga0097620_100143433
1893 Ga0097620_100275336
1894 Ga0097620_100686751
1895 Ga0097620_101172540
1896 Ga0075435_100002120
1897 Ga0075435_100038520
1898 Ga0075435_100432484
1899 Ga0075435_100448504
1900 Ga0075435_101490363
1901 Ga0105251_10158903
1902 Ga0105240_10272672
1903 Ga0105240_12418306
1904 Ga0111539_10001300
1905 Ga0111539_10026624
1906 Ga0111539_10062606
1907 Ga0111539_10070924
1908 Ga0111539_10086896
1909 Ga0111539_10360120
1910 Ga0111539_10391808
1911 Ga0111539_10415259
1912 Ga0111539_10613930
1913 Ga0111539_10638007
1914 Ga0111539_11733765
1915 Ga0105245_10005009
1916 Ga0105245_10006850
1917 Ga0105245_10007026
1918 Ga0105245_10011927
1919 Ga0105245_10023010
1920 Ga0105245_10029924
1921 Ga0105245_10058255
1922 Ga0105245_10080889
1923 Ga0105245_10129850
1924 Ga0105245_10155239
1925 Ga0105245_10190067
1926 Ga0105245_10903135
1927 Ga0105245_11162393
1928 Ga0105247_10038579
1929 Ga0105247_10039881
1930 Ga0114129_10017948
1931 Ga0114129_10025388
1932 Ga0114129_10221016
1933 Ga0114129_10250599
1934 Ga0114129_10262875
1935 Ga0114129_10367673
1936 Ga0114129_10427919
1937 Ga0114129_10441889
1938 Ga0114129_10635608
1939 Ga0114129_11411463
1940 Ga0114129_11588031
1941 Ga0114129_11601796
1942 Ga0114129_12127753
1943 Ga0114129_12564375
1944 Ga0114129_13474414
1945 Ga0105243_10016980
1946 Ga0105243_10018403
1947 Ga0105243_10020309
1948 Ga0105243_10120478
1949 Ga0105243_10231886
1950 Ga0105243_10299535
1951 Ga0105243_10417362
1952 Ga0105243_10578083
1953 Ga0105243_11962433
1954 Ga0105241_10025150
1955 Ga0105241_10085677
1956 Ga0105241_10194519
1957 Ga0105241_10264996
1958 Ga0105241_11245208
1959 Ga0105242_10054489
1960 Ga0105242_10057114
1961 Ga0105242_10090548
1962 Ga0105242_10228509
1963 Ga0105242_10261080
1964 Ga0105242_10275626
1965 Ga0105242_10291678
1966 Ga0105242_10489243
1967 Ga0105242_10502618
1968 Ga0105248_10059696
1969 Ga0105248_10192729
1970 Ga0105248_10263635
1971 Ga0105248_10523506
1972 Ga0105248_11227193
1973 Ga0105248_12526910
1974 Ga0105237_10772838
1975 Ga0105238_10046555
1976 Ga0105249_10022421
1977 Ga0105249_10042394
1978 Ga0105249_10106711
1979 Ga0105249_10118880
1980 Ga0105249_10155091
1981 Ga0105249_10212688
1982 Ga0105239_10054011
1983 Ga0105239_10682275
1984 Ga0105239_10772101
1985 Ga0105239_11052229
1986 Ga0105246_10008409
1987 Ga0105246_10020264
1988 Ga0105246_10032448
1989 Ga0105246_10157983
1990 Ga0105246_10436670
1991 Ga0105246_10941796
1992 Ga0157314_1005294
1993 Ga0157339_1033690
1994 Ga0157371_10100598
1995 Ga0157371_10163072
1996 Ga0157371_10214330
1997 Ga0157371_11488747
1998 Ga0157370_10072748
1999 Ga0157369_10116690
2000 Ga0157369_10328377
2001 Ga0157369_10798741
2002 Ga0157369_12141966
2003 Ga0157374_10006679
2004 Ga0157374_10090651
2005 Ga0157374_10100997
2006 Ga0157374_10160625
2007 Ga0157374_10316502
2008 Ga0157374_10581655
2009 Ga0157374_12089078
2010 Ga0157378_10030477
2011 Ga0157378_10640768
2012 Ga0157378_11096424
2013 Ga0163162_10015163
2014 Ga0163162_10062392
2015 Ga0163162_10167749
2016 Ga0163162_10817772
2017 Ga0157372_10164556
2018 Ga0157372_10400861
2019 Ga0157372_10739771
2020 Ga0157372_13366590
2021 Ga0157375_10028862
2022 Ga0157375_10043912
2023 Ga0157375_10283694
2024 Ga0157375_10362507
2025 Ga0157375_10446781
2026 Ga0157375_11035639
2027 Ga0163163_10004711
2028 Ga0163163_10005098
2029 Ga0163163_11191612
2030 Ga0157380_10000820
2031 Ga0157380_10078485
2032 Ga0157380_10258387
2033 Ga0157380_11022686
2034 Ga0157380_11422974
2035 Ga0157380_12652401
2036 Ga0157377_10012869
2037 Ga0157377_10025499
2038 Ga0157377_10061866
2039 Ga0157377_10100202
2040 Ga0157377_10119201
2041 Ga0157377_10328004
2042 Ga0157377_11003628
2043 Ga0157377_11200624
2044 Ga0157379_10150788
2045 Ga0157379_10460288
2046 Ga0157379_11157721
2047 Ga0157376_10003493
2048 Ga0157376_10014456
2049 Ga0157376_10055617
2050 Ga0157376_10196312
2051 Ga0157376_10431237
2052 Ga0157376_10475813
2053 Ga0157376_10990826
2054 Ga0163161_10020279
2055 Ga0163161_10037167
2056 Ga0163161_10102290
2057 Ga0163161_10517554
2058 Ga0163161_11667215
2059 Ga0206353_10024931
2060 Ga0207697_10172200
2061 Ga0207697_10218753
2062 Ga0207656_10094726
2063 Ga0207692_10006470
2064 Ga0207692_10055620
2065 Ga0207642_10004754
2066 Ga0207642_10064284
2067 Ga0207642_10551027
2068 Ga0207688_10005248
2069 Ga0207688_10009489
2070 Ga0207688_10014758
2071 Ga0207688_10035442
2072 Ga0207688_10055378
2073 Ga0207688_10056107
2074 Ga0207647_10120800
2075 Ga0207647_10122005
2076 Ga0207647_10450914
2077 Ga0207685_10004888
2078 Ga0207685_10018092
2079 Ga0207685_10141903
2080 Ga0207685_10305143
2081 Ga0207699_10092826
2082 Ga0207699_10096502
2083 Ga0207699_10855847
2084 Ga0207699_10992185
2085 Ga0207645_10025047
2086 Ga0207645_10115624
2087 Ga0207645_10244802
2088 Ga0207643_10070350
2089 Ga0207643_10283382
2090 Ga0207643_10331843
2091 Ga0207643_10352515
2092 Ga0207705_10338169
2093 Ga0207684_10014283
2094 Ga0207684_10131761
2095 Ga0207684_10206093
2096 Ga0207654_10063579
2097 Ga0207707_10151644
2098 Ga0207707_10335172
2099 Ga0207707_10613529
2100 Ga0207695_10340146
2101 Ga0207671_10162534
2102 Ga0207671_11156606
2103 Ga0207693_10000468
2104 Ga0207693_10002699
2105 Ga0207693_10005673
2106 Ga0207693_10013206
2107 Ga0207693_10026932
2108 Ga0207693_10034674
2109 Ga0207693_10112075
2110 Ga0207663_10004759
2111 Ga0207663_10119254
2112 Ga0207663_10169674
2113 Ga0207663_10214793
2114 Ga0207660_10062759
2115 Ga0207660_10103287
2116 Ga0207660_10116295
2117 Ga0207660_10338680
2118 Ga0207660_10497649
2119 Ga0207662_10056177
2120 Ga0207662_10074188
2121 Ga0207657_10001010
2122 Ga0207657_10062881
2123 Ga0207657_10095825
2124 Ga0207657_10119052
2125 Ga0207657_10712855
2126 Ga0207649_10854879
2127 Ga0207649_11116269
2128 Ga0207652_10276867
2129 Ga0207646_10007769
2130 Ga0207646_10009003
2131 Ga0207646_10363970
2132 Ga0207681_10030241
2133 Ga0207681_10091381
2134 Ga0207681_10198511
2135 Ga0207681_10286095
2136 Ga0207681_10776915
2137 Ga0207694_10026457
2138 Ga0207650_10014921
2139 Ga0207650_10030691
2140 Ga0207650_10240503
2141 Ga0207659_10022079
2142 Ga0207659_10311417
2143 Ga0207659_10365311
2144 Ga0207659_10372850
2145 Ga0207659_10470404
2146 Ga0207659_10603928
2147 Ga0207687_10017159
2148 Ga0207687_10045339
2149 Ga0207687_10110337
2150 Ga0207687_10136192
2151 Ga0207687_10136707
2152 Ga0207687_10163594
2153 Ga0207687_10179796
2154 Ga0207687_10320444
2155 Ga0207687_10511191
2156 Ga0207687_10679087
2157 Ga0207700_10149119
2158 Ga0207700_10186943
2159 Ga0207700_10254325
2160 Ga0207664_10015157
2161 Ga0207664_10028593
2162 Ga0207664_10431177
2163 Ga0207644_10046784
2164 Ga0207644_10151691
2165 Ga0207644_10185486
2166 Ga0207690_10116490
2167 Ga0207690_10350480
2168 Ga0207690_10743568
2169 Ga0207690_10767466
2170 Ga0207706_10003053
2171 Ga0207706_10029490
2172 Ga0207706_10037122
2173 Ga0207706_10052872
2174 Ga0207706_10078082
2175 Ga0207706_10136076
2176 Ga0207706_10294619
2177 Ga0207706_10523556
2178 Ga0207706_10572431
2179 Ga0207706_10605488
2180 Ga0207686_10002592
2181 Ga0207686_10024437
2182 Ga0207686_10051819
2183 Ga0207686_10152740
2184 Ga0207686_10206348
2185 Ga0207686_10232702
2186 Ga0207686_10314152
2187 Ga0207709_10004481
2188 Ga0207709_10040521
2189 Ga0207709_10106688
2190 Ga0207709_10124695
2191 Ga0207709_10425075
2192 Ga0207670_10020602
2193 Ga0207670_10148695
2194 Ga0207669_10013142
2195 Ga0207669_10058883
2196 Ga0207669_10158783
2197 Ga0207669_10503455
2198 Ga0207669_10857163
2199 Ga0207704_10004272
2200 Ga0207704_10190823
2201 Ga0207704_10311456
2202 Ga0207704_10569689
2203 Ga0207704_11206536
2204 Ga0207665_10005276
2205 Ga0207665_10016737
2206 Ga0207665_10019092
2207 Ga0207691_10004591
2208 Ga0207691_10024335
2209 Ga0207691_10033336
2210 Ga0207691_10254907
2211 Ga0207711_10231488
2212 Ga0207711_10319226
2213 Ga0207711_10403199
2214 Ga0207711_11855884
2215 Ga0207689_10118363
2216 Ga0207689_10530708
2217 Ga0207689_11092254
2218 Ga0207661_10062508
2219 Ga0207661_10212962
2220 Ga0207661_10354344
2221 Ga0207661_10373693
2222 Ga0207661_10953893
2223 Ga0207661_11171372
2224 Ga0207679_10052810
2225 Ga0207679_10433856
2226 Ga0207679_11118912
2227 Ga0207667_10122244
2228 Ga0207667_10130288
2229 Ga0207667_10409006
2230 Ga0207667_10464306
2231 Ga0207651_10058205
2232 Ga0207651_10060356
2233 Ga0207651_10081292
2234 Ga0207651_10301550
2235 Ga0207651_10312521
2236 Ga0207651_10614236
2237 Ga0207712_10037905
2238 Ga0207712_10066524
2239 Ga0207712_10251913
2240 Ga0207668_10065371
2241 Ga0207668_10143420
2242 Ga0207668_10512052
2243 Ga0207668_11772023
2244 Ga0207640_10251955
2245 Ga0207640_10567292
2246 Ga0207640_10754479
2247 Ga0207640_11471608
2248 Ga0207658_10340731
2249 Ga0207658_10653487
2250 Ga0207677_10050647
2251 Ga0207677_10054351
2252 Ga0207677_10061821
2253 Ga0207677_10190351
2254 Ga0207677_10342949
2255 Ga0207639_10035329
2256 Ga0207639_10268205
2257 Ga0207678_10007870
2258 Ga0207678_10028896
2259 Ga0207678_10034547
2260 Ga0207678_10108329
2261 Ga0207678_11595420
2262 Ga0207708_10000434
2263 Ga0207708_10006543
2264 Ga0207708_10010108
2265 Ga0207708_10259655
2266 Ga0207708_10612065
2267 Ga0207708_10621758
2268 Ga0207708_10983921
2269 Ga0207702_10006809
2270 Ga0207702_10037538
2271 Ga0207702_10099432
2272 Ga0207702_10381755
2273 Ga0207702_10873666
2274 Ga0207702_11109645
2275 Ga0207702_12211051
2276 Ga0207641_10391377
2277 Ga0207641_11340768
2278 Ga0207648_10003561
2279 Ga0207648_10010611
2280 Ga0207648_10194727
2281 Ga0207648_10197230
2282 Ga0207648_10521671
2283 Ga0207648_10797361
2284 Ga0207648_10860523
2285 Ga0207676_10049792
2286 Ga0207676_10173590
2287 Ga0207676_10603859
2288 Ga0207674_10183829
2289 Ga0207674_11810939
2290 Ga0207675_100000929
2291 Ga0207675_100022783
2292 Ga0207675_100042327
2293 Ga0207675_100061539
2294 Ga0207675_100125449
2295 Ga0207675_100145230
2296 Ga0207675_100906463
2297 Ga0207675_100982677
2298 Ga0207683_10008655
2299 Ga0207683_10014994
2300 Ga0207683_10016453
2301 Ga0207683_10022492
2302 Ga0207683_10083078
2303 Ga0207683_10123157
2304 Ga0207683_10194938
2305 Ga0207683_10322856
2306 Ga0207698_10104801
2307 Ga0207698_10133410
2308 Ga0207698_10158699
2309 Ga0209966_1127929
2310 Ga0209974_10149298
2311 Ga0207428_10016203
2312 Ga0207428_10017291
2313 Ga0207428_10030243
2314 Ga0207428_10041952
2315 Ga0207428_10059700
2316 Ga0207428_10237150
2317 Ga0207428_10258606
2318 Ga0207428_10499753
2319 Ga0207428_10811977
2320 Ga0268266_10132525
2321 Ga0268266_10713353
2322 Ga0268266_10777332
2323 Ga0268265_10427518
2324 Ga0268265_10575052
2325 Ga0268265_11732074
2326 Ga0268264_10165658
2327 Ga0268264_10181795
2328 Ga0268264_10620425
2329 Ga0268264_10791741
2330 Ga0268264_11719274
2331 Ga0307408_100026730
2332 Ga0307408_100142111
2333 Ga0307408_100646728
2334 Ga0307413_10378179
2335 Ga0307410_10031890
2336 Ga0307406_10011043
2337 Ga0307406_10711386
2338 Ga0307407_10245278
2339 Ga0307407_10628199
2340 Ga0307409_100010374
2341 Ga0307409_100237172
2342 Ga0307409_100983768
2343 Ga0307409_101509474
2344 Ga0307416_100004219
2345 Ga0307416_100007736
2346 Ga0307416_100216609
2347 Ga0307416_100246630
2348 Ga0307414_12209359
2349 Ga0307411_10089487
2350 Ga0307411_10228781
2351 Ga0307415_100000808
2352 Ga0307415_100021834
2353 Ga0307415_100195143
2354 Ga0307415_101005051
2355 Ga0307415_102319889
2356 Ga0373930_0110510
2357 Ga0373930_0143986
2358 Ga0373948_0094070
2359 Ga0373950_0004977
2360 Ga0373959_0109728
2361 Ga0373928_0014071
2362 Ga0373944_0001983
2363 Ga0373949_0005829
2364 Ga0373949_0089046
2365 Ga0373952_0011491
2366 Ga0373932_0006265
2367 Ga0373932_0085299
2368 Ga0373932_0139901
2369 Ga0373936_0470036
2370 Ga0373939_0053385
2371 Ga0373939_0477311
2372 Ga0373941_0018107
2373 Ga0373941_0237678
2374 Ga0373960_0025142
2375 Ga0373960_0337527
2376 Ga0373943_0000198
2377 Ga0373943_0090845
2378 Ga0373946_0123284
2379 Ga0373961_0030013
2380 Ga0373962_0101075
2381 Ga0373931_0038872
2382 Ga0373931_0282214
2383 Ga0373931_0771393
2384 Ga0373931_0876272
2385 Ga0373935_0026470
2386 Ga0373935_1464746
2387 Ga0373927_0196855
2388 Ga0373947_0004346
2389 Ga0373947_0238578
2390 Ga0373925_0024727
2391 Ga0395899_0000862
2392 Ga0395899_0007610
2393 Ga0395899_0010899
2394 Ga0395899_0017974
2395 Ga0395899_0023261
2396 Ga0395899_0033719
2397 Ga0395899_0040508
2398 Ga0395899_0049553
2399 Ga0395899_0061595
2400 Ga0395899_0609227
2401 Ga0395900_0001266
2402 Ga0395900_0002625
2403 Ga0395900_0002980
2404 Ga0395900_0005422
2405 Ga0395900_0007274
2406 Ga0395900_0027616
2407 Ga0395900_0035757
2408 Ga0395900_0054878
2409 Ga0395900_0080840
2410 Ga0395900_0096139
2411 Ga0395900_0140715
2412 Ga0395900_0186990
2413 Ga0395900_0277384
2414 Ga0395900_0280779
2415 Ga0395900_0316752
2416 Ga0395900_0542489
2417 Ga0395900_0608699
2418 Ga0395898_0002345
2419 Ga0395898_0002841
2420 Ga0395898_0003303
2421 Ga0395898_0003734
2422 Ga0395898_0007075
2423 Ga0395898_0008888
2424 Ga0395898_0014330
2425 Ga0395898_0015278
2426 Ga0395898_0045908
2427 Ga0395898_0051506
2428 Ga0395898_0063078
2429 Ga0395898_0069483
2430 Ga0395898_0084496
2431 Ga0395898_0089482
2432 Ga0395898_0196948
2433 Ga0395898_0340270
2434 Ga0395898_0385485
2435 Ga0395898_1163811
2436 Ga0395898_1734498
2437 Ga0395905_0001694
2438 Ga0395905_0003053
2439 Ga0395905_0003210
2440 Ga0395905_0009789
2441 Ga0395905_0013678
2442 Ga0395905_0017506
2443 Ga0395905_0020791
2444 Ga0395905_0026568
2445 Ga0395905_0046230
2446 Ga0395905_0050765
2447 Ga0395905_0051423
2448 Ga0395905_0063055
2449 Ga0395905_0245546
2450 Ga0395905_0259270
2451 Ga0395905_0689296
2452 Ga0395905_1489220
2453 Ga0395901_0001749
2454 Ga0395901_0002270
2455 Ga0395901_0003365
2456 Ga0395901_0004675
2457 Ga0395901_0005294
2458 Ga0395901_0012865
2459 Ga0395901_0014566
2460 Ga0395901_0018530
2461 Ga0395901_0092174
2462 Ga0395901_0104920
2463 Ga0395901_0130499
2464 Ga0395901_0139881
2465 Ga0395901_0169408
2466 Ga0395901_0305693
2467 Ga0395901_0338922
2468 Ga0395901_0358867
2469 Ga0395901_0389261
2470 Ga0395901_1232048
2471 Ga0395901_1277704
2472 Ga0242420_151020
2473 Ga0436363_0708027
2474 Ga0439461_0003188
2475 Ga0439461_0018750
2476 Ga0451789_0477297
2477 Ga0451800_0214577
2478 Ga0451800_0969733
2479 Ga0451802_1709161
2480 Ga0451802_1723895
2481 Ga0451804_0948022
2482 Ga0451804_0973345
2483 Ga0451835_0412301
2484 Ga0451839_0962805
2485 Ga0451845_0454819
2486 Ga0451845_0915420
2487 Ga0451847_0310254
2488 Ga0451847_0524792
2489 Ga0451849_1357471
2490 Ga0451855_0355001
2491 Ga0451855_1954170
2492 Ga0451853_0563886
2493 Ga0451853_2940054
2494 Ga0451853_3005281
2495 Ga0439437_005057
2496 Ga0439448_0030442
2497 Ga0439448_0240698
2498 Ga0439454_071322
2499 Ga0439455_0156098
2500 Ga0450914_019073
2501 Ga0450920_006939
2502 Ga0450920_011792
2503 Ga0450922_043894
2504 Ga0450902_004613
2505 Ga0450905_015958
2506 Ga0450906_033732
2507 Ga0439446_0027233
2508 Ga0439446_0117384
2509 Ga0450908_044627
2510 Ga0439434_0019517
2511 Ga0439459_0083590
2512 Ga0439459_0086809
2513 Ga0439464_0067392
2514 Ga0439460_0289782
2515 Ga0450918_109298
2516 Ga0451577_0843213
2517 Ga0466972_0142262
2518 Ga0466972_0281426
2519 Ga0453683_0422057
2520 Ga0466961_0207825
2521 Ga0466961_0670293
2522 Ga0466963_0011685
2523 Ga0466964_0042314
2524 Ga0466964_0082046
2525 Ga0466964_0148485
2526 Ga0466971_0362824
2527 Ga0466968_0329851
2528 Ga0466968_0719438
2529 Ga0466970_0554343
2530 Ga0466957_0035282
2531 Ga0466957_0077290
2532 Ga0466960_0191295
2533 Ga0466960_0192038
2534 Ga0466960_0365049
2535 Ga0466960_0389299
2536 Ga0466960_0630913
2537 Ga0466959_0111694
2538 Ga0466959_0192441
2539 Ga0466959_0296216
2540 Ga0451576_0148554
2541 Ga0451576_0204742
2542 Ga0451576_1313640
2543 Ga0451576_2164806
2544 Ga0466958_0020190
2545 Ga0466958_0361374
2546 Ga0466967_0065238
2547 Ga0466967_0073266
2548 Ga0466967_0180758
2549 Ga0466967_0475316
2550 Ga0466967_1025246
2551 Ga0495592_0717671
2552 Ga0495603_0000081
2553 Ga0495603_0188052
2554 Ga0495603_0258146
2555 Ga0495641_0003826
2556 Ga0495641_0035403
2557 Ga0495580_0349545
2558 Ga0495582_0165072
2559 Ga0495605_0023019
2560 Ga0495605_0050247
2561 Ga0495605_0104950
2562 Ga0495605_0138218
2563 Ga0495605_0143667
2564 Ga0495639_0072725
2565 Ga0495584_0029628
2566 Ga0495584_0150972
2567 Ga0495584_0267847
2568 Ga0495584_0274749
2569 Ga0495584_0467788
2570 Ga0495584_0687324
2571 Ga0495585_0167026
2572 Ga0495594_0000307
2573 Ga0495596_0059567
2574 Ga0495596_0090141
2575 Ga0495583_0136470
2576 Ga0495616_0064042
2577 Ga0495616_0084325
2578 Ga0495630_0047100
2579 Ga0495630_0210783
2580 Ga0495630_0271128
2581 Ga0495630_0285681
2582 Ga0495631_0307634
2583 Ga0495631_0397354
2584 Ga0495637_0099539
2585 Ga0495637_0220124
2586 Ga0495644_0156525
2587 Ga0495663_0012292
2588 Ga0495663_0099889
2589 Ga0495663_0160878
2590 Ga0495666_0007871
2591 Ga0495642_0021874
2592 Ga0495642_0109330
2593 Ga0495642_0120457
2594 Ga0495642_0522668
2595 Ga0495654_0249553
2596 Ga0495665_0055694
2597 Ga0495598_0202370
2598 Ga0495609_0120468
2599 Ga0495609_0125780
2600 Ga0495609_0289395
2601 Ga0495656_0021635
2602 Ga0495656_0159202
2603 Ga0495656_0308243
2604 Ga0495668_0051443
2605 Ga0495668_0713824
2606 Ga0495611_0114409
2607 Ga0495611_0474427
2608 Ga0495635_0220333
2609 Ga0495659_0075246
2610 Ga0495659_0124975
2611 Ga0495659_0270981
2612 Ga0495659_0346160
2613 Ga0495661_0360603
2614 Ga0495588_0001033
2615 Ga0495588_0243944
2616 Ga0495647_0017415
2617 Ga0495647_0062545
2618 Ga0495658_0105872
2619 Ga0495658_0413230
2620 Ga0495658_0750194
2621 Ga0495670_0198029
2622 Ga0495670_0304280
2623 Ga0495671_0141170
2624 Ga0495671_0165160
2625 Ga0495589_0093005
2626 Ga0495589_0120612
2627 Ga0495589_0142604
2628 Ga0495589_0176138
2629 Ga0495589_0193396
2630 Ga0495600_0240509
2631 Ga0495660_0330879
2632 Ga0495581_0033481
2633 Ga0495581_0134370
2634 Ga0495581_0309913
2635 Ga0495604_0706902
2636 Ga0495604_0892693
2637 Ga0495674_0689238
2638 Ga0495676_0004078
2639 Ga0495676_0047807
2640 Ga0495676_0068170
2641 Ga0495676_0753182
2642 Ga0495683_0132957
2643 Ga0495683_0137812
2644 Ga0495679_070677
2645 Ga0495679_126618
2646 Ga0495602_0258315
2647 Ga0495602_0668633
2648 Ga0495626_0230681
2649 Ga0495626_0246477
2650 Ga0496100_0007377
2651 Ga0496100_0009219
2652 Ga0496100_0094399
2653 Ga0496100_0182188
2654 Ga0496100_0299854
2655 Ga0496100_0559705
2656 Ga0496100_0743459
2657 Ga0496100_1548704
2658 Ga0496101_0002103
2659 Ga0496101_0029183
2660 Ga0496101_0078649
2661 Ga0496101_0211505
2662 Ga0496101_0327336
2663 Ga0496101_0625234
2664 Ga0496101_0674625
2665 Ga0496101_0721210
2666 Ga0496101_1010773
2667 Ga0496102_0013820
2668 Ga0496102_0050210
2669 Ga0496102_0198984
2670 Ga0496102_0269575
2671 Ga0496102_0380170
2672 Ga0496102_0487945
2673 Ga0496102_1015854
2674 Ga0496103_0030702
2675 Ga0496103_0071231
2676 Ga0496103_0078196
2677 Ga0496103_0183524
2678 Ga0496103_0200777
2679 Ga0496103_1036078
2680 Ga0496104_0000584
2681 Ga0496104_0041334
2682 Ga0496104_0044880
2683 Ga0496104_0227856
2684 Ga0496104_0428200
2685 Ga0496104_1005166
2686 Ga0496105_0003054
2687 Ga0496105_0011626
2688 Ga0496105_0037996
2689 Ga0496105_0081251
2690 Ga0496105_0103234
2691 Ga0496105_0109809
2692 Ga0496106_0028268
2693 Ga0496106_0115148
2694 Ga0496106_0138204
2695 Ga0496106_0174792
2696 Ga0496106_0598900
2697 Ga0496106_0650374
2698 Ga0496106_0659127
2699 Ga0496107_0004908
2700 Ga0496107_0022326
2701 Ga0496107_0032156
2702 Ga0496107_0149041
2703 Ga0496107_0280587
2704 Ga0496108_0004843
2705 Ga0496108_0021690
2706 Ga0496108_0028435
2707 Ga0496108_0054920
2708 Ga0496108_0070458
2709 Ga0496108_0159892
2710 Ga0496108_0250905
2711 Ga0496108_0329368
2712 Ga0496108_0479185
2713 Ga0496108_0657737
2714 Ga0496109_0005961
2715 Ga0496109_0007456
2716 Ga0496109_0010340
2717 Ga0496109_0037837
2718 Ga0496109_0077215
2719 Ga0496109_0083134
2720 Ga0496109_0093225
2721 Ga0496109_0128380
2722 Ga0496109_0280480
2723 Ga0496109_0462953
2724 Ga0496109_0557047
2725 Ga0496109_0719688
2726 Ga0496109_1018558
2727 Ga0496110_0000277
2728 Ga0496110_0024958
2729 Ga0496110_0040205
2730 Ga0496110_0064768
2731 Ga0496110_0067059
2732 Ga0496110_0196361
2733 Ga0496110_0198318
2734 Ga0496110_0275587
2735 Ga0496110_0288688
2736 Ga0496110_0338861
2737 Ga0496110_0397319
2738 Ga0496110_0809496
2739 Ga0496110_0881807
2740 Ga0496111_0000676
2741 Ga0496111_0005855
2742 Ga0496111_0010107
2743 Ga0496111_0012451
2744 Ga0496111_0036718
2745 Ga0496111_0114490
2746 Ga0496111_0194115
2747 Ga0496111_0228680
2748 Ga0496111_0361321
2749 Ga0496111_0676710
2750 Ga0496112_0000434
2751 Ga0496112_0001332
2752 Ga0496112_0081758
2753 Ga0496112_0089043
2754 Ga0496112_0112397
2755 Ga0496112_0199560
2756 Ga0496112_0395399
2757 Ga0496112_0549638
2758 Ga0496112_0610270
2759 Ga0496112_1101134
2760 Ga0496112_1168491
2761 Ga0496112_1512916
2762 Ga0496113_0002971
2763 Ga0496113_0014924
2764 Ga0496113_0019937
2765 Ga0496113_0050905
2766 Ga0496113_0165666
2767 Ga0496113_0166080
2768 Ga0496113_0184703
2769 Ga0496113_0277967
2770 Ga0496113_0452065
2771 Ga0496113_0485510
2772 Ga0496114_0004422
2773 Ga0496114_0015083
2774 Ga0496114_0022506
2775 Ga0496114_0108447
2776 Ga0496114_0119330
2777 Ga0496114_0125811
2778 Ga0496114_0206185
2779 Ga0496114_0463550
2780 Ga0496114_0595974
2781 Ga0496114_0718716
2782 Ga0496115_0015485
2783 Ga0496115_0033327
2784 Ga0496115_0038699
2785 Ga0496115_0065990
2786 Ga0496115_0237466
2787 Ga0496115_0353056
2788 Ga0496115_0551889
2789 Ga0496115_0574919
2790 Ga0501031_0005847
2791 Ga0501031_0040078
2792 Ga0501031_0042795
2793 Ga0501031_0183095
2794 Ga0501031_0226484
2795 Ga0501032_0003181
2796 Ga0501032_0197258
2797 Ga0501033_0003631
2798 Ga0501033_0090759
2799 Ga0501033_0146044
2800 Ga0501033_0213796
2801 Ga0501034_0027634
2802 Ga0501034_0414420
2803 Ga0501036_0018221
2804 Ga0501036_0053357
2805 Ga0501036_0123710
2806 Ga0501036_0145466
2807 Ga0501036_1505648
2808 Ga0501037_0005371
2809 Ga0501037_0014431
2810 Ga0501038_0019492
2811 Ga0501038_0044651
2812 Ga0501038_0163136
2813 Ga0501038_0416856
2814 Ga0501038_0502671
2815 Ga0501039_0006661
2816 Ga0501039_0020432
2817 Ga0501039_0037336
2818 Ga0501039_0200224
2819 Ga0501039_0552365
2820 Ga0501039_0669645
2821 Ga0501039_0754384
2822 Ga0501039_1250734
2823 Ga0501040_0016156
2824 Ga0501040_0102911
2825 Ga0501040_0123069
2826 Ga0501040_0130177
2827 Ga0501040_0328705
2828 Ga0501040_0338884
2829 Ga0501040_0803995
2830 Ga0501041_0013404
2831 Ga0501041_0076253
2832 Ga0501041_0107328
2833 Ga0501041_0398556
2834 Ga0501042_0010417
2835 Ga0501042_0019226
2836 Ga0501042_0029262
2837 Ga0501042_0030665
2838 Ga0501042_0091720
2839 Ga0501042_0272242
2840 Ga0501042_0323432
2841 Ga0501042_0950031
2842 Ga0501042_0958007
2843 Ga0501043_0014107
2844 Ga0501043_0028485
2845 Ga0501043_0530761
2846 Ga0501046_0013235
2847 Ga0501046_0017331
2848 Ga0501046_0423826
2849 Ga0501047_0031837
2850 Ga0501048_0008057
2851 Ga0501048_0008511
2852 Ga0501048_0185977
2853 Ga0501067_0015893
2854 Ga0501067_0160142
2855 Ga0501068_0001367
2856 Ga0501068_0007185
2857 Ga0501068_0028085
2858 Ga0501068_0083302
2859 Ga0501068_0196367
2860 Ga0501068_0330152
2861 Ga0501069_0005535
2862 Ga0501069_0010559
2863 Ga0501069_0067767
2864 Ga0501069_0134542
2865 Ga0501070_0065677
2866 Ga0501070_0173529
2867 Ga0501070_0531025
2868 Ga0501070_1178742
2869 Ga0501071_0003656
2870 Ga0501071_0007072
2871 Ga0501071_0042051
2872 Ga0501071_0083783
2873 Ga0501071_0385247
2874 Ga0501071_0508468
2875 Ga0501071_0745571
2876 Ga0501071_0943612
2877 Ga0501072_0008341
2878 Ga0501072_0012103
2879 Ga0501072_0018673
2880 Ga0501072_0019083
2881 Ga0501072_0080255
2882 Ga0501072_0146259
2883 Ga0501072_0213515
2884 Ga0501072_0309095
2885 Ga0501072_0342783
2886 Ga0501072_0633013
2887 Ga0501072_0803996
2888 Ga0501073_0026968
2889 Ga0501073_0231813
2890 Ga0501073_0349445
2891 Ga0501073_1006698
2892 Ga0501074_0086741
2893 Ga0501074_0106265
2894 Ga0501074_0132367
2895 Ga0501074_0199165
2896 Ga0501074_0449178
2897 Ga0501074_0613112
2898 Ga0501075_0008156
2899 Ga0501075_0016438
2900 Ga0501075_0035375
2901 Ga0501075_0046038
2902 Ga0501075_0051526
2903 Ga0501075_0129176
2904 Ga0501076_0009449
2905 Ga0501076_0010440
2906 Ga0501076_0036137
2907 Ga0501076_0079464
2908 Ga0501076_0086960
2909 Ga0501076_0112029
2910 Ga0501076_0305484
2911 Ga0501077_0003076
2912 Ga0501077_0003918
2913 Ga0501077_0006605
2914 Ga0501077_0049104
2915 Ga0501077_0087686
2916 Ga0501077_0701709
2917 Ga0501079_0005224
2918 Ga0501079_0014622
2919 Ga0501079_0039043
2920 Ga0501079_0213244
2921 Ga0501079_0340475
2922 Ga0501079_0389856
2923 Ga0501079_0622230
2924 Ga0501080_0010471
2925 Ga0501080_0027221
2926 Ga0501080_0198282
2927 Ga0501080_0239941
2928 Ga0501080_0543158
2929 Ga0501080_0663161
2930 Ga0501081_0007569
2931 Ga0501081_0046709
2932 Ga0501081_0049864
2933 Ga0501081_0231203
2934 Ga0501081_0246443
2935 Ga0501081_0262901
2936 Ga0501081_0494660
2937 Ga0501081_0542476
2938 Ga0501081_0551513
2939 Ga0501081_0682495
2940 Ga0501081_0811227
2941 Ga0501083_0008656
2942 Ga0501083_0068625
2943 Ga0501083_0280393
2944 Ga0501265_060616
2945 Ga0501279_077695
2946 Ga0501035_0005105
2947 Ga0501035_0023034
2948 Ga0501035_0372520
2949 Ga0501044_0055545
2950 Ga0501044_0150492
2951 Ga0501045_0007285
2952 Ga0501045_0087443
2953 Ga0501045_0111745
2954 Ga0501045_0152045
2955 Ga0501045_0333768
2956 Ga0501045_0397798
2957 nmdc:mga0yw44_212398_c1
2958 nmdc:mga0yw44_255592_c1
2959 nmdc:mga0yw44_40267_c1
2960 nmdc:mga0yw44_50647_c1
2961 nmdc:mga0yw44_678455_c1
2962 nmdc:mga05p37_104554_c1
2963 nmdc:mga05p37_108180_c1
2964 nmdc:mga05p37_1226434_c1
2965 nmdc:mga05p37_342792_c1
2966 nmdc:mga05p37_412455_c1
2967 nmdc:mga05p37_446260_c1
2968 nmdc:mga05p37_718810_c1
2969 nmdc:mga09592_236405_c1
2970 nmdc:mga09592_444986_c1
2971 nmdc:mga09592_44866_c1
2972 nmdc:mga09592_528418_c1
2973 nmdc:mga09592_531826_c1
2974 nmdc:mga09592_771954_c1
2975 nmdc:mga09592_959655_c1
2976 nmdc:mga0qj67_178237_c1
2977 nmdc:mga06r32_232795_c1
2978 nmdc:mga06r32_26472_c1
2979 nmdc:mga06r32_268714_c1
2980 nmdc:mga06r32_353026_c1
2981 nmdc:mga08y16_199057_c1
2982 nmdc:mga08y16_24029_c1
2983 nmdc:mga08y16_263246_c1
2984 nmdc:mga08y16_33292_c1
2985 nmdc:mga08y16_354689_c1
2986 nmdc:mga08y16_466925_c1
2987 nmdc:mga08y16_479356_c1
2988 nmdc:mga08y16_488990_c1
2989 nmdc:mga08y16_508159_c1
2990 nmdc:mga08y16_51029_c1
2991 nmdc:mga08y16_682846_c1
2992 nmdc:mga08y16_72168_c1
2993 nmdc:mga08y16_81682_c1
2994 nmdc:mga08y16_96769_c1
2995 nmdc:mga0n895_1012532_c1
2996 nmdc:mga0n895_11434_c1
2997 nmdc:mga0n895_1627_c1
2998 nmdc:mga0n895_258585_c1
2999 nmdc:mga0n895_405892_c1
3000 nmdc:mga0n895_754496_c1
3001 nmdc:mga0n895_87775_c1
3002 nmdc:mga0rr50_117778_c1
3003 nmdc:mga0rr50_162335_c1
3004 nmdc:mga0rr50_206761_c1
3005 nmdc:mga0rr50_301600_c1
3006 nmdc:mga0rr50_3028_c1
3007 nmdc:mga0rr50_8967_c1
3008 nmdc:mga08x19_18530_c1
3009 nmdc:mga08x19_467604_c1
3010 nmdc:mga08x19_46825_c1
3011 nmdc:mga08x19_65419_c1
3012 nmdc:mga08x19_8369_c1
3013 nmdc:mga08x19_859986_c1
3014 nmdc:mga0a205_1196_c1
3015 nmdc:mga0a205_142201_c1
3016 nmdc:mga0a205_183065_c1
3017 nmdc:mga0a205_328258_c1
3018 nmdc:mga0a205_346192_c1
3019 nmdc:mga0a205_485986_c1
3020 nmdc:mga0a205_85499_c1
3021 Ga0495612_0139372
3022 Ga0495655_0017138
3023 Ga0495619_0431170
3024 Ga0501084_0009058
3025 Ga0501084_0026876
3026 Ga0501084_0040607
3027 Ga0501084_0059551
3028 Ga0501084_0241147
3029 Ga0501084_0272920
3030 Ga0501084_0475379
3031 Ga0501084_0688939
3032 Ga0501084_0983155
3033 Ga0590075_003995
3034 Ga0590075_086626
3035 Ga0590077_009077
3036 Ga0590077_023594
3037 Ga0590077_073003
3038 Ga0501082_0005543
3039 Ga0501082_0018883
3040 Ga0501082_0033764
3041 Ga0501082_0049904
3042 Ga0501082_0157280
3043 Ga0501082_0584293
3044 Ga0501082_0896797
3045 Ga0501082_1201300
3046 Ga0501082_1305043
3047 Ga0466962_0016768
3048 Ga0466962_0100061
3049 Ga0530510_0035868
3050 Ga0530510_0395116
3051 Ga0530510_0443566
3052 Ga0530510_1176402

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13669

Glyoxalase_4

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

28

138

0.96

PF00903

Glyoxalase

Glyoxalase/Bleomycin resistance protein/Dioxygenase superfamily

26

150

0.91

PF13468

Glyoxalase_3

Glyoxalase-like domain

27

151

0.83

Structural Annotation

Top 5 Hits

ID Description Score Start End
3oa4-assembly1.cif.gz_A-2 crystal structure of hypothetical protein bh1468 from bacillus halodurans c-125 0.9434 5 132
6xbr-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43l) in complex with 2-nitronate-propionyl-coa 0.9291 2 132
6xbv-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (s115t) in complex with 2-nitronate-propionyl-coa 0.9288 2 132
6wf7-assembly1.cif.gz_A methylmalonyl-coa epimerase in complex with methylmalonyl-coa and nh4+ 0.9278 2 132
6xbs-assembly1.cif.gz_A-2 streptomyces coelicolor methylmalonyl-coa epimerase (e43q) in complex with 2-nitronate-propionyl-coa 0.9253 2 132
ID Description Score Start End Superfamily
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9434 5 132 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9342 3 134 3.10.180.10
af_L7N6B1_8_152_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9144 3 134 3.10.180.10
3oa4A01 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.9029 5 132 3.10.180.10
af_A0A1X7YDR8_31_97_3.10.180.10 Alpha Beta;Roll;2,3-Dihydroxybiphenyl 1,2-Dioxygenase; domain 1;2,3-Dihydroxybiphenyl 1,2-Dioxygenase, domain 1 0.8857 4 58 3.10.180.10
ID Description Score Start End GO Terms
AF-A0A538A076-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9677 7 133 GO:0004493
GO:0046491
GO:0046872
AF-A0A6J6XET1-F1-model_v4 Unannotated protein 0.966 3 134 GO:0004493
GO:0046491
GO:0046872
AF-A0A7V9C1Z3-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9647 7 131 GO:0004493
GO:0046491
GO:0046872
AF-A0A7W1H355-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.964 1 132 GO:0004493
GO:0046491
GO:0046872
AF-A0A538FWW5-F1-model_v4 Methylmalonyl-CoA epimerase (EC 5.1.99.1) 0.9622 1 132 GO:0004493
GO:0046491
GO:0046872

Map