F494388

General Info

Members Datasets Scaffolds Average Seq Length
1498 1162 615 291

Family's Representative Sequence

Representative Sequence 3300031995|Ga0307409_100433856|Ga0307409_1004338562
Length 312
Sequence MRAVSAMPDGDKRGLSGVIDMAGAHQKQHDYHIIDPSPWPLLASIGAFVMAFGGVGYMRYLSGGSFKLFGLEFANPWVFFIGLALILYTMFGWWSDTIKEAHEGHHTRVVSLHLRYGMIMFIASEVMFFAAWFWAFFDASLFPGEAIQAARAEFTGGVWPPKGIEVLDPWHLPLYNTVILLLSGTTATWAHHALLHNDRKGLVYGLTLTVLLGVLFSYVQGYEYAHAPFAFKDSIYGATFFMATGFHGFHVLVGTIFLLVCLLRALRGDFTPKHHFGFEAAAWYWHFVDVVWLFLFFSIYIWGGWGAPIAHG

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2503198000 Mesorhizobium opportunistum WSM2075 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2508501123 Mesorhizobium sp. WSM3626 Isolate Nodule
5 2508501127 Mesorhizobium sp. WSM2561 Isolate Nodule
6 2509276018 Mesorhizobium ciceri CMG6 Isolate Nodule
7 2509276019 Ensifer aridi TW10 Isolate Nodule
8 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
9 2509276022 Mesorhizobium australicum WSM2073 Isolate Nodule
10 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
11 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
12 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
13 2510065059 Mesorhizobium ciceri WSM4083 Isolate Nodule
14 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
15 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
16 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
17 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
18 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
19 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
20 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
21 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
22 2512875016 Mesorhizobium japonicum R7A Isolate Nodule
23 2512875024 Mesorhizobium loti R88b Isolate Nodule
24 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
25 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
26 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
27 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
28 2513237087 Azorhizobium doebereinerae UFLA1-100 Isolate Nodule
29 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
30 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
31 2513237090 Mesorhizobium sp. WSM3224 Isolate Nodule
32 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
33 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
34 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
35 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
36 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
37 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
38 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
39 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
40 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
41 2513237159 Rhizobium giardinii bv. giardinii H152 Isolate Nodule
42 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
43 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
44 2513237164 Mesorhizobium loti CJ3sym Isolate Nodule
45 2513237305 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
46 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
47 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
48 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
49 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
50 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
51 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
52 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
53 2516143018 Ensifer sp. BR816 Isolate Nodule
54 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
55 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
56 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
57 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
58 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
59 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
60 2519899620 Rhizobium sp. Pop5 Isolate Nodule
61 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
62 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
63 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
64 2534681786 Brucella suis 92/29 Isolate Unclassified
65 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
66 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
67 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
68 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
69 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
70 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
71 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
72 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
73 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
74 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
75 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
76 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
77 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
78 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
79 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
80 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
81 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
82 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
83 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
84 2582581306 Rhizobium sp. YR295 Isolate Rhizosphere
85 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
86 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
87 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
88 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
89 2582581865 Rhizobium sp. CF258 Isolate Rhizosphere
90 2582581866 Rhizobium sp. CF097 Isolate Rhizosphere
91 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
92 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
93 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
94 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
95 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
96 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
97 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
98 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
99 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
100 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
101 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
102 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
103 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
104 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
105 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
106 2588253730 Mesorhizobium huakuii 7653R Isolate Rhizosphere
107 2597489875 Mesorhizobium ciceri ca181 Isolate Unclassified
108 2599185156 Rhizobium sp. NFR03 Isolate Rhizoplane
109 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
110 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
111 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
112 2599185301 Mesorhizobium sp. NFR06 Isolate Rhizoplane
113 2599185352 Sinorhizobium sp. NFACC03 Isolate Rhizoplane
114 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
115 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
116 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
117 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
118 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
119 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
120 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
121 2643221550 Mesorhizobium sp. Root552 Isolate Unclassified
122 2643221551 Mesorhizobium sp. Root1471 Isolate Unclassified
123 2643221555 Mesorhizobium sp. Root554 Isolate Unclassified
124 2643221557 Ensifer sp. Root558 Isolate Unclassified
125 2643221558 Rhizobium sp. Root149 Isolate Unclassified
126 2643221564 Mesorhizobium sp. Root157 Isolate Unclassified
127 2643221568 Rhizobium sp. Root564 Isolate Unclassified
128 2643221582 Rhizobium sp. Root651 Isolate Unclassified
129 2643221595 Mesorhizobium sp. Root695 Isolate Unclassified
130 2643221599 Rhizobium sp. Root708 Isolate Unclassified
131 2643221607 Rhizobium sp. Root73 Isolate Unclassified
132 2643221610 Ensifer sp. Root74 Isolate Unclassified
133 2643221618 Ensifer sp. Root231 Isolate Unclassified
134 2643221623 Aminobacter sp. DSM 101952 Root100 Isolate Unclassified
135 2643221626 Ensifer sp. Root31 Isolate Unclassified
136 2643221627 Mesorhizobium sp. Root102 Isolate Unclassified
137 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
138 2643221636 Rhizobium sp. Root1204 Isolate Unclassified
139 2643221637 Rhizobium sp. Root1212 Isolate Unclassified
140 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
141 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
142 2643221655 Ensifer sp. Root1252 Isolate Unclassified
143 2643221659 Ensifer sp. Root127 Isolate Unclassified
144 2643221668 Ensifer sp. Root423 Isolate Unclassified
145 2643221675 Ensifer sp. Root1298 Isolate Unclassified
146 2643221680 Ensifer sp. Root1312 Isolate Unclassified
147 2643221686 Rhizobium sp. Root1334 Isolate Unclassified
148 2643221688 Rhizobium sp. Root482 Isolate Unclassified
149 2643221689 Rhizobium sp. Root483D2 Isolate Unclassified
150 2643221693 Rhizobium sp. Root491 Isolate Unclassified
151 2643221698 Ensifer sp. Root142 Isolate Unclassified
152 2643221712 Ensifer sp. Root258 Isolate Unclassified
153 2643221718 Rhizobium sp. Root268 Isolate Unclassified
154 2643221719 Rhizobium sp. Root274 Isolate Unclassified
155 2643221723 Ensifer sp. Root278 Isolate Unclassified
156 2643221726 Ensifer sp. Root954 Isolate Unclassified
157 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
158 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
159 2687453392 Mesorhizobium ciceri biserrulae WSM1284 Isolate Unclassified
160 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
161 2693429783 Mesorhizobium sp. LCM 4577 Isolate Rhizosphere
162 2693429784 Mesorhizobium sp. LCM 4576 Isolate Rhizosphere
163 2718217882 Rhizobium sp. N741 Isolate Nodule
164 2718217927 Rhizobium sp. N324 Isolate Nodule
165 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
166 2718218009 Rhizobium sp. N561 Isolate Nodule
167 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
168 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
169 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
170 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
171 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
172 2718218363 Rhizobium sp. N113 Isolate Nodule
173 2718218365 Rhizobium sp. N731 Isolate Nodule
174 2718218366 Rhizobium sp. N621 Isolate Nodule
175 2718218423 Rhizobium sp. N941 Isolate Nodule
176 2721755514 Rhizobium sp. N6212 Isolate Nodule
177 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
178 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
179 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
180 2721755686 Mesorhizobium amorphae CCNWGS0123 Isolate Nodule
181 2721755809 Rhizobium sp. N541 Isolate Nodule
182 2721755810 Rhizobium sp. N871 Isolate Nodule
183 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
184 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
185 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
186 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
187 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
188 2728369365 Rhizobium sp. N1341 Isolate Nodule
189 2728369397 Rhizobium sp. N1314 Isolate Nodule
190 2738541293 Rhizobium sp. GV031 Isolate Unclassified
191 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
192 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
193 2738543024 Aminobacter sp. AP02 Isolate Unclassified
194 2751185800 Brucella pituitosa AA2 Isolate Unclassified
195 2756170246 Mesorhizobium loti DSM 2626 Isolate Nodule
196 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
197 2758568016 [Ochrobactrum] quorumnocens A44 Isolate Rhizosphere
198 2765235802 Phyllobacterium bourgognense 31-25a Isolate Rhizoplane
199 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
200 2767802442 Phyllobacterium brassicacearum 29-15 Isolate Rhizoplane
201 2775506902 Phyllobacterium zundukense Tri-48 Isolate Unclassified
202 2775506904 Phyllobacterium zundukense Tri-38 Isolate Unclassified
203 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
204 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
205 2791355082 Ensifer alkalisoli YIC4027 Isolate Nodule
206 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
207 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
208 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
209 2791355123 Mesorhizobium sophorae ICMP 19535 Isolate Unclassified
210 2791355253 Rhizobium rhizosphaerae RD15 Isolate Rhizosphere
211 2791355256 Rhizobium sp. M10 Isolate Nodule
212 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
213 2791355260 Rhizobium sp. L9 Isolate Nodule
214 2791355261 Rhizobium sp. J15 Isolate Nodule
215 2791355262 Rhizobium sp. M1 Isolate Nodule
216 2791355263 Rhizobium chutanense C5 Isolate Nodule
217 2791355264 Rhizobium sp. S9 Isolate Nodule
218 2791355265 Rhizobium sp. H4 Isolate Nodule
219 2791355266 Rhizobium sp. L43 Isolate Nodule
220 2791355267 Rhizobium sp. L18 Isolate Nodule
221 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
222 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
223 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
224 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
225 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
226 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
227 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
228 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
229 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
230 2802429633 Rhizobium anhuiense J3 Isolate Nodule
231 2802429634 Rhizobium anhuiense S10 Isolate Nodule
232 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
233 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
234 2802429637 Rhizobium anhuiense C15 Isolate Nodule
235 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
236 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
237 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
238 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
239 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
240 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
241 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
242 2837651117 Pseudohoeflea suaedae YC6898 Isolate Unclassified
243 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
244 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
245 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
246 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
247 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
248 2838048938 Rhizobium pisi 27/80 Isolate Nodule
249 2838061910 Rhizobium phaseoli L15 Isolate Nodule
250 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
251 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
252 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
253 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
254 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
255 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
256 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
257 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
258 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
259 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
260 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
261 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
262 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
263 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
264 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
265 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
266 2839993093 Phyllobacterium endophyticum PEPV15 Isolate Unclassified
267 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
268 2841734538 Mesorhizobium sp. M6A.T.Cr.TU.016.01.1.1 Isolate Nodule
269 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
270 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
271 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
272 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
273 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
274 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
275 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
276 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
277 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
278 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
279 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
280 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
281 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
282 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
283 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
284 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
285 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
286 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
287 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
288 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
289 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
290 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
291 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
292 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
293 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
294 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
295 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
296 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
297 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
298 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
299 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
300 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
301 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
302 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
303 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
304 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
305 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
306 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
307 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
308 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
309 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
310 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
311 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
312 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
313 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
314 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
315 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
316 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
317 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
318 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
319 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
320 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
321 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
322 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
323 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
324 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
325 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
326 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
327 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
328 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
329 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
330 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
331 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
332 2842521101 Rhizobium giardinii SEMIA 4084 Isolate Nodule
333 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
334 2842922631 Pararhizobium sp. R-72066 Isolate Unclassified
335 2844002411 Mesorhizobium sp. M7D.F.Ca.US.005.01.1.1 Isolate Nodule
336 2844009547 Mesorhizobium sp. M7A.F.Ce.TU.012.03.2.1 Isolate Nodule
337 2844163670 Ensifer sp. 1H6 Isolate Unclassified
338 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
339 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
340 2847670302 Mesorhizobium sp. M3A.F.Ca.ET.080.04.2.1 Isolate Nodule
341 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
342 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
343 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
344 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
345 2854911287 Brucella lupini LUP21 Isolate Unclassified
346 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
347 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
348 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
349 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
350 2856314179 Mesorhizobium sp. M3A.F.Ca.ET.175.01.1.1 Isolate Nodule
351 2856320880 Mesorhizobium sp. M8A.F.Ca.ET.165.01.1.1 Isolate Nodule
352 2856328259 Mesorhizobium sp. Primo-B Isolate Nodule
353 2856334872 Mesorhizobium sp. M7A.F.Ca.US.005.03.1.1 Isolate Nodule
354 2856342000 Mesorhizobium sp. M5C.F.Cr.IN.023.01.1.1 Isolate Nodule
355 2856349417 Mesorhizobium sp. M4A.F.Ca.ET.090.04.2.1 Isolate Nodule
356 2856356410 Mesorhizobium sp. M4B.F.Ca.ET.088.02.2.1 Isolate Nodule
357 2856364286 Mesorhizobium sp. M00.F.Ca.ET.151.01.1.1 Isolate Nodule
358 2857349434 Mesorhizobium sp. M2E.F.Ca.ET.166.01.1.1 Isolate Nodule
359 2857367948 Mesorhizobium sp. M7A.F.Ca.US.002.01.1.1 Isolate Nodule
360 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
361 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
362 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
363 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
364 2869169390 Mesorhizobium sp. M7A.F.Ca.CA.001.10.2.1 Isolate Nodule
365 2869234852 Mesorhizobium sp. M7A.T.Ca.US.000.02.2.1 Isolate Nodule
366 2869242130 Mesorhizobium sp. M7A.F.Ca.CA.004.11.2.1 Isolate Nodule
367 2869249662 Mesorhizobium sp. M7A.F.Ca.CA.001.16.1.1 Isolate Nodule
368 2869256925 Mesorhizobium sp. M7A.F.Ca.MR.176.00.0.0 Isolate Nodule
369 2869264136 Mesorhizobium sp. M7A.F.Ca.CA.001.15.1.1 Isolate Nodule
370 2869271264 Mesorhizobium sp. M7A.F.Ca.AU.002.06.1.1 Isolate Nodule
371 2869278585 Mesorhizobium sp. M8A.F.Ca.ET.198.01.1.1 Isolate Nodule
372 2869285874 Mesorhizobium sp. M2D.F.Ca.ET.147.01.1.1 Isolate Nodule
373 2871429161 Mesorhizobium sp. M2D.F.Ca.ET.225.01.1.1 Isolate Nodule
374 2871435913 Mesorhizobium sp. M7A.F.Ca.MR.228.00.0.0 Isolate Nodule
375 2871444079 Mesorhizobium sp. M1A.F.Ca.IN.020.06.1.1 Isolate Nodule
376 2871451962 Mesorhizobium sp. M7A.F.Ca.US.006.01.1.1 Isolate Nodule
377 2871459585 Mesorhizobium sp. M7A.F.Ca.CA.001.09.1.1 Isolate Nodule
378 2871466892 Mesorhizobium sp. M7D.F.Ca.US.004.01.2.1 Isolate Nodule
379 2871474448 Mesorhizobium sp. M6A.T.Cr.TU.017.01.1.1 Isolate Nodule
380 2871481445 Mesorhizobium sp. M7A.F.Ca.CA.004.02.1.1 Isolate Nodule
381 2871488783 Mesorhizobium sp. M4B.F.Ca.ET.203.01.1.1 Isolate Nodule
382 2871495908 Mesorhizobium sp. M1C.F.Ca.ET.193.01.1.1 Isolate Nodule
383 2874102143 Mesorhizobium sp. M1A.F.Ca.IN.022.04.1.1 Isolate Nodule
384 2874109183 Mesorhizobium sp. M7A.T.Ca.TU.009.02.1.1 Isolate Nodule
385 2874116593 Mesorhizobium sp. M7A.F.Ca.CA.004.08.2.1 Isolate Nodule
386 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
387 2874131515 Mesorhizobium sp. M7A.F.Ca.CA.001.05.1.1 Isolate Nodule
388 2874139085 Mesorhizobium sp. M8A.F.Ca.ET.207.01.1.1 Isolate Nodule
389 2874146452 Mesorhizobium sp. M2D.F.Ca.ET.160.01.1.1 Isolate Nodule
390 2874155637 Mesorhizobium sp. M2D.F.Ca.ET.224.01.1.1 Isolate Nodule
391 2874162495 Mesorhizobium sp. M7A.F.Ca.CA.002.11.2.1 Isolate Nodule
392 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
393 2876363079 Mesorhizobium loti R7ANS::ICEMlSym2042 Isolate Nodule
394 2876369609 Mesorhizobium sp. USDA-HM6 Isolate Unclassified
395 2876377896 Mesorhizobium sp. M2C.T.Ca.TU.009.01.2.1 Isolate Nodule
396 2876386047 Mesorhizobium sp. M7A.F.Ca.CA.004.07.1.1 Isolate Nodule
397 2876392853 Mesorhizobium sp. M1D.F.Ca.ET.234.01.1.1 Isolate Nodule
398 2876399893 Mesorhizobium sp. M7A.F.Ca.AU.002.03.1.1 Isolate Nodule
399 2876406927 Mesorhizobium sp. M7A.F.Ca.CA.002.03.2.1 Isolate Nodule
400 2876413966 Mesorhizobium sp. M2D.F.Ca.ET.233.01.1.1 Isolate Nodule
401 2876420981 Mesorhizobium sp. M7A.F.Ca.CA.004.08.1.1 Isolate Nodule
402 2878035449 Mesorhizobium sp. M3A.F.Ca.ET.201.01.1.1 Isolate Nodule
403 2878730984 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.1 Isolate Nodule
404 2878738818 Mesorhizobium sp. M8A.F.Ca.ET.218.01.1.1 Isolate Nodule
405 2878745973 Mesorhizobium sp. M2D.F.Ca.ET.226.01.1.1 Isolate Nodule
406 2878753008 Mesorhizobium sp. M4B.F.Ca.ET.150.01.1.1 Isolate Nodule
407 2878760144 Mesorhizobium sp. M1C.F.Ca.ET.192.01.1.1 Isolate Nodule
408 2878767105 Mesorhizobium sp. M1C.F.Ca.ET.144.01.1.1 Isolate Nodule
409 2878774303 Mesorhizobium sp. M7A.F.Ca.CA.002.15.1.1 Isolate Nodule
410 2878781027 Mesorhizobium sp. M7A.F.Ca.CA.001.12.2.1 Isolate Nodule
411 2878788777 Mesorhizobium sp. M6A.T.Ca.TU.002.02.2.1 Isolate Nodule
412 2881147464 Mesorhizobium sp. M1B.F.Ca.ET.045.04.1.1 Isolate Nodule
413 2881155292 Mesorhizobium sp. M4B.F.Ca.ET.058.02.1.1 Isolate Nodule
414 2881161766 Mesorhizobium sp. M1D.F.Ca.ET.043.01.1.1 Isolate Nodule
415 2881845957 Mesorhizobium sp. M4B.F.Ca.ET.019.03.1.1 Isolate Nodule
416 2881853255 Mesorhizobium sp. M4A.F.Ca.ET.020.02.1.1 Isolate Nodule
417 2881861095 Mesorhizobium sp. M4B.F.Ca.ET.049.02.1.2 Isolate Nodule
418 2882632389 Mesorhizobium waimense ICMP19557 Isolate Unclassified
419 2882912400 Mesorhizobium sp. M4B.F.Ca.ET.013.02.1.1 Isolate Nodule
420 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
421 2885312484 Mesorhizobium sp. M9A.F.Ca.ET.002.03.1.2 Isolate Nodule
422 2885318864 Mesorhizobium sp. M4B.F.Ca.ET.017.02.2.1 Isolate Nodule
423 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
424 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
425 2885350715 Mesorhizobium sp. M4A.F.Ca.ET.022.05.2.1 Isolate Nodule
426 2888337043 Mesorhizobium sp. M8A.F.Ca.ET.057.01.1.1 Isolate Nodule
427 2888343758 Mesorhizobium sp. AA22 Isolate Unclassified
428 2888350351 Mesorhizobium sp. M2A.F.Ca.ET.046.03.2.1 Isolate Nodule
429 2889010040 Mesorhizobium sp. M2A.F.Ca.ET.043.05.1.1 Isolate Nodule
430 2889016732 Mesorhizobium sp. M2A.F.Ca.ET.043.02.1.1 Isolate Nodule
431 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
432 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
433 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
434 2891373044 Shinella sp. AETb1-6 Isolate Rhizosphere
435 2894652903 Phyllobacterium sp. SYP-B3895 Isolate Rhizosphere
436 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
437 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
438 2896429255 Sphingomonas rhizophila KACC 19189 Isolate Rhizosphere
439 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
440 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
441 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
442 2903448605 Mesorhizobium japonicum Opo-235 Isolate Nodule
443 2903492973 Mesorhizobium sp. M00.F.Ca.ET.220.01.1.1 Isolate Nodule
444 2903513507 Mesorhizobium sp. M7A.T.Ca.TU.009.01.1.2 Isolate Nodule
445 2903521522 Mesorhizobium loti R7ANS::ICEMlSym2014 Isolate Nodule
446 2903528002 Mesorhizobium loti R7ANS::ICEMlSym2037 Isolate Nodule
447 2903540706 Mesorhizobium sp. M1C.F.Ca.ET.212.01.1.1 Isolate Nodule
448 2904578770 Phyllobacterium sp. 586 Isolate Unclassified
449 2904659560 Mesorhizobium sp. M1D.F.Ca.ET.184.01.1.1 Isolate Nodule
450 2906308376 Mesorhizobium sp. M2D.F.Ca.ET.185.01.1.1 Isolate Nodule
451 2906321335 Mesorhizobium sp. M2D.F.Ca.ET.206.01.1.1 Isolate Nodule
452 2906328253 Mesorhizobium sp. M1A.T.Ca.IN.004.03.1.1 Isolate Nodule
453 2906354277 Mesorhizobium sp. M2A.F.Ca.ET.040.01.1.1 Isolate Nodule
454 2906363423 Mesorhizobium sp. M7A.F.Ca.CA.001.14.1.1 Isolate Nodule
455 2906370794 Mesorhizobium sp. M7A.F.Ca.CA.001.13.1.1 Isolate Nodule
456 2906378014 Mesorhizobium sp. M7D.F.Ca.US.004.03.1.1 Isolate Nodule
457 2906386501 Mesorhizobium sp. M7A.F.Ca.CA.003.01.2.1 Isolate Nodule
458 2906393657 Mesorhizobium sp. M7A.F.Ca.CA.001.11.2.1 Isolate Nodule
459 2906401398 Mesorhizobium sp. M7A.F.Ca.CA.004.10.1.1 Isolate Nodule
460 2906408224 Mesorhizobium sp. M7A.F.Ca.CA.002.03.1.1 Isolate Nodule
461 2906414383 Mesorhizobium sp. M3A.F.Ca.ET.174.01.1.1 Isolate Nodule
462 2906427513 Mesorhizobium sp. M7A.F.Ca.CA.004.05.1.1 Isolate Nodule
463 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
464 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
465 2915650412 Ochrobactrum sp. CM-21-5 Isolate Rhizosphere
466 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
467 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
468 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
469 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
470 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
471 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
472 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
473 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
474 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
475 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
476 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
477 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
478 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
479 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
480 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
481 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
482 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
483 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
484 2919119836 Phyllobacterium sp. 1468 Isolate Rhizosphere
485 2919166419 Agrobacterium cavarae 2074 Isolate Unclassified
486 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
487 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
488 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
489 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
490 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
491 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
492 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
493 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
494 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
495 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
496 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
497 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
498 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
499 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
500 2922130491 Mesorhizobium sp. M00.F.Ca.ET.038.03.1.1 Isolate Nodule
501 2922151315 Mesorhizobium sp. M7A.F.Ca.US.007.01.2.1 Isolate Nodule
502 2922158528 Mesorhizobium sp. M1A.F.Ca.IN.022.05.2.1 Isolate Nodule
503 2922172374 Mesorhizobium sp. M7A.F.Ca.CA.002.06.1.1 Isolate Nodule
504 2922178524 Mesorhizobium sp. M7A.F.Ca.CA.002.09.1.1 Isolate Nodule
505 2922185730 Mesorhizobium sp. M2A.F.Ca.ET.037.01.1.1 Isolate Nodule
506 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
507 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
508 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
509 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
510 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
511 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
512 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
513 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
514 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
515 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
516 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
517 2924214083 Sinorhizobium meliloti USDA1702 Isolate Nodule
518 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
519 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
520 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
521 2924718760 Mesorhizobium sp. M8A.F.Ca.ET.023.01.1.1 Isolate Nodule
522 2924726620 Mesorhizobium sp. M1A.F.Ca.IN.020.03.2.1 Isolate Nodule
523 2924733363 Mesorhizobium sp. M7A.F.Ca.US.011.01.1.1 Isolate Nodule
524 2924741084 Mesorhizobium sp. M7A.F.Ca.CA.004.09.1.2 Isolate Nodule
525 2924748358 Mesorhizobium sp. M7A.F.Ca.CA.002.14.1.2 Isolate Nodule
526 2924754689 Mesorhizobium sp. M5C.F.Ca.IN.020.32.2.1 Isolate Nodule
527 2924762789 Mesorhizobium sp. WSM4303 Isolate Unclassified
528 2924776078 Mesorhizobium sp. M8A.F.Ca.ET.213.01.1.1 Isolate Nodule
529 2924784321 Mesorhizobium sp. M4B.F.Ca.ET.143.01.1.1 Isolate Nodule
530 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
531 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
532 2928521798 Phyllobacterium ifriqiyense 1451 Isolate Rhizosphere
533 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
534 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
535 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
536 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
537 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
538 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
539 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
540 2933599457 Rhizobium phaseoli M3 Isolate Nodule
541 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
542 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
543 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
544 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
545 2936381700 Rhizobium chutanense C16 Isolate Unclassified
546 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
547 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
548 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
549 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
550 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
551 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
552 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
553 2937042894 Sinorhizobium meliloti USDA1687 Isolate Nodule
554 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
555 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
556 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
557 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
558 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
559 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
560 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
561 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
562 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
563 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
564 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
565 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
566 2937813078 Mesorhizobium sp. M2D.F.Ca.ET.223.01.1.1 Isolate Nodule
567 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
568 2937836603 Mesorhizobium sp. M6A.T.Cr.TU.014.01.1.1 Isolate Nodule
569 2937848649 Mesorhizobium sp. WSM4310 Isolate Unclassified
570 2937861824 Mesorhizobium sp. M7A.F.Ca.CA.001.07.2.1 Isolate Nodule
571 2937868953 Mesorhizobium sp. M7A.F.Ca.CA.001.13.2.1 Isolate Nodule
572 2937877337 Mesorhizobium sp. M8A.F.Ca.ET.161.01.1.1 Isolate Nodule
573 2937891427 Mesorhizobium sp. M1A.F.Ca.IN.022.07.1.1 Isolate Nodule
574 2937972304 Mesorhizobium sp. M8A.F.Ca.ET.173.01.1.1 Isolate Nodule
575 2937980651 Mesorhizobium sp. M7A.F.Ca.CA.004.04.2.1 Isolate Nodule
576 2937994558 Mesorhizobium sp. M1C.F.Ca.ET.187.01.1.1 Isolate Nodule
577 2938014810 Mesorhizobium sp. M2C.T.Ca.TU.002.02.1.1 Isolate Nodule
578 2941499720 Ensifer sp. 4252 Isolate Rhizosphere
579 2954011201 Phyllobacterium ifrigiyense W4I11 Isolate Rhizosphere
580 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
581 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
582 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
583 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
584 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
585 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
586 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
587 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
588 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
589 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
590 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
591 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
592 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
593 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
594 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
595 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
596 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
597 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
598 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
599 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
600 2958034702 Mesorhizobium sp. M8A.F.Ca.ET.202.01.1.1 Isolate Nodule
601 2958041894 Mesorhizobium sp. M00.F.Ca.ET.149.01.1.1 Isolate Nodule
602 2958064165 Mesorhizobium sp. SARCC-RB16n Isolate Unclassified
603 2958071322 Mesorhizobium sp. M6A.T.Ce.TU.016.01.1.1 Isolate Nodule
604 2958084443 Mesorhizobium sp. M8A.F.Ca.ET.142.01.1.1 Isolate Nodule
605 2958092219 Mesorhizobium sp. M8A.F.Ca.ET.059.01.1.1 Isolate Nodule
606 2958100919 Mesorhizobium sp. M2A.F.Ca.ET.015.02.1.1 Isolate Nodule
607 2958108152 Mesorhizobium sp. M7A.F.Ca.CA.004.11.1.1 Isolate Nodule
608 2958115193 Mesorhizobium sp. M00.F.Ca.ET.217.01.1.1 Isolate Nodule
609 2958122699 Mesorhizobium sp. M7A.F.Ca.US.001.04.2.1 Isolate Nodule
610 2958130278 Mesorhizobium sp. M2D.F.Ca.ET.148.01.1.1 Isolate Nodule
611 2958137437 Mesorhizobium sp. M7A.F.Ca.CA.002.04.1.1 Isolate Nodule
612 2958144490 Mesorhizobium sp. M8A.F.Ca.ET.021.01.1.1 Isolate Nodule
613 2958158011 Mesorhizobium sp. M7A.F.Ca.CA.002.15.2.1 Isolate Nodule
614 2958165035 Mesorhizobium sp. M1C.F.Ca.ET.196.01.1.1 Isolate Nodule
615 2958172287 Mesorhizobium sp. M2A.F.Ca.ET.029.05.1.1 Isolate Nodule
616 2958179912 Mesorhizobium sp. M2D.F.Ca.ET.171.01.1.1 Isolate Nodule
617 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
618 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
619 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
620 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
621 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
622 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
623 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
624 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
625 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
626 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
627 2960652885 Sinorhizobium meliloti USDA1199 Isolate Nodule
628 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
629 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
630 2960674078 Sinorhizobium meliloti USDA1666 Isolate Nodule
631 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
632 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
633 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
634 2961077736 Mesorhizobium sp. M2D.F.Ca.ET.178.01.1.1 Isolate Nodule
635 2961114664 Mesorhizobium sp. M1D.F.Ca.ET.231.01.1.1 Isolate Nodule
636 2961127735 Mesorhizobium sp. M4A.F.Ca.ET.029.04.2.1 Isolate Nodule
637 2961136820 Mesorhizobium sp. M7A.F.Ca.AU.001.01.1.1 Isolate Nodule
638 2961163497 Mesorhizobium sp. M1C.F.Ca.ET.176.01.1.1 Isolate Nodule
639 2961170736 Mesorhizobium sp. M4B.F.Ca.ET.200.01.1.1 Isolate Nodule
640 2961183825 Mesorhizobium sp. M7A.F.Ca.CA.001.12.1.1 Isolate Nodule
641 2963644680 Mesorhizobium japonicum R7A Isolate Nodule
642 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
643 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
644 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
645 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
646 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
647 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
648 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
649 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
650 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
651 2964670856 Sinorhizobium meliloti USDA1211 Isolate Nodule
652 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
653 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
654 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
655 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
656 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
657 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
658 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
659 2965018300 Mesorhizobium sp. M1C.F.Ca.ET.188.01.1.1 Isolate Nodule
660 2965025482 Mesorhizobium sp. Primo-A Isolate Nodule
661 2965032056 Mesorhizobium sp. M7A.F.Ca.US.006.04.2.1 Isolate Nodule
662 2965040258 Mesorhizobium sp. M7A.F.Ca.CA.001.06.1.1 Isolate Nodule
663 2965047637 Mesorhizobium sp. M7A.F.Ca.US.014.04.1.1 Isolate Nodule
664 2965062239 Mesorhizobium sp. M1A.F.Ca.ET.072.01.1.1 Isolate Nodule
665 2965089291 Mesorhizobium sp. M7A.F.Ca.CA.001.04.1.1 Isolate Nodule
666 2965102966 Mesorhizobium sp. M7A.F.Ca.AU.002.02.1.1 Isolate Nodule
667 2965110997 Mesorhizobium sp. M7A.F.Ca.US.003.02.2.1 Isolate Nodule
668 2965119406 Mesorhizobium sp. M2A.F.Ca.ET.067.02.1.1 Isolate Nodule
669 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
670 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
671 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
672 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
673 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
674 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
675 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
676 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
677 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
678 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
679 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
680 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
681 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
682 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
683 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
684 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
685 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
686 2967996073 Mesorhizobium sp. M4B.F.Ca.ET.169.01.1.1 Isolate Nodule
687 2968003550 Mesorhizobium sp. M4B.F.Ca.ET.215.01.1.1 Isolate Nodule
688 2968016561 Mesorhizobium sp. M8A.F.Ca.ET.182.01.1.1 Isolate Nodule
689 2968083720 Mesorhizobium erdmanii Opo-242 Isolate Unclassified
690 2968091066 Mesorhizobium sp. AA23 Isolate Unclassified
691 2968097103 Mesorhizobium sp. M1A.F.Ca.IN.020.30.1.1 Isolate Nodule
692 2968110612 Mesorhizobium sp. M1D.F.Ca.ET.183.01.1.1 Isolate Nodule
693 2968117919 Mesorhizobium atlanticum CNPSo 3140 Isolate Unclassified
694 2968128360 Mesorhizobium sp. WSM3873 Isolate Unclassified
695 2968138860 Mesorhizobium sp. M7A.F.Ca.ET.027.03.2.1 Isolate Nodule
696 2968171901 Mesorhizobium sp. M1C.F.Ca.ET.189.01.1.1 Isolate Nodule
697 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
698 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
699 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
700 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
701 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
702 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
703 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
704 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
705 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
706 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
707 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
708 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
709 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
710 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
711 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
712 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
713 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
714 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
715 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
716 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
717 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
718 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
719 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
720 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
721 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
722 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
723 2970469710 Mesorhizobium sp. M8A.F.Ca.ET.181.01.1.1 Isolate Nodule
724 2970489779 Mesorhizobium sp. M7A.F.Ca.US.008.03.1.1 Isolate Nodule
725 2970503327 Mesorhizobium sp. M4B.F.Ca.ET.190.01.1.1 Isolate Nodule
726 2970510686 Mesorhizobium sp. M7A.F.Ca.MR.148.00.0.0 Isolate Nodule
727 2970524798 Mesorhizobium sp. M5C.F.Ca.ET.164.01.1.1 Isolate Nodule
728 2970532167 Mesorhizobium sp. M7A.F.Ca.CA.002.05.1.1 Isolate Nodule
729 2970540015 Mesorhizobium sp. M5C.F.Ca.IN.020.29.1.1 Isolate Nodule
730 2970547951 Mesorhizobium sp. M7A.F.Ca.AU.002.04.1.1 Isolate Nodule
731 2970554993 Mesorhizobium sp. M1C.F.Ca.ET.210.01.1.1 Isolate Nodule
732 2970593180 Mesorhizobium sp. M8A.F.Ca.ET.197.01.1.1 Isolate Nodule
733 2970619444 Mesorhizobium sp. M7A.F.Ca.ET.027.02.1.1 Isolate Nodule
734 2970627176 Mesorhizobium sp. M7A.F.Ca.US.006.01.2.1 Isolate Nodule
735 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
736 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
737 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
738 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
739 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
740 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
741 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
742 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
743 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
744 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
745 2977821940 Mesorhizobium sp. M4B.F.Ca.ET.214.01.1.1 Isolate Nodule
746 2977828996 Mesorhizobium sp. M4B.F.Ca.ET.089.01.1.1 Isolate Nodule
747 2977843712 Mesorhizobium sp. M2D.F.Ca.ET.140.01.1.1 Isolate Nodule
748 2977851361 Mesorhizobium sp. M7A.F.Ca.CA.004.06.2.1 Isolate Nodule
749 2977858184 Mesorhizobium sp. M1A.F.Ca.IN.020.03.1.1 Isolate Nodule
750 2977864932 Mesorhizobium tamadayense DSM 28320 Isolate Nodule
751 2977872689 Mesorhizobium sp. M7A.F.Ca.US.001.04.1.1 Isolate Nodule
752 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
753 2977907340 Mesorhizobium sp. M7A.F.Ca.CA.004.12.1.1 Isolate Nodule
754 2977915119 Mesorhizobium sp. M7A.F.Ca.CA.001.09.2.1 Isolate Nodule
755 2977922695 Mesorhizobium sp. WSM4305 Isolate Unclassified
756 2977935797 Mesorhizobium sp. M7A.F.Ca.CA.002.12.1.1 Isolate Nodule
757 2977942078 Mesorhizobium sp. M2E.F.Ca.ET.209.01.1.1 Isolate Nodule
758 2977950692 Mesorhizobium sp. M7A.F.Ca.CA.001.04.2.1 Isolate Nodule
759 2977957713 Mesorhizobium sp. M7A.F.Ca.US.001.02.1.1 Isolate Nodule
760 2977986579 Mesorhizobium intechi BD68 Isolate Unclassified
761 2978969890 Agrobacterium sp. SORGH_AS 787 Isolate Unclassified
762 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
763 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
764 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
765 2979710463 Mesorhizobium sp. M2A.F.Ca.ET.017.03.2.1 Isolate Nodule
766 2979742915 Mesorhizobium sp. M2A.F.Ca.ET.046.02.1.1 Isolate Nodule
767 2979764755 Mesorhizobium sp. M7A.F.Ca.CA.004.05.2.1 Isolate Nodule
768 2979772303 Mesorhizobium sp. M7A.F.Ca.CA.004.04.1.1 Isolate Nodule
769 2979779861 Mesorhizobium sp. M1A.F.Ca.IN.022.02.1.1 Isolate Nodule
770 2979793036 Mesorhizobium sp. M7A.F.Ca.US.007.01.1.1 Isolate Nodule
771 2979808191 Mesorhizobium sp. M4B.F.Ca.ET.172.01.1.1 Isolate Nodule
772 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
773 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
774 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
775 2984587000 Agrobacterium larrymoorei SORGH_AS974 Isolate Aerial Root
776 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
777 2987636660 Mesorhizobium sp. M2E.F.Ca.ET.154.01.1.1 Isolate Nodule
778 2987645492 Mesorhizobium sp. M7A.F.Ca.CA.002.10.1.1 Isolate Nodule
779 2987652177 Mesorhizobium sp. M2A.F.Ca.ET.042.01.1.1 Isolate Nodule
780 2987659509 Mesorhizobium sp. M1C.F.Ca.ET.204.01.1.1 Isolate Nodule
781 2987666974 Mesorhizobium sp. WSM4306 Isolate Unclassified
782 2987673487 Mesorhizobium sp. M7A.F.Ca.US.003.02.1.1 Isolate Nodule
783 2989349275 Shinella kummerowiae CCBAU 25048 Isolate Unclassified
784 2989771324 Rhizobium rhizolycopersici DBTS2 Isolate Rhizosphere
785 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
786 2995392953 Martelella limonii NBRC 109441 Isolate Unclassified
787 2996310559 Mesorhizobium zhangyense CGMCC 1.15528 Isolate Unclassified
788 2996336353 Mesorhizobium sp. YM1C-6-2 Isolate Unclassified
789 2996341866 Mesorhizobium sp. M1A.F.Ca.IN.020.32.1.1 Isolate Nodule
790 2996348954 Mesorhizobium sp. M8A.F.Ca.ET.167.01.1.1 Isolate Nodule
791 2996386984 Mesorhizobium sp. M7A.F.Ca.MR.245.00.0.0 Isolate Nodule
792 2996887358 Rhizobium sp. R711 Isolate Nodule
793 2996893221 Rhizobium sp. R635 Isolate Nodule
794 3000135777 Unclassified bacterium M00.F.Ca.ET.205.01.1.1 Isolate Unclassified
795 3002141150 Phyllobacterium sp. 628 Isolate Unclassified
796 3003930520 Sinorhizobium sp. BG8 Isolate Unclassified
797 3004167301 Mesorhizobium loti 582 Isolate Unclassified
798 3004188549 Mesorhizobium sp. M1C.F.Ca.ET.195.01.1.1 Isolate Nodule
799 3004195979 Mesorhizobium sp. M7A.F.Ca.CA.001.08.2.1 Isolate Nodule
800 3004203850 Mesorhizobium sp. M2E.F.Ca.ET.219.01.1.1 Isolate Nodule
801 3004211236 Mesorhizobium sp. WSM4307 Isolate Unclassified
802 3004218560 Mesorhizobium sp. WSM4315 Isolate Unclassified
803 3004232784 Mesorhizobium sp. M7A.T.Ca.US.000.02.1.1 Isolate Nodule
804 3004239961 Mesorhizobium sp. M7A.F.Ca.US.005.03.2.1 Isolate Nodule
805 3004248173 Mesorhizobium sp. M7A.F.Ca.CA.004.06.1.1 Isolate Nodule
806 3004268573 Mesorhizobium sp. M7A.F.Ca.US.010.02.1.1 Isolate Nodule
807 3004275668 Mesorhizobium sp. M8A.F.Ca.ET.208.01.1.1 Isolate Nodule
808 3004289098 Mesorhizobium sp. M8A.F.Ca.ET.023.02.2.1 Isolate Nodule
809 3004334049 Mesorhizobium huakuii 583 Isolate Unclassified
810 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
811 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
812 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
813 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
814 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
815 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
816 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
817 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
818 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
819 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
820 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
821 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
822 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
823 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
824 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
825 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
826 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
827 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
828 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
829 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
830 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
831 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
832 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
833 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
834 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
835 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
836 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
837 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
838 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
839 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
840 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
841 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
842 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
843 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
844 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
845 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
846 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
847 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
848 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
849 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
850 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
851 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
852 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
853 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
854 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
855 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
856 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
857 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
858 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
859 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
860 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
861 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
862 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
863 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
864 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
865 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
866 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
867 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
868 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
869 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
870 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
871 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
872 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
873 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
874 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
875 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
876 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
877 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
878 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
879 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
880 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
881 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
882 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
883 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
884 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
885 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
886 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
887 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
888 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
889 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
890 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
891 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
892 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
893 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
894 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
895 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
896 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
897 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
898 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
899 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
900 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
901 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
902 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
903 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
904 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
905 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
906 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
907 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
908 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
909 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
910 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
911 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
912 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
913 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
914 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
915 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
916 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
917 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
918 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
919 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
920 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
921 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
922 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
923 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
924 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
925 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
926 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
927 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
928 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
929 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
930 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
931 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
932 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
933 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
934 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
935 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
936 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
937 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
938 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
939 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
940 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
941 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
942 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
943 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
944 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
945 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
946 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
947 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
948 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
949 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
950 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
951 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
952 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
953 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
954 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
955 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
956 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
957 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
958 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
959 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
960 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
961 3300039062 Seagrass microbial communities from Seahorse Key, FL, USA - HH0818 Metagenome Unclassified
962 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
963 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
964 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
965 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
966 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
967 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
968 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
969 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
970 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
971 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
972 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
973 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
974 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
975 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
976 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
977 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
978 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
979 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
980 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
981 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
982 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
983 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
984 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
985 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
986 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
987 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
988 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
989 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
990 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
991 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
992 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
993 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
994 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
995 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
996 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
997 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
998 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
999 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
1000 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
1001 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
1002 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
1003 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
1004 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
1005 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
1006 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
1007 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
1008 3300049513 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D25_A_7_control Metagenome Rhizosphere
1009 3300049515 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_B_5_drought Metagenome Rhizosphere
1010 3300049520 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E22_B_7_drought Metagenome Rhizosphere
1011 3300049523 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J25_B_7_control Metagenome Rhizosphere
1012 3300049524 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H21_B_7_control Metagenome Rhizosphere
1013 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
1014 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
1015 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
1016 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
1017 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
1018 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
1019 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
1020 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
1021 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
1022 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
1023 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
1024 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
1025 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
1026 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
1027 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
1028 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
1029 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
1030 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
1031 3300049653 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_A_0_control Metagenome Rhizosphere
1032 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
1033 3300049665 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H4_A_2_drought Metagenome Rhizosphere
1034 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
1035 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
1036 3300049670 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_B_2_drought Metagenome Rhizosphere
1037 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
1038 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
1039 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
1040 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
1041 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
1042 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
1043 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
1044 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
1045 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
1046 3300049777 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G24_A_5_control Metagenome Rhizosphere
1047 3300049778 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I22_A_5_control Metagenome Rhizosphere
1048 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
1049 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
1050 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
1051 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
1052 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
1053 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
1054 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
1055 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
1056 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
1057 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
1058 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
1059 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
1060 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
1061 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
1062 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
1063 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
1064 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
1065 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
1066 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
1067 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
1068 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
1069 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
1070 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
1071 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
1072 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
1073 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
1074 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
1075 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
1076 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
1077 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
1078 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
1079 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
1080 3300053724 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 endosphere Metagenome Endosphere
1081 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
1082 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1083 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1084 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1085 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1086 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1087 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1088 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1089 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1090 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1091 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
1092 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
1093 637000159 Mesorhizobium japonicum MAFF 303099 Isolate Unclassified
1094 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
1095 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
1096 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
1097 649633066 Mesorhizobium ciceri bv. biserrulae WSM1271 Isolate Nodule
1098 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
1099 8002285264 Aminobacter anthyllidis LMG 26462 Isolate Nodule
1100 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
1101 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
1102 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
1103 8004300914 Mesorhizobium sp. M7A.F.Ca.CA.002.07.1.1 Isolate Nodule
1104 8004312739 Mesorhizobium sp. M7A.F.Ca.MR.362.00.0.0 Isolate Nodule
1105 8004361976 Mesorhizobium sp. M7A.F.Ca.CA.001.08.1.1 Isolate Nodule
1106 8004374579 Mesorhizobium sp. M4B.F.Ca.ET.211.01.1.1 Isolate Nodule
1107 8004387939 Mesorhizobium sp. M2D.F.Ca.ET.232.01.1.1 Isolate Nodule
1108 8004395343 Mesorhizobium sp. M5C.F.Ca.IN.020.14.1.1 Isolate Nodule
1109 8004445564 Mesorhizobium sp. M1A.F.Ca.IN.020.04.1.1 Isolate Nodule
1110 8004633249 Mesorhizobium sp. M6A.T.Ce.TU.002.03.1.1 Isolate Nodule
1111 8004640170 Mesorhizobium sp. GbtcB19 Isolate Unclassified
1112 8004695233 Mesorhizobium sp. M7A.F.Ca.US.001.01.1.1 Isolate Nodule
1113 8004703790 Mesorhizobium sp. M00.F.Ca.ET.158.01.1.1 Isolate Nodule
1114 8004714634 Mesorhizobium sp. M2D.F.Ca.ET.153.01.1.1 Isolate Nodule
1115 8004727605 Mesorhizobium sp. M7A.F.Ca.CA.004.01.1.1 Isolate Nodule
1116 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
1117 8005258706 Rhizobium sp. R693 Isolate Nodule
1118 8005275841 Rhizobium sp. N4311 Isolate Nodule
1119 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
1120 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
1121 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
1122 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
1123 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
1124 8005321885 Rhizobium sp. R72 Isolate Nodule
1125 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
1126 8005382845 Rhizobium sp. R634 Isolate Nodule
1127 8005395548 Rhizobium sp. R339 Isolate Nodule
1128 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
1129 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
1130 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
1131 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
1132 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
1133 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
1134 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
1135 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
1136 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
1137 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
1138 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
1139 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
1140 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
1141 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
1142 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
1143 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
1144 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
1145 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
1146 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
1147 8018176218 Rhizobium sp. N122 Isolate Nodule
1148 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
1149 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
1150 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
1151 8024501048 Rhizobium sp. H4 Isolate Nodule
1152 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
1153 8049293176 Ensifer alkalisoli YIC4027 Isolate Nodule
1154 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
1155 8054558443 Rhizobium alarense TRM95111 Isolate Nodule
1156 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
1157 8055617313 Mesorhizobium onobrychidis OM4 Isolate Nodule
1158 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
1159 8056382006 Rhizobium croatiense 13T Isolate Nodule
1160 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
1161 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
1162 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 39.79
Metatranscriptomes 1.27
Isolates 58.95

Biome Distribution

Category Percentage (%)
Aerial Root 0.33
Bulb 0
Endosphere 14.62
Nodule 45.86
Rhizoplane 1.34
Rhizosphere 22.5
Stem 0
Stem Tuber 0
Unclassified 15.35

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C2142 2010549000 Bacteria 1467
2 JGI24740J21852_10000294 3300001979 Bacteria 21271
3 JGI24740J21852_10011706 3300001979 Bacteria 3332
4 JGI24739J22299_10010929 3300001989 Bacteria 3356
5 JGI25155J39150_1000006 3300002704 Bacteria 244109
6 JGI25156J39149_1000019 3300002705 Bacteria 160845
7 JGI25156J39149_1002193 3300002705 Bacteria 7271
8 JGI25162J39368_1000266 3300002737 Bacteria 50234
9 JGI25162J39368_1001936 3300002737 Bacteria 9375
10 JGI25154J39366_1000055 3300002738 Bacteria 115597
11 JGI25158J39367_1000267 3300002739 Bacteria 11866
12 JGI25158J39367_1002216 3300002739 Bacteria 3233
13 JGI25157J39369_1000024 3300002741 Bacteria 160844
14 JGI25157J39369_1001637 3300002741 Bacteria 7700
15 JGI25152J39213_1001649 3300002773 Bacteria 9296
16 JGI25152J39213_1002383 3300002773 Bacteria 7193
17 JGI25152J39213_1005870 3300002773 Bacteria 3472
18 JGI25152J39213_1008741 3300002773 Bacteria 2479
19 JGI25150J39212_1000256 3300002774 Bacteria 28172
20 JGI25150J39212_1000592 3300002774 Bacteria 14212
21 JGI25150J39212_1003476 3300002774 Bacteria 3677
22 JGI25159J45721_1000001 3300002987 Bacteria 303489
23 JGI25159J45721_1000307 3300002987 Bacteria 22942
24 JGI25159J45721_1000921 3300002987 Bacteria 12790
25 JGI25151J46595_10000629 3300003187 Bacteria 30634
26 JGI25151J46595_10001621 3300003187 Bacteria 14878
27 JGI25151J46595_10002526 3300003187 Bacteria 10872
28 JGI25165J46597_1000016 3300003214 Bacteria 377866
29 JGI25165J46597_1000702 3300003214 Bacteria 26615
30 JGI25153J46596_10011761 3300003215 Bacteria 3841
31 JGI25160J50197_1000002 3300003354 Bacteria 561707
32 JGI25160J50197_1000053 3300003354 Bacteria 127632
33 JGI25160J50197_1001098 3300003354 Bacteria 13818
34 JGI25160J50197_1007804 3300003354 Bacteria 4144
35 JGI25160J50197_1023218 3300003354 Bacteria 1797
36 JGI25161J50226_1000039 3300003374 Bacteria 127632
37 JGI25161J50226_1000235 3300003374 Bacteria 33663
38 JGI25161J50226_1000968 3300003374 Bacteria 10178
39 JGI25161J50226_1002271 3300003374 Bacteria 5028
40 Ga0006562J51391_1004501 3300003578 Bacteria 9850
41 Ga0006562J51391_1009215 3300003578 Bacteria 5410
42 Ga0006562J51391_1011613 3300003578 Bacteria 5790
43 Ga0055542_1000586 3300003762 Bacteria 31578
44 Ga0055529_1013358 3300003763 Bacteria 1045
45 Ga0055526_1000370 3300003771 Bacteria 36363
46 Ga0055526_1000699 3300003771 Bacteria 25422
47 Ga0055526_1011897 3300003771 Bacteria 3859
48 Ga0055524_1000974 3300003775 Bacteria 17947
49 Ga0055524_1015730 3300003775 Bacteria 2746
50 Ga0055536_1008905 3300003781 Bacteria 4238
51 Ga0055536_1012504 3300003781 Bacteria 3142
52 Ga0055528_1003983 3300003790 Bacteria 7231
53 Ga0055530_10019848 3300003791 Bacteria 2026
54 Ga0055540_1003180 3300003792 Bacteria 8095
55 Ga0055540_1012461 3300003792 Bacteria 2666
56 Ga0055540_1014616 3300003792 Bacteria 2328
57 Ga0055531_10000882 3300003794 Bacteria 24537
58 Ga0055531_10004081 3300003794 Bacteria 9043
59 Ga0058692_1000854 3300003856 Bacteria 12014
60 Ga0058692_1001560 3300003856 Bacteria 8280
61 Ga0055543_1000010 3300004625 Bacteria 198371
62 Ga0055543_1000015 3300004625 Bacteria 177197
63 Ga0055543_1000033 3300004625 Bacteria 129476
64 Ga0055543_1000967 3300004625 Bacteria 13084
65 Ga0065165_1000004 3300005262 Bacteria 377081
66 Ga0065165_1000361 3300005262 Bacteria 74514
67 Ga0065165_1006075 3300005262 Bacteria 6473
68 Ga0065165_1011907 3300005262 Bacteria 3580
69 Ga0065165_1017007 3300005262 Bacteria 2698
70 Ga0065707_10116042 3300005295 Bacteria 2250
71 Ga0070658_10295154 3300005327 Bacteria 1382
72 Ga0070670_100020702 3300005331 Bacteria 5658
73 Ga0070668_100009224 3300005347 Bacteria 7316
74 Ga0070671_100015587 3300005355 Bacteria 6142
75 Ga0070659_100037881 3300005366 Bacteria 3760
76 Ga0070663_100007730 3300005455 Bacteria 6566
77 Ga0070663_100037526 3300005455 Bacteria 3374
78 Ga0070672_100121537 3300005543 Bacteria 2138
79 Ga0070665_100017880 3300005548 Bacteria 7118
80 Ga0070665_100037637 3300005548 Bacteria 4864
81 Ga0070665_100052494 3300005548 Bacteria 4088
82 Ga0070665_100483688 3300005548 Bacteria 1249
83 Ga0070665_100730092 3300005548 Bacteria 1003
84 Ga0068855_100207646 3300005563 Bacteria 2203
85 Ga0068854_100023205 3300005578 Bacteria 4236
86 Ga0068852_100121813 3300005616 Bacteria 2389
87 Ga0081540_1089865 3300005983 Bacteria 1354
88 Ga0081539_10001043 3300005985 Bacteria 50701
89 Ga0075365_10002139 3300006038 Bacteria 9479
90 Ga0075365_10010471 3300006038 Bacteria 5402
91 Ga0075365_10017038 3300006038 Bacteria 4436
92 Ga0075365_10019390 3300006038 Bacteria 4198
93 Ga0075365_10030508 3300006038 Bacteria 3453
94 Ga0075365_10040232 3300006038 Bacteria 3048
95 Ga0075368_10001501 3300006042 Bacteria 7468
96 Ga0075368_10003717 3300006042 Bacteria 5119
97 Ga0075368_10064281 3300006042 Bacteria 1473
98 Ga0075363_100005422 3300006048 Bacteria 5669
99 Ga0075363_100070145 3300006048 Bacteria 1903
100 Ga0075364_10000081 3300006051 Bacteria 37644
101 Ga0075364_10100450 3300006051 Bacteria 1926
102 Ga0075362_10018911 3300006177 Bacteria 2858
103 Ga0075362_10088552 3300006177 Bacteria 1434
104 Ga0075367_10017046 3300006178 Bacteria 3979
105 Ga0075367_10063279 3300006178 Bacteria 2211
106 Ga0075367_10076771 3300006178 Bacteria 2016
107 Ga0075367_10102165 3300006178 Bacteria 1753
108 Ga0075367_10143854 3300006178 Bacteria 1478
109 Ga0075367_10278722 3300006178 Bacteria 1051
110 Ga0075369_10003037 3300006186 Bacteria 6069
111 Ga0075369_10006666 3300006186 Bacteria 4377
112 Ga0075369_10027638 3300006186 Bacteria 2373
113 Ga0075369_10033582 3300006186 Bacteria 2175
114 Ga0075369_10037977 3300006186 Bacteria 2053
115 Ga0075369_10056168 3300006186 Bacteria 1711
116 Ga0075366_10012526 3300006195 Bacteria 4812
117 Ga0075370_10016354 3300006353 Bacteria 3991
118 Ga0075370_10069604 3300006353 Bacteria 2011
119 Ga0079104_1000010 3300006946 Bacteria 366021
120 Ga0079104_1017322 3300006946 Bacteria 2074
121 Ga0099826_10001318 3300006948 Bacteria 14680
122 Ga0099826_10004914 3300006948 Bacteria 9465
123 Ga0105251_10012402 3300009011 Bacteria 4822
124 Ga0105240_10000027 3300009093 Bacteria 348486
125 Ga0105240_10281545 3300009093 Bacteria 1910
126 Ga0105248_10020887 3300009177 Bacteria 7257
127 Ga0105237_10001405 3300009545 Bacteria 31816
128 Ga0105237_10215884 3300009545 Bacteria 1918
129 Ga0105249_10087077 3300009553 Bacteria 2914
130 Ga0123341_1000098 3300009765 Bacteria 37289
131 Ga0123342_1009019 3300009766 Bacteria 12185
132 Ga0123342_1023934 3300009766 Bacteria 3893
133 Ga0105239_10001129 3300010375 Bacteria 36802
134 Ga0105239_10106109 3300010375 Bacteria 3112
135 Ga0105239_10512341 3300010375 Bacteria 1364
136 Ga0105239_10592785 3300010375 Bacteria 1264
137 Ga0105239_10675825 3300010375 Bacteria 1180
138 Ga0105246_10057874 3300011119 Bacteria 2684
139 Ga0105246_10573719 3300011119 Bacteria 970
140 Ga0157373_10048556 3300013100 Bacteria 3026
141 Ga0157371_10000200 3300013102 Bacteria 87804
142 Ga0157371_10006915 3300013102 Bacteria 9255
143 Ga0157370_10000030 3300013104 Bacteria 145571
144 Ga0157370_10000048 3300013104 Bacteria 124683
145 Ga0157370_10082413 3300013104 Bacteria 3026
146 Ga0157369_10330041 3300013105 Bacteria 1585
147 Ga0157369_10424728 3300013105 Bacteria 1378
148 Ga0171463_1001 3300013249 Bacteria 1406070
149 Ga0157374_10114675 3300013296 Bacteria 2595
150 Ga0157378_10607423 3300013297 Bacteria 1106
151 Ga0182007_10002627 3300015262 Bacteria 8842
152 Ga0182005_1010351 3300015265 Bacteria 2687
153 Ga0183363_1167 3300015690 Bacteria 15135
154 Ga0163161_10195564 3300017792 Bacteria 1556
155 Ga0214544_1000008 3300021320 Bacteria 326027
156 Ga0214542_1000010 3300021321 Bacteria 262816
157 Ga0214542_1018203 3300021321 Bacteria 6036
158 Ga0214543_1000003 3300021327 Bacteria 692327
159 Ga0214543_1000004 3300021327 Bacteria 527190
160 Ga0228711_1000001 3300022739 Bacteria 357377
161 Ga0228710_1000001 3300022740 Bacteria 314328
162 Ga0209435_100011 3300025206 Bacteria 413027
163 Ga0209436_100002 3300025208 Bacteria 222172
164 Ga0209436_103514 3300025208 Bacteria 4134
165 Ga0209672_107903 3300025228 Bacteria 1609
166 Ga0209437_100036 3300025233 Bacteria 469153
167 Ga0209437_100086 3300025233 Bacteria 254578
168 Ga0207425_1000312 3300025245 Bacteria 35041
169 Ga0207425_1004745 3300025245 Bacteria 4004
170 Ga0207425_1005199 3300025245 Bacteria 3746
171 Ga0207425_1018906 3300025245 Bacteria 1491
172 Ga0209646_1000024 3300025246 Bacteria 413027
173 Ga0209026_1000005 3300025250 Bacteria 731387
174 Ga0209026_1000030 3300025250 Bacteria 329811
175 Ga0209677_100188 3300025253 Bacteria 50341
176 Ga0209148_1000057 3300025254 Bacteria 360463
177 Ga0209759_1000011 3300025256 Bacteria 413027
178 Ga0209759_1000385 3300025256 Bacteria 55125
179 Ga0209129_1000078 3300025258 Bacteria 192880
180 Ga0209129_1000393 3300025258 Bacteria 35041
181 Ga0209129_1003543 3300025258 Bacteria 6732
182 Ga0209129_1003719 3300025258 Bacteria 6457
183 Ga0209233_1000056 3300025261 Bacteria 438104
184 Ga0209233_1000068 3300025261 Bacteria 377969
185 Ga0209233_1000110 3300025261 Bacteria 260825
186 Ga0209233_1000271 3300025261 Bacteria 73658
187 Ga0209455_1000231 3300025272 Bacteria 70607
188 Ga0209673_1000015 3300025273 Bacteria 530618
189 Ga0209673_1000091 3300025273 Bacteria 201875
190 Ga0209673_1003438 3300025273 Bacteria 9346
191 Ga0209673_1028717 3300025273 Bacteria 1784
192 Ga0209673_1048186 3300025273 Bacteria 1149
193 Ga0209130_1000008 3300025284 Bacteria 581232
194 Ga0209130_1000015 3300025284 Bacteria 409631
195 Ga0209130_1000038 3300025284 Bacteria 264226
196 Ga0209130_1012609 3300025284 Bacteria 2202
197 Ga0209675_1000493 3300025291 Bacteria 29684
198 Ga0209676_1006528 3300025292 Bacteria 5731
199 Ga0209676_1010131 3300025292 Bacteria 3971
200 Ga0209676_1013430 3300025292 Bacteria 3150
201 Ga0209025_1000118 3300025294 Bacteria 214009
202 Ga0209025_1000205 3300025294 Bacteria 141452
203 Ga0209025_1000489 3300025294 Bacteria 76167
204 Ga0209025_1000575 3300025294 Bacteria 66684
205 Ga0209025_1000664 3300025294 Bacteria 59562
206 Ga0209025_1000887 3300025294 Bacteria 46715
207 Ga0209025_1001772 3300025294 Bacteria 25723
208 Ga0209025_1025453 3300025294 Bacteria 3011
209 Ga0209025_1037759 3300025294 Bacteria 2136
210 Ga0209025_1040663 3300025294 Bacteria 2006
211 Ga0209564_1000104 3300025295 Bacteria 219017
212 Ga0209564_1000821 3300025295 Bacteria 42300
213 Ga0209564_1001024 3300025295 Bacteria 34391
214 Ga0209564_1004614 3300025295 Bacteria 8303
215 Ga0209564_1004635 3300025295 Bacteria 8271
216 Ga0209564_1015710 3300025295 Bacteria 3061
217 Ga0209758_1000191 3300025297 Bacteria 136984
218 Ga0209758_1000549 3300025297 Bacteria 59562
219 Ga0209758_1000620 3300025297 Bacteria 54509
220 Ga0209758_1001053 3300025297 Bacteria 36113
221 Ga0209758_1012258 3300025297 Bacteria 4820
222 Ga0209758_1013206 3300025297 Bacteria 4534
223 Ga0209758_1029290 3300025297 Bacteria 2306
224 Ga0209758_1056964 3300025297 Bacteria 1316
225 Ga0209050_1001561 3300025298 Bacteria 23872
226 Ga0209050_1002861 3300025298 Bacteria 13669
227 Ga0209050_1013599 3300025298 Bacteria 3599
228 Ga0209256_1000461 3300025299 Bacteria 61432
229 Ga0209256_1000465 3300025299 Bacteria 61255
230 Ga0209256_1000782 3300025299 Bacteria 41037
231 Ga0209256_1001819 3300025299 Bacteria 20012
232 Ga0209256_1002265 3300025299 Bacteria 16316
233 Ga0209256_1007287 3300025299 Bacteria 5512
234 Ga0209256_1020462 3300025299 Bacteria 2064
235 Ga0207426_1000016 3300025302 Bacteria 581232
236 Ga0207426_1000081 3300025302 Bacteria 304502
237 Ga0207426_1000144 3300025302 Bacteria 191590
238 Ga0207426_1000406 3300025302 Bacteria 72462
239 Ga0207426_1001732 3300025302 Bacteria 16645
240 Ga0209051_1000408 3300025303 Bacteria 59354
241 Ga0209051_1002529 3300025303 Bacteria 12955
242 Ga0209051_1006571 3300025303 Bacteria 6525
243 Ga0209051_1020786 3300025303 Bacteria 2814
244 Ga0209051_1021123 3300025303 Bacteria 2783
245 Ga0209051_1024231 3300025303 Bacteria 2500
246 Ga0209257_1004842 3300025304 Bacteria 9967
247 Ga0209257_1005245 3300025304 Bacteria 9253
248 Ga0209257_1013466 3300025304 Bacteria 3633
249 Ga0209257_1017369 3300025304 Bacteria 2839
250 Ga0207647_10055277 3300025904 Bacteria 2440
251 Ga0207705_10224336 3300025909 Bacteria 1428
252 Ga0207695_10000024 3300025913 Bacteria 632311
253 Ga0207695_10092964 3300025913 Bacteria 3026
254 Ga0207671_10000463 3300025914 Bacteria 55685
255 Ga0207681_10372096 3300025923 Bacteria 1148
256 Ga0207694_10066437 3300025924 Bacteria 2814
257 Ga0207650_10065778 3300025925 Bacteria 2717
258 Ga0207687_10303290 3300025927 Bacteria 1287
259 Ga0207644_10018095 3300025931 Bacteria 4764
260 Ga0207709_10188186 3300025935 Bacteria 1464
261 Ga0207691_10134416 3300025940 Bacteria 2183
262 Ga0207711_10025140 3300025941 Bacteria 4997
263 Ga0207711_10075448 3300025941 Bacteria 2934
264 Ga0207712_10063086 3300025961 Bacteria 2636
265 Ga0207668_10006879 3300025972 Bacteria 6749
266 Ga0207668_10108567 3300025972 Bacteria 2077
267 Ga0207668_10496558 3300025972 Bacteria 1049
268 Ga0207658_10184611 3300025986 Bacteria 1729
269 Ga0207678_10014723 3300026067 Bacteria 6881
270 Ga0209281_1000078 3300027111 Bacteria 261622
271 Ga0209281_1000155 3300027111 Bacteria 164423
272 Ga0209281_1000215 3300027111 Bacteria 126639
273 Ga0209371_1000009 3300027312 Bacteria 963030
274 Ga0209371_1001013 3300027312 Bacteria 21462
275 Ga0209371_1001948 3300027312 Bacteria 12536
276 Ga0209371_1013361 3300027312 Bacteria 2311
277 Ga0209282_1000025 3300027666 Bacteria 168676
278 Ga0209282_1000293 3300027666 Bacteria 24666
279 Ga0209282_1052292 3300027666 Bacteria 2333
280 Ga0209813_10000636 3300027866 Bacteria 8137
281 Ga0209813_10036220 3300027866 Bacteria 1481
282 Ga0209974_10091649 3300027876 Bacteria 1055
283 Ga0268266_10022338 3300028379 Bacteria 5393
284 Ga0268266_10143640 3300028379 Bacteria 2143
285 Ga0268266_10412883 3300028379 Bacteria 1278
286 Ga0307515_10000937 3300028794 Bacteria 66983
287 Ga0307515_10002427 3300028794 Bacteria 40656
288 Ga0307515_10069382 3300028794 Bacteria 4819
289 Ga0268256_1000010 3300030500 Bacteria 963034
290 Ga0268256_1001705 3300030500 Bacteria 12536
291 Ga0268256_1006082 3300030500 Bacteria 4564
292 Ga0307408_100146895 3300031548 Bacteria 1857
293 Ga0307408_100288196 3300031548 Bacteria 1370
294 Ga0307405_10034223 3300031731 Bacteria 3021
295 Ga0307405_10365800 3300031731 Bacteria 1118
296 Ga0307406_10010249 3300031901 Bacteria 5281
297 Ga0307406_10035056 3300031901 Bacteria 3083
298 Ga0307406_10218242 3300031901 Bacteria 1416
299 Ga0315914_1000020 3300031967 Bacteria 121647
300 Ga0307409_100329545 3300031995 Bacteria 1432
301 Ga0307409_100433856 3300031995 Bacteria 1264
302 Ga0307414_10028634 3300032004 Bacteria 3616
303 Ga0307411_10010298 3300032005 Bacteria 4975
304 Ga0315913_1000013 3300033430 Bacteria 121559
305 Ga0315915_1000015 3300033464 Bacteria 168491
306 Ga0373927_0000727 3300035695 Bacteria 25196
307 Ga0373947_0013728 3300035725 Bacteria 4642
308 Ga0316582_0038255 3300036647 Bacteria 2980
309 Ga0316584_0230250 3300036712 Bacteria 1359
310 Ga0373925_0009740 3300037068 Bacteria 6979
311 Ga0373925_0378780 3300037068 Bacteria 1152
312 Ga0395899_0000030 3300037312 Bacteria 329063
313 Ga0395899_0197220 3300037312 Bacteria 1406
314 Ga0395900_0000023 3300037418 Bacteria 336048
315 Ga0395900_0579503 3300037418 Bacteria 1064
316 Ga0395898_0000038 3300037466 Bacteria 329063
317 Ga0395905_0000021 3300037471 Bacteria 329054
318 Ga0395905_0000463 3300037471 Bacteria 56433
319 Ga0395905_0001846 3300037471 Bacteria 24436
320 Ga0395905_0013227 3300037471 Bacteria 7919
321 Ga0395905_0097955 3300037471 Bacteria 2753
322 Ga0395901_0000018 3300038443 Bacteria 336048
323 Ga0395901_0029879 3300038443 Bacteria 5613
324 Ga0395901_0549591 3300038443 Bacteria 1170
325 Ga0400483_044087 3300039062 Bacteria 1534
326 Ga0400483_151782 3300039062 Bacteria 1683
327 Ga0439465_0018747 3300041413 Bacteria 2162
328 Ga0451798_0576103 3300041458 Bacteria 1237
329 Ga0451798_0810827 3300041458 Bacteria 1245
330 Ga0451841_0394451 3300041498 Bacteria 1154
331 Ga0451845_0120191 3300041501 Bacteria 1550
332 Ga0439457_035027 3300042014 Bacteria 1116
333 Ga0450906_008543 3300042145 Bacteria 1976
334 Ga0466972_0025250 3300044658 Bacteria 2946
335 Ga0466965_0033869 3300044683 Bacteria 2498
336 Ga0495629_0076712 3300046459 Bacteria 2333
337 Ga0495638_0003268 3300046460 Bacteria 12793
338 Ga0495638_0015723 3300046460 Bacteria 5073
339 Ga0495605_0004327 3300046474 Bacteria 8354
340 Ga0495585_0034165 3300046492 Bacteria 2875
341 Ga0495583_0010857 3300046506 Bacteria 5271
342 Ga0495606_0006905 3300046507 Bacteria 10332
343 Ga0495631_0050153 3300046518 Bacteria 1826
344 Ga0495632_0004419 3300046519 Bacteria 9558
345 Ga0495632_0045274 3300046519 Bacteria 2192
346 Ga0495643_0011973 3300046522 Bacteria 5251
347 Ga0495643_0071065 3300046522 Bacteria 1827
348 Ga0495643_0131921 3300046522 Bacteria 1253
349 Ga0495654_0000043 3300046530 Bacteria 161913
350 Ga0495654_0016645 3300046530 Bacteria 3879
351 Ga0495597_0120259 3300046542 Bacteria 1095
352 Ga0495633_0044517 3300046558 Bacteria 2103
353 Ga0495668_0010174 3300046616 Bacteria 5717
354 Ga0495668_0011280 3300046616 Bacteria 5361
355 Ga0495668_0054863 3300046616 Bacteria 2201
356 Ga0495625_0007283 3300046660 Bacteria 9677
357 Ga0495625_0007525 3300046660 Bacteria 9460
358 Ga0495625_0111077 3300046660 Bacteria 1873
359 Ga0495588_0006962 3300046674 Bacteria 5127
360 Ga0495657_0149390 3300046675 Bacteria 1452
361 Ga0495670_0037584 3300046691 Bacteria 2413
362 Ga0495649_0040344 3300046694 Bacteria 2557
363 Ga0495604_0049673 3300047317 Bacteria 3257
364 Ga0495687_030085 3300047443 Bacteria 2504
365 Ga0495686_0001564 3300047472 Bacteria 24387
366 Ga0495686_0096470 3300047472 Bacteria 1789
367 Ga0495686_0140581 3300047472 Bacteria 1425
368 Ga0496101_0062411 3300048904 Bacteria 2709
369 Ga0496102_0024012 3300048905 Bacteria 5419
370 Ga0496102_0072700 3300048905 Bacteria 3161
371 Ga0496106_0015335 3300048909 Bacteria 5670
372 Ga0496110_0104998 3300048913 Bacteria 2535
373 Ga0496112_0076554 3300048915 Bacteria 3309
374 Ga0496116_0000080 3300048919 Bacteria 224530
375 Ga0496116_0004852 3300048919 Bacteria 12683
376 Ga0496116_0039503 3300048919 Bacteria 3262
377 Ga0496117_0000002 3300048920 Bacteria 2483758
378 Ga0496117_0008316 3300048920 Bacteria 9873
379 Ga0496117_0014997 3300048920 Bacteria 6638
380 Ga0496117_0016911 3300048920 Bacteria 6117
381 Ga0496118_0000483 3300048921 Bacteria 66119
382 Ga0496118_0007453 3300048921 Bacteria 11588
383 Ga0496118_0008926 3300048921 Bacteria 10234
384 Ga0496118_0015536 3300048921 Bacteria 7042
385 Ga0496118_0026257 3300048921 Bacteria 4968
386 Ga0496118_0059701 3300048921 Bacteria 2837
387 Ga0496119_0011774 3300048922 Bacteria 7189
388 Ga0496119_0017455 3300048922 Bacteria 5394
389 Ga0496119_0048443 3300048922 Bacteria 2635
390 Ga0496119_0062411 3300048922 Bacteria 2221
391 Ga0496119_0066801 3300048922 Bacteria 2122
392 Ga0496119_0133762 3300048922 Bacteria 1348
393 Ga0496120_0000971 3300048923 Bacteria 39060
394 Ga0496120_0001519 3300048923 Bacteria 27337
395 Ga0496120_0023512 3300048923 Bacteria 3857
396 Ga0496120_0028875 3300048923 Bacteria 3394
397 Ga0496120_0051971 3300048923 Bacteria 2336
398 Ga0496121_0000001 3300048924 Bacteria 1830318
399 Ga0496121_0007648 3300048924 Bacteria 12982
400 Ga0496121_0008329 3300048924 Bacteria 12248
401 Ga0496121_0038824 3300048924 Bacteria 4208
402 Ga0496121_0050885 3300048924 Bacteria 3495
403 Ga0496121_0079506 3300048924 Bacteria 2603
404 Ga0496121_0144527 3300048924 Bacteria 1759
405 Ga0496121_0217954 3300048924 Bacteria 1346
406 Ga0496121_0240777 3300048924 Bacteria 1261
407 Ga0496122_0000001 3300048925 Bacteria 1827766
408 Ga0496122_0000009 3300048925 Bacteria 584024
409 Ga0496122_0000758 3300048925 Bacteria 62582
410 Ga0496122_0015116 3300048925 Bacteria 7400
411 Ga0496122_0015834 3300048925 Bacteria 7183
412 Ga0496122_0018239 3300048925 Bacteria 6498
413 Ga0496122_0019021 3300048925 Bacteria 6301
414 Ga0496122_0066483 3300048925 Bacteria 2604
415 Ga0496122_0072713 3300048925 Bacteria 2443
416 Ga0496123_0000001 3300048926 Bacteria 1831497
417 Ga0496123_0000020 3300048926 Bacteria 388748
418 Ga0496123_0000499 3300048926 Bacteria 68150
419 Ga0496123_0008905 3300048926 Bacteria 9129
420 Ga0496123_0011781 3300048926 Bacteria 7532
421 Ga0496123_0056469 3300048926 Bacteria 2565
422 Ga0496124_0000262 3300048927 Bacteria 101572
423 Ga0496124_0004143 3300048927 Bacteria 17124
424 Ga0496124_0005219 3300048927 Bacteria 14741
425 Ga0496124_0011809 3300048927 Bacteria 8701
426 Ga0496124_0031459 3300048927 Bacteria 4696
427 Ga0496124_0069693 3300048927 Bacteria 2919
428 Ga0496124_0107616 3300048927 Bacteria 2249
429 Ga0496124_0285644 3300048927 Bacteria 1200
430 Ga0496125_0000001 3300048928 Bacteria 1766138
431 Ga0496125_0000254 3300048928 Bacteria 109882
432 Ga0496125_0009173 3300048928 Bacteria 10224
433 Ga0496125_0014472 3300048928 Bacteria 7681
434 Ga0496125_0036086 3300048928 Bacteria 4324
435 Ga0496125_0129008 3300048928 Bacteria 1784
436 Ga0496125_0138201 3300048928 Bacteria 1699
437 Ga0496125_0154632 3300048928 Bacteria 1569
438 Ga0496125_0347941 3300048928 Bacteria 886
439 Ga0496126_0000690 3300048929 Bacteria 61848
440 Ga0496126_0071022 3300048929 Bacteria 3100
441 Ga0496126_0074187 3300048929 Bacteria 3022
442 Ga0496126_0096626 3300048929 Bacteria 2589
443 Ga0496126_0125936 3300048929 Bacteria 2217
444 Ga0495678_018243 3300049459 Bacteria 3160
445 Ga0501290_001432 3300049513 Bacteria 3269
446 Ga0501292_000311 3300049515 Bacteria 6731
447 Ga0501297_003090 3300049520 Bacteria 1641
448 Ga0501300_000985 3300049523 Bacteria 4345
449 Ga0501301_000349 3300049524 Bacteria 2719
450 Ga0501031_0000015 3300049568 Bacteria 113809
451 Ga0501031_0023683 3300049568 Bacteria 4002
452 Ga0501031_0036354 3300049568 Bacteria 3212
453 Ga0501032_0000008 3300049569 Bacteria 240313
454 Ga0501032_0000060 3300049569 Bacteria 95279
455 Ga0501032_0006839 3300049569 Bacteria 8367
456 Ga0501032_0139440 3300049569 Bacteria 1597
457 Ga0501032_0199050 3300049569 Bacteria 1307
458 Ga0501033_0000012 3300049570 Bacteria 241599
459 Ga0501033_0000165 3300049570 Bacteria 63213
460 Ga0501033_0001975 3300049570 Bacteria 17865
461 Ga0501033_0004354 3300049570 Bacteria 11347
462 Ga0501033_0004796 3300049570 Bacteria 10798
463 Ga0501033_0029575 3300049570 Bacteria 4117
464 Ga0501033_0177551 3300049570 Bacteria 1527
465 Ga0501034_0000035 3300049571 Bacteria 241623
466 Ga0501034_0000262 3300049571 Bacteria 95293
467 Ga0501034_0035209 3300049571 Bacteria 5076
468 Ga0501034_0169331 3300049571 Bacteria 2152
469 Ga0501034_0355297 3300049571 Bacteria 1393
470 Ga0501036_0000006 3300049572 Bacteria 241623
471 Ga0501036_0000514 3300049572 Bacteria 27770
472 Ga0501037_0000076 3300049573 Bacteria 92049
473 Ga0501037_0000123 3300049573 Bacteria 72229
474 Ga0501037_0002944 3300049573 Bacteria 12350
475 Ga0501038_0000007 3300049574 Bacteria 210775
476 Ga0501038_0000051 3300049574 Bacteria 95293
477 Ga0501038_0036034 3300049574 Bacteria 4342
478 Ga0501038_0161053 3300049574 Bacteria 1823
479 Ga0501038_0282859 3300049574 Bacteria 1305
480 Ga0501038_0318441 3300049574 Bacteria 1217
481 Ga0501039_0000012 3300049575 Bacteria 241623
482 Ga0501039_0000051 3300049575 Bacteria 95293
483 Ga0501040_0034055 3300049576 Bacteria 3451
484 Ga0501043_0000039 3300049579 Bacteria 119155
485 Ga0501043_0000844 3300049579 Bacteria 27234
486 Ga0501043_0003160 3300049579 Bacteria 13629
487 Ga0501043_0050418 3300049579 Bacteria 3272
488 Ga0501043_0070018 3300049579 Bacteria 2755
489 Ga0501043_0078164 3300049579 Bacteria 2600
490 Ga0501043_0347948 3300049579 Bacteria 1126
491 Ga0501047_0002382 3300049581 Bacteria 17976
492 Ga0501047_0020241 3300049581 Bacteria 6389
493 Ga0501067_0034138 3300049583 Bacteria 2823
494 Ga0501068_0109300 3300049584 Bacteria 1718
495 Ga0501069_0000022 3300049585 Bacteria 119155
496 Ga0501069_0019058 3300049585 Bacteria 3707
497 Ga0501070_0000080 3300049586 Bacteria 81734
498 Ga0501070_0000959 3300049586 Bacteria 26022
499 Ga0501070_0001852 3300049586 Bacteria 18673
500 Ga0501070_0015205 3300049586 Bacteria 6479
501 Ga0501070_0018469 3300049586 Bacteria 5850
502 Ga0501070_0051224 3300049586 Bacteria 3427
503 Ga0501071_0005859 3300049587 Bacteria 7941
504 Ga0501071_0481869 3300049587 Bacteria 951
505 Ga0501074_0000046 3300049590 Bacteria 57165
506 Ga0501074_0054577 3300049590 Bacteria 2881
507 Ga0501074_0313937 3300049590 Bacteria 1113
508 Ga0501202_003073 3300049652 Bacteria 2841
509 Ga0501206_000567 3300049653 Bacteria 4492
510 Ga0501222_000962 3300049662 Bacteria 4129
511 Ga0501227_008054 3300049665 Bacteria 2262
512 Ga0501233_002894 3300049668 Bacteria 3060
513 Ga0501235_010757 3300049669 Bacteria 2001
514 Ga0501236_003861 3300049670 Bacteria 1759
515 Ga0501257_012589 3300049686 Bacteria 1936
516 Ga0501259_002258 3300049688 Bacteria 3159
517 Ga0501261_000111 3300049690 Bacteria 12333
518 Ga0501225_0007429 3300049705 Bacteria 3173
519 Ga0501079_0094167 3300049741 Bacteria 2321
520 Ga0501080_0012437 3300049742 Bacteria 7802
521 Ga0501080_0032758 3300049742 Bacteria 4848
522 Ga0501080_0058370 3300049742 Bacteria 3592
523 Ga0501083_0000050 3300049744 Bacteria 86199
524 Ga0501083_0100752 3300049744 Bacteria 1904
525 Ga0501279_000095 3300049775 Bacteria 14125
526 Ga0501280_000141 3300049776 Bacteria 18711
527 Ga0501281_00092 3300049777 Bacteria 10626
528 Ga0501282_000655 3300049778 Bacteria 3982
529 Ga0501283_000632 3300049779 Bacteria 4651
530 Ga0501035_0000035 3300049822 Bacteria 166916
531 Ga0501035_0000119 3300049822 Bacteria 95271
532 Ga0501035_0000987 3300049822 Bacteria 30112
533 Ga0501035_0002532 3300049822 Bacteria 17865
534 Ga0501035_0004371 3300049822 Bacteria 13425
535 Ga0501035_0006637 3300049822 Bacteria 10830
536 Ga0501035_0012543 3300049822 Bacteria 7829
537 Ga0501035_0013334 3300049822 Bacteria 7584
538 Ga0501035_0029131 3300049822 Bacteria 5035
539 Ga0501035_0038863 3300049822 Bacteria 4308
540 Ga0501044_0000015 3300049823 Bacteria 241623
541 Ga0501044_0001241 3300049823 Bacteria 30294
542 Ga0501044_0008520 3300049823 Bacteria 11236
543 Ga0501044_0022134 3300049823 Bacteria 6777
544 Ga0501044_0083386 3300049823 Bacteria 3233
545 Ga0501044_0141066 3300049823 Bacteria 2398
546 Ga0501044_0240028 3300049823 Bacteria 1756
547 Ga0501044_0406365 3300049823 Bacteria 1273
548 nmdc:mga03683_50674_c1 3300050489 Bacteria 1731
549 nmdc:mga03683_6790_c1 3300050489 Bacteria 3939
550 nmdc:mga03n38_10030_c1 3300050490 Bacteria 3469
551 nmdc:mga03n38_45018_c1 3300050490 Bacteria 1941
552 nmdc:mga00v17_194_c1 3300050491 Bacteria 36724
553 nmdc:mga00v17_6475_c1 3300050491 Bacteria 6215
554 nmdc:mga00v17_92_c1 3300050491 Bacteria 53037
555 nmdc:mga0yw44_10491_c1 3300050492 Bacteria 4737
556 nmdc:mga0yw44_17242_c1 3300050492 Bacteria 3925
557 nmdc:mga0yw44_226_c1 3300050492 Bacteria 19284
558 nmdc:mga0yw44_92717_c1 3300050492 Bacteria 1912
559 nmdc:mga0k408_23370_c1 3300050493 Bacteria 3486
560 nmdc:mga06z11_118934_c1 3300050494 Bacteria 1472
561 nmdc:mga04h51_11199_c1 3300050495 Bacteria 2484
562 nmdc:mga04h51_25402_c1 3300050495 Bacteria 1823
563 nmdc:mga07m45_21624_c1 3300050496 Bacteria 3504
564 nmdc:mga07m45_54866_c1 3300050496 Bacteria 2252
565 nmdc:mga0sz30_461_c1 3300050516 Bacteria 15397
566 nmdc:mga0sz30_56716_c1 3300050516 Bacteria 1669
567 nmdc:mga0sz30_72400_c1 3300050516 Bacteria 1485
568 Ga0500610_0067435 3300053079 Bacteria 1866
569 Ga0500643_002924 3300053087 Bacteria 8479
570 Ga0500643_007818 3300053087 Bacteria 4262
571 Ga0500643_013521 3300053087 Bacteria 2878
572 Ga0500556_0000076 3300053104 Bacteria 95452
573 Ga0500569_005761 3300053109 Bacteria 2679
574 Ga0500572_002456 3300053111 Bacteria 4459
575 Ga0500594_0002072 3300053118 Bacteria 4330
576 Ga0500594_0002711 3300053118 Bacteria 3854
577 Ga0500618_000007 3300053125 Bacteria 226268
578 Ga0500618_004183 3300053125 Bacteria 4700
579 Ga0500642_0000001 3300053130 Bacteria 1468402
580 Ga0500655_000615 3300053133 Bacteria 7153
581 Ga0500658_0001052 3300053134 Bacteria 11294
582 Ga0500561_0000108 3300053137 Bacteria 16003
583 Ga0500568_0000563 3300053139 Bacteria 27290
584 Ga0500568_0001297 3300053139 Bacteria 16411
585 Ga0500573_0008390 3300053140 Bacteria 5688
586 Ga0500577_0012106 3300053142 Bacteria 2597
587 Ga0500616_0000758 3300053153 Bacteria 37186
588 Ga0500616_0004523 3300053153 Bacteria 9869
589 Ga0500616_0005243 3300053153 Bacteria 8864
590 Ga0500622_0001715 3300053156 Bacteria 17000
591 Ga0500624_001991 3300053157 Bacteria 2895
592 Ga0500627_0002238 3300053158 Bacteria 5670
593 Ga0500634_0001101 3300053161 Bacteria 10017
594 Ga0500636_0000023 3300053177 Bacteria 89900
595 Ga0500636_0000562 3300053177 Bacteria 20257
596 Ga0500570_021757 3300053724 Bacteria 3567
597 Ga0500645_003805 3300053730 Bacteria 5994
598 Ga0587073_0028422 3300059492 Bacteria 1136
599 Ga0587077_004431 3300059493 Bacteria 1847
600 Ga0587077_016469 3300059493 Bacteria 1246
601 Ga0587077_032716 3300059493 Bacteria 1001
602 Ga0587082_019244 3300059504 Bacteria 1095
603 Ga0587082_036716 3300059504 Bacteria 880
604 Ga0587083_0027837 3300059505 Bacteria 1102
605 Ga0587088_001214 3300059508 Bacteria 2601
606 Ga0587099_006668 3300059622 Bacteria 1073
607 Ga0587128_006185 3300059630 Bacteria 1463
608 Ga0587128_016436 3300059630 Bacteria 1084
609 Ga0587067_014580 3300059640 Bacteria 1262
610 Ga0587067_019132 3300059640 Bacteria 1157
611 Ga0587072_001299 3300059643 Bacteria 3041
612 Ga0587072_023595 3300059643 Bacteria 1106
613 Ga0587075_016176 3300059644 Bacteria 1057
614 Ga0501082_0082812 3300060353 Bacteria 2768
615 Ga0501082_0541901 3300060353 Bacteria 1018

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2921296804 2921303761 202
2 3300049513 Ga0501290_001432 Ga0501290_001432_875_1693 218
3 3300049515 Ga0501292_000311 Ga0501292_000311_3467_4285 218
4 3300049520 Ga0501297_003090 Ga0501297_003090_781_1599 218
5 3300049523 Ga0501300_000985 Ga0501300_000985_2301_3119 218
6 3300049524 Ga0501301_000349 Ga0501301_000349_15_833 218
7 3300049652 Ga0501202_003073 Ga0501202_003073_254_1072 218
8 3300049653 Ga0501206_000567 Ga0501206_000567_3126_3944 218
9 3300049662 Ga0501222_000962 Ga0501222_000962_1888_2706 218
10 3300049665 Ga0501227_008054 Ga0501227_008054_284_1102 218
11 3300049668 Ga0501233_002894 Ga0501233_002894_36_854 218
12 3300049669 Ga0501235_010757 Ga0501235_010757_558_1376 218
13 3300049670 Ga0501236_003861 Ga0501236_003861_476_1294 218
14 3300049686 Ga0501257_012589 Ga0501257_012589_1095_1913 218
15 3300049688 Ga0501259_002258 Ga0501259_002258_64_882 218
16 3300049690 Ga0501261_000111 Ga0501261_000111_2244_3062 218
17 3300049705 Ga0501225_0007429 Ga0501225_0007429_2221_3039 218
18 3300049775 Ga0501279_000095 Ga0501279_000095_11086_11904 218
19 3300049776 Ga0501280_000141 Ga0501280_000141_11123_11941 218
20 3300049777 Ga0501281_00092 Ga0501281_00092_1233_2051 218
21 3300049778 Ga0501282_000655 Ga0501282_000655_2337_3155 218
22 3300049779 Ga0501283_000632 Ga0501283_000632_2163_2981 218
23 3300059493 Ga0587077_032716 Ga0587077_032716_10_828 218
24 3300005563 Ga0068855_100207646 Ga0068855_1002076462 221
25 3300059504 Ga0587082_036716 Ga0587082_036716_48_830 221
26 3300047472 Ga0495686_0140581 Ga0495686_0140581_14_697 222
27 3300053730 Ga0500645_003805 Ga0500645_003805_957_1787 222
28 3300053087 Ga0500643_002924 Ga0500643_002924_5863_6684 227
29 3300015265 Ga0182005_1010351 Ga0182005_10103512 230
30 3300053153 Ga0500616_0005243 Ga0500616_0005243_3044_3859 230
31 3300025941 Ga0207711_10025140 Ga0207711_100251406 231
32 3300046660 Ga0495625_0007283 Ga0495625_0007283_2584_3414 231
33 3300048928 Ga0496125_0014472 Ga0496125_0014472_4606_5475 231
34 3300053087 Ga0500643_013521 Ga0500643_013521_1341_2171 231
35 3300053104 Ga0500556_0000076 Ga0500556_0000076_92312_93142 231
36 3300053130 Ga0500642_0000001 Ga0500642_0000001_1291626_1292456 231
37 3300025291 Ga0209675_1000493 Ga0209675_10004936 232
38 3300035725 Ga0373947_0013728 Ga0373947_0013728_3744_4556 232
39 3300037068 Ga0373925_0378780 Ga0373925_0378780_18_830 232
40 3300046542 Ga0495597_0120259 Ga0495597_0120259_103_915 232
41 3300053133 Ga0500655_000615 Ga0500655_000615_2347_3159 232
42 3300053142 Ga0500577_0012106 Ga0500577_0012106_681_1493 232
43 3300053724 Ga0500570_021757 Ga0500570_021757_2481_3293 232
44 3300059643 Ga0587072_023595 Ga0587072_023595_70_927 232
45 3300039062 Ga0400483_044087 Ga0400483_044087_412_1299 233
46 3300041498 Ga0451841_0394451 Ga0451841_0394451_152_1015 234
47 3300005983 Ga0081540_1089865 Ga0081540_10898651 235
48 3300010375 Ga0105239_10675825 Ga0105239_106758252 235
49 3300031995 Ga0307409_100329545 Ga0307409_1003295452 236
50 3300032005 Ga0307411_10010298 Ga0307411_100102981 236
51 3300039062 Ga0400483_151782 Ga0400483_151782_253_1137 236
52 3300048921 Ga0496118_0026257 Ga0496118_0026257_2948_3766 236
53 3300048922 Ga0496119_0017455 Ga0496119_0017455_2120_2938 236
54 3300048924 Ga0496121_0079506 Ga0496121_0079506_937_1755 236
55 3300049744 Ga0501083_0100752 Ga0501083_0100752_385_1263 236
56 iso_pu_bacteria 2896429255 2896432024 236
57 3300053087 Ga0500643_007818 Ga0500643_007818_1260_2090 237
58 3300053118 Ga0500594_0002072 Ga0500594_0002072_441_1271 237
59 3300005295 Ga0065707_10116042 Ga0065707_101160422 240
60 3300009553 Ga0105249_10087077 Ga0105249_100870774 240
61 3300025961 Ga0207712_10063086 Ga0207712_100630861 240
62 3300031901 Ga0307406_10218242 Ga0307406_102182422 241
63 3300046530 Ga0495654_0016645 Ga0495654_0016645_825_1694 241
64 3300046616 Ga0495668_0010174 Ga0495668_0010174_2158_3027 241
65 3300053158 Ga0500627_0002238 Ga0500627_0002238_2752_3621 241
66 iso_pu_bacteria 2513237087 2513591030 241
67 3300013297 Ga0157378_10607423 Ga0157378_106074232 242
68 3300005347 Ga0070668_100009224 Ga0070668_1000092245 243
69 3300025972 Ga0207668_10006879 Ga0207668_100068795 243
70 3300038443 Ga0395901_0029879 Ga0395901_0029879_3957_4805 243
71 iso_pu_bacteria 2977907340 2977910020 244
72 3300041458 Ga0451798_0576103 Ga0451798_0576103_467_1225 245
73 iso_pu_bacteria 2906363423 2906364994 245
74 iso_pu_bacteria 2588253730 2588515098 251
75 iso_pu_bacteria 3004334049 3004339065 251
76 3300025986 Ga0207658_10184611 Ga0207658_101846111 252
77 3300017792 Ga0163161_10195564 Ga0163161_101955641 253
78 3300059505 Ga0587083_0027837 Ga0587083_0027837_10_888 253
79 iso_pu_bacteria 8054558443 8054560326 253
80 3300003187 JGI25151J46595_10001621 JGI25151J46595_1000162117 254
81 3300003354 JGI25160J50197_1001098 JGI25160J50197_10010988 254
82 3300003374 JGI25161J50226_1002271 JGI25161J50226_10022716 254
83 3300003578 Ga0006562J51391_1011613 Ga0006562J51391_10116137 254
84 3300003781 Ga0055536_1008905 Ga0055536_10089052 254
85 3300003791 Ga0055530_10019848 Ga0055530_100198482 254
86 3300003792 Ga0055540_1014616 Ga0055540_10146162 254
87 3300003794 Ga0055531_10000882 Ga0055531_1000088212 254
88 3300003856 Ga0058692_1000854 Ga0058692_100085413 254
89 3300003856 Ga0058692_1001560 Ga0058692_10015606 254
90 3300004625 Ga0055543_1000967 Ga0055543_10009676 254
91 3300005262 Ga0065165_1006075 Ga0065165_10060753 254
92 3300005262 Ga0065165_1011907 Ga0065165_10119075 254
93 3300005331 Ga0070670_100020702 Ga0070670_1000207026 254
94 3300005548 Ga0070665_100037637 Ga0070665_1000376374 254
95 3300005548 Ga0070665_100052494 Ga0070665_1000524945 254
96 3300006038 Ga0075365_10002139 Ga0075365_100021392 254
97 3300006038 Ga0075365_10030508 Ga0075365_100305084 254
98 3300006042 Ga0075368_10001501 Ga0075368_100015014 254
99 3300006048 Ga0075363_100070145 Ga0075363_1000701451 254
100 3300006051 Ga0075364_10000081 Ga0075364_100000815 254
101 3300006051 Ga0075364_10100450 Ga0075364_101004502 254
102 3300006177 Ga0075362_10018911 Ga0075362_100189112 254
103 3300006177 Ga0075362_10088552 Ga0075362_100885522 254
104 3300006178 Ga0075367_10063279 Ga0075367_100632793 254
105 3300006178 Ga0075367_10143854 Ga0075367_101438542 254
106 3300006178 Ga0075367_10278722 Ga0075367_102787221 254
107 3300006186 Ga0075369_10006666 Ga0075369_100066665 254
108 3300006186 Ga0075369_10033582 Ga0075369_100335824 254
109 3300006353 Ga0075370_10016354 Ga0075370_100163542 254
110 3300006948 Ga0099826_10001318 Ga0099826_1000131811 254
111 3300006948 Ga0099826_10004914 Ga0099826_1000491411 254
112 3300011119 Ga0105246_10057874 Ga0105246_100578742 254
113 3300011119 Ga0105246_10573719 Ga0105246_105737191 254
114 3300013100 Ga0157373_10048556 Ga0157373_100485563 254
115 3300013102 Ga0157371_10000200 Ga0157371_100002009 254
116 3300013104 Ga0157370_10000030 Ga0157370_1000003044 254
117 3300021320 Ga0214544_1000008 Ga0214544_1000008170 254
118 3300021321 Ga0214542_1000010 Ga0214542_1000010126 254
119 3300021327 Ga0214543_1000004 Ga0214543_1000004148 254
120 3300025258 Ga0209129_1003543 Ga0209129_10035437 254
121 3300025284 Ga0209130_1012609 Ga0209130_10126092 254
122 3300025292 Ga0209676_1006528 Ga0209676_10065285 254
123 3300025294 Ga0209025_1000205 Ga0209025_100020518 254
124 3300025294 Ga0209025_1000575 Ga0209025_100057539 254
125 3300025295 Ga0209564_1004614 Ga0209564_10046147 254
126 3300025297 Ga0209758_1000191 Ga0209758_100019112 254
127 3300025297 Ga0209758_1000620 Ga0209758_10006206 254
128 3300025297 Ga0209758_1029290 Ga0209758_10292902 254
129 3300025298 Ga0209050_1002861 Ga0209050_100286117 254
130 3300025299 Ga0209256_1020462 Ga0209256_10204622 254
131 3300025302 Ga0207426_1000406 Ga0207426_100040671 254
132 3300025303 Ga0209051_1006571 Ga0209051_10065715 254
133 3300025304 Ga0209257_1005245 Ga0209257_100524511 254
134 3300025923 Ga0207681_10372096 Ga0207681_103720961 254
135 3300025925 Ga0207650_10065778 Ga0207650_100657784 254
136 3300025935 Ga0207709_10188186 Ga0207709_101881862 254
137 3300027312 Ga0209371_1000009 Ga0209371_1000009268 254
138 3300027312 Ga0209371_1001013 Ga0209371_100101317 254
139 3300027312 Ga0209371_1013361 Ga0209371_10133612 254
140 3300027666 Ga0209282_1000293 Ga0209282_100029315 254
141 3300027666 Ga0209282_1052292 Ga0209282_10522921 254
142 3300027866 Ga0209813_10000636 Ga0209813_100006369 254
143 3300027876 Ga0209974_10091649 Ga0209974_100916491 254
144 3300028379 Ga0268266_10022338 Ga0268266_100223381 254
145 3300028379 Ga0268266_10143640 Ga0268266_101436402 254
146 3300028794 Ga0307515_10000937 Ga0307515_1000093741 254
147 3300030500 Ga0268256_1000010 Ga0268256_1000010267 254
148 3300030500 Ga0268256_1006082 Ga0268256_10060825 254
149 3300031901 Ga0307406_10035056 Ga0307406_100350564 254
150 3300032004 Ga0307414_10028634 Ga0307414_100286345 254
151 3300044683 Ga0466965_0033869 Ga0466965_0033869_346_1224 254
152 3300046674 Ga0495588_0006962 Ga0495588_0006962_2431_3306 254
153 3300048920 Ga0496117_0000002 Ga0496117_0000002_1791386_1792261 254
154 3300048921 Ga0496118_0000483 Ga0496118_0000483_19680_20555 254
155 3300048922 Ga0496119_0062411 Ga0496119_0062411_859_1734 254
156 3300048923 Ga0496120_0000971 Ga0496120_0000971_23369_24244 254
157 3300048923 Ga0496120_0051971 Ga0496120_0051971_983_1858 254
158 3300048924 Ga0496121_0000001 Ga0496121_0000001_603136_604011 254
159 3300048924 Ga0496121_0007648 Ga0496121_0007648_415_1290 254
160 3300048925 Ga0496122_0000001 Ga0496122_0000001_1162176_1163051 254
161 3300048925 Ga0496122_0000009 Ga0496122_0000009_325824_326702 254
162 3300048925 Ga0496122_0018239 Ga0496122_0018239_3300_4175 254
163 3300048925 Ga0496122_0019021 Ga0496122_0019021_5200_6075 254
164 3300048926 Ga0496123_0000001 Ga0496123_0000001_1165907_1166782 254
165 3300048926 Ga0496123_0000020 Ga0496123_0000020_130276_131154 254
166 3300048927 Ga0496124_0000262 Ga0496124_0000262_27287_28162 254
167 3300048927 Ga0496124_0011809 Ga0496124_0011809_2302_3177 254
168 3300048927 Ga0496124_0031459 Ga0496124_0031459_1818_2693 254
169 3300048928 Ga0496125_0000001 Ga0496125_0000001_714140_715015 254
170 3300048928 Ga0496125_0009173 Ga0496125_0009173_3053_3928 254
171 3300048928 Ga0496125_0129008 Ga0496125_0129008_450_1325 254
172 3300048929 Ga0496126_0096626 Ga0496126_0096626_869_1744 254
173 3300050489 nmdc:mga03683_6790_c1 nmdc:mga03683_6790_c1_2259_3134 254
174 3300050491 nmdc:mga00v17_194_c1 nmdc:mga00v17_194_c1_26672_27547 254
175 3300050491 nmdc:mga00v17_6475_c1 nmdc:mga00v17_6475_c1_1364_2239 254
176 3300050491 nmdc:mga00v17_92_c1 nmdc:mga00v17_92_c1_1358_2233 254
177 3300050492 nmdc:mga0yw44_226_c1 nmdc:mga0yw44_226_c1_2638_3513 254
178 3300050493 nmdc:mga0k408_23370_c1 nmdc:mga0k408_23370_c1_109_984 254
179 3300050494 nmdc:mga06z11_118934_c1 nmdc:mga06z11_118934_c1_169_1044 254
180 3300050495 nmdc:mga04h51_11199_c1 nmdc:mga04h51_11199_c1_1032_1907 254
181 3300050496 nmdc:mga07m45_54866_c1 nmdc:mga07m45_54866_c1_359_1234 254
182 3300050516 nmdc:mga0sz30_461_c1 nmdc:mga0sz30_461_c1_4056_4931 254
183 3300050516 nmdc:mga0sz30_72400_c1 nmdc:mga0sz30_72400_c1_148_1023 254
184 3300053111 Ga0500572_002456 Ga0500572_002456_2996_3871 254
185 3300053137 Ga0500561_0000108 Ga0500561_0000108_11999_12874 254
186 3300053153 Ga0500616_0000758 Ga0500616_0000758_6896_7771 254
187 3300053157 Ga0500624_001991 Ga0500624_001991_1987_2862 254
188 3300053177 Ga0500636_0000023 Ga0500636_0000023_24067_24879 254
189 3300053177 Ga0500636_0000562 Ga0500636_0000562_2375_3250 254
190 3300059493 Ga0587077_016469 Ga0587077_016469_262_1137 254
191 3300059640 Ga0587067_014580 Ga0587067_014580_160_1035 254
192 3300059643 Ga0587072_001299 Ga0587072_001299_538_1413 254
193 3300060353 Ga0501082_0541901 Ga0501082_0541901_22_903 254
194 iso_pu_bacteria 2513237144 2513907885 254
195 iso_pu_bacteria 2537561587 2537874428 254
196 iso_pu_bacteria 2554235003 2554246799 254
197 iso_pu_bacteria 2558860242 2559294026 254
198 iso_pu_bacteria 2585427528 2585539917 254
199 iso_pu_bacteria 2585427593 2585837898 254
200 iso_pu_bacteria 2585427633 2585994705 254
201 iso_pu_bacteria 2585427634 2585999188 254
202 iso_pu_bacteria 2599185156 2599333737 254
203 iso_pu_bacteria 2599185210 2599603651 254
204 iso_pu_bacteria 2600254933 2600374908 254
205 iso_pu_bacteria 2600255279 2601608998 254
206 iso_pu_bacteria 2600255308 2601745773 254
207 iso_pu_bacteria 2643221558 2643810343 254
208 iso_pu_bacteria 2643221564 2643838514 254
209 iso_pu_bacteria 2643221582 2643920983 254
210 iso_pu_bacteria 2643221623 2644132666 254
211 iso_pu_bacteria 2643221643 2644241355 254
212 iso_pu_bacteria 2643221689 2644497243 254
213 iso_pu_bacteria 2643221693 2644519059 254
214 iso_pu_bacteria 2657244999 2657682092 254
215 iso_pu_bacteria 2738541333 2739034776 254
216 iso_pu_bacteria 2765235942 2766065003 254
217 iso_pu_bacteria 2775507049 2776912440 254
218 iso_pu_bacteria 2791355253 2793283657 254
219 iso_pu_bacteria 2802429268 2804751110 254
220 iso_pu_bacteria 2802429633 2806044071 254
221 iso_pu_bacteria 2802429634 2806052112 254
222 iso_pu_bacteria 2802429635 2806058413 254
223 iso_pu_bacteria 2802429636 2806066908 254
224 iso_pu_bacteria 2802429637 2806074650 254
225 iso_pu_bacteria 2808606387 2808986201 254
226 iso_pu_bacteria 2818991439 2819556329 254
227 iso_pu_bacteria 2818991461 2819684505 254
228 iso_pu_bacteria 2838675328 2838677054 254
229 iso_pu_bacteria 2838714209 2838715941 254
230 iso_pu_bacteria 2838719591 2838720257 254
231 iso_pu_bacteria 2838724970 2838726694 254
232 iso_pu_bacteria 2841846520 2841847190 254
233 iso_pu_bacteria 2841859092 2841860276 254
234 iso_pu_bacteria 2842110456 2842112438 254
235 iso_pu_bacteria 2842124991 2842126780 254
236 iso_pu_bacteria 2842130223 2842131947 254
237 iso_pu_bacteria 2842152218 2842152883 254
238 iso_pu_bacteria 2842170452 2842172186 254
239 iso_pu_bacteria 2842175837 2842176502 254
240 iso_pu_bacteria 2842187318 2842189050 254
241 iso_pu_bacteria 2842211629 2842213363 254
242 iso_pu_bacteria 2842224351 2842225019 254
243 iso_pu_bacteria 2842515876 2842517061 254
244 iso_pu_bacteria 2842922631 2842924825 254
245 iso_pu_bacteria 2854896431 2854898484 254
246 iso_pu_bacteria 2857516855 2857524036 254
247 iso_pu_bacteria 2889790730 2889794204 254
248 iso_pu_bacteria 2889914905 2889920249 254
249 iso_pu_bacteria 2899792073 2899792342 254
250 iso_pu_bacteria 2899803654 2899805933 254
251 iso_pu_bacteria 2899845264 2899846614 254
252 iso_pu_bacteria 2913295892 2913297791 254
253 iso_pu_bacteria 2915650412 2915651286 254
254 iso_pu_bacteria 2917554339 2917555825 254
255 iso_pu_bacteria 2919114240 2919116146 254
256 iso_pu_bacteria 2919171160 2919171848 254
257 iso_pu_bacteria 2926754445 2926757098 254
258 iso_pu_bacteria 2926760298 2926761320 254
259 iso_pu_bacteria 2929138655 2929139138 254
260 iso_pu_bacteria 2933006813 2933007528 254
261 iso_pu_bacteria 2933011516 2933012296 254
262 iso_pu_bacteria 2933586486 2933587767 254
263 iso_pu_bacteria 2933594066 2933594740 254
264 iso_pu_bacteria 2936367885 2936368701 254
265 iso_pu_bacteria 2936375103 2936379390 254
266 iso_pu_bacteria 2979089926 2979093398 254
267 iso_pu_bacteria 2979095461 2979099216 254
268 iso_pu_bacteria 2979100975 2979105368 254
269 iso_pu_bacteria 2984509177 2984512776 254
270 iso_pu_bacteria 2984518228 2984520861 254
271 iso_pu_bacteria 2984537506 2984540155 254
272 iso_pu_bacteria 2984601300 2984602348 254
273 iso_pu_bacteria 2989771324 2989774158 254
274 iso_pu_bacteria 650716007 650739217 254
275 iso_pu_bacteria 8003570095 8003570226 254
276 iso_pu_bacteria 8005376324 8005377208 254
277 iso_pu_bacteria 8005570704 8005577152 254
278 iso_pu_bacteria 8018150411 8018151853 254
279 iso_pu_bacteria 8054460903 8054461472 254
280 iso_pu_bacteria 8056875544 8056879312 254
281 2010549000 RicEn_C2142 RicEn_39470 255
282 3300001979 JGI24740J21852_10000294 JGI24740J21852_1000029420 255
283 3300001979 JGI24740J21852_10011706 JGI24740J21852_100117062 255
284 3300001989 JGI24739J22299_10010929 JGI24739J22299_100109295 255
285 3300002704 JGI25155J39150_1000006 JGI25155J39150_1000006125 255
286 3300002705 JGI25156J39149_1000019 JGI25156J39149_1000019120 255
287 3300002705 JGI25156J39149_1002193 JGI25156J39149_10021934 255
288 3300002737 JGI25162J39368_1000266 JGI25162J39368_100026655 255
289 3300002737 JGI25162J39368_1001936 JGI25162J39368_10019367 255
290 3300002738 JGI25154J39366_1000055 JGI25154J39366_100005568 255
291 3300002739 JGI25158J39367_1000267 JGI25158J39367_10002675 255
292 3300002739 JGI25158J39367_1002216 JGI25158J39367_10022165 255
293 3300002741 JGI25157J39369_1000024 JGI25157J39369_100002442 255
294 3300002741 JGI25157J39369_1001637 JGI25157J39369_10016376 255
295 3300002773 JGI25152J39213_1001649 JGI25152J39213_100164911 255
296 3300002773 JGI25152J39213_1002383 JGI25152J39213_100238310 255
297 3300002773 JGI25152J39213_1005870 JGI25152J39213_10058702 255
298 3300002773 JGI25152J39213_1008741 JGI25152J39213_10087414 255
299 3300002774 JGI25150J39212_1000256 JGI25150J39212_100025627 255
300 3300002774 JGI25150J39212_1000592 JGI25150J39212_10005925 255
301 3300002774 JGI25150J39212_1003476 JGI25150J39212_10034765 255
302 3300002987 JGI25159J45721_1000001 JGI25159J45721_100000132 255
303 3300002987 JGI25159J45721_1000307 JGI25159J45721_10003074 255
304 3300002987 JGI25159J45721_1000921 JGI25159J45721_100092112 255
305 3300003187 JGI25151J46595_10000629 JGI25151J46595_1000062931 255
306 3300003187 JGI25151J46595_10002526 JGI25151J46595_100025265 255
307 3300003214 JGI25165J46597_1000016 JGI25165J46597_1000016186 255
308 3300003214 JGI25165J46597_1000702 JGI25165J46597_100070227 255
309 3300003215 JGI25153J46596_10011761 JGI25153J46596_100117614 255
310 3300003354 JGI25160J50197_1000002 JGI25160J50197_1000002278 255
311 3300003354 JGI25160J50197_1000053 JGI25160J50197_100005369 255
312 3300003354 JGI25160J50197_1007804 JGI25160J50197_10078044 255
313 3300003354 JGI25160J50197_1023218 JGI25160J50197_10232182 255
314 3300003374 JGI25161J50226_1000039 JGI25161J50226_100003969 255
315 3300003374 JGI25161J50226_1000235 JGI25161J50226_100023517 255
316 3300003374 JGI25161J50226_1000968 JGI25161J50226_10009687 255
317 3300003578 Ga0006562J51391_1004501 Ga0006562J51391_10045018 255
318 3300003578 Ga0006562J51391_1009215 Ga0006562J51391_10092156 255
319 3300003762 Ga0055542_1000586 Ga0055542_100058628 255
320 3300003763 Ga0055529_1013358 Ga0055529_10133581 255
321 3300003771 Ga0055526_1000370 Ga0055526_100037017 255
322 3300003771 Ga0055526_1000699 Ga0055526_100069925 255
323 3300003771 Ga0055526_1011897 Ga0055526_10118974 255
324 3300003775 Ga0055524_1000974 Ga0055524_100097410 255
325 3300003775 Ga0055524_1015730 Ga0055524_10157304 255
326 3300003781 Ga0055536_1012504 Ga0055536_10125045 255
327 3300003790 Ga0055528_1003983 Ga0055528_10039837 255
328 3300003792 Ga0055540_1003180 Ga0055540_100318011 255
329 3300003792 Ga0055540_1012461 Ga0055540_10124614 255
330 3300003794 Ga0055531_10004081 Ga0055531_100040814 255
331 3300004625 Ga0055543_1000010 Ga0055543_1000010105 255
332 3300004625 Ga0055543_1000015 Ga0055543_1000015119 255
333 3300004625 Ga0055543_1000033 Ga0055543_100003337 255
334 3300005262 Ga0065165_1000004 Ga0065165_1000004100 255
335 3300005262 Ga0065165_1000361 Ga0065165_100036149 255
336 3300005262 Ga0065165_1017007 Ga0065165_10170072 255
337 3300005327 Ga0070658_10295154 Ga0070658_102951542 255
338 3300005355 Ga0070671_100015587 Ga0070671_1000155875 255
339 3300005366 Ga0070659_100037881 Ga0070659_1000378813 255
340 3300005455 Ga0070663_100007730 Ga0070663_1000077302 255
341 3300005455 Ga0070663_100037526 Ga0070663_1000375263 255
342 3300005543 Ga0070672_100121537 Ga0070672_1001215371 255
343 3300005548 Ga0070665_100017880 Ga0070665_10001788010 255
344 3300005548 Ga0070665_100483688 Ga0070665_1004836882 255
345 3300005548 Ga0070665_100730092 Ga0070665_1007300922 255
346 3300005578 Ga0068854_100023205 Ga0068854_1000232055 255
347 3300005616 Ga0068852_100121813 Ga0068852_1001218134 255
348 3300005985 Ga0081539_10001043 Ga0081539_1000104326 255
349 3300006038 Ga0075365_10010471 Ga0075365_100104715 255
350 3300006038 Ga0075365_10017038 Ga0075365_100170384 255
351 3300006038 Ga0075365_10019390 Ga0075365_100193905 255
352 3300006038 Ga0075365_10040232 Ga0075365_100402325 255
353 3300006042 Ga0075368_10003717 Ga0075368_100037176 255
354 3300006042 Ga0075368_10064281 Ga0075368_100642812 255
355 3300006048 Ga0075363_100005422 Ga0075363_1000054225 255
356 3300006178 Ga0075367_10017046 Ga0075367_100170462 255
357 3300006178 Ga0075367_10076771 Ga0075367_100767712 255
358 3300006178 Ga0075367_10102165 Ga0075367_101021652 255
359 3300006186 Ga0075369_10003037 Ga0075369_100030374 255
360 3300006186 Ga0075369_10027638 Ga0075369_100276382 255
361 3300006186 Ga0075369_10037977 Ga0075369_100379772 255
362 3300006186 Ga0075369_10056168 Ga0075369_100561682 255
363 3300006195 Ga0075366_10012526 Ga0075366_100125267 255
364 3300006353 Ga0075370_10069604 Ga0075370_100696042 255
365 3300006946 Ga0079104_1000010 Ga0079104_1000010386 255
366 3300006946 Ga0079104_1017322 Ga0079104_10173224 255
367 3300009011 Ga0105251_10012402 Ga0105251_100124022 255
368 3300009093 Ga0105240_10000027 Ga0105240_10000027103 255
369 3300009093 Ga0105240_10281545 Ga0105240_102815452 255
370 3300009177 Ga0105248_10020887 Ga0105248_100208875 255
371 3300009545 Ga0105237_10001405 Ga0105237_100014055 255
372 3300009545 Ga0105237_10215884 Ga0105237_102158843 255
373 3300009765 Ga0123341_1000098 Ga0123341_10000988 255
374 3300009766 Ga0123342_1009019 Ga0123342_10090192 255
375 3300009766 Ga0123342_1023934 Ga0123342_10239343 255
376 3300010375 Ga0105239_10001129 Ga0105239_1000112911 255
377 3300010375 Ga0105239_10106109 Ga0105239_101061094 255
378 3300010375 Ga0105239_10512341 Ga0105239_105123412 255
379 3300010375 Ga0105239_10592785 Ga0105239_105927852 255
380 3300013102 Ga0157371_10006915 Ga0157371_100069158 255
381 3300013104 Ga0157370_10000048 Ga0157370_1000004883 255
382 3300013104 Ga0157370_10082413 Ga0157370_100824134 255
383 3300013105 Ga0157369_10330041 Ga0157369_103300411 255
384 3300013105 Ga0157369_10424728 Ga0157369_104247282 255
385 3300013249 Ga0171463_1001 Ga0171463_1001490 255
386 3300013296 Ga0157374_10114675 Ga0157374_101146752 255
387 3300015262 Ga0182007_10002627 Ga0182007_100026272 255
388 3300015690 Ga0183363_1167 Ga0183363_11677 255
389 3300021321 Ga0214542_1018203 Ga0214542_10182034 255
390 3300021327 Ga0214543_1000003 Ga0214543_1000003246 255
391 3300022739 Ga0228711_1000001 Ga0228711_1000001294 255
392 3300022740 Ga0228710_1000001 Ga0228710_100000131 255
393 3300025206 Ga0209435_100011 Ga0209435_100011123 255
394 3300025208 Ga0209436_100002 Ga0209436_10000262 255
395 3300025208 Ga0209436_103514 Ga0209436_1035145 255
396 3300025228 Ga0209672_107903 Ga0209672_1079032 255
397 3300025233 Ga0209437_100036 Ga0209437_100036227 255
398 3300025233 Ga0209437_100086 Ga0209437_10008621 255
399 3300025245 Ga0207425_1000312 Ga0207425_100031234 255
400 3300025245 Ga0207425_1004745 Ga0207425_10047452 255
401 3300025245 Ga0207425_1005199 Ga0207425_10051992 255
402 3300025245 Ga0207425_1018906 Ga0207425_10189062 255
403 3300025246 Ga0209646_1000024 Ga0209646_1000024288 255
404 3300025250 Ga0209026_1000005 Ga0209026_1000005304 255
405 3300025250 Ga0209026_1000030 Ga0209026_1000030288 255
406 3300025253 Ga0209677_100188 Ga0209677_10018845 255
407 3300025254 Ga0209148_1000057 Ga0209148_1000057308 255
408 3300025256 Ga0209759_1000011 Ga0209759_1000011123 255
409 3300025256 Ga0209759_1000385 Ga0209759_100038550 255
410 3300025258 Ga0209129_1000078 Ga0209129_100007826 255
411 3300025258 Ga0209129_1000393 Ga0209129_100039334 255
412 3300025258 Ga0209129_1003719 Ga0209129_10037193 255
413 3300025261 Ga0209233_1000056 Ga0209233_1000056365 255
414 3300025261 Ga0209233_1000068 Ga0209233_1000068187 255
415 3300025261 Ga0209233_1000110 Ga0209233_1000110227 255
416 3300025261 Ga0209233_1000271 Ga0209233_10002718 255
417 3300025272 Ga0209455_1000231 Ga0209455_100023127 255
418 3300025273 Ga0209673_1000015 Ga0209673_1000015198 255
419 3300025273 Ga0209673_1000091 Ga0209673_100009134 255
420 3300025273 Ga0209673_1003438 Ga0209673_100343810 255
421 3300025273 Ga0209673_1028717 Ga0209673_10287172 255
422 3300025273 Ga0209673_1048186 Ga0209673_10481862 255
423 3300025284 Ga0209130_1000008 Ga0209130_1000008266 255
424 3300025284 Ga0209130_1000015 Ga0209130_1000015264 255
425 3300025284 Ga0209130_1000038 Ga0209130_100003868 255
426 3300025292 Ga0209676_1010131 Ga0209676_10101316 255
427 3300025292 Ga0209676_1013430 Ga0209676_10134302 255
428 3300025294 Ga0209025_1000118 Ga0209025_1000118101 255
429 3300025294 Ga0209025_1000489 Ga0209025_100048927 255
430 3300025294 Ga0209025_1000664 Ga0209025_100066434 255
431 3300025294 Ga0209025_1000887 Ga0209025_10008876 255
432 3300025294 Ga0209025_1001772 Ga0209025_10017725 255
433 3300025294 Ga0209025_1025453 Ga0209025_10254532 255
434 3300025294 Ga0209025_1037759 Ga0209025_10377592 255
435 3300025294 Ga0209025_1040663 Ga0209025_10406632 255
436 3300025295 Ga0209564_1000104 Ga0209564_100010436 255
437 3300025295 Ga0209564_1000821 Ga0209564_100082121 255
438 3300025295 Ga0209564_1001024 Ga0209564_100102434 255
439 3300025295 Ga0209564_1004635 Ga0209564_10046358 255
440 3300025295 Ga0209564_1015710 Ga0209564_10157103 255
441 3300025297 Ga0209758_1000549 Ga0209758_100054934 255
442 3300025297 Ga0209758_1001053 Ga0209758_10010536 255
443 3300025297 Ga0209758_1012258 Ga0209758_10122584 255
444 3300025297 Ga0209758_1013206 Ga0209758_10132063 255
445 3300025297 Ga0209758_1056964 Ga0209758_10569642 255
446 3300025298 Ga0209050_1001561 Ga0209050_100156123 255
447 3300025298 Ga0209050_1013599 Ga0209050_10135994 255
448 3300025299 Ga0209256_1000461 Ga0209256_100046160 255
449 3300025299 Ga0209256_1000465 Ga0209256_100046561 255
450 3300025299 Ga0209256_1000782 Ga0209256_100078235 255
451 3300025299 Ga0209256_1001819 Ga0209256_10018195 255
452 3300025299 Ga0209256_1002265 Ga0209256_100226512 255
453 3300025299 Ga0209256_1007287 Ga0209256_10072876 255
454 3300025302 Ga0207426_1000016 Ga0207426_1000016295 255
455 3300025302 Ga0207426_1000081 Ga0207426_1000081108 255
456 3300025302 Ga0207426_1000144 Ga0207426_100014434 255
457 3300025302 Ga0207426_1001732 Ga0207426_100173213 255
458 3300025303 Ga0209051_1000408 Ga0209051_10004081 255
459 3300025303 Ga0209051_1002529 Ga0209051_100252914 255
460 3300025303 Ga0209051_1020786 Ga0209051_10207863 255
461 3300025303 Ga0209051_1021123 Ga0209051_10211232 255
462 3300025303 Ga0209051_1024231 Ga0209051_10242314 255
463 3300025304 Ga0209257_1004842 Ga0209257_10048427 255
464 3300025304 Ga0209257_1013466 Ga0209257_10134665 255
465 3300025304 Ga0209257_1017369 Ga0209257_10173694 255
466 3300025904 Ga0207647_10055277 Ga0207647_100552774 255
467 3300025909 Ga0207705_10224336 Ga0207705_102243362 255
468 3300025913 Ga0207695_10000024 Ga0207695_10000024527 255
469 3300025913 Ga0207695_10092964 Ga0207695_100929644 255
470 3300025914 Ga0207671_10000463 Ga0207671_1000046350 255
471 3300025924 Ga0207694_10066437 Ga0207694_100664374 255
472 3300025927 Ga0207687_10303290 Ga0207687_103032902 255
473 3300025931 Ga0207644_10018095 Ga0207644_100180955 255
474 3300025940 Ga0207691_10134416 Ga0207691_101344164 255
475 3300025941 Ga0207711_10075448 Ga0207711_100754483 255
476 3300025972 Ga0207668_10108567 Ga0207668_101085672 255
477 3300025972 Ga0207668_10496558 Ga0207668_104965581 255
478 3300026067 Ga0207678_10014723 Ga0207678_100147232 255
479 3300027111 Ga0209281_1000078 Ga0209281_1000078263 255
480 3300027111 Ga0209281_1000155 Ga0209281_1000155119 255
481 3300027111 Ga0209281_1000215 Ga0209281_1000215100 255
482 3300027312 Ga0209371_1001948 Ga0209371_10019483 255
483 3300027666 Ga0209282_1000025 Ga0209282_100002545 255
484 3300027866 Ga0209813_10036220 Ga0209813_100362202 255
485 3300028379 Ga0268266_10412883 Ga0268266_104128832 255
486 3300028794 Ga0307515_10002427 Ga0307515_1000242740 255
487 3300028794 Ga0307515_10069382 Ga0307515_100693824 255
488 3300030500 Ga0268256_1001705 Ga0268256_100170511 255
489 3300031548 Ga0307408_100146895 Ga0307408_1001468952 255
490 3300031548 Ga0307408_100288196 Ga0307408_1002881962 255
491 3300031731 Ga0307405_10034223 Ga0307405_100342234 255
492 3300031731 Ga0307405_10365800 Ga0307405_103658002 255
493 3300031901 Ga0307406_10010249 Ga0307406_100102495 255
494 3300031967 Ga0315914_1000020 Ga0315914_100002044 255
495 3300031995 Ga0307409_100433856 Ga0307409_1004338562 255
496 3300033430 Ga0315913_1000013 Ga0315913_100001376 255
497 3300033464 Ga0315915_1000015 Ga0315915_1000015117 255
498 3300035695 Ga0373927_0000727 Ga0373927_0000727_2383_3261 255
499 3300036647 Ga0316582_0038255 Ga0316582_0038255_1736_2614 255
500 3300036712 Ga0316584_0230250 Ga0316584_0230250_569_1336 255
501 3300037068 Ga0373925_0009740 Ga0373925_0009740_5326_6204 255
502 3300037312 Ga0395899_0000030 Ga0395899_0000030_295609_296502 255
503 3300037312 Ga0395899_0197220 Ga0395899_0197220_417_1298 255
504 3300037418 Ga0395900_0000023 Ga0395900_0000023_302015_302908 255
505 3300037418 Ga0395900_0579503 Ga0395900_0579503_167_1048 255
506 3300037466 Ga0395898_0000038 Ga0395898_0000038_295609_296502 255
507 3300037471 Ga0395905_0000021 Ga0395905_0000021_295609_296502 255
508 3300037471 Ga0395905_0000463 Ga0395905_0000463_43478_44356 255
509 3300037471 Ga0395905_0001846 Ga0395905_0001846_15924_16802 255
510 3300037471 Ga0395905_0013227 Ga0395905_0013227_4946_5827 255
511 3300037471 Ga0395905_0097955 Ga0395905_0097955_624_1502 255
512 3300038443 Ga0395901_0000018 Ga0395901_0000018_302015_302908 255
513 3300038443 Ga0395901_0549591 Ga0395901_0549591_128_1009 255
514 3300041413 Ga0439465_0018747 Ga0439465_0018747_12_803 255
515 3300041458 Ga0451798_0810827 Ga0451798_0810827_189_1067 255
516 3300041501 Ga0451845_0120191 Ga0451845_0120191_551_1429 255
517 3300042014 Ga0439457_035027 Ga0439457_035027_86_964 255
518 3300042145 Ga0450906_008543 Ga0450906_008543_613_1491 255
519 3300044658 Ga0466972_0025250 Ga0466972_0025250_450_1331 255
520 3300046459 Ga0495629_0076712 Ga0495629_0076712_536_1414 255
521 3300046460 Ga0495638_0003268 Ga0495638_0003268_9736_10614 255
522 3300046460 Ga0495638_0015723 Ga0495638_0015723_3249_4136 255
523 3300046474 Ga0495605_0004327 Ga0495605_0004327_6642_7520 255
524 3300046492 Ga0495585_0034165 Ga0495585_0034165_207_1085 255
525 3300046506 Ga0495583_0010857 Ga0495583_0010857_1897_2775 255
526 3300046507 Ga0495606_0006905 Ga0495606_0006905_8439_9347 255
527 3300046518 Ga0495631_0050153 Ga0495631_0050153_97_975 255
528 3300046519 Ga0495632_0004419 Ga0495632_0004419_1189_2067 255
529 3300046519 Ga0495632_0045274 Ga0495632_0045274_1356_2123 255
530 3300046522 Ga0495643_0011973 Ga0495643_0011973_2242_3120 255
531 3300046522 Ga0495643_0071065 Ga0495643_0071065_384_1265 255
532 3300046522 Ga0495643_0131921 Ga0495643_0131921_182_1060 255
533 3300046530 Ga0495654_0000043 Ga0495654_0000043_109385_110263 255
534 3300046558 Ga0495633_0044517 Ga0495633_0044517_791_1669 255
535 3300046616 Ga0495668_0011280 Ga0495668_0011280_4235_5113 255
536 3300046616 Ga0495668_0054863 Ga0495668_0054863_379_1257 255
537 3300046660 Ga0495625_0007525 Ga0495625_0007525_6427_7305 255
538 3300046660 Ga0495625_0111077 Ga0495625_0111077_42_923 255
539 3300046675 Ga0495657_0149390 Ga0495657_0149390_196_1074 255
540 3300046691 Ga0495670_0037584 Ga0495670_0037584_60_827 255
541 3300046694 Ga0495649_0040344 Ga0495649_0040344_379_1257 255
542 3300047317 Ga0495604_0049673 Ga0495604_0049673_161_1039 255
543 3300047443 Ga0495687_030085 Ga0495687_030085_249_1127 255
544 3300047472 Ga0495686_0001564 Ga0495686_0001564_16313_17221 255
545 3300047472 Ga0495686_0096470 Ga0495686_0096470_238_1116 255
546 3300048904 Ga0496101_0062411 Ga0496101_0062411_1879_2670 255
547 3300048905 Ga0496102_0024012 Ga0496102_0024012_2419_3327 255
548 3300048905 Ga0496102_0072700 Ga0496102_0072700_2204_3091 255
549 3300048909 Ga0496106_0015335 Ga0496106_0015335_2667_3545 255
550 3300048913 Ga0496110_0104998 Ga0496110_0104998_163_1044 255
551 3300048915 Ga0496112_0076554 Ga0496112_0076554_75_956 255
552 3300048919 Ga0496116_0000080 Ga0496116_0000080_192061_192945 255
553 3300048919 Ga0496116_0004852 Ga0496116_0004852_10807_11685 255
554 3300048919 Ga0496116_0039503 Ga0496116_0039503_1406_2284 255
555 3300048920 Ga0496117_0008316 Ga0496117_0008316_2013_2921 255
556 3300048920 Ga0496117_0014997 Ga0496117_0014997_3843_4721 255
557 3300048920 Ga0496117_0016911 Ga0496117_0016911_4027_4905 255
558 3300048921 Ga0496118_0007453 Ga0496118_0007453_9621_10499 255
559 3300048921 Ga0496118_0008926 Ga0496118_0008926_2374_3282 255
560 3300048921 Ga0496118_0015536 Ga0496118_0015536_4194_5072 255
561 3300048921 Ga0496118_0059701 Ga0496118_0059701_464_1342 255
562 3300048922 Ga0496119_0011774 Ga0496119_0011774_2485_3363 255
563 3300048922 Ga0496119_0048443 Ga0496119_0048443_688_1569 255
564 3300048922 Ga0496119_0066801 Ga0496119_0066801_1118_2026 255
565 3300048922 Ga0496119_0133762 Ga0496119_0133762_80_961 255
566 3300048923 Ga0496120_0001519 Ga0496120_0001519_22717_23598 255
567 3300048923 Ga0496120_0023512 Ga0496120_0023512_396_1304 255
568 3300048923 Ga0496120_0028875 Ga0496120_0028875_129_1007 255
569 3300048924 Ga0496121_0008329 Ga0496121_0008329_2665_3543 255
570 3300048924 Ga0496121_0038824 Ga0496121_0038824_1163_2071 255
571 3300048924 Ga0496121_0050885 Ga0496121_0050885_2072_2950 255
572 3300048924 Ga0496121_0144527 Ga0496121_0144527_99_977 255
573 3300048924 Ga0496121_0217954 Ga0496121_0217954_379_1296 255
574 3300048924 Ga0496121_0240777 Ga0496121_0240777_276_1154 255
575 3300048925 Ga0496122_0000758 Ga0496122_0000758_24321_25199 255
576 3300048925 Ga0496122_0015116 Ga0496122_0015116_145_1023 255
577 3300048925 Ga0496122_0015834 Ga0496122_0015834_4993_5871 255
578 3300048925 Ga0496122_0066483 Ga0496122_0066483_734_1642 255
579 3300048925 Ga0496122_0072713 Ga0496122_0072713_259_1176 255
580 3300048926 Ga0496123_0000499 Ga0496123_0000499_29889_30767 255
581 3300048926 Ga0496123_0008905 Ga0496123_0008905_6378_7256 255
582 3300048926 Ga0496123_0011781 Ga0496123_0011781_2974_3852 255
583 3300048926 Ga0496123_0056469 Ga0496123_0056469_920_1840 255
584 3300048927 Ga0496124_0004143 Ga0496124_0004143_9365_10243 255
585 3300048927 Ga0496124_0005219 Ga0496124_0005219_1841_2719 255
586 3300048927 Ga0496124_0069693 Ga0496124_0069693_1614_2492 255
587 3300048927 Ga0496124_0107616 Ga0496124_0107616_826_1704 255
588 3300048927 Ga0496124_0285644 Ga0496124_0285644_338_1138 255
589 3300048928 Ga0496125_0000254 Ga0496125_0000254_1719_2597 255
590 3300048928 Ga0496125_0036086 Ga0496125_0036086_636_1514 255
591 3300048928 Ga0496125_0138201 Ga0496125_0138201_879_1673 255
592 3300048928 Ga0496125_0154632 Ga0496125_0154632_195_1076 255
593 3300048928 Ga0496125_0347941 Ga0496125_0347941_66_860 255
594 3300048929 Ga0496126_0000690 Ga0496126_0000690_29876_30760 255
595 3300048929 Ga0496126_0071022 Ga0496126_0071022_76_954 255
596 3300048929 Ga0496126_0074187 Ga0496126_0074187_253_1131 255
597 3300048929 Ga0496126_0125936 Ga0496126_0125936_51_968 255
598 3300049459 Ga0495678_018243 Ga0495678_018243_1627_2505 255
599 3300049568 Ga0501031_0000015 Ga0501031_0000015_82230_83117 255
600 3300049568 Ga0501031_0023683 Ga0501031_0023683_1561_2445 255
601 3300049568 Ga0501031_0036354 Ga0501031_0036354_1369_2247 255
602 3300049569 Ga0501032_0000008 Ga0501032_0000008_124743_125630 255
603 3300049569 Ga0501032_0000060 Ga0501032_0000060_24079_24960 255
604 3300049569 Ga0501032_0006839 Ga0501032_0006839_2640_3524 255
605 3300049569 Ga0501032_0139440 Ga0501032_0139440_10_777 255
606 3300049569 Ga0501032_0199050 Ga0501032_0199050_29_913 255
607 3300049570 Ga0501033_0000012 Ga0501033_0000012_115995_116882 255
608 3300049570 Ga0501033_0000165 Ga0501033_0000165_24007_24885 255
609 3300049570 Ga0501033_0001975 Ga0501033_0001975_2582_3463 255
610 3300049570 Ga0501033_0004354 Ga0501033_0004354_2147_3031 255
611 3300049570 Ga0501033_0004796 Ga0501033_0004796_7543_8427 255
612 3300049570 Ga0501033_0029575 Ga0501033_0029575_1527_2411 255
613 3300049570 Ga0501033_0177551 Ga0501033_0177551_629_1513 255
614 3300049571 Ga0501034_0000035 Ga0501034_0000035_115994_116881 255
615 3300049571 Ga0501034_0000262 Ga0501034_0000262_24079_24960 255
616 3300049571 Ga0501034_0035209 Ga0501034_0035209_3018_3896 255
617 3300049571 Ga0501034_0169331 Ga0501034_0169331_225_1103 255
618 3300049571 Ga0501034_0355297 Ga0501034_0355297_84_962 255
619 3300049572 Ga0501036_0000006 Ga0501036_0000006_115994_116881 255
620 3300049572 Ga0501036_0000514 Ga0501036_0000514_2872_3753 255
621 3300049573 Ga0501037_0000076 Ga0501037_0000076_28512_29396 255
622 3300049573 Ga0501037_0000123 Ga0501037_0000123_30290_31177 255
623 3300049573 Ga0501037_0002944 Ga0501037_0002944_8793_9674 255
624 3300049574 Ga0501038_0000007 Ga0501038_0000007_124743_125630 255
625 3300049574 Ga0501038_0000051 Ga0501038_0000051_70334_71215 255
626 3300049574 Ga0501038_0036034 Ga0501038_0036034_1333_2217 255
627 3300049574 Ga0501038_0161053 Ga0501038_0161053_95_973 255
628 3300049574 Ga0501038_0282859 Ga0501038_0282859_167_1051 255
629 3300049574 Ga0501038_0318441 Ga0501038_0318441_228_1112 255
630 3300049575 Ga0501039_0000012 Ga0501039_0000012_115994_116881 255
631 3300049575 Ga0501039_0000051 Ga0501039_0000051_24079_24960 255
632 3300049576 Ga0501040_0034055 Ga0501040_0034055_2285_3172 255
633 3300049579 Ga0501043_0000039 Ga0501043_0000039_89760_90644 255
634 3300049579 Ga0501043_0000844 Ga0501043_0000844_2275_3156 255
635 3300049579 Ga0501043_0003160 Ga0501043_0003160_12229_13116 255
636 3300049579 Ga0501043_0050418 Ga0501043_0050418_32_916 255
637 3300049579 Ga0501043_0070018 Ga0501043_0070018_768_1652 255
638 3300049579 Ga0501043_0078164 Ga0501043_0078164_1222_2106 255
639 3300049579 Ga0501043_0347948 Ga0501043_0347948_14_892 255
640 3300049581 Ga0501047_0002382 Ga0501047_0002382_2124_3011 255
641 3300049581 Ga0501047_0020241 Ga0501047_0020241_3380_4264 255
642 3300049583 Ga0501067_0034138 Ga0501067_0034138_359_1243 255
643 3300049584 Ga0501068_0109300 Ga0501068_0109300_392_1276 255
644 3300049585 Ga0501069_0000022 Ga0501069_0000022_28512_29396 255
645 3300049585 Ga0501069_0019058 Ga0501069_0019058_678_1562 255
646 3300049586 Ga0501070_0000080 Ga0501070_0000080_52339_53223 255
647 3300049586 Ga0501070_0000959 Ga0501070_0000959_12888_13772 255
648 3300049586 Ga0501070_0001852 Ga0501070_0001852_9813_10697 255
649 3300049586 Ga0501070_0015205 Ga0501070_0015205_1937_2824 255
650 3300049586 Ga0501070_0018469 Ga0501070_0018469_3937_4821 255
651 3300049586 Ga0501070_0051224 Ga0501070_0051224_1803_2687 255
652 3300049587 Ga0501071_0005859 Ga0501071_0005859_6122_7006 255
653 3300049587 Ga0501071_0481869 Ga0501071_0481869_11_808 255
654 3300049590 Ga0501074_0000046 Ga0501074_0000046_28897_29781 255
655 3300049590 Ga0501074_0054577 Ga0501074_0054577_1655_2539 255
656 3300049590 Ga0501074_0313937 Ga0501074_0313937_195_1079 255
657 3300049741 Ga0501079_0094167 Ga0501079_0094167_1377_2261 255
658 3300049742 Ga0501080_0012437 Ga0501080_0012437_51_935 255
659 3300049742 Ga0501080_0032758 Ga0501080_0032758_3793_4677 255
660 3300049742 Ga0501080_0058370 Ga0501080_0058370_664_1548 255
661 3300049744 Ga0501083_0000050 Ga0501083_0000050_79462_80346 255
662 3300049822 Ga0501035_0000035 Ga0501035_0000035_41287_42174 255
663 3300049822 Ga0501035_0000119 Ga0501035_0000119_70327_71208 255
664 3300049822 Ga0501035_0000987 Ga0501035_0000987_28512_29396 255
665 3300049822 Ga0501035_0002532 Ga0501035_0002532_10126_11010 255
666 3300049822 Ga0501035_0004371 Ga0501035_0004371_6083_6961 255
667 3300049822 Ga0501035_0006637 Ga0501035_0006637_2115_2999 255
668 3300049822 Ga0501035_0012543 Ga0501035_0012543_6617_7501 255
669 3300049822 Ga0501035_0013334 Ga0501035_0013334_4551_5435 255
670 3300049822 Ga0501035_0029131 Ga0501035_0029131_994_1872 255
671 3300049822 Ga0501035_0038863 Ga0501035_0038863_3058_3942 255
672 3300049823 Ga0501044_0000015 Ga0501044_0000015_124743_125630 255
673 3300049823 Ga0501044_0001241 Ga0501044_0001241_28512_29396 255
674 3300049823 Ga0501044_0008520 Ga0501044_0008520_8043_8927 255
675 3300049823 Ga0501044_0022134 Ga0501044_0022134_5787_6665 255
676 3300049823 Ga0501044_0083386 Ga0501044_0083386_1211_2095 255
677 3300049823 Ga0501044_0141066 Ga0501044_0141066_1403_2287 255
678 3300049823 Ga0501044_0240028 Ga0501044_0240028_713_1597 255
679 3300049823 Ga0501044_0406365 Ga0501044_0406365_365_1249 255
680 3300050489 nmdc:mga03683_50674_c1 nmdc:mga03683_50674_c1_106_987 255
681 3300050490 nmdc:mga03n38_10030_c1 nmdc:mga03n38_10030_c1_858_1739 255
682 3300050490 nmdc:mga03n38_45018_c1 nmdc:mga03n38_45018_c1_1059_1853 255
683 3300050492 nmdc:mga0yw44_10491_c1 nmdc:mga0yw44_10491_c1_2398_3279 255
684 3300050492 nmdc:mga0yw44_17242_c1 nmdc:mga0yw44_17242_c1_2934_3815 255
685 3300050492 nmdc:mga0yw44_92717_c1 nmdc:mga0yw44_92717_c1_519_1400 255
686 3300050495 nmdc:mga04h51_25402_c1 nmdc:mga04h51_25402_c1_833_1714 255
687 3300050496 nmdc:mga07m45_21624_c1 nmdc:mga07m45_21624_c1_111_992 255
688 3300050516 nmdc:mga0sz30_56716_c1 nmdc:mga0sz30_56716_c1_523_1404 255
689 3300053079 Ga0500610_0067435 Ga0500610_0067435_749_1627 255
690 3300053109 Ga0500569_005761 Ga0500569_005761_157_1035 255
691 3300053118 Ga0500594_0002711 Ga0500594_0002711_1421_2299 255
692 3300053125 Ga0500618_000007 Ga0500618_000007_223328_224206 255
693 3300053125 Ga0500618_004183 Ga0500618_004183_2190_3092 255
694 3300053134 Ga0500658_0001052 Ga0500658_0001052_2112_2990 255
695 3300053139 Ga0500568_0000563 Ga0500568_0000563_2550_3440 255
696 3300053139 Ga0500568_0001297 Ga0500568_0001297_1013_1891 255
697 3300053140 Ga0500573_0008390 Ga0500573_0008390_2615_3493 255
698 3300053153 Ga0500616_0004523 Ga0500616_0004523_8327_9205 255
699 3300053156 Ga0500622_0001715 Ga0500622_0001715_13961_14839 255
700 3300053161 Ga0500634_0001101 Ga0500634_0001101_2094_2972 255
701 3300059492 Ga0587073_0028422 Ga0587073_0028422_110_988 255
702 3300059493 Ga0587077_004431 Ga0587077_004431_22_912 255
703 3300059504 Ga0587082_019244 Ga0587082_019244_10_888 255
704 3300059508 Ga0587088_001214 Ga0587088_001214_37_915 255
705 3300059622 Ga0587099_006668 Ga0587099_006668_75_953 255
706 3300059630 Ga0587128_006185 Ga0587128_006185_60_941 255
707 3300059630 Ga0587128_016436 Ga0587128_016436_95_973 255
708 3300059640 Ga0587067_019132 Ga0587067_019132_63_944 255
709 3300059644 Ga0587075_016176 Ga0587075_016176_38_916 255
710 3300060353 Ga0501082_0082812 Ga0501082_0082812_67_951 255
711 iso_pu_bacteria 2503198000 2503203667 255
712 iso_pu_bacteria 2508501122 2509107311 255
713 iso_pu_bacteria 2508501123 2509113969 255
714 iso_pu_bacteria 2508501127 2509141105 255
715 iso_pu_bacteria 2509276018 2509370850 255
716 iso_pu_bacteria 2509276019 2509374723 255
717 iso_pu_bacteria 2509276021 2509388177 255
718 iso_pu_bacteria 2509276022 2509398034 255
719 iso_pu_bacteria 2509276033 2509443770 255
720 iso_pu_bacteria 2510065019 2510131713 255
721 iso_pu_bacteria 2510065057 2510304992 255
722 iso_pu_bacteria 2510065059 2510316603 255
723 iso_pu_bacteria 2510461069 2510842250 255
724 iso_pu_bacteria 2510461076 2510898007 255
725 iso_pu_bacteria 2510917022 2511133941 255
726 iso_pu_bacteria 2510917028 2511183601 255
727 iso_pu_bacteria 2510917030 2511196172 255
728 iso_pu_bacteria 2511231027 2511392879 255
729 iso_pu_bacteria 2511231052 2511500786 255
730 iso_pu_bacteria 2512047086 2512532200 255
731 iso_pu_bacteria 2512875016 2512929522 255
732 iso_pu_bacteria 2512875024 2512964316 255
733 iso_pu_bacteria 2512875026 2512972462 255
734 iso_pu_bacteria 2513237084 2513571289 255
735 iso_pu_bacteria 2513237085 2513579177 255
736 iso_pu_bacteria 2513237086 2513584979 255
737 iso_pu_bacteria 2513237088 2513598692 255
738 iso_pu_bacteria 2513237089 2513605485 255
739 iso_pu_bacteria 2513237090 2513608131 255
740 iso_pu_bacteria 2513237091 2513616724 255
741 iso_pu_bacteria 2513237093 2513632384 255
742 iso_pu_bacteria 2513237103 2513711710 255
743 iso_pu_bacteria 2513237138 2513866268 255
744 iso_pu_bacteria 2513237140 2513880862 255
745 iso_pu_bacteria 2513237143 2513903856 255
746 iso_pu_bacteria 2513237146 2513927546 255
747 iso_pu_bacteria 2513237156 2513984871 255
748 iso_pu_bacteria 2513237159 2513999961 255
749 iso_pu_bacteria 2513237160 2514007460 255
750 iso_pu_bacteria 2513237162 2514024973 255
751 iso_pu_bacteria 2513237164 2514033933 255
752 iso_pu_bacteria 2513237305 2514422924 255
753 iso_pu_bacteria 2513237351 2514591509 255
754 iso_pu_bacteria 2515075009 2515110650 255
755 iso_pu_bacteria 2515154107 2515607916 255
756 iso_pu_bacteria 2515154113 2515638687 255
757 iso_pu_bacteria 2515154114 2515645898 255
758 iso_pu_bacteria 2515154116 2515660622 255
759 iso_pu_bacteria 2515154134 2515742867 255
760 iso_pu_bacteria 2516143018 2516208661 255
761 iso_pu_bacteria 2516653046 2516892057 255
762 iso_pu_bacteria 2516653077 2517039351 255
763 iso_pu_bacteria 2516653085 2517079570 255
764 iso_pu_bacteria 2517093000 2517093521 255
765 iso_pu_bacteria 2517287029 2517405223 255
766 iso_pu_bacteria 2517487022 2517568873 255
767 iso_pu_bacteria 2519899620 2520376644 255
768 iso_pu_bacteria 2524023207 2524450110 255
769 iso_pu_bacteria 2524023209 2524457717 255
770 iso_pu_bacteria 2529292951 2530647585 255
771 iso_pu_bacteria 2534681786 2535484233 255
772 iso_pu_bacteria 2534681796 2535515293 255
773 iso_pu_bacteria 2551306084 2551680137 255
774 iso_pu_bacteria 2551306085 2551684233 255
775 iso_pu_bacteria 2551306086 2551694415 255
776 iso_pu_bacteria 2551306087 2551700152 255
777 iso_pu_bacteria 2551306089 2551711614 255
778 iso_pu_bacteria 2551306090 2551717664 255
779 iso_pu_bacteria 2551306091 2551728981 255
780 iso_pu_bacteria 2551306093 2551745667 255
781 iso_pu_bacteria 2558860100 2558863715 255
782 iso_pu_bacteria 2558860983 2561467241 255
783 iso_pu_bacteria 2582581283 2585165233 255
784 iso_pu_bacteria 2582581294 2585204074 255
785 iso_pu_bacteria 2582581298 2585225661 255
786 iso_pu_bacteria 2582581299 2585229185 255
787 iso_pu_bacteria 2582581304 2585256982 255
788 iso_pu_bacteria 2582581306 2585266553 255
789 iso_pu_bacteria 2582581307 2585275242 255
790 iso_pu_bacteria 2582581308 2585282016 255
791 iso_pu_bacteria 2582581315 2585325782 255
792 iso_pu_bacteria 2582581316 2585329950 255
793 iso_pu_bacteria 2582581865 2585387569 255
794 iso_pu_bacteria 2582581866 2585394174 255
795 iso_pu_bacteria 2582581867 2585403876 255
796 iso_pu_bacteria 2585427526 2585528519 255
797 iso_pu_bacteria 2585427527 2585536333 255
798 iso_pu_bacteria 2585427529 2585548064 255
799 iso_pu_bacteria 2585427530 2585554206 255
800 iso_pu_bacteria 2585427531 2585560315 255
801 iso_pu_bacteria 2585427590 2585824369 255
802 iso_pu_bacteria 2585427594 2585844421 255
803 iso_pu_bacteria 2585427608 2585901416 255
804 iso_pu_bacteria 2585427609 2585905500 255
805 iso_pu_bacteria 2585428125 2587979385 255
806 iso_pu_bacteria 2597489875 2597815807 255
807 iso_pu_bacteria 2599185170 2599418977 255
808 iso_pu_bacteria 2599185236 2599719353 255
809 iso_pu_bacteria 2599185301 2599938669 255
810 iso_pu_bacteria 2599185352 2600191661 255
811 iso_pu_bacteria 2615840624 2616295887 255
812 iso_pu_bacteria 2615840626 2616306125 255
813 iso_pu_bacteria 2615840698 2616553619 255
814 iso_pu_bacteria 2617270742 2617382667 255
815 iso_pu_bacteria 2643221550 2643773937 255
816 iso_pu_bacteria 2643221551 2643774699 255
817 iso_pu_bacteria 2643221555 2643793144 255
818 iso_pu_bacteria 2643221557 2643807483 255
819 iso_pu_bacteria 2643221568 2643856179 255
820 iso_pu_bacteria 2643221595 2643989131 255
821 iso_pu_bacteria 2643221599 2644007547 255
822 iso_pu_bacteria 2643221607 2644046913 255
823 iso_pu_bacteria 2643221610 2644069894 255
824 iso_pu_bacteria 2643221618 2644109278 255
825 iso_pu_bacteria 2643221626 2644151799 255
826 iso_pu_bacteria 2643221627 2644152328 255
827 iso_pu_bacteria 2643221634 2644190800 255
828 iso_pu_bacteria 2643221636 2644203648 255
829 iso_pu_bacteria 2643221637 2644206485 255
830 iso_pu_bacteria 2643221653 2644297310 255
831 iso_pu_bacteria 2643221655 2644311933 255
832 iso_pu_bacteria 2643221659 2644330206 255
833 iso_pu_bacteria 2643221668 2644380866 255
834 iso_pu_bacteria 2643221675 2644414770 255
835 iso_pu_bacteria 2643221680 2644448427 255
836 iso_pu_bacteria 2643221686 2644479702 255
837 iso_pu_bacteria 2643221688 2644493651 255
838 iso_pu_bacteria 2643221698 2644543040 255
839 iso_pu_bacteria 2643221712 2644617731 255
840 iso_pu_bacteria 2643221718 2644650132 255
841 iso_pu_bacteria 2643221719 2644655562 255
842 iso_pu_bacteria 2643221723 2644673825 255
843 iso_pu_bacteria 2643221726 2644689266 255
844 iso_pu_bacteria 2667528174 2671112568 255
845 iso_pu_bacteria 2687453392 2688600430 255
846 iso_pu_bacteria 2690316117 2692317051 255
847 iso_pu_bacteria 2693429783 2694632591 255
848 iso_pu_bacteria 2693429784 2694639680 255
849 iso_pu_bacteria 2718217882 2719179786 255
850 iso_pu_bacteria 2718217927 2719384392 255
851 iso_pu_bacteria 2718217997 2719664138 255
852 iso_pu_bacteria 2718218009 2719730456 255
853 iso_pu_bacteria 2718218199 2720490557 255
854 iso_pu_bacteria 2718218232 2720611937 255
855 iso_pu_bacteria 2718218233 2720618791 255
856 iso_pu_bacteria 2718218235 2720630191 255
857 iso_pu_bacteria 2718218269 2720773886 255
858 iso_pu_bacteria 2718218363 2721145879 255
859 iso_pu_bacteria 2718218365 2721157416 255
860 iso_pu_bacteria 2718218366 2721162758 255
861 iso_pu_bacteria 2718218423 2721398106 255
862 iso_pu_bacteria 2721755514 2722838928 255
863 iso_pu_bacteria 2721755556 2723025556 255
864 iso_pu_bacteria 2721755684 2723559141 255
865 iso_pu_bacteria 2721755685 2723565746 255
866 iso_pu_bacteria 2721755686 2723577708 255
867 iso_pu_bacteria 2721755809 2724036916 255
868 iso_pu_bacteria 2721755810 2724043212 255
869 iso_pu_bacteria 2721755819 2724088493 255
870 iso_pu_bacteria 2721755822 2724103011 255
871 iso_pu_bacteria 2721755823 2724108873 255
872 iso_pu_bacteria 2724679232 2725952121 255
873 iso_pu_bacteria 2728369352 2730106492 255
874 iso_pu_bacteria 2728369365 2730163023 255
875 iso_pu_bacteria 2728369397 2730297048 255
876 iso_pu_bacteria 2738541293 2738802403 255
877 iso_pu_bacteria 2738541317 2738945822 255
878 iso_pu_bacteria 2738543024 2739308650 255
879 iso_pu_bacteria 2751185800 2753358831 255
880 iso_pu_bacteria 2756170246 2756673012 255
881 iso_pu_bacteria 2757320392 2757569458 255
882 iso_pu_bacteria 2758568016 2758641064 255
883 iso_pu_bacteria 2765235802 2765469093 255
884 iso_pu_bacteria 2767802442 2770194899 255
885 iso_pu_bacteria 2775506902 2776272318 255
886 iso_pu_bacteria 2775506904 2776284257 255
887 iso_pu_bacteria 2775507266 2778174369 255
888 iso_pu_bacteria 2791355082 2792583946 255
889 iso_pu_bacteria 2791355091 2792622253 255
890 iso_pu_bacteria 2791355092 2792628182 255
891 iso_pu_bacteria 2791355094 2792638564 255
892 iso_pu_bacteria 2791355123 2792753124 255
893 iso_pu_bacteria 2791355256 2793299330 255
894 iso_pu_bacteria 2791355259 2793315213 255
895 iso_pu_bacteria 2791355260 2793320068 255
896 iso_pu_bacteria 2791355261 2793328306 255
897 iso_pu_bacteria 2791355262 2793332649 255
898 iso_pu_bacteria 2791355263 2793342895 255
899 iso_pu_bacteria 2791355264 2793350564 255
900 iso_pu_bacteria 2791355265 2793353168 255
901 iso_pu_bacteria 2791355266 2793360972 255
902 iso_pu_bacteria 2791355267 2793364904 255
903 iso_pu_bacteria 2802428858 2802717514 255
904 iso_pu_bacteria 2802428859 2802723557 255
905 iso_pu_bacteria 2802428860 2802730993 255
906 iso_pu_bacteria 2802428861 2802735999 255
907 iso_pu_bacteria 2802428862 2802743792 255
908 iso_pu_bacteria 2802428863 2802752991 255
909 iso_pu_bacteria 2802429605 2805927366 255
910 iso_pu_bacteria 2802429606 2805936405 255
911 iso_pu_bacteria 2818991272 2819242979 255
912 iso_pu_bacteria 2818991448 2819608202 255
913 iso_pu_bacteria 2818991453 2819639554 255
914 iso_pu_bacteria 2821123053 2821123846 255
915 iso_pu_bacteria 2837651117 2837652382 255
916 iso_pu_bacteria 2838016132 2838021772 255
917 iso_pu_bacteria 2838022645 2838026532 255
918 iso_pu_bacteria 2838029111 2838035184 255
919 iso_pu_bacteria 2838035591 2838037336 255
920 iso_pu_bacteria 2838042994 2838047309 255
921 iso_pu_bacteria 2838048938 2838054840 255
922 iso_pu_bacteria 2838061910 2838067495 255
923 iso_pu_bacteria 2838068647 2838074033 255
924 iso_pu_bacteria 2838074704 2838076194 255
925 iso_pu_bacteria 2838661181 2838663478 255
926 iso_pu_bacteria 2838668709 2838673414 255
927 iso_pu_bacteria 2838680041 2838680814 255
928 iso_pu_bacteria 2838686498 2838692306 255
929 iso_pu_bacteria 2838694306 2838695153 255
930 iso_pu_bacteria 2838701080 2838705903 255
931 iso_pu_bacteria 2838707686 2838708529 255
932 iso_pu_bacteria 2838729681 2838732598 255
933 iso_pu_bacteria 2838736955 2838739125 255
934 iso_pu_bacteria 2838742623 2838745493 255
935 iso_pu_bacteria 2839993093 2839994451 255
936 iso_pu_bacteria 2840764183 2840764985 255
937 iso_pu_bacteria 2841734538 2841735075 255
938 iso_pu_bacteria 2841840854 2841843023 255
939 iso_pu_bacteria 2841851746 2841855137 255
940 iso_pu_bacteria 2841864319 2841866586 255
941 iso_pu_bacteria 2842077413 2842080237 255
942 iso_pu_bacteria 2842118031 2842120856 255
943 iso_pu_bacteria 2842140634 2842142805 255
944 iso_pu_bacteria 2842146304 2842150755 255
945 iso_pu_bacteria 2842156927 2842161833 255
946 iso_pu_bacteria 2842163707 2842169211 255
947 iso_pu_bacteria 2842180545 2842185450 255
948 iso_pu_bacteria 2842192696 2842193121 255
949 iso_pu_bacteria 2842198810 2842203135 255
950 iso_pu_bacteria 2842205361 2842206717 255
951 iso_pu_bacteria 2842217011 2842218560 255
952 iso_pu_bacteria 2842229732 2842233388 255
953 iso_pu_bacteria 2842237096 2842237941 255
954 iso_pu_bacteria 2842243621 2842249682 255
955 iso_pu_bacteria 2842250916 2842255624 255
956 iso_pu_bacteria 2842257432 2842261751 255
957 iso_pu_bacteria 2842264693 2842267223 255
958 iso_pu_bacteria 2842271015 2842276775 255
959 iso_pu_bacteria 2842278818 2842280590 255
960 iso_pu_bacteria 2842285085 2842289544 255
961 iso_pu_bacteria 2842291075 2842293896 255
962 iso_pu_bacteria 2842298080 2842300668 255
963 iso_pu_bacteria 2842304105 2842306257 255
964 iso_pu_bacteria 2842311132 2842315932 255
965 iso_pu_bacteria 2842317721 2842322300 255
966 iso_pu_bacteria 2842341865 2842342836 255
967 iso_pu_bacteria 2842357229 2842358214 255
968 iso_pu_bacteria 2842363717 2842369463 255
969 iso_pu_bacteria 2842370503 2842371277 255
970 iso_pu_bacteria 2842377471 2842380292 255
971 iso_pu_bacteria 2842384541 2842387364 255
972 iso_pu_bacteria 2842395702 2842400779 255
973 iso_pu_bacteria 2842402390 2842406892 255
974 iso_pu_bacteria 2842409023 2842413611 255
975 iso_pu_bacteria 2842415677 2842420426 255
976 iso_pu_bacteria 2842422224 2842427661 255
977 iso_pu_bacteria 2842428310 2842431526 255
978 iso_pu_bacteria 2842434925 2842437861 255
979 iso_pu_bacteria 2842441272 2842444675 255
980 iso_pu_bacteria 2842447887 2842450432 255
981 iso_pu_bacteria 2842462802 2842465497 255
982 iso_pu_bacteria 2842469257 2842472307 255
983 iso_pu_bacteria 2842475841 2842481968 255
984 iso_pu_bacteria 2842482326 2842482551 255
985 iso_pu_bacteria 2842489311 2842495197 255
986 iso_pu_bacteria 2842495871 2842501038 255
987 iso_pu_bacteria 2842502639 2842508843 255
988 iso_pu_bacteria 2842509118 2842509404 255
989 iso_pu_bacteria 2842521101 2842526537 255
990 iso_pu_bacteria 2842871566 2842873656 255
991 iso_pu_bacteria 2844002411 2844005473 255
992 iso_pu_bacteria 2844009547 2844015752 255
993 iso_pu_bacteria 2844163670 2844163705 255
994 iso_pu_bacteria 2844454524 2844455752 255
995 iso_pu_bacteria 2847417321 2847417879 255
996 iso_pu_bacteria 2847670302 2847672100 255
997 iso_pu_bacteria 2848992105 2848992721 255
998 iso_pu_bacteria 2850079185 2850080248 255
999 iso_pu_bacteria 2852387548 2852388726 255
1000 iso_pu_bacteria 2854911287 2854914403 255
1001 iso_pu_bacteria 2854916844 2854917740 255
1002 iso_pu_bacteria 2855825444 2855831978 255
1003 iso_pu_bacteria 2855839649 2855840263 255
1004 iso_pu_bacteria 2855872281 2855873273 255
1005 iso_pu_bacteria 2856314179 2856318090 255
1006 iso_pu_bacteria 2856320880 2856326626 255
1007 iso_pu_bacteria 2856328259 2856330863 255
1008 iso_pu_bacteria 2856334872 2856339891 255
1009 iso_pu_bacteria 2856342000 2856344557 255
1010 iso_pu_bacteria 2856349417 2856352117 255
1011 iso_pu_bacteria 2856356410 2856357817 255
1012 iso_pu_bacteria 2856364286 2856365379 255
1013 iso_pu_bacteria 2857349434 2857354808 255
1014 iso_pu_bacteria 2857367948 2857369176 255
1015 iso_pu_bacteria 2857531043 2857531408 255
1016 iso_pu_bacteria 2858800743 2858800795 255
1017 iso_pu_bacteria 2869162929 2869168201 255
1018 iso_pu_bacteria 2869169390 2869174408 255
1019 iso_pu_bacteria 2869234852 2869239975 255
1020 iso_pu_bacteria 2869242130 2869245758 255
1021 iso_pu_bacteria 2869249662 2869250632 255
1022 iso_pu_bacteria 2869256925 2869261498 255
1023 iso_pu_bacteria 2869264136 2869266638 255
1024 iso_pu_bacteria 2869271264 2869271764 255
1025 iso_pu_bacteria 2869278585 2869280260 255
1026 iso_pu_bacteria 2869285874 2869289290 255
1027 iso_pu_bacteria 2871429161 2871431358 255
1028 iso_pu_bacteria 2871435913 2871438640 255
1029 iso_pu_bacteria 2871444079 2871449511 255
1030 iso_pu_bacteria 2871451962 2871455234 255
1031 iso_pu_bacteria 2871459585 2871463357 255
1032 iso_pu_bacteria 2871466892 2871468773 255
1033 iso_pu_bacteria 2871474448 2871478063 255
1034 iso_pu_bacteria 2871481445 2871488329 255
1035 iso_pu_bacteria 2871488783 2871492784 255
1036 iso_pu_bacteria 2871495908 2871497346 255
1037 iso_pu_bacteria 2874102143 2874106893 255
1038 iso_pu_bacteria 2874109183 2874109395 255
1039 iso_pu_bacteria 2874116593 2874119791 255
1040 iso_pu_bacteria 2874123672 2874125331 255
1041 iso_pu_bacteria 2874131515 2874133005 255
1042 iso_pu_bacteria 2874139085 2874144368 255
1043 iso_pu_bacteria 2874146452 2874148557 255
1044 iso_pu_bacteria 2874155637 2874156301 255
1045 iso_pu_bacteria 2874162495 2874166686 255
1046 iso_pu_bacteria 2874168670 2874173203 255
1047 iso_pu_bacteria 2876363079 2876366918 255
1048 iso_pu_bacteria 2876369609 2876376710 255
1049 iso_pu_bacteria 2876377896 2876378211 255
1050 iso_pu_bacteria 2876386047 2876387120 255
1051 iso_pu_bacteria 2876392853 2876398884 255
1052 iso_pu_bacteria 2876399893 2876404558 255
1053 iso_pu_bacteria 2876406927 2876410382 255
1054 iso_pu_bacteria 2876413966 2876415336 255
1055 iso_pu_bacteria 2876420981 2876421895 255
1056 iso_pu_bacteria 2878035449 2878037348 255
1057 iso_pu_bacteria 2878730984 2878736288 255
1058 iso_pu_bacteria 2878738818 2878744255 255
1059 iso_pu_bacteria 2878745973 2878747962 255
1060 iso_pu_bacteria 2878753008 2878758665 255
1061 iso_pu_bacteria 2878760144 2878761564 255
1062 iso_pu_bacteria 2878767105 2878768531 255
1063 iso_pu_bacteria 2878774303 2878776403 255
1064 iso_pu_bacteria 2878781027 2878787368 255
1065 iso_pu_bacteria 2878788777 2878794058 255
1066 iso_pu_bacteria 2881147464 2881154025 255
1067 iso_pu_bacteria 2881155292 2881157773 255
1068 iso_pu_bacteria 2881161766 2881163101 255
1069 iso_pu_bacteria 2881845957 2881846212 255
1070 iso_pu_bacteria 2881853255 2881856099 255
1071 iso_pu_bacteria 2881861095 2881866902 255
1072 iso_pu_bacteria 2882632389 2882640031 255
1073 iso_pu_bacteria 2882912400 2882914689 255
1074 iso_pu_bacteria 2885305155 2885312060 255
1075 iso_pu_bacteria 2885312484 2885315859 255
1076 iso_pu_bacteria 2885318864 2885319868 255
1077 iso_pu_bacteria 2885326080 2885332979 255
1078 iso_pu_bacteria 2885334103 2885339975 255
1079 iso_pu_bacteria 2885350715 2885354910 255
1080 iso_pu_bacteria 2888337043 2888341806 255
1081 iso_pu_bacteria 2888343758 2888349098 255
1082 iso_pu_bacteria 2888350351 2888351030 255
1083 iso_pu_bacteria 2889010040 2889013418 255
1084 iso_pu_bacteria 2889016732 2889021864 255
1085 iso_pu_bacteria 2891048133 2891050720 255
1086 iso_pu_bacteria 2891373044 2891376342 255
1087 iso_pu_bacteria 2894652903 2894655181 255
1088 iso_pu_bacteria 2894817345 2894817917 255
1089 iso_pu_bacteria 2896384573 2896385326 255
1090 iso_pu_bacteria 2903448605 2903453616 255
1091 iso_pu_bacteria 2903492973 2903496484 255
1092 iso_pu_bacteria 2903492973 2903505962 255
1093 iso_pu_bacteria 2903513507 2903520733 255
1094 iso_pu_bacteria 2903521522 2903524785 255
1095 iso_pu_bacteria 2903528002 2903530972 255
1096 iso_pu_bacteria 2903540706 2903542141 255
1097 iso_pu_bacteria 2904578770 2904578896 255
1098 iso_pu_bacteria 2904659560 2904665416 255
1099 iso_pu_bacteria 2906308376 2906311580 255
1100 iso_pu_bacteria 2906321335 2906323320 255
1101 iso_pu_bacteria 2906328253 2906331588 255
1102 iso_pu_bacteria 2906354277 2906355815 255
1103 iso_pu_bacteria 2906370794 2906377026 255
1104 iso_pu_bacteria 2906378014 2906385647 255
1105 iso_pu_bacteria 2906386501 2906390298 255
1106 iso_pu_bacteria 2906393657 2906398327 255
1107 iso_pu_bacteria 2906401398 2906404198 255
1108 iso_pu_bacteria 2906408224 2906409895 255
1109 iso_pu_bacteria 2906414383 2906418127 255
1110 iso_pu_bacteria 2906427513 2906434672 255
1111 iso_pu_bacteria 2913308742 2913310495 255
1112 iso_pu_bacteria 2915980308 2915982225 255
1113 iso_pu_bacteria 2915986958 2915991636 255
1114 iso_pu_bacteria 2915993759 2915998007 255
1115 iso_pu_bacteria 2916000859 2916005784 255
1116 iso_pu_bacteria 2916007675 2916008520 255
1117 iso_pu_bacteria 2916014648 2916020331 255
1118 iso_pu_bacteria 2916021584 2916023494 255
1119 iso_pu_bacteria 2916028427 2916034487 255
1120 iso_pu_bacteria 2916035215 2916035233 255
1121 iso_pu_bacteria 2916041962 2916045539 255
1122 iso_pu_bacteria 2916048683 2916051209 255
1123 iso_pu_bacteria 2916055098 2916059994 255
1124 iso_pu_bacteria 2916061851 2916062560 255
1125 iso_pu_bacteria 2916068649 2916070229 255
1126 iso_pu_bacteria 2916076590 2916081792 255
1127 iso_pu_bacteria 2919100787 2919101136 255
1128 iso_pu_bacteria 2919119836 2919122277 255
1129 iso_pu_bacteria 2919166419 2919167054 255
1130 iso_pu_bacteria 2919408235 2919409001 255
1131 iso_pu_bacteria 2920760137 2920763119 255
1132 iso_pu_bacteria 2920822456 2920823587 255
1133 iso_pu_bacteria 2921201388 2921207699 255
1134 iso_pu_bacteria 2921208531 2921214492 255
1135 iso_pu_bacteria 2921237296 2921240493 255
1136 iso_pu_bacteria 2921244191 2921249998 255
1137 iso_pu_bacteria 2921250672 2921250780 255
1138 iso_pu_bacteria 2921257292 2921261132 255
1139 iso_pu_bacteria 2921263974 2921269237 255
1140 iso_pu_bacteria 2921282425 2921283797 255
1141 iso_pu_bacteria 2921289301 2921295030 255
1142 iso_pu_bacteria 2922130491 2922131466 255
1143 iso_pu_bacteria 2922151315 2922158132 255
1144 iso_pu_bacteria 2922158528 2922164428 255
1145 iso_pu_bacteria 2922172374 2922176362 255
1146 iso_pu_bacteria 2922178524 2922181616 255
1147 iso_pu_bacteria 2922185730 2922188830 255
1148 iso_pu_bacteria 2923556063 2923557399 255
1149 iso_pu_bacteria 2924144063 2924147041 255
1150 iso_pu_bacteria 2924150972 2924158131 255
1151 iso_pu_bacteria 2924158325 2924160389 255
1152 iso_pu_bacteria 2924165586 2924166189 255
1153 iso_pu_bacteria 2924172951 2924178667 255
1154 iso_pu_bacteria 2924179722 2924180269 255
1155 iso_pu_bacteria 2924186466 2924191676 255
1156 iso_pu_bacteria 2924193448 2924198526 255
1157 iso_pu_bacteria 2924200457 2924204508 255
1158 iso_pu_bacteria 2924207177 2924207543 255
1159 iso_pu_bacteria 2924214083 2924220035 255
1160 iso_pu_bacteria 2924221636 2924222798 255
1161 iso_pu_bacteria 2924228884 2924231334 255
1162 iso_pu_bacteria 2924710171 2924716006 255
1163 iso_pu_bacteria 2924718760 2924724824 255
1164 iso_pu_bacteria 2924726620 2924728481 255
1165 iso_pu_bacteria 2924733363 2924738601 255
1166 iso_pu_bacteria 2924741084 2924743189 255
1167 iso_pu_bacteria 2924748358 2924753987 255
1168 iso_pu_bacteria 2924754689 2924760897 255
1169 iso_pu_bacteria 2924762789 2924764327 255
1170 iso_pu_bacteria 2924776078 2924782173 255
1171 iso_pu_bacteria 2924784321 2924788399 255
1172 iso_pu_bacteria 2928521798 2928526235 255
1173 iso_pu_bacteria 2933016740 2933017692 255
1174 iso_pu_bacteria 2933570622 2933573326 255
1175 iso_pu_bacteria 2933599457 2933604455 255
1176 iso_pu_bacteria 2935894831 2935895676 255
1177 iso_pu_bacteria 2935901341 2935907369 255
1178 iso_pu_bacteria 2936381700 2936383870 255
1179 iso_pu_bacteria 2936996657 2936999262 255
1180 iso_pu_bacteria 2937002841 2937003272 255
1181 iso_pu_bacteria 2937009748 2937010576 255
1182 iso_pu_bacteria 2937016420 2937016857 255
1183 iso_pu_bacteria 2937023124 2937028108 255
1184 iso_pu_bacteria 2937029754 2937030043 255
1185 iso_pu_bacteria 2937036028 2937037963 255
1186 iso_pu_bacteria 2937042894 2937049268 255
1187 iso_pu_bacteria 2937049772 2937050787 255
1188 iso_pu_bacteria 2937056579 2937057061 255
1189 iso_pu_bacteria 2937063883 2937066596 255
1190 iso_pu_bacteria 2937071275 2937075180 255
1191 iso_pu_bacteria 2937078374 2937080120 255
1192 iso_pu_bacteria 2937084907 2937091770 255
1193 iso_pu_bacteria 2937091812 2937097700 255
1194 iso_pu_bacteria 2937098957 2937103138 255
1195 iso_pu_bacteria 2937106411 2937112606 255
1196 iso_pu_bacteria 2937113482 2937119674 255
1197 iso_pu_bacteria 2937119839 2937120962 255
1198 iso_pu_bacteria 2937126314 2937130269 255
1199 iso_pu_bacteria 2937813078 2937818600 255
1200 iso_pu_bacteria 2937822353 2937828487 255
1201 iso_pu_bacteria 2937836603 2937838771 255
1202 iso_pu_bacteria 2937848649 2937850567 255
1203 iso_pu_bacteria 2937861824 2937868069 255
1204 iso_pu_bacteria 2937868953 2937873984 255
1205 iso_pu_bacteria 2937877337 2937877698 255
1206 iso_pu_bacteria 2937891427 2937897534 255
1207 iso_pu_bacteria 2937972304 2937977770 255
1208 iso_pu_bacteria 2937980651 2937986079 255
1209 iso_pu_bacteria 2937994558 2937995996 255
1210 iso_pu_bacteria 2938014810 2938022534 255
1211 iso_pu_bacteria 2941499720 2941500511 255
1212 iso_pu_bacteria 2954011201 2954014868 255
1213 iso_pu_bacteria 2957375807 2957379041 255
1214 iso_pu_bacteria 2957382221 2957385253 255
1215 iso_pu_bacteria 2957388812 2957389316 255
1216 iso_pu_bacteria 2957395598 2957396995 255
1217 iso_pu_bacteria 2957402308 2957402790 255
1218 iso_pu_bacteria 2957408893 2957415097 255
1219 iso_pu_bacteria 2957415311 2957417277 255
1220 iso_pu_bacteria 2957422303 2957429984 255
1221 iso_pu_bacteria 2957430029 2957436513 255
1222 iso_pu_bacteria 2957437181 2957439459 255
1223 iso_pu_bacteria 2957443900 2957450026 255
1224 iso_pu_bacteria 2957450854 2957453302 255
1225 iso_pu_bacteria 2957457609 2957462040 255
1226 iso_pu_bacteria 2957464669 2957466331 255
1227 iso_pu_bacteria 2957471148 2957477421 255
1228 iso_pu_bacteria 2957478035 2957483847 255
1229 iso_pu_bacteria 2957484790 2957489757 255
1230 iso_pu_bacteria 2957491536 2957494296 255
1231 iso_pu_bacteria 2957498199 2957501429 255
1232 iso_pu_bacteria 2957505466 2957512122 255
1233 iso_pu_bacteria 2958034702 2958036129 255
1234 iso_pu_bacteria 2958041894 2958047553 255
1235 iso_pu_bacteria 2958064165 2958066220 255
1236 iso_pu_bacteria 2958071322 2958074490 255
1237 iso_pu_bacteria 2958084443 2958084805 255
1238 iso_pu_bacteria 2958092219 2958098122 255
1239 iso_pu_bacteria 2958100919 2958107220 255
1240 iso_pu_bacteria 2958108152 2958108492 255
1241 iso_pu_bacteria 2958115193 2958115753 255
1242 iso_pu_bacteria 2958122699 2958129207 255
1243 iso_pu_bacteria 2958130278 2958133666 255
1244 iso_pu_bacteria 2958137437 2958141390 255
1245 iso_pu_bacteria 2958144490 2958147457 255
1246 iso_pu_bacteria 2958158011 2958159292 255
1247 iso_pu_bacteria 2958165035 2958166467 255
1248 iso_pu_bacteria 2958172287 2958179855 255
1249 iso_pu_bacteria 2958179912 2958183310 255
1250 iso_pu_bacteria 2960584000 2960589185 255
1251 iso_pu_bacteria 2960591022 2960593792 255
1252 iso_pu_bacteria 2960597568 2960600759 255
1253 iso_pu_bacteria 2960603979 2960610743 255
1254 iso_pu_bacteria 2960610863 2960613916 255
1255 iso_pu_bacteria 2960617483 2960617520 255
1256 iso_pu_bacteria 2960624210 2960628687 255
1257 iso_pu_bacteria 2960631154 2960632899 255
1258 iso_pu_bacteria 2960637947 2960643472 255
1259 iso_pu_bacteria 2960645483 2960651506 255
1260 iso_pu_bacteria 2960652885 2960653414 255
1261 iso_pu_bacteria 2960660292 2960663319 255
1262 iso_pu_bacteria 2960667422 2960668548 255
1263 iso_pu_bacteria 2960674078 2960677635 255
1264 iso_pu_bacteria 2960680706 2960685665 255
1265 iso_pu_bacteria 2960687367 2960690485 255
1266 iso_pu_bacteria 2960693952 2960696196 255
1267 iso_pu_bacteria 2961077736 2961081277 255
1268 iso_pu_bacteria 2961114664 2961120416 255
1269 iso_pu_bacteria 2961127735 2961132247 255
1270 iso_pu_bacteria 2961136820 2961143494 255
1271 iso_pu_bacteria 2961163497 2961164932 255
1272 iso_pu_bacteria 2961170736 2961173140 255
1273 iso_pu_bacteria 2961183825 2961188689 255
1274 iso_pu_bacteria 2963644680 2963649711 255
1275 iso_pu_bacteria 2964607997 2964608606 255
1276 iso_pu_bacteria 2964615318 2964617925 255
1277 iso_pu_bacteria 2964621998 2964622969 255
1278 iso_pu_bacteria 2964628898 2964633416 255
1279 iso_pu_bacteria 2964636051 2964641998 255
1280 iso_pu_bacteria 2964643177 2964644339 255
1281 iso_pu_bacteria 2964649959 2964652919 255
1282 iso_pu_bacteria 2964656573 2964658128 255
1283 iso_pu_bacteria 2964663802 2964666157 255
1284 iso_pu_bacteria 2964670856 2964673468 255
1285 iso_pu_bacteria 2964678106 2964684661 255
1286 iso_pu_bacteria 2964685014 2964686228 255
1287 iso_pu_bacteria 2964691889 2964692769 255
1288 iso_pu_bacteria 2964698721 2964701997 255
1289 iso_pu_bacteria 2964705432 2964710450 255
1290 iso_pu_bacteria 2964712639 2964713517 255
1291 iso_pu_bacteria 2964719344 2964726524 255
1292 iso_pu_bacteria 2965018300 2965019757 255
1293 iso_pu_bacteria 2965025482 2965026339 255
1294 iso_pu_bacteria 2965032056 2965038767 255
1295 iso_pu_bacteria 2965040258 2965047500 255
1296 iso_pu_bacteria 2965047637 2965048501 255
1297 iso_pu_bacteria 2965062239 2965062536 255
1298 iso_pu_bacteria 2965089291 2965090945 255
1299 iso_pu_bacteria 2965102966 2965108469 255
1300 iso_pu_bacteria 2965110997 2965115749 255
1301 iso_pu_bacteria 2965119406 2965122626 255
1302 iso_pu_bacteria 2967664464 2967669338 255
1303 iso_pu_bacteria 2967671571 2967676559 255
1304 iso_pu_bacteria 2967678726 2967678740 255
1305 iso_pu_bacteria 2967686174 2967686239 255
1306 iso_pu_bacteria 2967693043 2967693061 255
1307 iso_pu_bacteria 2967699805 2967703724 255
1308 iso_pu_bacteria 2967706974 2967710595 255
1309 iso_pu_bacteria 2967714385 2967717576 255
1310 iso_pu_bacteria 2967721400 2967724674 255
1311 iso_pu_bacteria 2967728569 2967729790 255
1312 iso_pu_bacteria 2967735183 2967741082 255
1313 iso_pu_bacteria 2967742019 2967742708 255
1314 iso_pu_bacteria 2967748971 2967751895 255
1315 iso_pu_bacteria 2967755722 2967756584 255
1316 iso_pu_bacteria 2967762386 2967765226 255
1317 iso_pu_bacteria 2967769361 2967773240 255
1318 iso_pu_bacteria 2967775926 2967780751 255
1319 iso_pu_bacteria 2967996073 2967998311 255
1320 iso_pu_bacteria 2968003550 2968006263 255
1321 iso_pu_bacteria 2968016561 2968022235 255
1322 iso_pu_bacteria 2968083720 2968086980 255
1323 iso_pu_bacteria 2968091066 2968095612 255
1324 iso_pu_bacteria 2968097103 2968100151 255
1325 iso_pu_bacteria 2968110612 2968116883 255
1326 iso_pu_bacteria 2968117919 2968118608 255
1327 iso_pu_bacteria 2968128360 2968131959 255
1328 iso_pu_bacteria 2968138860 2968146023 255
1329 iso_pu_bacteria 2968171901 2968173332 255
1330 iso_pu_bacteria 2970019648 2970026138 255
1331 iso_pu_bacteria 2970026789 2970032601 255
1332 iso_pu_bacteria 2970033650 2970039261 255
1333 iso_pu_bacteria 2970040964 2970042668 255
1334 iso_pu_bacteria 2970047711 2970053400 255
1335 iso_pu_bacteria 2970054988 2970059333 255
1336 iso_pu_bacteria 2970061556 2970064485 255
1337 iso_pu_bacteria 2970068827 2970074837 255
1338 iso_pu_bacteria 2970076120 2970076548 255
1339 iso_pu_bacteria 2970082768 2970083318 255
1340 iso_pu_bacteria 2970088815 2970093588 255
1341 iso_pu_bacteria 2970095765 2970100872 255
1342 iso_pu_bacteria 2970102677 2970108382 255
1343 iso_pu_bacteria 2970109326 2970112426 255
1344 iso_pu_bacteria 2970116247 2970118151 255
1345 iso_pu_bacteria 2970122695 2970123704 255
1346 iso_pu_bacteria 2970129317 2970129335 255
1347 iso_pu_bacteria 2970136068 2970139607 255
1348 iso_pu_bacteria 2970143518 2970149227 255
1349 iso_pu_bacteria 2970149975 2970151363 255
1350 iso_pu_bacteria 2970156795 2970157049 255
1351 iso_pu_bacteria 2970164137 2970167320 255
1352 iso_pu_bacteria 2970170962 2970175914 255
1353 iso_pu_bacteria 2970177841 2970182553 255
1354 iso_pu_bacteria 2970184632 2970187319 255
1355 iso_pu_bacteria 2970191845 2970197298 255
1356 iso_pu_bacteria 2970469710 2970474825 255
1357 iso_pu_bacteria 2970489779 2970494621 255
1358 iso_pu_bacteria 2970503327 2970505734 255
1359 iso_pu_bacteria 2970510686 2970511711 255
1360 iso_pu_bacteria 2970524798 2970529105 255
1361 iso_pu_bacteria 2970532167 2970537980 255
1362 iso_pu_bacteria 2970540015 2970541953 255
1363 iso_pu_bacteria 2970547951 2970550749 255
1364 iso_pu_bacteria 2970554993 2970556421 255
1365 iso_pu_bacteria 2970593180 2970594858 255
1366 iso_pu_bacteria 2970619444 2970623460 255
1367 iso_pu_bacteria 2970627176 2970633398 255
1368 iso_pu_bacteria 2977516862 2977521614 255
1369 iso_pu_bacteria 2977523885 2977526051 255
1370 iso_pu_bacteria 2977530762 2977537529 255
1371 iso_pu_bacteria 2977537788 2977537806 255
1372 iso_pu_bacteria 2977544691 2977544755 255
1373 iso_pu_bacteria 2977551784 2977551802 255
1374 iso_pu_bacteria 2977558990 2977563015 255
1375 iso_pu_bacteria 2977565890 2977568257 255
1376 iso_pu_bacteria 2977572785 2977574771 255
1377 iso_pu_bacteria 2977579622 2977581678 255
1378 iso_pu_bacteria 2977821940 2977827198 255
1379 iso_pu_bacteria 2977828996 2977829248 255
1380 iso_pu_bacteria 2977843712 2977844604 255
1381 iso_pu_bacteria 2977851361 2977856663 255
1382 iso_pu_bacteria 2977858184 2977862866 255
1383 iso_pu_bacteria 2977864932 2977870355 255
1384 iso_pu_bacteria 2977872689 2977876120 255
1385 iso_pu_bacteria 2977898635 2977907331 255
1386 iso_pu_bacteria 2977915119 2977920038 255
1387 iso_pu_bacteria 2977922695 2977927745 255
1388 iso_pu_bacteria 2977935797 2977939846 255
1389 iso_pu_bacteria 2977942078 2977946590 255
1390 iso_pu_bacteria 2977950692 2977954129 255
1391 iso_pu_bacteria 2977957713 2977962378 255
1392 iso_pu_bacteria 2977986579 2977989062 255
1393 iso_pu_bacteria 2978969890 2978973470 255
1394 iso_pu_bacteria 2979710463 2979717717 255
1395 iso_pu_bacteria 2979742915 2979748115 255
1396 iso_pu_bacteria 2979764755 2979767506 255
1397 iso_pu_bacteria 2979772303 2979775751 255
1398 iso_pu_bacteria 2979779861 2979782138 255
1399 iso_pu_bacteria 2979793036 2979800898 255
1400 iso_pu_bacteria 2979808191 2979810455 255
1401 iso_pu_bacteria 2984587000 2984591753 255
1402 iso_pu_bacteria 2987636660 2987643410 255
1403 iso_pu_bacteria 2987645492 2987651321 255
1404 iso_pu_bacteria 2987652177 2987658563 255
1405 iso_pu_bacteria 2987659509 2987660939 255
1406 iso_pu_bacteria 2987666974 2987672827 255
1407 iso_pu_bacteria 2987673487 2987678169 255
1408 iso_pu_bacteria 2989349275 2989355293 255
1409 iso_pu_bacteria 2989776772 2989777760 255
1410 iso_pu_bacteria 2995392953 2995395123 255
1411 iso_pu_bacteria 2996310559 2996313067 255
1412 iso_pu_bacteria 2996336353 2996340054 255
1413 iso_pu_bacteria 2996341866 2996347439 255
1414 iso_pu_bacteria 2996348954 2996354235 255
1415 iso_pu_bacteria 2996386984 2996391852 255
1416 iso_pu_bacteria 2996887358 2996891981 255
1417 iso_pu_bacteria 2996893221 2996893668 255
1418 iso_pu_bacteria 3000135777 3000136838 255
1419 iso_pu_bacteria 3002141150 3002142960 255
1420 iso_pu_bacteria 3003930520 3003932295 255
1421 iso_pu_bacteria 3004167301 3004171241 255
1422 iso_pu_bacteria 3004188549 3004189989 255
1423 iso_pu_bacteria 3004195979 3004200558 255
1424 iso_pu_bacteria 3004203850 3004206956 255
1425 iso_pu_bacteria 3004211236 3004213872 255
1426 iso_pu_bacteria 3004218560 3004223463 255
1427 iso_pu_bacteria 3004232784 3004235677 255
1428 iso_pu_bacteria 3004239961 3004244785 255
1429 iso_pu_bacteria 3004248173 3004255811 255
1430 iso_pu_bacteria 3004268573 3004270485 255
1431 iso_pu_bacteria 3004275668 3004280903 255
1432 iso_pu_bacteria 3004289098 3004292810 255
1433 iso_pu_bacteria 3005409236 3005411425 255
1434 iso_pu_bacteria 3005416602 3005422606 255
1435 iso_pu_bacteria 3005445848 3005446376 255
1436 iso_pu_bacteria 3005452660 3005453050 255
1437 iso_pu_bacteria 637000159 637079270 255
1438 iso_pu_bacteria 639633055 639646907 255
1439 iso_pu_bacteria 643692032 643824736 255
1440 iso_pu_bacteria 648276728 648737678 255
1441 iso_pu_bacteria 649633066 649874880 255
1442 iso_pu_bacteria 8002285264 8002288086 255
1443 iso_pu_bacteria 8003992118 8003992679 255
1444 iso_pu_bacteria 8003999396 8004000004 255
1445 iso_pu_bacteria 8004300914 8004306727 255
1446 iso_pu_bacteria 8004312739 8004319550 255
1447 iso_pu_bacteria 8004361976 8004365816 255
1448 iso_pu_bacteria 8004374579 8004380181 255
1449 iso_pu_bacteria 8004387939 8004391169 255
1450 iso_pu_bacteria 8004395343 8004403063 255
1451 iso_pu_bacteria 8004445564 8004450570 255
1452 iso_pu_bacteria 8004633249 8004633725 255
1453 iso_pu_bacteria 8004640170 8004646067 255
1454 iso_pu_bacteria 8004695233 8004702243 255
1455 iso_pu_bacteria 8004703790 8004703992 255
1456 iso_pu_bacteria 8004714634 8004716540 255
1457 iso_pu_bacteria 8004727605 8004733102 255
1458 iso_pu_bacteria 8005246636 8005247064 255
1459 iso_pu_bacteria 8005258706 8005263696 255
1460 iso_pu_bacteria 8005275841 8005279107 255
1461 iso_pu_bacteria 8005282627 8005283803 255
1462 iso_pu_bacteria 8005289223 8005291927 255
1463 iso_pu_bacteria 8005301065 8005304074 255
1464 iso_pu_bacteria 8005307578 8005308887 255
1465 iso_pu_bacteria 8005314921 8005321857 255
1466 iso_pu_bacteria 8005321885 8005326508 255
1467 iso_pu_bacteria 8005382845 8005387072 255
1468 iso_pu_bacteria 8005395548 8005401833 255
1469 iso_pu_bacteria 8005430974 8005436025 255
1470 iso_pu_bacteria 8005460587 8005461292 255
1471 iso_pu_bacteria 8005484373 8005485940 255
1472 iso_pu_bacteria 8005497431 8005498885 255
1473 iso_pu_bacteria 8005542996 8005543975 255
1474 iso_pu_bacteria 8005556819 8005559237 255
1475 iso_pu_bacteria 8005563573 8005569849 255
1476 iso_pu_bacteria 8005619151 8005620070 255
1477 iso_pu_bacteria 8005626139 8005628676 255
1478 iso_pu_bacteria 8005645114 8005646679 255
1479 iso_pu_bacteria 8005658619 8005660551 255
1480 iso_pu_bacteria 8005668836 8005670298 255
1481 iso_pu_bacteria 8005682033 8005684910 255
1482 iso_pu_bacteria 8005688590 8005690499 255
1483 iso_pu_bacteria 8005695170 8005699008 255
1484 iso_pu_bacteria 8018127388 8018133344 255
1485 iso_pu_bacteria 8018163183 8018167047 255
1486 iso_pu_bacteria 8018176218 8018180478 255
1487 iso_pu_bacteria 8023680758 8023683991 255
1488 iso_pu_bacteria 8024479707 8024480523 255
1489 iso_pu_bacteria 8024486573 8024487702 255
1490 iso_pu_bacteria 8024501048 8024502574 255
1491 iso_pu_bacteria 8046767195 8046769782 255
1492 iso_pu_bacteria 8049293176 8049293691 255
1493 iso_pu_bacteria 8055431914 8055433061 255
1494 iso_pu_bacteria 8055617313 8055623411 255
1495 iso_pu_bacteria 8056375014 8056379104 255
1496 iso_pu_bacteria 8056382006 8056386176 255
1497 iso_pu_bacteria 8057575449 8057577401 255
1498 iso_pu_bacteria 8057874678 8057881179 255

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00510

COX3

Cytochrome c oxidase subunit III

29

304

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
3dza-assembly1.cif.gz_C crystal structure of a putative membrane protein of unknown function (yfdx) from klebsiella pneumoniae subsp. at 1.65 a resolution 0.945 126 157
6uxt-assembly1.cif.gz_A crystal structure of unknown function protein yfdx from shigella flexneri 0.9376 120 156
7dgq-assembly1.cif.gz_A9 activity optimized supercomplex state1 0.9033 23 246
5gpn-assembly1.cif.gz_0 architecture of mammalian respirasome 0.9033 23 246
5luf-assembly1.cif.gz_z cryo-em of bovine respirasome 0.9033 23 246
ID Description Score Start End Superfamily
af_P24891_68_255_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9454 52 246 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9366 49 247 1.20.120.80
af_A0A0R0H600_74_264_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9319 49 247 1.20.120.80
af_P24891_68_255_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9262 52 246 1.20.120.80
af_P14575_77_269_1.20.120.80 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Cytochrome c oxidase, subunit III, four-helix bundle 0.9245 49 246 1.20.120.80
ID Description Score Start End GO Terms
AF-Q2QB03-F1-model_v4 Cytochrome c oxidase subunit 3 0.9844 104 243 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A6H1PG00-F1-model_v4 Cytochrome c oxidase subunit 3 0.9835 103 246 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A3G3C7E7-F1-model_v4 Cytochrome c oxidase subunit 3 0.9833 106 246 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-A0A3G3MEN3-F1-model_v4 Cytochrome c oxidase subunit 3 0.9832 101 246 GO:0004129
GO:0005739
GO:0006123
GO:0016020
AF-Q35826-F1-model_v4 Cytochrome c oxidase subunit 3 (EC 7.1.1.9) (Cytochrome c oxidase polypeptide III) 0.983 101 246 GO:0004129
GO:0005743
GO:0006123

Feature Viewer

pLDDT pTM Quality
90.88 0.82 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map