F494270

General Info

Members Datasets Scaffolds Average Seq Length
1481 384 1480 84

Family's Representative Sequence

Representative Sequence 3300005467|Ga0070706_100049336|Ga0070706_1000493365
Length 93
Sequence MHLLVHHLLYSAAGPPGSPGNPYTIHVKSLGALVYGLAAIGPGIGIGLVFGHAIEAMARQPEAAGMITTYMWIGFALTEALALIGIAVPFFIS

Samples

Sample ID Description Type Environment
1 2582581314 Streptomyces mirabilis YR139 Isolate Rhizosphere
2 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
3 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
4 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
6 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
7 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
8 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
9 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
10 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
11 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
12 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
13 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
14 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
15 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
16 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
17 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
18 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
19 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
20 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
21 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
22 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
23 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
24 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
25 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
26 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
27 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
28 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
29 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
30 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
31 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
32 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
33 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
34 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
35 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
36 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
37 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
38 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
39 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
40 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
41 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
42 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
43 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
44 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
45 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
46 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
47 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
48 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
49 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
50 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
51 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
52 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
53 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
54 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
55 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
56 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
57 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
58 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
59 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
60 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
61 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
62 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
63 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
64 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
65 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
66 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
67 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
68 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
69 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
70 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
71 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
72 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
73 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
74 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
75 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
76 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
77 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
78 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
79 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
80 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
81 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
82 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
83 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
84 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
85 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
86 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
87 3300012477 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.3.yng.040610 Metagenome Rhizosphere
88 3300013059 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
89 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
90 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
91 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
92 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
93 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
94 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
95 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
96 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
97 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
98 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
99 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
100 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
101 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
102 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
103 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
104 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
105 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
106 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
107 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
108 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
109 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
110 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
111 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
112 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
113 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
114 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
115 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
116 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
117 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
118 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
119 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
120 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
121 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
122 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
159 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
161 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
165 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
166 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
167 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
168 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
169 3300030836 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
170 3300030888 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU6 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
171 3300030963 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
172 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
173 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
174 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
175 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
176 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
177 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
178 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
179 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
180 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
181 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
182 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
183 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
184 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
185 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
186 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
187 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
188 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
189 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
190 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
191 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
192 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
193 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
194 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
195 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
196 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
197 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
198 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
199 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
200 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
201 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
202 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
207 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
208 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
209 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
210 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
211 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
213 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
214 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
215 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
216 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300036459 Metatranscriptome of spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE5 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
218 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
219 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
220 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
221 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
222 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
223 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
224 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
225 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
226 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
227 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
244 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
245 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
246 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
247 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
248 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
249 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
250 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
251 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
252 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
253 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
254 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
255 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
256 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
257 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
258 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
259 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
260 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
261 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
262 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
263 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
264 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
265 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
266 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
267 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
268 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
269 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
270 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
271 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
272 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
273 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
274 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
275 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
276 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
277 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
278 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
279 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
280 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
281 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
282 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
283 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
284 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
285 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
286 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
287 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
288 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
289 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
290 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
291 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
292 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
293 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
294 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
295 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
296 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
297 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
298 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
299 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
300 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
301 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
302 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
303 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
304 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
305 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
306 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
307 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
308 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
309 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
310 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
311 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
312 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
313 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
314 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
315 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
316 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
317 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
318 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
319 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
320 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
321 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
322 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
323 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
324 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
325 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
326 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
327 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
328 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
329 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
330 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
331 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
332 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
333 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
334 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
335 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
336 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
337 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
339 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
340 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
341 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
342 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
343 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
344 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
345 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
346 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
347 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
348 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
349 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
350 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
351 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
352 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
353 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
354 3300059491 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 12R_AW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
355 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
357 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
358 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
359 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
360 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
361 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
362 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
363 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
364 3300059512 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 57R_AW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
365 3300059604 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 63R_AD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
366 3300059605 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 71R_SD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
367 3300059622 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 222R_AD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
368 3300059623 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 66R_SW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
369 3300059624 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 146R_CW_T3_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
370 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
371 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
372 3300059641 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 9R_AW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
373 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
374 3300059643 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 13R_AD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
375 3300059644 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 38R_AD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
376 3300059645 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 18R_SW_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
377 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
378 3300059651 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 70R_SD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
379 3300059655 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 152R_CD_T3_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
380 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
381 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
382 3300060346 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 169R_CW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 91.9
Metatranscriptomes 8.04
Isolates 0.07

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.07
Nodule 0
Rhizoplane 3.92
Rhizosphere 93.11
Stem 0
Stem Tuber 0
Unclassified 2.9

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI25404J52841_10109599 3300003659 Bacteria 580
2 Ga0058861_11672637 3300004800 Bacteria 523
3 Ga0058862_12459020 3300004803 Bacteria 586
4 Ga0058862_12609771 3300004803 Bacteria 695
5 Ga0058862_12665468 3300004803 Bacteria 2315
6 Ga0070658_10011984 3300005327 Bacteria 6961
7 Ga0070658_11417108 3300005327 Bacteria 603
8 Ga0070683_100040113 3300005329 Bacteria 4302
9 Ga0070683_100251156 3300005329 Bacteria 1682
10 Ga0070683_100408571 3300005329 Bacteria 1295
11 Ga0070683_100593613 3300005329 Bacteria 1060
12 Ga0070683_100778167 3300005329 Bacteria 917
13 Ga0070690_100009520 3300005330 Bacteria 5631
14 Ga0070690_100055382 3300005330 Bacteria 2540
15 Ga0070677_10600628 3300005333 Bacteria 609
16 Ga0068869_100329025 3300005334 Bacteria 1241
17 Ga0070680_100359880 3300005336 Bacteria 1238
18 Ga0070680_100472138 3300005336 Bacteria 1072
19 Ga0070680_100682556 3300005336 Bacteria 883
20 Ga0070682_100160728 3300005337 Bacteria 1551
21 Ga0070682_101536225 3300005337 Bacteria 573
22 Ga0068868_101946257 3300005338 Bacteria 557
23 Ga0070660_100517110 3300005339 Bacteria 994
24 Ga0070660_101269121 3300005339 Bacteria 625
25 Ga0070691_10172164 3300005341 Bacteria 1123
26 Ga0070691_10625809 3300005341 Bacteria 638
27 Ga0070661_100213623 3300005344 Bacteria 1477
28 Ga0070661_101508581 3300005344 Bacteria 567
29 Ga0070692_10374080 3300005345 Bacteria 892
30 Ga0070692_10920214 3300005345 Bacteria 606
31 Ga0070675_100893622 3300005354 Bacteria 814
32 Ga0070671_100165384 3300005355 Bacteria 1870
33 Ga0070671_100360854 3300005355 Bacteria 1240
34 Ga0070671_101684271 3300005355 Bacteria 563
35 Ga0070674_100564531 3300005356 Bacteria 957
36 Ga0070674_100744850 3300005356 Bacteria 841
37 Ga0070673_100038521 3300005364 Bacteria 3651
38 Ga0070703_10085630 3300005406 Bacteria 1083
39 Ga0070709_10037942 3300005434 Bacteria 2947
40 Ga0070709_10047666 3300005434 Bacteria 2670
41 Ga0070709_10053200 3300005434 Bacteria 2548
42 Ga0070709_10176433 3300005434 Bacteria 1497
43 Ga0070709_10231848 3300005434 Bacteria 1321
44 Ga0070709_10315735 3300005434 Bacteria 1145
45 Ga0070709_10435447 3300005434 Bacteria 985
46 Ga0070709_10953895 3300005434 Bacteria 680
47 Ga0070709_11544106 3300005434 Bacteria 540
48 Ga0070714_100002366 3300005435 Bacteria 13874
49 Ga0070714_100035689 3300005435 Bacteria 4167
50 Ga0070714_100043909 3300005435 Bacteria 3782
51 Ga0070714_100113551 3300005435 Bacteria 2402
52 Ga0070714_100114113 3300005435 Bacteria 2396
53 Ga0070714_100248669 3300005435 Bacteria 1643
54 Ga0070714_100283298 3300005435 Bacteria 1540
55 Ga0070714_100420235 3300005435 Bacteria 1266
56 Ga0070714_100618253 3300005435 Bacteria 1041
57 Ga0070714_100659807 3300005435 Bacteria 1007
58 Ga0070714_100701643 3300005435 Bacteria 976
59 Ga0070714_100795801 3300005435 Bacteria 915
60 Ga0070714_101039527 3300005435 Bacteria 798
61 Ga0070714_101107702 3300005435 Bacteria 772
62 Ga0070714_101604840 3300005435 Bacteria 635
63 Ga0070714_101638758 3300005435 Bacteria 628
64 Ga0070713_100016977 3300005436 Bacteria 5488
65 Ga0070713_100019967 3300005436 Bacteria 5129
66 Ga0070713_100053073 3300005436 Bacteria 3358
67 Ga0070713_100130632 3300005436 Bacteria 2214
68 Ga0070713_100249244 3300005436 Bacteria 1619
69 Ga0070713_100262886 3300005436 Bacteria 1577
70 Ga0070713_100537537 3300005436 Bacteria 1106
71 Ga0070713_100580706 3300005436 Bacteria 1063
72 Ga0070713_100687085 3300005436 Bacteria 976
73 Ga0070713_100949027 3300005436 Bacteria 828
74 Ga0070713_101348329 3300005436 Bacteria 691
75 Ga0070713_101433349 3300005436 Bacteria 670
76 Ga0070713_101560868 3300005436 Bacteria 641
77 Ga0070713_101633896 3300005436 Bacteria 625
78 Ga0070713_101881463 3300005436 Bacteria 581
79 Ga0070713_102059441 3300005436 Bacteria 553
80 Ga0070713_102309641 3300005436 Bacteria 520
81 Ga0070710_10001320 3300005437 Bacteria 11710
82 Ga0070710_10006445 3300005437 Bacteria 5640
83 Ga0070710_10039384 3300005437 Bacteria 2600
84 Ga0070710_10077995 3300005437 Bacteria 1926
85 Ga0070710_10088701 3300005437 Bacteria 1820
86 Ga0070710_10108007 3300005437 Bacteria 1667
87 Ga0070710_10411724 3300005437 Bacteria 908
88 Ga0070710_10457206 3300005437 Bacteria 866
89 Ga0070710_10812573 3300005437 Bacteria 669
90 Ga0070710_11099300 3300005437 Bacteria 584
91 Ga0070710_11412628 3300005437 Bacteria 521
92 Ga0070701_10960782 3300005438 Bacteria 594
93 Ga0070711_100000491 3300005439 Bacteria 20613
94 Ga0070711_100012750 3300005439 Bacteria 5262
95 Ga0070711_100016584 3300005439 Bacteria 4679
96 Ga0070711_100327400 3300005439 Bacteria 1226
97 Ga0070711_100561015 3300005439 Bacteria 948
98 Ga0070711_101245254 3300005439 Bacteria 644
99 Ga0070711_101340796 3300005439 Bacteria 621
100 Ga0070705_100018473 3300005440 Bacteria 3656
101 Ga0070705_100043660 3300005440 Bacteria 2570
102 Ga0070705_100504767 3300005440 Bacteria 919
103 Ga0070694_100436581 3300005444 Bacteria 1031
104 Ga0070708_100006587 3300005445 Bacteria 9244
105 Ga0070708_100012652 3300005445 Bacteria 6891
106 Ga0070708_100027392 3300005445 Bacteria 4889
107 Ga0070708_100080328 3300005445 Bacteria 2951
108 Ga0070708_100379011 3300005445 Bacteria 1334
109 Ga0070708_100426597 3300005445 Bacteria 1251
110 Ga0070708_100539369 3300005445 Bacteria 1101
111 Ga0070708_100683237 3300005445 Bacteria 967
112 Ga0070708_101950408 3300005445 Bacteria 544
113 Ga0070663_100515427 3300005455 Bacteria 995
114 Ga0070663_100674356 3300005455 Bacteria 876
115 Ga0070663_101641516 3300005455 Bacteria 574
116 Ga0070678_100540596 3300005456 Bacteria 1033
117 Ga0070681_10008205 3300005458 Bacteria 10219
118 Ga0070681_10141220 3300005458 Bacteria 2338
119 Ga0070681_10159090 3300005458 Bacteria 2183
120 Ga0070681_10349589 3300005458 Bacteria 1389
121 Ga0070681_10674733 3300005458 Bacteria 949
122 Ga0070681_10892248 3300005458 Bacteria 807
123 Ga0070706_100009451 3300005467 Bacteria 9073
124 Ga0070706_100015712 3300005467 Bacteria 6992
125 Ga0070706_100028300 3300005467 Bacteria 5160
126 Ga0070706_100049336 3300005467 Bacteria 3885
127 Ga0070706_100086515 3300005467 Bacteria 2904
128 Ga0070706_100238137 3300005467 Bacteria 1699
129 Ga0070706_100252109 3300005467 Unclassified 1648
130 Ga0070706_100294440 3300005467 Bacteria 1514
131 Ga0070706_100312582 3300005467 Bacteria 1466
132 Ga0070706_100483497 3300005467 Bacteria 1152
133 Ga0070707_100001170 3300005468 Bacteria 25835
134 Ga0070707_100037310 3300005468 Bacteria 4637
135 Ga0070707_100055617 3300005468 Bacteria 3794
136 Ga0070707_100066622 3300005468 Bacteria 3461
137 Ga0070707_100086908 3300005468 Bacteria 3024
138 Ga0070707_100101696 3300005468 Bacteria 2785
139 Ga0070707_100113207 3300005468 Bacteria 2632
140 Ga0070707_100142934 3300005468 Bacteria 2329
141 Ga0070707_100259475 3300005468 Bacteria 1691
142 Ga0070707_100437235 3300005468 Bacteria 1269
143 Ga0070707_101432501 3300005468 Bacteria 657
144 Ga0070707_101566454 3300005468 Bacteria 626
145 Ga0070707_101925277 3300005468 Bacteria 559
146 Ga0070698_100000350 3300005471 Bacteria 47668
147 Ga0070698_100000957 3300005471 Bacteria 31599
148 Ga0070698_100003075 3300005471 Bacteria 18395
149 Ga0070698_100010566 3300005471 Bacteria 9839
150 Ga0070698_100035043 3300005471 Bacteria 5191
151 Ga0070698_100048696 3300005471 Bacteria 4330
152 Ga0070698_100055121 3300005471 Bacteria 4034
153 Ga0070698_100066053 3300005471 Bacteria 3642
154 Ga0070698_100133559 3300005471 Bacteria 2436
155 Ga0070698_100175181 3300005471 Bacteria 2084
156 Ga0070698_100326036 3300005471 Bacteria 1466
157 Ga0070698_100350458 3300005471 Bacteria 1408
158 Ga0070698_100612530 3300005471 Bacteria 1029
159 Ga0070698_101792033 3300005471 Bacteria 567
160 Ga0070698_101843002 3300005471 Bacteria 558
161 Ga0070699_100137056 3300005518 Bacteria 2159
162 Ga0070699_100229315 3300005518 Bacteria 1656
163 Ga0070699_100380804 3300005518 Bacteria 1274
164 Ga0070679_100018457 3300005530 Bacteria 6770
165 Ga0070679_100509096 3300005530 Bacteria 1148
166 Ga0070684_100025715 3300005535 Bacteria 4950
167 Ga0070684_100097156 3300005535 Bacteria 2626
168 Ga0070684_100221838 3300005535 Bacteria 1725
169 Ga0070684_100342356 3300005535 Bacteria 1375
170 Ga0070684_100472097 3300005535 Bacteria 1160
171 Ga0070697_100005931 3300005536 Bacteria 9437
172 Ga0070697_100044930 3300005536 Bacteria 3578
173 Ga0070697_100137727 3300005536 Bacteria 2051
174 Ga0070697_100187224 3300005536 Bacteria 1756
175 Ga0070697_100651313 3300005536 Bacteria 928
176 Ga0070697_100787937 3300005536 Bacteria 841
177 Ga0068853_100935707 3300005539 Bacteria 833
178 Ga0070686_101835158 3300005544 Bacteria 516
179 Ga0070695_100047700 3300005545 Bacteria 2737
180 Ga0070695_100315611 3300005545 Bacteria 1160
181 Ga0070695_100459845 3300005545 Bacteria 977
182 Ga0070696_100425187 3300005546 Bacteria 1044
183 Ga0070693_100107379 3300005547 Bacteria 1711
184 Ga0070693_101265711 3300005547 Bacteria 569
185 Ga0070665_100082418 3300005548 Bacteria 3222
186 Ga0070665_100107962 3300005548 Bacteria 2786
187 Ga0070665_100235441 3300005548 Bacteria 1832
188 Ga0068855_100043409 3300005563 Bacteria 5326
189 Ga0068855_100140031 3300005563 Bacteria 2759
190 Ga0070664_101038175 3300005564 Bacteria 771
191 Ga0070664_101884539 3300005564 Bacteria 567
192 Ga0068857_100082356 3300005577 Bacteria 2874
193 Ga0068857_100162346 3300005577 Bacteria 2028
194 Ga0068857_100300873 3300005577 Bacteria 1479
195 Ga0068857_100532929 3300005577 Bacteria 1105
196 Ga0068856_100014524 3300005614 Bacteria 7608
197 Ga0068856_100141608 3300005614 Bacteria 2412
198 Ga0068856_100267775 3300005614 Bacteria 1724
199 Ga0068856_100391787 3300005614 Bacteria 1409
200 Ga0068856_100556784 3300005614 Bacteria 1168
201 Ga0068856_101928667 3300005614 Bacteria 601
202 Ga0068852_100597126 3300005616 Bacteria 1108
203 Ga0068852_101212194 3300005616 Bacteria 776
204 Ga0068852_102304688 3300005616 Bacteria 559
205 Ga0068852_102585941 3300005616 Bacteria 527
206 Ga0068864_100039258 3300005618 Bacteria 4046
207 Ga0068864_100307801 3300005618 Bacteria 1485
208 Ga0068864_100526975 3300005618 Bacteria 1140
209 Ga0068864_101175556 3300005618 Bacteria 765
210 Ga0068861_100196566 3300005719 Bacteria 1690
211 Ga0068861_100250243 3300005719 Bacteria 1511
212 Ga0068863_100135702 3300005841 Bacteria 2351
213 Ga0068863_100184075 3300005841 Bacteria 2006
214 Ga0068858_100039859 3300005842 Bacteria 4355
215 Ga0068860_100134199 3300005843 Bacteria 2377
216 Ga0081540_1000250 3300005983 Bacteria 56639
217 Ga0081540_1000386 3300005983 Bacteria 44292
218 Ga0081540_1063367 3300005983 Bacteria 1750
219 Ga0070717_10000595 3300006028 Bacteria 23178
220 Ga0070717_10030253 3300006028 Bacteria 4350
221 Ga0070717_10034269 3300006028 Bacteria 4104
222 Ga0070717_10114761 3300006028 Bacteria 2301
223 Ga0070717_10123370 3300006028 Bacteria 2221
224 Ga0070717_10166902 3300006028 Bacteria 1912
225 Ga0070717_10194019 3300006028 Bacteria 1776
226 Ga0070717_10253428 3300006028 Bacteria 1555
227 Ga0070717_10344856 3300006028 Bacteria 1331
228 Ga0070717_10348029 3300006028 Bacteria 1324
229 Ga0070717_10486255 3300006028 Bacteria 1115
230 Ga0070717_10704492 3300006028 Bacteria 917
231 Ga0070717_10715708 3300006028 Bacteria 910
232 Ga0070717_10781398 3300006028 Bacteria 868
233 Ga0070717_10859627 3300006028 Bacteria 825
234 Ga0070717_10908699 3300006028 Bacteria 801
235 Ga0070717_11456826 3300006028 Bacteria 621
236 Ga0070717_11504774 3300006028 Bacteria 611
237 Ga0070717_11910520 3300006028 Bacteria 536
238 Ga0070717_12018134 3300006028 Bacteria 520
239 Ga0075432_10030515 3300006058 Bacteria 1863
240 Ga0070715_10006797 3300006163 Bacteria 3902
241 Ga0070715_10018682 3300006163 Bacteria 2646
242 Ga0070715_10054324 3300006163 Bacteria 1734
243 Ga0070715_10155538 3300006163 Bacteria 1125
244 Ga0070715_10581662 3300006163 Bacteria 653
245 Ga0070715_11019986 3300006163 Unclassified 517
246 Ga0070716_100002986 3300006173 Bacteria 7889
247 Ga0070716_100004137 3300006173 Bacteria 6887
248 Ga0070716_100048208 3300006173 Bacteria 2407
249 Ga0070716_100077382 3300006173 Bacteria 1974
250 Ga0070716_100189516 3300006173 Bacteria 1357
251 Ga0070716_100220046 3300006173 Bacteria 1275
252 Ga0070716_100304061 3300006173 Bacteria 1111
253 Ga0070716_100883262 3300006173 Bacteria 698
254 Ga0070716_101448088 3300006173 Unclassified 560
255 Ga0070712_100000461 3300006175 Bacteria 23352
256 Ga0070712_100022849 3300006175 Bacteria 4123
257 Ga0070712_100046905 3300006175 Bacteria 2988
258 Ga0070712_100102931 3300006175 Bacteria 2116
259 Ga0070712_100241384 3300006175 Bacteria 1439
260 Ga0070712_100299746 3300006175 Bacteria 1301
261 Ga0070712_100422685 3300006175 Bacteria 1105
262 Ga0070712_100820865 3300006175 Bacteria 799
263 Ga0070712_101008824 3300006175 Bacteria 720
264 Ga0070712_101088169 3300006175 Bacteria 693
265 Ga0070712_101259931 3300006175 Bacteria 644
266 Ga0097621_100007903 3300006237 Bacteria 7629
267 Ga0097621_100089871 3300006237 Bacteria 2569
268 Ga0097621_100190433 3300006237 Bacteria 1776
269 Ga0097621_102058403 3300006237 Bacteria 545
270 Ga0068871_100021758 3300006358 Bacteria 4935
271 Ga0068871_101305907 3300006358 Bacteria 682
272 Ga0075428_100126690 3300006844 Bacteria 2779
273 Ga0075433_10006954 3300006852 Bacteria 8966
274 Ga0075434_100011518 3300006871 Bacteria 8344
275 Ga0075434_100065438 3300006871 Bacteria 3620
276 Ga0075434_100395537 3300006871 Bacteria 1403
277 Ga0075434_101101119 3300006871 Bacteria 808
278 Ga0075434_101106231 3300006871 Bacteria 805
279 Ga0075434_102046974 3300006871 Bacteria 577
280 Ga0075434_102528183 3300006871 Bacteria 514
281 Ga0075436_100029644 3300006914 Bacteria 3762
282 Ga0075436_100031389 3300006914 Bacteria 3658
283 Ga0075436_100073634 3300006914 Bacteria 2364
284 Ga0075436_100299300 3300006914 Bacteria 1153
285 Ga0075436_100409271 3300006914 Bacteria 983
286 Ga0075435_100015899 3300007076 Bacteria 5665
287 Ga0075435_100023557 3300007076 Bacteria 4763
288 Ga0075435_100882691 3300007076 Bacteria 780
289 Ga0099794_10065151 3300007265 Bacteria 1777
290 Ga0099794_10372503 3300007265 Bacteria 744
291 Ga0099795_10011048 3300007788 Bacteria 2682
292 Ga0105240_11224281 3300009093 Bacteria 794
293 Ga0105240_11324241 3300009093 Bacteria 759
294 Ga0105240_12721051 3300009093 Bacteria 510
295 Ga0111539_10060235 3300009094 Bacteria 4499
296 Ga0105245_10034447 3300009098 Bacteria 4491
297 Ga0105245_10568890 3300009098 Bacteria 1157
298 Ga0105247_10048592 3300009101 Bacteria 2606
299 Ga0105247_10585715 3300009101 Bacteria 825
300 Ga0105247_10691761 3300009101 Bacteria 766
301 Ga0114129_10070952 3300009147 Bacteria 4857
302 Ga0114129_10514110 3300009147 Bacteria 1562
303 Ga0105243_12793001 3300009148 Bacteria 529
304 Ga0105241_10155785 3300009174 Bacteria 1873
305 Ga0105241_10457878 3300009174 Bacteria 1130
306 Ga0105241_10513486 3300009174 Bacteria 1070
307 Ga0105241_10729830 3300009174 Bacteria 907
308 Ga0105242_11357624 3300009176 Bacteria 737
309 Ga0105248_11381702 3300009177 Bacteria 797
310 Ga0105237_10092550 3300009545 Bacteria 3013
311 Ga0105237_10664482 3300009545 Bacteria 1049
312 Ga0105238_12039787 3300009551 Bacteria 607
313 Ga0105238_12822183 3300009551 Bacteria 522
314 Ga0105249_11502816 3300009553 Bacteria 746
315 Ga0105249_13312531 3300009553 Bacteria 518
316 Ga0099796_10415423 3300010159 Bacteria 592
317 Ga0105239_10277199 3300010375 Bacteria 1887
318 Ga0105239_10507145 3300010375 Bacteria 1372
319 Ga0105239_10857671 3300010375 Bacteria 1042
320 Ga0105239_12790518 3300010375 Bacteria 570
321 Ga0105246_11028559 3300011119 Bacteria 748
322 Ga0157336_1002702 3300012477 Bacteria 1022
323 Ga0154012_125040 3300013059 Bacteria 598
324 Ga0157371_10111937 3300013102 Bacteria 1937
325 Ga0157371_10583273 3300013102 Bacteria 831
326 Ga0157371_11163750 3300013102 Bacteria 593
327 Ga0157370_10045631 3300013104 Bacteria 4203
328 Ga0157370_10076283 3300013104 Bacteria 3158
329 Ga0157370_10235583 3300013104 Bacteria 1694
330 Ga0157370_10672125 3300013104 Bacteria 946
331 Ga0157369_10070021 3300013105 Bacteria 3768
332 Ga0157369_10091955 3300013105 Bacteria 3238
333 Ga0157369_10146354 3300013105 Bacteria 2498
334 Ga0157369_10172803 3300013105 Bacteria 2276
335 Ga0157369_10206472 3300013105 Bacteria 2060
336 Ga0157369_10723063 3300013105 Bacteria 1025
337 Ga0157369_11609267 3300013105 Bacteria 660
338 Ga0157369_11625271 3300013105 Bacteria 657
339 Ga0157374_10101651 3300013296 Bacteria 2756
340 Ga0157374_10387799 3300013296 Bacteria 1392
341 Ga0157374_11470293 3300013296 Bacteria 705
342 Ga0157378_10962660 3300013297 Bacteria 886
343 Ga0157378_12514810 3300013297 Bacteria 567
344 Ga0163162_10103045 3300013306 Bacteria 2947
345 Ga0163162_10182402 3300013306 Bacteria 2225
346 Ga0163162_11302768 3300013306 Bacteria 825
347 Ga0157372_10502436 3300013307 Bacteria 1414
348 Ga0157372_11130963 3300013307 Bacteria 906
349 Ga0157375_10038053 3300013308 Bacteria 4616
350 Ga0157375_12033296 3300013308 Bacteria 683
351 Ga0163163_10015458 3300014325 Bacteria 7057
352 Ga0163163_10203058 3300014325 Bacteria 2030
353 Ga0157377_10976640 3300014745 Bacteria 639
354 Ga0157379_10073167 3300014968 Bacteria 3067
355 Ga0157376_10051720 3300014969 Bacteria 3413
356 Ga0157376_10211504 3300014969 Bacteria 1791
357 Ga0157376_10933642 3300014969 Bacteria 887
358 Ga0163161_12088251 3300017792 Bacteria 504
359 Ga0197907_10248340 3300020069 Bacteria 574
360 Ga0197907_10533194 3300020069 Bacteria 1169
361 Ga0197907_11233163 3300020069 Bacteria 2356
362 Ga0197907_11395272 3300020069 Bacteria 1625
363 Ga0197907_11416400 3300020069 Bacteria 1290
364 Ga0206356_10292195 3300020070 Bacteria 890
365 Ga0206356_10463876 3300020070 Bacteria 768
366 Ga0206356_10985920 3300020070 Bacteria 895
367 Ga0206356_11028082 3300020070 Bacteria 3150
368 Ga0206356_11150882 3300020070 Bacteria 870
369 Ga0206356_11439059 3300020070 Bacteria 870
370 Ga0206349_1119587 3300020075 Bacteria 677
371 Ga0206349_1169648 3300020075 Bacteria 778
372 Ga0206349_1250825 3300020075 Bacteria 2802
373 Ga0206349_1457189 3300020075 Bacteria 760
374 Ga0206349_1555218 3300020075 Bacteria 863
375 Ga0206355_1032308 3300020076 Bacteria 2298
376 Ga0206355_1214635 3300020076 Bacteria 1601
377 Ga0206355_1487130 3300020076 Bacteria 957
378 Ga0206351_10037739 3300020077 Bacteria 920
379 Ga0206351_10322884 3300020077 Bacteria 931
380 Ga0206351_10476555 3300020077 Bacteria 2281
381 Ga0206351_10479162 3300020077 Bacteria 1061
382 Ga0206351_10835893 3300020077 Bacteria 1969
383 Ga0206352_10444969 3300020078 Bacteria 917
384 Ga0206352_10466689 3300020078 Bacteria 586
385 Ga0206352_10594696 3300020078 Bacteria 1036
386 Ga0206352_10871456 3300020078 Bacteria 2826
387 Ga0206352_11066802 3300020078 Bacteria 525
388 Ga0206350_10030057 3300020080 Bacteria 846
389 Ga0206350_10080394 3300020080 Bacteria 805
390 Ga0206350_10604595 3300020080 Bacteria 1539
391 Ga0206350_10625460 3300020080 Bacteria 1140
392 Ga0206350_10800850 3300020080 Bacteria 945
393 Ga0206350_11262342 3300020080 Bacteria 2460
394 Ga0206350_11618886 3300020080 Bacteria 860
395 Ga0206354_10030221 3300020081 Bacteria 1963
396 Ga0206354_10244137 3300020081 Bacteria 788
397 Ga0206354_10393601 3300020081 Bacteria 1196
398 Ga0206354_10522195 3300020081 Bacteria 599
399 Ga0206354_10870360 3300020081 Bacteria 1276
400 Ga0206353_10363191 3300020082 Bacteria 2148
401 Ga0206353_10488590 3300020082 Bacteria 886
402 Ga0206353_11203152 3300020082 Bacteria 1476
403 Ga0154015_1032811 3300020610 Bacteria 2327
404 Ga0154015_1189455 3300020610 Bacteria 1289
405 Ga0154015_1639779 3300020610 Bacteria 529
406 Ga0213876_10445050 3300021384 Bacteria 689
407 Ga0213875_10000956 3300021388 Bacteria 20645
408 Ga0213875_10004773 3300021388 Bacteria 7376
409 Ga0213875_10014503 3300021388 Bacteria 3844
410 Ga0213875_10042294 3300021388 Bacteria 2141
411 Ga0213875_10462994 3300021388 Bacteria 607
412 Ga0213875_10586726 3300021388 Bacteria 538
413 Ga0213875_10656986 3300021388 Bacteria 508
414 Ga0224712_10001308 3300022467 Bacteria 5665
415 Ga0224712_10002390 3300022467 Bacteria 4621
416 Ga0224712_10010136 3300022467 Bacteria 2869
417 Ga0224712_10030399 3300022467 Bacteria 1949
418 Ga0224712_10039219 3300022467 Bacteria 1774
419 Ga0224712_10141026 3300022467 Bacteria 1061
420 Ga0224712_10185905 3300022467 Bacteria 938
421 Ga0224712_10373500 3300022467 Bacteria 677
422 Ga0224712_10607313 3300022467 Bacteria 534
423 Ga0224571_111971 3300022734 Bacteria 607
424 Ga0224572_1020179 3300024225 Bacteria 1280
425 Ga0228598_1005048 3300024227 Bacteria 2776
426 Ga0207692_10001193 3300025898 Bacteria 9635
427 Ga0207692_10010145 3300025898 Bacteria 3959
428 Ga0207692_10017774 3300025898 Bacteria 3177
429 Ga0207692_10026148 3300025898 Bacteria 2736
430 Ga0207692_10029033 3300025898 Bacteria 2623
431 Ga0207692_10049198 3300025898 Bacteria 2126
432 Ga0207692_10061660 3300025898 Bacteria 1944
433 Ga0207692_10111092 3300025898 Bacteria 1520
434 Ga0207692_10151320 3300025898 Bacteria 1329
435 Ga0207692_10512806 3300025898 Bacteria 762
436 Ga0207692_10674206 3300025898 Bacteria 669
437 Ga0207692_10821351 3300025898 Bacteria 609
438 Ga0207710_10660114 3300025900 Bacteria 548
439 Ga0207647_10172408 3300025904 Bacteria 1259
440 Ga0207685_10004954 3300025905 Bacteria 3454
441 Ga0207685_10042062 3300025905 Bacteria 1714
442 Ga0207685_10266466 3300025905 Bacteria 835
443 Ga0207685_10338829 3300025905 Bacteria 755
444 Ga0207685_10693111 3300025905 Bacteria 554
445 Ga0207699_10000107 3300025906 Bacteria 58818
446 Ga0207699_10006535 3300025906 Bacteria 5654
447 Ga0207699_10020453 3300025906 Bacteria 3549
448 Ga0207699_10022185 3300025906 Bacteria 3436
449 Ga0207699_10036028 3300025906 Bacteria 2818
450 Ga0207699_10088672 3300025906 Bacteria 1937
451 Ga0207699_10149433 3300025906 Bacteria 1544
452 Ga0207699_10438784 3300025906 Bacteria 935
453 Ga0207699_10992616 3300025906 Bacteria 621
454 Ga0207645_10033143 3300025907 Bacteria 3320
455 Ga0207643_11016131 3300025908 Bacteria 536
456 Ga0207705_10273042 3300025909 Bacteria 1293
457 Ga0207705_10691701 3300025909 Bacteria 793
458 Ga0207705_10969496 3300025909 Bacteria 657
459 Ga0207705_11514720 3300025909 Bacteria 508
460 Ga0207684_10001220 3300025910 Bacteria 28611
461 Ga0207684_10003611 3300025910 Bacteria 15057
462 Ga0207684_10013477 3300025910 Bacteria 7072
463 Ga0207684_10026750 3300025910 Bacteria 4919
464 Ga0207684_10087833 3300025910 Bacteria 2649
465 Ga0207684_10100671 3300025910 Bacteria 2469
466 Ga0207684_10108575 3300025910 Bacteria 2374
467 Ga0207684_10138322 3300025910 Bacteria 2092
468 Ga0207684_10214318 3300025910 Bacteria 1661
469 Ga0207684_10403565 3300025910 Bacteria 1175
470 Ga0207684_10478107 3300025910 Bacteria 1069
471 Ga0207684_10598062 3300025910 Bacteria 942
472 Ga0207684_10767717 3300025910 Bacteria 816
473 Ga0207684_10840982 3300025910 Bacteria 774
474 Ga0207654_10144195 3300025911 Bacteria 1522
475 Ga0207654_11142263 3300025911 Bacteria 568
476 Ga0207707_10007735 3300025912 Bacteria 9357
477 Ga0207707_10135386 3300025912 Bacteria 2154
478 Ga0207707_10717493 3300025912 Bacteria 838
479 Ga0207707_10754734 3300025912 Bacteria 813
480 Ga0207695_10719509 3300025913 Bacteria 879
481 Ga0207671_10055156 3300025914 Bacteria 2944
482 Ga0207693_10000536 3300025915 Bacteria 34408
483 Ga0207693_10045344 3300025915 Bacteria 3455
484 Ga0207693_10046258 3300025915 Bacteria 3418
485 Ga0207693_10062052 3300025915 Bacteria 2928
486 Ga0207693_10112993 3300025915 Bacteria 2131
487 Ga0207693_10144815 3300025915 Bacteria 1868
488 Ga0207693_10182558 3300025915 Bacteria 1651
489 Ga0207693_10308419 3300025915 Bacteria 1239
490 Ga0207693_10356136 3300025915 Bacteria 1145
491 Ga0207693_10402908 3300025915 Bacteria 1069
492 Ga0207663_10002645 3300025916 Bacteria 8625
493 Ga0207663_10007401 3300025916 Bacteria 5692
494 Ga0207663_10067381 3300025916 Bacteria 2295
495 Ga0207663_10112814 3300025916 Bacteria 1847
496 Ga0207663_10167043 3300025916 Bacteria 1559
497 Ga0207663_10489690 3300025916 Bacteria 954
498 Ga0207663_10543772 3300025916 Bacteria 907
499 Ga0207663_11031751 3300025916 Bacteria 660
500 Ga0207663_11217685 3300025916 Bacteria 606
501 Ga0207663_11422879 3300025916 Bacteria 558
502 Ga0207660_10037618 3300025917 Bacteria 3374
503 Ga0207660_10705090 3300025917 Bacteria 823
504 Ga0207660_11458075 3300025917 Bacteria 554
505 Ga0207662_10017924 3300025918 Bacteria 4010
506 Ga0207657_10114392 3300025919 Bacteria 2225
507 Ga0207652_10034294 3300025921 Bacteria 4276
508 Ga0207652_10416766 3300025921 Bacteria 1211
509 Ga0207646_10000071 3300025922 Bacteria 141799
510 Ga0207646_10004644 3300025922 Bacteria 14825
511 Ga0207646_10053134 3300025922 Bacteria 3624
512 Ga0207646_10081632 3300025922 Bacteria 2891
513 Ga0207646_10089695 3300025922 Bacteria 2752
514 Ga0207646_10129012 3300025922 Bacteria 2275
515 Ga0207646_10129584 3300025922 Bacteria 2270
516 Ga0207646_10250177 3300025922 Bacteria 1601
517 Ga0207646_10273592 3300025922 Bacteria 1526
518 Ga0207646_10285365 3300025922 Bacteria 1492
519 Ga0207646_10527795 3300025922 Bacteria 1062
520 Ga0207694_10499316 3300025924 Bacteria 1019
521 Ga0207659_11450511 3300025926 Bacteria 588
522 Ga0207687_10206836 3300025927 Bacteria 1537
523 Ga0207687_10405182 3300025927 Bacteria 1122
524 Ga0207700_10001550 3300025928 Bacteria 13035
525 Ga0207700_10002475 3300025928 Bacteria 10602
526 Ga0207700_10004514 3300025928 Bacteria 8219
527 Ga0207700_10004682 3300025928 Bacteria 8105
528 Ga0207700_10005025 3300025928 Bacteria 7868
529 Ga0207700_10012430 3300025928 Bacteria 5490
530 Ga0207700_10049768 3300025928 Bacteria 3119
531 Ga0207700_10065993 3300025928 Bacteria 2764
532 Ga0207700_10271899 3300025928 Bacteria 1455
533 Ga0207700_10463627 3300025928 Bacteria 1118
534 Ga0207700_10472036 3300025928 Bacteria 1108
535 Ga0207700_10707776 3300025928 Bacteria 899
536 Ga0207700_10729369 3300025928 Bacteria 885
537 Ga0207700_11312096 3300025928 Bacteria 645
538 Ga0207700_11427056 3300025928 Bacteria 615
539 Ga0207664_10000271 3300025929 Bacteria 39054
540 Ga0207664_10001093 3300025929 Bacteria 18092
541 Ga0207664_10001238 3300025929 Bacteria 16904
542 Ga0207664_10007512 3300025929 Bacteria 7562
543 Ga0207664_10011579 3300025929 Bacteria 6279
544 Ga0207664_10056328 3300025929 Bacteria 3122
545 Ga0207664_10059312 3300025929 Bacteria 3046
546 Ga0207664_10083912 3300025929 Bacteria 2597
547 Ga0207664_10102521 3300025929 Bacteria 2366
548 Ga0207664_10143079 3300025929 Bacteria 2025
549 Ga0207664_10247927 3300025929 Bacteria 1553
550 Ga0207664_10323395 3300025929 Bacteria 1361
551 Ga0207664_10348591 3300025929 Bacteria 1310
552 Ga0207664_10406636 3300025929 Bacteria 1211
553 Ga0207664_10456934 3300025929 Bacteria 1140
554 Ga0207664_10621560 3300025929 Bacteria 970
555 Ga0207664_10764118 3300025929 Bacteria 869
556 Ga0207664_10859873 3300025929 Bacteria 815
557 Ga0207664_11035318 3300025929 Bacteria 735
558 Ga0207664_11105282 3300025929 Bacteria 709
559 Ga0207664_11411711 3300025929 Bacteria 617
560 Ga0207664_11412417 3300025929 Bacteria 617
561 Ga0207644_10409747 3300025931 Bacteria 1109
562 Ga0207644_10544546 3300025931 Bacteria 960
563 Ga0207644_11829955 3300025931 Bacteria 508
564 Ga0207686_10884203 3300025934 Bacteria 720
565 Ga0207709_11459291 3300025935 Bacteria 567
566 Ga0207669_10204328 3300025937 Bacteria 1437
567 Ga0207669_11788768 3300025937 Bacteria 525
568 Ga0207665_10000930 3300025939 Bacteria 19800
569 Ga0207665_10004087 3300025939 Bacteria 9740
570 Ga0207665_10032752 3300025939 Bacteria 3442
571 Ga0207665_10079555 3300025939 Bacteria 2253
572 Ga0207665_10099311 3300025939 Bacteria 2030
573 Ga0207665_10474529 3300025939 Bacteria 963
574 Ga0207661_10116325 3300025944 Bacteria 2270
575 Ga0207661_10169614 3300025944 Bacteria 1899
576 Ga0207661_10187931 3300025944 Bacteria 1809
577 Ga0207661_10212900 3300025944 Bacteria 1704
578 Ga0207661_10514854 3300025944 Bacteria 1094
579 Ga0207679_10668455 3300025945 Bacteria 941
580 Ga0207667_10029339 3300025949 Bacteria 5967
581 Ga0207667_11132378 3300025949 Bacteria 765
582 Ga0207667_11383335 3300025949 Bacteria 678
583 Ga0207651_10447834 3300025960 Bacteria 1107
584 Ga0207677_11361491 3300026023 Bacteria 653
585 Ga0207639_12210933 3300026041 Bacteria 511
586 Ga0207678_10012040 3300026067 Bacteria 7597
587 Ga0207678_10698743 3300026067 Bacteria 892
588 Ga0207702_10056901 3300026078 Bacteria 3321
589 Ga0207702_10148153 3300026078 Bacteria 2132
590 Ga0207702_10351167 3300026078 Bacteria 1411
591 Ga0207702_10406590 3300026078 Bacteria 1314
592 Ga0207702_10654278 3300026078 Bacteria 1033
593 Ga0207641_10553374 3300026088 Bacteria 1122
594 Ga0207641_11545494 3300026088 Bacteria 665
595 Ga0207676_10011596 3300026095 Bacteria 6303
596 Ga0207676_10168694 3300026095 Bacteria 1905
597 Ga0207676_10899628 3300026095 Bacteria 868
598 Ga0207676_10914172 3300026095 Bacteria 861
599 Ga0207674_10032442 3300026116 Bacteria 5478
600 Ga0207674_10067802 3300026116 Bacteria 3591
601 Ga0207674_10129863 3300026116 Bacteria 2484
602 Ga0207674_10275748 3300026116 Bacteria 1629
603 Ga0207675_100121346 3300026118 Bacteria 2473
604 Ga0207675_100220071 3300026118 Bacteria 1829
605 Ga0207698_10287883 3300026142 Bacteria 1523
606 Ga0209588_1115268 3300027671 Bacteria 862
607 Ga0268266_10029996 3300028379 Bacteria 4622
608 Ga0268266_10051856 3300028379 Bacteria 3523
609 Ga0268266_10072591 3300028379 Bacteria 2985
610 Ga0268266_11621160 3300028379 Bacteria 622
611 Ga0268264_10028663 3300028381 Bacteria 4556
612 Ga0265338_10001163 3300028800 Bacteria 43486
613 Ga0265338_10006190 3300028800 Bacteria 15341
614 Ga0265338_10007955 3300028800 Bacteria 12990
615 Ga0307511_10054527 3300030521 Bacteria 3150
616 Ga0307512_10440784 3300030522 Bacteria 530
617 Ga0265762_1027256 3300030760 Bacteria 1071
618 Ga0265762_1067450 3300030760 Bacteria 745
619 Ga0265762_1094099 3300030760 Bacteria 657
620 Ga0265763_1058010 3300030763 Bacteria 500
621 Ga0265767_104426 3300030836 Bacteria 823
622 Ga0265769_117130 3300030888 Bacteria 552
623 Ga0265768_107244 3300030963 Bacteria 673
624 Ga0265773_1046377 3300031018 Bacteria 510
625 Ga0265760_10007779 3300031090 Bacteria 3062
626 Ga0265760_10047941 3300031090 Bacteria 1283
627 Ga0265760_10126069 3300031090 Bacteria 825
628 Ga0265760_10328797 3300031090 Bacteria 545
629 Ga0307508_10016193 3300031616 Bacteria 6789
630 Ga0307508_10192990 3300031616 Bacteria 1638
631 Ga0307508_10615040 3300031616 Bacteria 689
632 Ga0316053_114716 3300032120 Bacteria 577
633 Ga0307507_10282288 3300033179 Bacteria 1037
634 Ga0307510_10040783 3300033180 Bacteria 5089
635 Ga0316214_1008309 3300033545 Bacteria 1395
636 Ga0316214_1033205 3300033545 Bacteria 735
637 Ga0316212_1002286 3300033547 Bacteria 2722
638 Ga0316212_1055053 3300033547 Bacteria 569
639 Ga0373930_0012007 3300034816 Bacteria 1573
640 Ga0373930_0133767 3300034816 Bacteria 612
641 Ga0373948_0008622 3300034817 Bacteria 1740
642 Ga0373948_0095202 3300034817 Bacteria 695
643 Ga0373950_0033546 3300034818 Bacteria 959
644 Ga0373958_0002333 3300034819 Bacteria 2645
645 Ga0373959_0022243 3300034820 Bacteria 1224
646 Ga0373938_0038944 3300034957 Bacteria 1049
647 Ga0373926_0005462 3300035083 Bacteria 4192
648 Ga0373926_0007800 3300035083 Bacteria 3565
649 Ga0373926_0007865 3300035083 Bacteria 3552
650 Ga0373929_0034622 3300035085 Bacteria 1096
651 Ga0373934_0000004 3300035086 Bacteria 87334
652 Ga0373934_0002460 3300035086 Bacteria 6815
653 Ga0373934_0003132 3300035086 Bacteria 6030
654 Ga0373934_0012410 3300035086 Bacteria 3216
655 Ga0373934_0039669 3300035086 Bacteria 1857
656 Ga0373934_0274228 3300035086 Bacteria 698
657 Ga0373934_0299360 3300035086 Bacteria 667
658 Ga0373940_0005189 3300035088 Bacteria 2806
659 Ga0373944_0020925 3300035089 Bacteria 1889
660 Ga0373944_0040761 3300035089 Bacteria 1435
661 Ga0373949_0005906 3300035090 Bacteria 2717
662 Ga0373952_0022867 3300035092 Bacteria 1331
663 Ga0373923_0000882 3300035111 Bacteria 7972
664 Ga0373923_0009292 3300035111 Bacteria 3543
665 Ga0373923_0051177 3300035111 Bacteria 1732
666 Ga0373923_0503805 3300035111 Bacteria 591
667 Ga0373923_0523177 3300035111 Bacteria 580
668 Ga0373923_0573445 3300035111 Bacteria 554
669 Ga0373932_0404827 3300035112 Bacteria 528
670 Ga0373936_0011067 3300035113 Bacteria 3409
671 Ga0373936_0012964 3300035113 Bacteria 3179
672 Ga0373936_0084159 3300035113 Bacteria 1327
673 Ga0373936_0180219 3300035113 Bacteria 927
674 Ga0373936_0536937 3300035113 Bacteria 546
675 Ga0373939_0008923 3300035114 Bacteria 2472
676 Ga0373941_0004510 3300035115 Bacteria 3223
677 Ga0373945_0023202 3300035116 Bacteria 2142
678 Ga0373945_0053342 3300035116 Bacteria 1492
679 Ga0373945_0119713 3300035116 Bacteria 1046
680 Ga0373945_0247970 3300035116 Bacteria 751
681 Ga0373945_0319092 3300035116 Bacteria 668
682 Ga0373953_0000281 3300035117 Bacteria 14084
683 Ga0373953_0003073 3300035117 Bacteria 5130
684 Ga0373953_0017197 3300035117 Bacteria 2653
685 Ga0373953_0020341 3300035117 Bacteria 2479
686 Ga0373953_0112115 3300035117 Bacteria 1154
687 Ga0373953_0428917 3300035117 Bacteria 583
688 Ga0373954_0000410 3300035118 Bacteria 16026
689 Ga0373954_0010607 3300035118 Bacteria 4068
690 Ga0373954_0051745 3300035118 Bacteria 1929
691 Ga0373954_0150501 3300035118 Bacteria 1137
692 Ga0373954_0172827 3300035118 Bacteria 1058
693 Ga0373954_0270691 3300035118 Bacteria 837
694 Ga0373954_0292582 3300035118 Bacteria 803
695 Ga0373956_0003293 3300035119 Bacteria 6509
696 Ga0373956_0011860 3300035119 Bacteria 3600
697 Ga0373956_0030009 3300035119 Bacteria 2374
698 Ga0373956_0035072 3300035119 Bacteria 2211
699 Ga0373956_0115093 3300035119 Bacteria 1254
700 Ga0373957_0002278 3300035120 Bacteria 5443
701 Ga0373957_0004557 3300035120 Bacteria 4225
702 Ga0373957_0043313 3300035120 Bacteria 1701
703 Ga0373957_0060236 3300035120 Bacteria 1469
704 Ga0373957_0070229 3300035120 Bacteria 1368
705 Ga0373957_0499196 3300035120 Bacteria 529
706 Ga0373960_0100661 3300035121 Bacteria 936
707 Ga0373943_0054217 3300035170 Bacteria 1982
708 Ga0373943_0066786 3300035170 Bacteria 1812
709 Ga0373943_0072775 3300035170 Bacteria 1744
710 Ga0373943_0262213 3300035170 Bacteria 973
711 Ga0373943_0298372 3300035170 Bacteria 914
712 Ga0373943_0609411 3300035170 Bacteria 643
713 Ga0373946_0002228 3300035171 Bacteria 6838
714 Ga0373946_0018705 3300035171 Bacteria 2663
715 Ga0373946_0028833 3300035171 Bacteria 2204
716 Ga0373946_0455851 3300035171 Bacteria 652
717 Ga0373946_0751229 3300035171 Bacteria 512
718 Ga0373955_0000041 3300035172 Bacteria 51219
719 Ga0373955_0010850 3300035172 Bacteria 4321
720 Ga0373955_0016273 3300035172 Bacteria 3657
721 Ga0373955_0031903 3300035172 Bacteria 2761
722 Ga0373955_0099225 3300035172 Bacteria 1669
723 Ga0373955_0457218 3300035172 Bacteria 778
724 Ga0373955_0507870 3300035172 Bacteria 736
725 Ga0373955_0742847 3300035172 Bacteria 603
726 Ga0373961_0015177 3300035241 Bacteria 1966
727 Ga0373962_0016675 3300035242 Bacteria 1897
728 Ga0373962_0120678 3300035242 Bacteria 836
729 Ga0373924_0001289 3300035410 Bacteria 8048
730 Ga0373924_0001785 3300035410 Bacteria 7113
731 Ga0373924_0021163 3300035410 Bacteria 2536
732 Ga0373924_0176543 3300035410 Bacteria 939
733 Ga0373924_0247338 3300035410 Bacteria 789
734 Ga0373924_0259242 3300035410 Bacteria 770
735 Ga0373924_0552787 3300035410 Bacteria 518
736 Ga0373931_0023564 3300035691 Bacteria 3109
737 Ga0373931_0248686 3300035691 Bacteria 1080
738 Ga0373931_0421898 3300035691 Bacteria 848
739 Ga0373931_1204719 3300035691 Bacteria 518
740 Ga0373935_0000397 3300035692 Bacteria 22544
741 Ga0373935_0019194 3300035692 Bacteria 4170
742 Ga0373935_0066596 3300035692 Bacteria 2314
743 Ga0373935_0088777 3300035692 Bacteria 2020
744 Ga0373935_0277132 3300035692 Bacteria 1180
745 Ga0373935_0334345 3300035692 Bacteria 1077
746 Ga0373935_0404795 3300035692 Bacteria 980
747 Ga0373935_1149551 3300035692 Bacteria 578
748 Ga0373927_0017574 3300035695 Bacteria 4706
749 Ga0373927_0030691 3300035695 Bacteria 3506
750 Ga0373927_0310249 3300035695 Bacteria 1038
751 Ga0373927_0402972 3300035695 Bacteria 902
752 Ga0373927_0847497 3300035695 Bacteria 603
753 Ga0373927_0993800 3300035695 Bacteria 553
754 Ga0373933_0000246 3300035724 Bacteria 35782
755 Ga0373933_0000589 3300035724 Bacteria 22706
756 Ga0373933_0008104 3300035724 Bacteria 5733
757 Ga0373933_0019494 3300035724 Bacteria 3832
758 Ga0373933_0035910 3300035724 Bacteria 2898
759 Ga0373933_0036950 3300035724 Bacteria 2862
760 Ga0373933_0067376 3300035724 Bacteria 2171
761 Ga0373933_0093485 3300035724 Bacteria 1858
762 Ga0373933_0142585 3300035724 Bacteria 1513
763 Ga0373933_0200359 3300035724 Bacteria 1277
764 Ga0373933_0426112 3300035724 Bacteria 867
765 Ga0373947_0000015 3300035725 Bacteria 129181
766 Ga0373947_0025215 3300035725 Bacteria 3467
767 Ga0373947_0038877 3300035725 Bacteria 2830
768 Ga0373947_0095616 3300035725 Bacteria 1859
769 Ga0373947_0332386 3300035725 Bacteria 1017
770 Ga0373947_0468150 3300035725 Bacteria 854
771 Ga0373947_0690198 3300035725 Bacteria 696
772 Ga0373937_0000172 3300036401 Bacteria 63213
773 Ga0373937_0001641 3300036401 Bacteria 18799
774 Ga0373937_0005259 3300036401 Bacteria 11051
775 Ga0373937_0046875 3300036401 Bacteria 3953
776 Ga0373937_0069490 3300036401 Bacteria 3247
777 Ga0373937_0097188 3300036401 Bacteria 2731
778 Ga0373937_0105274 3300036401 Bacteria 2621
779 Ga0373937_0107833 3300036401 Bacteria 2589
780 Ga0373937_0257489 3300036401 Bacteria 1645
781 Ga0373937_0343497 3300036401 Bacteria 1413
782 Ga0373937_0818313 3300036401 Bacteria 879
783 Ga0373937_0981276 3300036401 Bacteria 793
784 Ga0265778_031182 3300036457 Bacteria 690
785 Ga0372808_030735 3300036459 Bacteria 770
786 Ga0372808_038148 3300036459 Bacteria 689
787 Ga0373925_0000008 3300037068 Bacteria 249158
788 Ga0373925_0002980 3300037068 Bacteria 13363
789 Ga0373925_0021506 3300037068 Bacteria 4701
790 Ga0373925_0090223 3300037068 Bacteria 2342
791 Ga0373925_0164427 3300037068 Bacteria 1749
792 Ga0373925_0231173 3300037068 Bacteria 1478
793 Ga0373925_0477371 3300037068 Bacteria 1022
794 Ga0373925_0550863 3300037068 Bacteria 948
795 Ga0373925_0609073 3300037068 Bacteria 899
796 Ga0373925_1081078 3300037068 Bacteria 660
797 Ga0373925_1486462 3300037068 Bacteria 554
798 Ga0395898_0019597 3300037466 Bacteria 6882
799 Ga0436364_0140940 3300037853 Bacteria 539
800 Ga0436364_0154449 3300037853 Bacteria 3656
801 Ga0436364_0354916 3300037853 Bacteria 534
802 Ga0436364_0414011 3300037853 Bacteria 5560
803 Ga0436364_0473068 3300037853 Bacteria 15750
804 Ga0436364_0584067 3300037853 Bacteria 157477
805 Ga0436364_0739436 3300037853 Bacteria 2285
806 Ga0436364_1299143 3300037853 Bacteria 2918
807 Ga0436364_1348865 3300037853 Bacteria 1064
808 Ga0436364_1491783 3300037853 Bacteria 585
809 Ga0242420_013561 3300038996 Bacteria 1391
810 Ga0242420_089115 3300038996 Bacteria 646
811 Ga0436365_0705632 3300039437 Bacteria 586
812 Ga0436361_0162503 3300039447 Bacteria 900
813 Ga0436361_0395439 3300039447 Bacteria 534
814 Ga0436363_0058422 3300039450 Bacteria 504
815 Ga0436363_0139691 3300039450 Bacteria 1225
816 Ga0436363_0263193 3300039450 Bacteria 865
817 Ga0436362_0981485 3300039453 Bacteria 565
818 Ga0451802_1306807 3300041460 Bacteria 574
819 Ga0451853_3823468 3300041512 Bacteria 1852
820 Ga0466969_0007996 3300044656 Bacteria 5615
821 Ga0466969_0019529 3300044656 Bacteria 3521
822 Ga0466969_0020209 3300044656 Bacteria 3451
823 Ga0466969_0315286 3300044656 Bacteria 708
824 Ga0466972_0013222 3300044658 Bacteria 4144
825 Ga0466965_0013844 3300044683 Bacteria 3810
826 Ga0466966_0004138 3300044684 Bacteria 9577
827 Ga0466966_0007040 3300044684 Bacteria 7447
828 Ga0466966_0007200 3300044684 Bacteria 7373
829 Ga0466966_0038909 3300044684 Bacteria 3063
830 Ga0466966_1013221 3300044684 Bacteria 501
831 Ga0466961_0000308 3300044693 Bacteria 32406
832 Ga0466961_0000436 3300044693 Bacteria 26623
833 Ga0466961_0027746 3300044693 Bacteria 3642
834 Ga0466963_0001216 3300044694 Bacteria 13564
835 Ga0466963_0010308 3300044694 Bacteria 5655
836 Ga0466963_0155863 3300044694 Bacteria 1588
837 Ga0466963_1221569 3300044694 Bacteria 528
838 Ga0466964_0008093 3300044706 Bacteria 3942
839 Ga0466964_0059264 3300044706 Bacteria 1590
840 Ga0466971_0001300 3300044719 Bacteria 10431
841 Ga0466971_0001501 3300044719 Bacteria 9843
842 Ga0466971_0076730 3300044719 Bacteria 1520
843 Ga0466968_0209808 3300044735 Bacteria 915
844 Ga0466968_0268230 3300044735 Bacteria 814
845 Ga0466970_0011498 3300044765 Bacteria 4511
846 Ga0466970_0015532 3300044765 Bacteria 3918
847 Ga0466970_0672102 3300044765 Bacteria 603
848 Ga0466970_0803495 3300044765 Bacteria 551
849 Ga0466957_0000605 3300044842 Bacteria 18193
850 Ga0466957_0016273 3300044842 Bacteria 4350
851 Ga0466960_0359942 3300044901 Bacteria 831
852 Ga0466959_0000486 3300045049 Bacteria 23165
853 Ga0466959_0010220 3300045049 Bacteria 6701
854 Ga0466959_0080452 3300045049 Bacteria 2349
855 Ga0466959_0663883 3300045049 Bacteria 699
856 Ga0466959_0756776 3300045049 Bacteria 650
857 Ga0466958_0000413 3300045836 Bacteria 17607
858 Ga0466958_0071452 3300045836 Bacteria 2125
859 Ga0466958_0636610 3300045836 Bacteria 694
860 Ga0466967_0006111 3300045976 Bacteria 8470
861 Ga0466967_0051501 3300045976 Bacteria 3609
862 Ga0466967_0145517 3300045976 Bacteria 2211
863 Ga0466967_1515903 3300045976 Bacteria 668
864 Ga0466967_2228277 3300045976 Bacteria 544
865 Ga0466967_2437758 3300045976 Bacteria 518
866 Ga0495592_0000417 3300046454 Bacteria 32303
867 Ga0495592_0006577 3300046454 Bacteria 8659
868 Ga0495592_0019141 3300046454 Bacteria 5209
869 Ga0495592_0025240 3300046454 Bacteria 4512
870 Ga0495592_0037650 3300046454 Bacteria 3641
871 Ga0495592_0051071 3300046454 Bacteria 3071
872 Ga0495592_0082763 3300046454 Bacteria 2319
873 Ga0495592_0115907 3300046454 Bacteria 1891
874 Ga0495592_0123994 3300046454 Bacteria 1814
875 Ga0495592_0157133 3300046454 Bacteria 1567
876 Ga0495592_0259603 3300046454 Bacteria 1145
877 Ga0495592_0441844 3300046454 Bacteria 816
878 Ga0495592_0486884 3300046454 Bacteria 767
879 Ga0495603_0005458 3300046455 Bacteria 7590
880 Ga0495603_0013793 3300046455 Bacteria 4890
881 Ga0495603_0068270 3300046455 Bacteria 2092
882 Ga0495603_0146574 3300046455 Bacteria 1372
883 Ga0495629_0003658 3300046459 Bacteria 11623
884 Ga0495629_0005355 3300046459 Bacteria 9581
885 Ga0495629_0010633 3300046459 Bacteria 6694
886 Ga0495629_0035301 3300046459 Bacteria 3533
887 Ga0495629_0046647 3300046459 Bacteria 3039
888 Ga0495629_0063999 3300046459 Bacteria 2568
889 Ga0495629_0190702 3300046459 Bacteria 1419
890 Ga0495641_0005412 3300046461 Bacteria 8632
891 Ga0495641_0015120 3300046461 Bacteria 4142
892 Ga0495641_0094606 3300046461 Bacteria 1334
893 Ga0495641_0236811 3300046461 Bacteria 820
894 Ga0495651_0000118 3300046462 Bacteria 58414
895 Ga0495651_0001369 3300046462 Bacteria 18875
896 Ga0495651_0005490 3300046462 Bacteria 9670
897 Ga0495651_0009360 3300046462 Bacteria 7520
898 Ga0495651_0012552 3300046462 Bacteria 6536
899 Ga0495651_0022293 3300046462 Bacteria 4922
900 Ga0495651_0034943 3300046462 Bacteria 3916
901 Ga0495651_0039080 3300046462 Bacteria 3694
902 Ga0495651_0040598 3300046462 Bacteria 3618
903 Ga0495651_0118880 3300046462 Bacteria 1944
904 Ga0495651_0297179 3300046462 Bacteria 1084
905 Ga0495653_0004695 3300046463 Bacteria 11060
906 Ga0495653_0008844 3300046463 Bacteria 8243
907 Ga0495653_0010635 3300046463 Bacteria 7530
908 Ga0495653_0015934 3300046463 Bacteria 6127
909 Ga0495653_0029994 3300046463 Bacteria 4335
910 Ga0495653_0058098 3300046463 Bacteria 2941
911 Ga0495653_0077665 3300046463 Bacteria 2464
912 Ga0495653_0327307 3300046463 Bacteria 991
913 Ga0495653_0621474 3300046463 Bacteria 662
914 Ga0495653_0753303 3300046463 Bacteria 588
915 Ga0495580_0006900 3300046472 Bacteria 9172
916 Ga0495580_0020255 3300046472 Bacteria 4927
917 Ga0495580_0098939 3300046472 Bacteria 2029
918 Ga0495580_0181747 3300046472 Bacteria 1452
919 Ga0495582_0004077 3300046473 Bacteria 8208
920 Ga0495582_0005781 3300046473 Bacteria 6889
921 Ga0495582_0006532 3300046473 Bacteria 6471
922 Ga0495639_0004481 3300046475 Bacteria 5986
923 Ga0495639_0023902 3300046475 Bacteria 2688
924 Ga0495639_0077826 3300046475 Bacteria 1540
925 Ga0495639_0163197 3300046475 Bacteria 1079
926 Ga0495639_0187768 3300046475 Bacteria 1008
927 Ga0495639_0309831 3300046475 Bacteria 788
928 Ga0495639_0617609 3300046475 Bacteria 558
929 Ga0495662_0000786 3300046476 Bacteria 15390
930 Ga0495662_0001119 3300046476 Bacteria 13196
931 Ga0495662_0002792 3300046476 Bacteria 8830
932 Ga0495662_0009413 3300046476 Bacteria 4791
933 Ga0495662_0018235 3300046476 Bacteria 3395
934 Ga0495662_0020529 3300046476 Bacteria 3196
935 Ga0495662_0054790 3300046476 Bacteria 1927
936 Ga0495662_0067471 3300046476 Bacteria 1731
937 Ga0495662_0265038 3300046476 Bacteria 846
938 Ga0495662_0355236 3300046476 Bacteria 720
939 Ga0495664_0013776 3300046477 Bacteria 4583
940 Ga0495664_0025298 3300046477 Bacteria 3455
941 Ga0495664_0034888 3300046477 Bacteria 2961
942 Ga0495664_0064824 3300046477 Bacteria 2177
943 Ga0495664_0076801 3300046477 Bacteria 1999
944 Ga0495664_0196269 3300046477 Bacteria 1223
945 Ga0495664_0249823 3300046477 Bacteria 1072
946 Ga0495664_0488162 3300046477 Bacteria 736
947 Ga0495664_0860218 3300046477 Bacteria 531
948 Ga0495585_0003651 3300046492 Bacteria 10291
949 Ga0495594_0076428 3300046499 Bacteria 1867
950 Ga0495594_0115603 3300046499 Bacteria 1515
951 Ga0495594_0324225 3300046499 Bacteria 877
952 Ga0495594_0382391 3300046499 Bacteria 801
953 Ga0495594_0658028 3300046499 Bacteria 593
954 Ga0495608_0000156 3300046511 Bacteria 48856
955 Ga0495608_0005072 3300046511 Bacteria 9409
956 Ga0495608_0020406 3300046511 Bacteria 4554
957 Ga0495608_0022430 3300046511 Bacteria 4327
958 Ga0495608_0033635 3300046511 Bacteria 3462
959 Ga0495608_0050212 3300046511 Bacteria 2767
960 Ga0495608_0054489 3300046511 Bacteria 2643
961 Ga0495608_0096316 3300046511 Bacteria 1911
962 Ga0495608_0128913 3300046511 Bacteria 1619
963 Ga0495608_0291588 3300046511 Bacteria 1011
964 Ga0495608_0774575 3300046511 Bacteria 567
965 Ga0495618_0015240 3300046514 Bacteria 4690
966 Ga0495618_0032098 3300046514 Bacteria 3289
967 Ga0495618_0035024 3300046514 Bacteria 3150
968 Ga0495618_0055095 3300046514 Bacteria 2517
969 Ga0495618_0091593 3300046514 Bacteria 1943
970 Ga0495618_0115027 3300046514 Bacteria 1722
971 Ga0495618_0158512 3300046514 Bacteria 1444
972 Ga0495618_0745498 3300046514 Bacteria 573
973 Ga0495628_0000655 3300046516 Bacteria 31697
974 Ga0495628_0000710 3300046516 Bacteria 30813
975 Ga0495628_0008150 3300046516 Bacteria 9015
976 Ga0495628_0033107 3300046516 Bacteria 4167
977 Ga0495628_0067754 3300046516 Bacteria 2786
978 Ga0495628_0121328 3300046516 Bacteria 2004
979 Ga0495628_0274424 3300046516 Bacteria 1253
980 Ga0495628_0284788 3300046516 Bacteria 1226
981 Ga0495628_0358759 3300046516 Bacteria 1070
982 Ga0495628_0399610 3300046516 Bacteria 1004
983 Ga0495628_1046664 3300046516 Bacteria 560
984 Ga0495630_0003977 3300046517 Bacteria 10334
985 Ga0495630_0006810 3300046517 Bacteria 8147
986 Ga0495630_0058747 3300046517 Bacteria 2883
987 Ga0495630_0064005 3300046517 Bacteria 2763
988 Ga0495630_0074750 3300046517 Bacteria 2552
989 Ga0495630_0379644 3300046517 Bacteria 1082
990 Ga0495630_0414255 3300046517 Bacteria 1032
991 Ga0495630_0616680 3300046517 Bacteria 831
992 Ga0495630_0719788 3300046517 Bacteria 763
993 Ga0495630_0878374 3300046517 Bacteria 683
994 Ga0495666_0010337 3300046526 Bacteria 4651
995 Ga0495666_0015980 3300046526 Bacteria 3737
996 Ga0495666_0019770 3300046526 Bacteria 3339
997 Ga0495666_0023514 3300046526 Bacteria 3047
998 Ga0495666_0090196 3300046526 Bacteria 1447
999 Ga0495666_0336761 3300046526 Bacteria 680
1000 Ga0495652_0000436 3300046529 Bacteria 48806
1001 Ga0495652_0015833 3300046529 Bacteria 6752
1002 Ga0495652_0018764 3300046529 Bacteria 6164
1003 Ga0495652_0030748 3300046529 Bacteria 4705
1004 Ga0495652_0033777 3300046529 Bacteria 4462
1005 Ga0495652_0037734 3300046529 Bacteria 4189
1006 Ga0495652_0041245 3300046529 Bacteria 3985
1007 Ga0495652_0090796 3300046529 Bacteria 2498
1008 Ga0495652_0136289 3300046529 Bacteria 1936
1009 Ga0495652_0163758 3300046529 Bacteria 1723
1010 Ga0495652_0185401 3300046529 Bacteria 1593
1011 Ga0495665_0000621 3300046531 Bacteria 18035
1012 Ga0495665_0003341 3300046531 Bacteria 8701
1013 Ga0495665_0005365 3300046531 Bacteria 6907
1014 Ga0495665_0006864 3300046531 Bacteria 6143
1015 Ga0495665_0051778 3300046531 Bacteria 2174
1016 Ga0495640_0004646 3300046533 Bacteria 10957
1017 Ga0495640_0005463 3300046533 Bacteria 10109
1018 Ga0495640_0006891 3300046533 Bacteria 8950
1019 Ga0495640_0019687 3300046533 Bacteria 4978
1020 Ga0495640_0025588 3300046533 Bacteria 4277
1021 Ga0495640_0043992 3300046533 Bacteria 3106
1022 Ga0495640_0059300 3300046533 Bacteria 2607
1023 Ga0495640_0061089 3300046533 Bacteria 2561
1024 Ga0495640_0062145 3300046533 Bacteria 2534
1025 Ga0495640_0182105 3300046533 Bacteria 1338
1026 Ga0495640_0571623 3300046533 Bacteria 684
1027 Ga0495586_0004191 3300046535 Bacteria 7722
1028 Ga0495586_0016555 3300046535 Bacteria 3922
1029 Ga0495586_0028936 3300046535 Bacteria 2965
1030 Ga0495586_0566484 3300046535 Bacteria 656
1031 Ga0495587_0000045 3300046536 Bacteria 108362
1032 Ga0495587_0007032 3300046536 Bacteria 7304
1033 Ga0495587_0008083 3300046536 Bacteria 6783
1034 Ga0495587_0011368 3300046536 Bacteria 5641
1035 Ga0495587_0012422 3300046536 Bacteria 5360
1036 Ga0495587_0020471 3300046536 Bacteria 4083
1037 Ga0495587_0069523 3300046536 Bacteria 2050
1038 Ga0495587_0123587 3300046536 Bacteria 1481
1039 Ga0495587_0127799 3300046536 Bacteria 1453
1040 Ga0495587_0235053 3300046536 Bacteria 1032
1041 Ga0495587_0419832 3300046536 Bacteria 742
1042 Ga0495587_0610173 3300046536 Bacteria 600
1043 Ga0495587_0666527 3300046536 Bacteria 571
1044 Ga0495645_0001626 3300046543 Bacteria 15212
1045 Ga0495645_0002428 3300046543 Bacteria 12658
1046 Ga0495645_0007460 3300046543 Bacteria 7612
1047 Ga0495645_0046690 3300046543 Bacteria 3156
1048 Ga0495645_0099214 3300046543 Bacteria 2072
1049 Ga0495645_0120279 3300046543 Bacteria 1849
1050 Ga0495645_0131960 3300046543 Bacteria 1749
1051 Ga0495645_0190114 3300046543 Bacteria 1400
1052 Ga0495645_0271210 3300046543 Bacteria 1120
1053 Ga0495645_0459746 3300046543 Bacteria 801
1054 Ga0495645_0478454 3300046543 Bacteria 781
1055 Ga0495645_0837807 3300046543 Bacteria 549
1056 Ga0495667_0000051 3300046559 Bacteria 109277
1057 Ga0495667_0000582 3300046559 Bacteria 23327
1058 Ga0495667_0000718 3300046559 Bacteria 21245
1059 Ga0495667_0012096 3300046559 Bacteria 5845
1060 Ga0495667_0053174 3300046559 Bacteria 2667
1061 Ga0495667_0085983 3300046559 Bacteria 2040
1062 Ga0495667_0088095 3300046559 Bacteria 2012
1063 Ga0495667_0099513 3300046559 Bacteria 1882
1064 Ga0495667_0104055 3300046559 Bacteria 1835
1065 Ga0495667_0175687 3300046559 Bacteria 1375
1066 Ga0495667_0222429 3300046559 Bacteria 1204
1067 Ga0495667_0406212 3300046559 Bacteria 858
1068 Ga0495634_0004805 3300046642 Bacteria 10497
1069 Ga0495634_0007306 3300046642 Bacteria 8311
1070 Ga0495634_0009667 3300046642 Bacteria 7099
1071 Ga0495634_0010584 3300046642 Bacteria 6754
1072 Ga0495634_0011392 3300046642 Bacteria 6477
1073 Ga0495634_0017849 3300046642 Bacteria 5058
1074 Ga0495634_0065755 3300046642 Bacteria 2402
1075 Ga0495634_0105576 3300046642 Bacteria 1816
1076 Ga0495634_0300973 3300046642 Bacteria 969
1077 Ga0495634_0329434 3300046642 Bacteria 918
1078 Ga0495634_0836412 3300046642 Bacteria 523
1079 Ga0495635_0008596 3300046663 Bacteria 7128
1080 Ga0495635_0013902 3300046663 Bacteria 5631
1081 Ga0495635_0036263 3300046663 Bacteria 3418
1082 Ga0495635_0117650 3300046663 Bacteria 1813
1083 Ga0495635_0157690 3300046663 Bacteria 1544
1084 Ga0495635_0193271 3300046663 Bacteria 1381
1085 Ga0495635_0228069 3300046663 Bacteria 1258
1086 Ga0495635_0269084 3300046663 Bacteria 1146
1087 Ga0495635_0385366 3300046663 Bacteria 932
1088 Ga0495635_0549050 3300046663 Bacteria 757
1089 Ga0495635_0682771 3300046663 Bacteria 667
1090 Ga0495588_0072823 3300046674 Bacteria 1788
1091 Ga0495588_0120244 3300046674 Bacteria 1385
1092 Ga0495588_0295289 3300046674 Bacteria 853
1093 Ga0495657_0000044 3300046675 Bacteria 108383
1094 Ga0495657_0002470 3300046675 Bacteria 15558
1095 Ga0495657_0002604 3300046675 Bacteria 15088
1096 Ga0495657_0009900 3300046675 Bacteria 7191
1097 Ga0495657_0015845 3300046675 Bacteria 5505
1098 Ga0495657_0025129 3300046675 Bacteria 4233
1099 Ga0495657_0034610 3300046675 Bacteria 3507
1100 Ga0495657_0071658 3300046675 Bacteria 2261
1101 Ga0495657_0076689 3300046675 Bacteria 2170
1102 Ga0495657_0212448 3300046675 Bacteria 1176
1103 Ga0495657_0325577 3300046675 Bacteria 912
1104 Ga0495657_0629802 3300046675 Bacteria 619
1105 Ga0495599_0000127 3300046678 Bacteria 48710
1106 Ga0495599_0012215 3300046678 Bacteria 5289
1107 Ga0495599_0013998 3300046678 Bacteria 4966
1108 Ga0495599_0014707 3300046678 Bacteria 4846
1109 Ga0495599_0042554 3300046678 Bacteria 2850
1110 Ga0495599_0043725 3300046678 Bacteria 2811
1111 Ga0495599_0114825 3300046678 Bacteria 1675
1112 Ga0495599_0188826 3300046678 Bacteria 1268
1113 Ga0495599_0277317 3300046678 Bacteria 1016
1114 Ga0495623_0003177 3300046679 Bacteria 10842
1115 Ga0495623_0010849 3300046679 Bacteria 5897
1116 Ga0495623_0023740 3300046679 Bacteria 3956
1117 Ga0495623_0028555 3300046679 Bacteria 3588
1118 Ga0495623_0036654 3300046679 Bacteria 3140
1119 Ga0495623_0038854 3300046679 Bacteria 3043
1120 Ga0495623_0199566 3300046679 Bacteria 1151
1121 Ga0495623_0250782 3300046679 Bacteria 995
1122 Ga0495623_0257169 3300046679 Bacteria 979
1123 Ga0495623_0340035 3300046679 Bacteria 820
1124 Ga0495646_0005042 3300046680 Bacteria 8329
1125 Ga0495646_0025849 3300046680 Bacteria 3689
1126 Ga0495646_0028003 3300046680 Bacteria 3531
1127 Ga0495646_0037559 3300046680 Bacteria 2994
1128 Ga0495646_0039852 3300046680 Bacteria 2894
1129 Ga0495646_0057582 3300046680 Bacteria 2326
1130 Ga0495646_0080355 3300046680 Bacteria 1901
1131 Ga0495646_0115595 3300046680 Bacteria 1523
1132 Ga0495646_0130583 3300046680 Bacteria 1414
1133 Ga0495647_0007962 3300046681 Bacteria 3562
1134 Ga0495647_0019153 3300046681 Bacteria 2446
1135 Ga0495647_0393803 3300046681 Bacteria 635
1136 Ga0495658_0016908 3300046683 Bacteria 3759
1137 Ga0495658_0040317 3300046683 Bacteria 2596
1138 Ga0495658_0040926 3300046683 Bacteria 2578
1139 Ga0495658_0120110 3300046683 Bacteria 1589
1140 Ga0495658_0307965 3300046683 Bacteria 1002
1141 Ga0495613_0002156 3300046689 Bacteria 14923
1142 Ga0495613_0009703 3300046689 Bacteria 7153
1143 Ga0495613_0019401 3300046689 Bacteria 5067
1144 Ga0495613_0132721 3300046689 Bacteria 1782
1145 Ga0495613_0500211 3300046689 Bacteria 818
1146 Ga0495613_0592315 3300046689 Bacteria 738
1147 Ga0495624_0015997 3300046690 Bacteria 5048
1148 Ga0495624_0020972 3300046690 Bacteria 4339
1149 Ga0495624_0029444 3300046690 Bacteria 3582
1150 Ga0495624_0045155 3300046690 Bacteria 2806
1151 Ga0495624_0071712 3300046690 Bacteria 2155
1152 Ga0495624_0122901 3300046690 Bacteria 1594
1153 Ga0495624_0167336 3300046690 Bacteria 1341
1154 Ga0495624_0277251 3300046690 Bacteria 1012
1155 Ga0495624_0487896 3300046690 Bacteria 737
1156 Ga0495624_0712248 3300046690 Bacteria 595
1157 Ga0495600_0002392 3300046809 Bacteria 10744
1158 Ga0495600_0007406 3300046809 Bacteria 6713
1159 Ga0495600_0008863 3300046809 Bacteria 6198
1160 Ga0495600_0014612 3300046809 Bacteria 4949
1161 Ga0495600_0018948 3300046809 Bacteria 4392
1162 Ga0495600_0028800 3300046809 Bacteria 3594
1163 Ga0495600_0030913 3300046809 Bacteria 3467
1164 Ga0495600_0031250 3300046809 Bacteria 3449
1165 Ga0495600_0060105 3300046809 Bacteria 2481
1166 Ga0495581_0002769 3300047315 Bacteria 9992
1167 Ga0495581_0004995 3300047315 Bacteria 7681
1168 Ga0495581_0018112 3300047315 Bacteria 4090
1169 Ga0495581_0020131 3300047315 Bacteria 3873
1170 Ga0495581_0024095 3300047315 Bacteria 3526
1171 Ga0495581_0067465 3300047315 Bacteria 2069
1172 Ga0495581_0534063 3300047315 Bacteria 681
1173 Ga0495604_0000046 3300047317 Bacteria 110553
1174 Ga0495604_0000228 3300047317 Bacteria 50550
1175 Ga0495604_0002826 3300047317 Bacteria 13937
1176 Ga0495604_0013450 3300047317 Bacteria 6520
1177 Ga0495604_0022707 3300047317 Bacteria 5009
1178 Ga0495604_0049620 3300047317 Bacteria 3259
1179 Ga0495604_0050200 3300047317 Bacteria 3239
1180 Ga0495604_0099974 3300047317 Bacteria 2133
1181 Ga0495604_0109294 3300047317 Bacteria 2018
1182 Ga0495604_0120005 3300047317 Bacteria 1905
1183 Ga0495674_0003211 3300047319 Bacteria 15877
1184 Ga0495674_0003442 3300047319 Bacteria 15375
1185 Ga0495674_0019926 3300047319 Bacteria 6217
1186 Ga0495674_0030826 3300047319 Bacteria 4873
1187 Ga0495674_0042646 3300047319 Bacteria 4045
1188 Ga0495674_0051956 3300047319 Bacteria 3610
1189 Ga0495674_0129752 3300047319 Bacteria 2124
1190 Ga0495674_0140784 3300047319 Bacteria 2028
1191 Ga0495674_0432957 3300047319 Bacteria 1058
1192 Ga0495674_0683723 3300047319 Bacteria 806
1193 Ga0495674_0696598 3300047319 Bacteria 797
1194 Ga0495674_0854150 3300047319 Bacteria 705
1195 Ga0495674_1038019 3300047319 Bacteria 627
1196 Ga0495674_1086482 3300047319 Bacteria 609
1197 Ga0495676_0000806 3300047321 Bacteria 26177
1198 Ga0495676_0017937 3300047321 Bacteria 6247
1199 Ga0495676_0030639 3300047321 Bacteria 4560
1200 Ga0495676_0049985 3300047321 Bacteria 3357
1201 Ga0495676_0057158 3300047321 Bacteria 3080
1202 Ga0495676_0751410 3300047321 Bacteria 629
1203 Ga0495680_0000945 3300047322 Bacteria 32299
1204 Ga0495680_0003754 3300047322 Bacteria 14788
1205 Ga0495680_0017697 3300047322 Bacteria 6071
1206 Ga0495680_0018327 3300047322 Bacteria 5946
1207 Ga0495680_0018740 3300047322 Bacteria 5865
1208 Ga0495680_0049489 3300047322 Bacteria 3291
1209 Ga0495680_0233940 3300047322 Bacteria 1307
1210 Ga0495680_0238739 3300047322 Bacteria 1291
1211 Ga0495680_0310591 3300047322 Bacteria 1105
1212 Ga0495680_0680157 3300047322 Bacteria 681
1213 Ga0495675_0000499 3300047444 Bacteria 25470
1214 Ga0495675_0002981 3300047444 Bacteria 10164
1215 Ga0495675_0004011 3300047444 Bacteria 8922
1216 Ga0495675_0014138 3300047444 Bacteria 5046
1217 Ga0495675_0025759 3300047444 Bacteria 3747
1218 Ga0495675_0025793 3300047444 Bacteria 3745
1219 Ga0495675_0039038 3300047444 Bacteria 3023
1220 Ga0495675_0041553 3300047444 Bacteria 2930
1221 Ga0495675_0158948 3300047444 Bacteria 1392
1222 Ga0495675_0205291 3300047444 Bacteria 1198
1223 Ga0495675_0580629 3300047444 Bacteria 637
1224 Ga0495684_0003724 3300047471 Bacteria 11889
1225 Ga0495684_0014182 3300047471 Bacteria 6131
1226 Ga0495684_0014426 3300047471 Bacteria 6079
1227 Ga0495684_0019877 3300047471 Bacteria 5174
1228 Ga0495684_0040223 3300047471 Bacteria 3584
1229 Ga0495684_0066691 3300047471 Bacteria 2736
1230 Ga0495684_0087800 3300047471 Bacteria 2357
1231 Ga0495684_0179952 3300047471 Bacteria 1567
1232 Ga0495684_0304223 3300047471 Bacteria 1144
1233 Ga0495684_0460732 3300047471 Bacteria 881
1234 Ga0495684_1005398 3300047471 Bacteria 529
1235 Ga0495593_0005718 3300047673 Bacteria 7338
1236 Ga0495593_0010589 3300047673 Bacteria 5319
1237 Ga0495593_0049286 3300047673 Bacteria 2235
1238 Ga0495593_0056946 3300047673 Bacteria 2054
1239 Ga0495593_0129651 3300047673 Bacteria 1280
1240 Ga0495602_0000665 3300048088 Bacteria 32273
1241 Ga0495602_0001500 3300048088 Bacteria 23247
1242 Ga0495602_0011883 3300048088 Bacteria 8986
1243 Ga0495602_0013415 3300048088 Bacteria 8375
1244 Ga0495602_0023155 3300048088 Bacteria 6060
1245 Ga0495602_0035177 3300048088 Bacteria 4673
1246 Ga0495602_0042702 3300048088 Bacteria 4129
1247 Ga0495602_0062906 3300048088 Bacteria 3218
1248 Ga0495602_0086906 3300048088 Bacteria 2608
1249 Ga0495602_0104900 3300048088 Bacteria 2312
1250 Ga0495602_0758297 3300048088 Bacteria 654
1251 Ga0495602_1078528 3300048088 Bacteria 527
1252 Ga0495614_0009295 3300048089 Bacteria 4350
1253 Ga0495614_0023989 3300048089 Bacteria 2632
1254 Ga0495614_0417838 3300048089 Bacteria 632
1255 Ga0496100_0763645 3300048903 Bacteria 756
1256 Ga0496100_1160927 3300048903 Bacteria 609
1257 Ga0496100_1219753 3300048903 Bacteria 593
1258 Ga0496101_0036183 3300048904 Bacteria 3496
1259 Ga0496101_0056982 3300048904 Bacteria 2825
1260 Ga0496101_0098911 3300048904 Bacteria 2180
1261 Ga0496102_0123810 3300048905 Bacteria 2416
1262 Ga0496102_0224376 3300048905 Bacteria 1771
1263 Ga0496102_0444589 3300048905 Bacteria 1216
1264 Ga0496102_1757650 3300048905 Bacteria 538
1265 Ga0496104_0002603 3300048907 Bacteria 15549
1266 Ga0496104_0004158 3300048907 Bacteria 12561
1267 Ga0496104_0362099 3300048907 Bacteria 1363
1268 Ga0496104_0981285 3300048907 Bacteria 749
1269 Ga0496105_0009862 3300048908 Bacteria 7488
1270 Ga0496105_0010437 3300048908 Bacteria 7302
1271 Ga0496105_0075214 3300048908 Bacteria 2789
1272 Ga0496106_0121141 3300048909 Bacteria 2045
1273 Ga0496106_0131481 3300048909 Bacteria 1963
1274 Ga0496106_0339069 3300048909 Bacteria 1207
1275 Ga0496107_0266296 3300048910 Bacteria 1275
1276 Ga0496107_0862765 3300048910 Bacteria 661
1277 Ga0496108_0013908 3300048911 Bacteria 6564
1278 Ga0496108_0056764 3300048911 Bacteria 3290
1279 Ga0496108_0116034 3300048911 Bacteria 2293
1280 Ga0496108_0516765 3300048911 Bacteria 1042
1281 Ga0496108_1252368 3300048911 Bacteria 625
1282 Ga0496109_0096339 3300048912 Bacteria 2741
1283 Ga0496109_0214437 3300048912 Bacteria 1810
1284 Ga0496109_0345827 3300048912 Bacteria 1404
1285 Ga0496109_1044076 3300048912 Bacteria 754
1286 Ga0496110_0082349 3300048913 Bacteria 2870
1287 Ga0496110_0086702 3300048913 Bacteria 2795
1288 Ga0496110_0527163 3300048913 Bacteria 1074
1289 Ga0496111_0003445 3300048914 Bacteria 9784
1290 Ga0496111_0720493 3300048914 Bacteria 725
1291 Ga0496112_0000614 3300048915 Bacteria 24602
1292 Ga0496112_0086248 3300048915 Bacteria 3106
1293 Ga0496112_0125550 3300048915 Bacteria 2537
1294 Ga0496112_0229101 3300048915 Bacteria 1813
1295 Ga0496112_0246985 3300048915 Bacteria 1736
1296 Ga0496112_0250700 3300048915 Bacteria 1721
1297 Ga0496112_1593134 3300048915 Bacteria 566
1298 Ga0496113_0011389 3300048916 Bacteria 5929
1299 Ga0496113_0072589 3300048916 Bacteria 2620
1300 Ga0496113_0138830 3300048916 Bacteria 1911
1301 Ga0496114_0010063 3300048917 Bacteria 7520
1302 Ga0496114_0032026 3300048917 Bacteria 4326
1303 Ga0496114_0161670 3300048917 Bacteria 1948
1304 Ga0496114_0311105 3300048917 Bacteria 1391
1305 Ga0496114_0485635 3300048917 Bacteria 1093
1306 Ga0496115_0028817 3300048918 Bacteria 4354
1307 Ga0496115_0029393 3300048918 Bacteria 4316
1308 Ga0496115_0032352 3300048918 Bacteria 4126
1309 Ga0496115_0165952 3300048918 Bacteria 1826
1310 Ga0496115_0529571 3300048918 Bacteria 944
1311 Ga0496115_0740396 3300048918 Bacteria 769
1312 Ga0496119_0182236 3300048922 Bacteria 1100
1313 Ga0496119_0357606 3300048922 Bacteria 706
1314 Ga0496120_0206444 3300048923 Bacteria 948
1315 Ga0496126_0029650 3300048929 Bacteria 5195
1316 Ga0496126_0045164 3300048929 Bacteria 4051
1317 Ga0496126_0231337 3300048929 Bacteria 1548
1318 Ga0496126_0439879 3300048929 Bacteria 1051
1319 Ga0501031_0002525 3300049568 Bacteria 11650
1320 Ga0501031_0028697 3300049568 Bacteria 3628
1321 Ga0501031_0053735 3300049568 Bacteria 2625
1322 Ga0501031_0065505 3300049568 Bacteria 2367
1323 Ga0501032_0006899 3300049569 Bacteria 8324
1324 Ga0501032_0013107 3300049569 Bacteria 5905
1325 Ga0501033_0007958 3300049570 Bacteria 8210
1326 Ga0501033_0012512 3300049570 Bacteria 6475
1327 Ga0501034_0022552 3300049571 Bacteria 6415
1328 Ga0501034_0028756 3300049571 Bacteria 5655
1329 Ga0501034_0051147 3300049571 Bacteria 4166
1330 Ga0501036_0001456 3300049572 Bacteria 18214
1331 Ga0501036_0022608 3300049572 Bacteria 5290
1332 Ga0501036_0793441 3300049572 Bacteria 780
1333 Ga0501037_0001515 3300049573 Bacteria 16967
1334 Ga0501037_0271113 3300049573 Bacteria 1184
1335 Ga0501037_1023046 3300049573 Bacteria 537
1336 Ga0501038_0003051 3300049574 Bacteria 15613
1337 Ga0501038_0016947 3300049574 Bacteria 6592
1338 Ga0501038_0024839 3300049574 Bacteria 5342
1339 Ga0501039_0010460 3300049575 Bacteria 7070
1340 Ga0501039_0286275 3300049575 Bacteria 1295
1341 Ga0501039_0397551 3300049575 Bacteria 1082
1342 Ga0501040_0005071 3300049576 Bacteria 8508
1343 Ga0501041_0006087 3300049577 Bacteria 7053
1344 Ga0501042_0002632 3300049578 Bacteria 11037
1345 Ga0501042_0269125 3300049578 Bacteria 1230
1346 Ga0501043_0001919 3300049579 Bacteria 17802
1347 Ga0501043_0018384 3300049579 Bacteria 5480
1348 Ga0501043_0065942 3300049579 Bacteria 2843
1349 Ga0501046_0009806 3300049580 Bacteria 8256
1350 Ga0501047_0003804 3300049581 Bacteria 14184
1351 Ga0501047_0030305 3300049581 Bacteria 5216
1352 Ga0501047_0104509 3300049581 Bacteria 2712
1353 Ga0501047_0311545 3300049581 Bacteria 1414
1354 Ga0501047_0318901 3300049581 Bacteria 1394
1355 Ga0501048_0008002 3300049582 Bacteria 8002
1356 Ga0501048_0341824 3300049582 Bacteria 1067
1357 Ga0501067_0001306 3300049583 Bacteria 13495
1358 Ga0501068_0003924 3300049584 Bacteria 8088
1359 Ga0501069_0002663 3300049585 Bacteria 9112
1360 Ga0501070_0010872 3300049586 Bacteria 7688
1361 Ga0501070_0447721 3300049586 Bacteria 1041
1362 Ga0501071_0001744 3300049587 Bacteria 12806
1363 Ga0501072_0007145 3300049588 Bacteria 8473
1364 Ga0501073_0014797 3300049589 Bacteria 5663
1365 Ga0501073_0738945 3300049589 Bacteria 679
1366 Ga0501074_0021798 3300049590 Bacteria 4650
1367 Ga0501076_0014083 3300049592 Bacteria 6012
1368 Ga0501077_0981931 3300049593 Bacteria 543
1369 Ga0501079_0001004 3300049741 Bacteria 19523
1370 Ga0501080_0011027 3300049742 Bacteria 8272
1371 Ga0501080_0814452 3300049742 Bacteria 818
1372 Ga0501081_0435738 3300049743 Bacteria 973
1373 Ga0501083_0006253 3300049744 Bacteria 8449
1374 Ga0501035_0024368 3300049822 Bacteria 5549
1375 Ga0501035_0025025 3300049822 Bacteria 5473
1376 Ga0501035_0038966 3300049822 Bacteria 4302
1377 Ga0501044_0030477 3300049823 Bacteria 5684
1378 Ga0501044_0072689 3300049823 Bacteria 3496
1379 Ga0501044_0186761 3300049823 Bacteria 2037
1380 Ga0501044_0330438 3300049823 Bacteria 1447
1381 Ga0501044_0479033 3300049823 Bacteria 1148
1382 Ga0501045_0026208 3300049824 Bacteria 4191
1383 Ga0501045_0088876 3300049824 Bacteria 2282
1384 Ga0501045_0615833 3300049824 Bacteria 803
1385 nmdc:mga05p37_14396_c1 3300050507 Bacteria 9497
1386 nmdc:mga05p37_556200_c1 3300050507 Bacteria 1305
1387 nmdc:mga06r32_918288_c1 3300050510 Bacteria 831
1388 nmdc:mga0n895_128857_c1 3300050512 Bacteria 2555
1389 nmdc:mga0n895_247660_c1 3300050512 Bacteria 1808
1390 nmdc:mga0n895_59059_c1 3300050512 Bacteria 3784
1391 nmdc:mga0n895_61232_c1 3300050512 Bacteria 3715
1392 nmdc:mga0n895_942547_c1 3300050512 Bacteria 847
1393 nmdc:mga0n895_9995_c1 3300050512 Bacteria 8351
1394 nmdc:mga0rr50_12608_c1 3300050513 Bacteria 5472
1395 nmdc:mga0rr50_1434012_c1 3300050513 Bacteria 584
1396 nmdc:mga0rr50_23626_c1 3300050513 Bacteria 4243
1397 nmdc:mga0rr50_406794_c1 3300050513 Bacteria 1150
1398 nmdc:mga0rr50_43037_c1 3300050513 Bacteria 3302
1399 nmdc:mga08x19_287282_c1 3300050514 Bacteria 1141
1400 nmdc:mga08x19_39221_c1 3300050514 Bacteria 3011
1401 nmdc:mga08x19_457442_c1 3300050514 Bacteria 899
1402 nmdc:mga0a205_115115_c1 3300050515 Bacteria 2588
1403 nmdc:mga0a205_33530_c2 3300050515 Bacteria 3178
1404 Ga0495601_0032480 3300053077 Bacteria 3250
1405 Ga0495601_0072745 3300053077 Bacteria 2196
1406 Ga0495601_0177211 3300053077 Bacteria 1394
1407 Ga0495601_0188972 3300053077 Bacteria 1346
1408 Ga0495601_0211021 3300053077 Bacteria 1268
1409 Ga0495601_0216821 3300053077 Bacteria 1250
1410 Ga0495601_0217408 3300053077 Bacteria 1248
1411 Ga0495601_0353274 3300053077 Bacteria 955
1412 Ga0495601_0685869 3300053077 Bacteria 654
1413 Ga0495612_0014321 3300053078 Bacteria 3190
1414 Ga0495612_0032388 3300053078 Bacteria 2112
1415 Ga0495612_0032532 3300053078 Bacteria 2108
1416 Ga0495612_0062319 3300053078 Bacteria 1546
1417 Ga0495612_0080943 3300053078 Bacteria 1364
1418 Ga0495612_0262615 3300053078 Bacteria 769
1419 Ga0495612_0366879 3300053078 Bacteria 651
1420 Ga0495595_0000195 3300053084 Bacteria 24720
1421 Ga0495595_0006650 3300053084 Bacteria 4720
1422 Ga0495595_0041034 3300053084 Bacteria 2116
1423 Ga0495595_0110183 3300053084 Bacteria 1334
1424 Ga0495595_0134301 3300053084 Bacteria 1211
1425 Ga0495595_0190729 3300053084 Bacteria 1018
1426 Ga0495619_0004590 3300053085 Bacteria 8822
1427 Ga0495619_0024316 3300053085 Bacteria 3884
1428 Ga0495619_0025903 3300053085 Bacteria 3770
1429 Ga0495619_0112143 3300053085 Bacteria 1864
1430 Ga0495619_0148858 3300053085 Bacteria 1614
1431 Ga0495619_0166301 3300053085 Bacteria 1524
1432 Ga0495619_0236964 3300053085 Bacteria 1264
1433 Ga0500573_0458277 3300053140 Bacteria 587
1434 Ga0501084_0006285 3300054114 Bacteria 9762
1435 Ga0587084_033296 3300059477 Bacteria 841
1436 Ga0587066_001727 3300059490 Bacteria 2265
1437 Ga0587070_036740 3300059491 Bacteria 918
1438 Ga0587070_058213 3300059491 Bacteria 791
1439 Ga0587073_0003121 3300059492 Bacteria 2234
1440 Ga0587077_012592 3300059493 Bacteria 1355
1441 Ga0587077_050479 3300059493 Bacteria 869
1442 Ga0587080_027104 3300059503 Bacteria 977
1443 Ga0587080_070428 3300059503 Bacteria 699
1444 Ga0587080_084238 3300059503 Bacteria 657
1445 Ga0587080_150842 3300059503 Bacteria 538
1446 Ga0587082_001729 3300059504 Bacteria 2333
1447 Ga0587082_068501 3300059504 Bacteria 716
1448 Ga0587083_0004124 3300059505 Bacteria 1991
1449 Ga0587083_0026501 3300059505 Bacteria 1119
1450 Ga0587083_0252215 3300059505 Bacteria 526
1451 Ga0587085_001484 3300059506 Bacteria 2180
1452 Ga0587088_028666 3300059508 Bacteria 981
1453 Ga0587090_022207 3300059510 Bacteria 1001
1454 Ga0587091_076204 3300059511 Bacteria 744
1455 Ga0587092_011852 3300059512 Bacteria 1220
1456 Ga0587098_010208 3300059604 Bacteria 1034
1457 Ga0587106_001831 3300059605 Bacteria 1977
1458 Ga0587099_014047 3300059622 Bacteria 841
1459 Ga0587101_032582 3300059623 Bacteria 821
1460 Ga0587109_077802 3300059624 Bacteria 728
1461 Ga0587128_115180 3300059630 Bacteria 579
1462 Ga0587067_089037 3300059640 Bacteria 696
1463 Ga0587067_125448 3300059640 Bacteria 621
1464 Ga0587068_002889 3300059641 Bacteria 2139
1465 Ga0587069_001640 3300059642 Bacteria 2113
1466 Ga0587072_025821 3300059643 Bacteria 1070
1467 Ga0587075_006057 3300059644 Bacteria 1470
1468 Ga0587076_089987 3300059645 Bacteria 669
1469 Ga0587076_198908 3300059645 Bacteria 514
1470 Ga0587079_004561 3300059647 Bacteria 1898
1471 Ga0587079_165666 3300059647 Unclassified 581
1472 Ga0587105_017169 3300059651 Bacteria 608
1473 Ga0587114_134761 3300059655 Bacteria 511
1474 Ga0587119_038793 3300059658 Bacteria 677
1475 Ga0587071_026824 3300060344 Bacteria 1089
1476 Ga0587111_0035881 3300060346 Bacteria 1036
1477 Ga0501082_0024697 3300060353 Bacteria 5180
1478 Ga0466962_0000418 3300061719 Bacteria 18353
1479 Ga0466962_0000646 3300061719 Bacteria 15546
1480 Ga0466962_0035824 3300061719 Bacteria 2374

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 iso_pu_bacteria 2582581314 2585319228 73
2 3300046463 Ga0495653_0753303 Ga0495653_0753303_321_572 75
3 3300046543 Ga0495645_0001626 Ga0495645_0001626_2731_2973 75
4 3300047444 Ga0495675_0014138 Ga0495675_0014138_28_264 75
5 3300005329 Ga0070683_100251156 Ga0070683_1002511562 76
6 3300005548 Ga0070665_100107962 Ga0070665_1001079624 76
7 3300012477 Ga0157336_1002702 Ga0157336_10027022 76
8 3300025944 Ga0207661_10212900 Ga0207661_102129002 76
9 3300028379 Ga0268266_10072591 Ga0268266_100725914 76
10 3300030521 Ga0307511_10054527 Ga0307511_100545273 76
11 3300031616 Ga0307508_10192990 Ga0307508_101929902 76
12 3300044656 Ga0466969_0020209 Ga0466969_0020209_1152_1397 76
13 3300044658 Ga0466972_0013222 Ga0466972_0013222_1629_1874 76
14 3300044683 Ga0466965_0013844 Ga0466965_0013844_1644_1889 76
15 3300044684 Ga0466966_0004138 Ga0466966_0004138_2640_2885 76
16 3300044693 Ga0466961_0000308 Ga0466961_0000308_10828_11073 76
17 3300044694 Ga0466963_0001216 Ga0466963_0001216_10840_11085 76
18 3300044706 Ga0466964_0008093 Ga0466964_0008093_2767_3012 76
19 3300044719 Ga0466971_0001501 Ga0466971_0001501_6831_7076 76
20 3300044765 Ga0466970_0011498 Ga0466970_0011498_1787_2032 76
21 3300044842 Ga0466957_0000605 Ga0466957_0000605_3429_3674 76
22 3300044901 Ga0466960_0359942 Ga0466960_0359942_317_562 76
23 3300045049 Ga0466959_0000486 Ga0466959_0000486_6697_6942 76
24 3300045836 Ga0466958_0000413 Ga0466958_0000413_2582_2827 76
25 3300045976 Ga0466967_0006111 Ga0466967_0006111_6748_6993 76
26 3300046454 Ga0495592_0025240 Ga0495592_0025240_3486_3731 76
27 3300046455 Ga0495603_0013793 Ga0495603_0013793_306_551 76
28 3300046459 Ga0495629_0005355 Ga0495629_0005355_6011_6256 76
29 3300046462 Ga0495651_0009360 Ga0495651_0009360_719_964 76
30 3300046472 Ga0495580_0006900 Ga0495580_0006900_8828_9070 76
31 3300046477 Ga0495664_0034888 Ga0495664_0034888_2101_2346 76
32 3300046492 Ga0495585_0003651 Ga0495585_0003651_5996_6241 76
33 3300046499 Ga0495594_0324225 Ga0495594_0324225_194_439 76
34 3300046499 Ga0495594_0382391 Ga0495594_0382391_389_634 76
35 3300046511 Ga0495608_0774575 Ga0495608_0774575_265_510 76
36 3300046514 Ga0495618_0035024 Ga0495618_0035024_1268_1513 76
37 3300046516 Ga0495628_0358759 Ga0495628_0358759_319_564 76
38 3300046526 Ga0495666_0336761 Ga0495666_0336761_405_650 76
39 3300046529 Ga0495652_0033777 Ga0495652_0033777_471_716 76
40 3300046533 Ga0495640_0005463 Ga0495640_0005463_3845_4090 76
41 3300046533 Ga0495640_0061089 Ga0495640_0061089_1857_2102 76
42 3300046559 Ga0495667_0085983 Ga0495667_0085983_890_1135 76
43 3300046642 Ga0495634_0007306 Ga0495634_0007306_3315_3560 76
44 3300046663 Ga0495635_0682771 Ga0495635_0682771_360_605 76
45 3300046675 Ga0495657_0002470 Ga0495657_0002470_9357_9602 76
46 3300046679 Ga0495623_0199566 Ga0495623_0199566_365_610 76
47 3300046689 Ga0495613_0002156 Ga0495613_0002156_4929_5174 76
48 3300046690 Ga0495624_0020972 Ga0495624_0020972_1861_2106 76
49 3300046690 Ga0495624_0122901 Ga0495624_0122901_1044_1280 76
50 3300046809 Ga0495600_0014612 Ga0495600_0014612_3945_4190 76
51 3300047317 Ga0495604_0013450 Ga0495604_0013450_5810_6055 76
52 3300047321 Ga0495676_0000806 Ga0495676_0000806_2086_2331 76
53 3300047444 Ga0495675_0158948 Ga0495675_0158948_249_494 76
54 3300048918 Ga0496115_0029393 Ga0496115_0029393_3029_3274 76
55 3300049568 Ga0501031_0002525 Ga0501031_0002525_1553_1798 76
56 3300049568 Ga0501031_0053735 Ga0501031_0053735_1552_1797 76
57 3300049568 Ga0501031_0065505 Ga0501031_0065505_1619_1864 76
58 3300049569 Ga0501032_0006899 Ga0501032_0006899_1849_2094 76
59 3300049569 Ga0501032_0013107 Ga0501032_0013107_3039_3284 76
60 3300049570 Ga0501033_0007958 Ga0501033_0007958_2847_3092 76
61 3300049570 Ga0501033_0012512 Ga0501033_0012512_4128_4373 76
62 3300049571 Ga0501034_0022552 Ga0501034_0022552_68_313 76
63 3300049571 Ga0501034_0028756 Ga0501034_0028756_2454_2699 76
64 3300049572 Ga0501036_0001456 Ga0501036_0001456_7152_7397 76
65 3300049572 Ga0501036_0793441 Ga0501036_0793441_126_371 76
66 3300049573 Ga0501037_0001515 Ga0501037_0001515_10509_10754 76
67 3300049573 Ga0501037_1023046 Ga0501037_1023046_57_302 76
68 3300049574 Ga0501038_0003051 Ga0501038_0003051_11349_11594 76
69 3300049574 Ga0501038_0016947 Ga0501038_0016947_4284_4529 76
70 3300049575 Ga0501039_0010460 Ga0501039_0010460_5613_5858 76
71 3300049575 Ga0501039_0397551 Ga0501039_0397551_789_1034 76
72 3300049576 Ga0501040_0005071 Ga0501040_0005071_1964_2209 76
73 3300049577 Ga0501041_0006087 Ga0501041_0006087_4937_5182 76
74 3300049578 Ga0501042_0002632 Ga0501042_0002632_2103_2348 76
75 3300049579 Ga0501043_0001919 Ga0501043_0001919_8966_9211 76
76 3300049579 Ga0501043_0018384 Ga0501043_0018384_3452_3697 76
77 3300049580 Ga0501046_0009806 Ga0501046_0009806_5021_5266 76
78 3300049581 Ga0501047_0003804 Ga0501047_0003804_12396_12641 76
79 3300049581 Ga0501047_0104509 Ga0501047_0104509_1515_1760 76
80 3300049581 Ga0501047_0311545 Ga0501047_0311545_144_389 76
81 3300049581 Ga0501047_0318901 Ga0501047_0318901_969_1214 76
82 3300049582 Ga0501048_0008002 Ga0501048_0008002_1553_1798 76
83 3300049582 Ga0501048_0341824 Ga0501048_0341824_688_933 76
84 3300049583 Ga0501067_0001306 Ga0501067_0001306_11146_11391 76
85 3300049584 Ga0501068_0003924 Ga0501068_0003924_1553_1798 76
86 3300049585 Ga0501069_0002663 Ga0501069_0002663_1866_2111 76
87 3300049586 Ga0501070_0010872 Ga0501070_0010872_1213_1458 76
88 3300049586 Ga0501070_0447721 Ga0501070_0447721_230_475 76
89 3300049587 Ga0501071_0001744 Ga0501071_0001744_9834_10079 76
90 3300049588 Ga0501072_0007145 Ga0501072_0007145_6369_6614 76
91 3300049589 Ga0501073_0014797 Ga0501073_0014797_1213_1458 76
92 3300049590 Ga0501074_0021798 Ga0501074_0021798_1544_1789 76
93 3300049592 Ga0501076_0014083 Ga0501076_0014083_5678_5923 76
94 3300049593 Ga0501077_0981931 Ga0501077_0981931_225_470 76
95 3300049741 Ga0501079_0001004 Ga0501079_0001004_10817_11062 76
96 3300049742 Ga0501080_0011027 Ga0501080_0011027_6815_7060 76
97 3300049743 Ga0501081_0435738 Ga0501081_0435738_355_600 76
98 3300049744 Ga0501083_0006253 Ga0501083_0006253_6103_6348 76
99 3300049822 Ga0501035_0024368 Ga0501035_0024368_5237_5482 76
100 3300049822 Ga0501035_0038966 Ga0501035_0038966_588_833 76
101 3300049823 Ga0501044_0030477 Ga0501044_0030477_305_550 76
102 3300049823 Ga0501044_0186761 Ga0501044_0186761_1167_1412 76
103 3300049823 Ga0501044_0330438 Ga0501044_0330438_975_1220 76
104 3300049824 Ga0501045_0026208 Ga0501045_0026208_2734_2979 76
105 3300049824 Ga0501045_0615833 Ga0501045_0615833_132_377 76
106 3300054114 Ga0501084_0006285 Ga0501084_0006285_7135_7380 76
107 3300059503 Ga0587080_150842 Ga0587080_150842_77_322 76
108 3300060353 Ga0501082_0024697 Ga0501082_0024697_4333_4578 76
109 3300061719 Ga0466962_0000418 Ga0466962_0000418_14807_15052 76
110 3300005458 Ga0070681_10159090 Ga0070681_101590904 77
111 3300005468 Ga0070707_100101696 Ga0070707_1001016963 77
112 3300005530 Ga0070679_100509096 Ga0070679_1005090962 77
113 3300009174 Ga0105241_10457878 Ga0105241_104578782 77
114 3300010375 Ga0105239_10277199 Ga0105239_102771993 77
115 3300014969 Ga0157376_10051720 Ga0157376_100517203 77
116 3300020070 Ga0206356_10985920 Ga0206356_109859202 77
117 3300020075 Ga0206349_1119587 Ga0206349_11195871 77
118 3300020077 Ga0206351_10037739 Ga0206351_100377392 77
119 3300020078 Ga0206352_11066802 Ga0206352_110668021 77
120 3300020080 Ga0206350_10604595 Ga0206350_106045951 77
121 3300020081 Ga0206354_10244137 Ga0206354_102441372 77
122 3300020082 Ga0206353_10488590 Ga0206353_104885902 77
123 3300021388 Ga0213875_10004773 Ga0213875_100047732 77
124 3300021388 Ga0213875_10656986 Ga0213875_106569862 77
125 3300022467 Ga0224712_10010136 Ga0224712_100101364 77
126 3300025912 Ga0207707_10135386 Ga0207707_101353863 77
127 3300025921 Ga0207652_10416766 Ga0207652_104167662 77
128 3300025922 Ga0207646_10250177 Ga0207646_102501773 77
129 3300025944 Ga0207661_10116325 Ga0207661_101163252 77
130 3300030760 Ga0265762_1067450 Ga0265762_10674501 77
131 3300030763 Ga0265763_1058010 Ga0265763_10580101 77
132 3300030836 Ga0265767_104426 Ga0265767_1044262 77
133 3300031018 Ga0265773_1046377 Ga0265773_10463772 77
134 3300033179 Ga0307507_10282288 Ga0307507_102822882 77
135 3300033545 Ga0316214_1033205 Ga0316214_10332052 77
136 3300033547 Ga0316212_1055053 Ga0316212_10550531 77
137 3300036457 Ga0265778_031182 Ga0265778_031182_135_380 77
138 3300037853 Ga0436364_0154449 Ga0436364_0154449_3170_3418 77
139 3300037853 Ga0436364_0473068 Ga0436364_0473068_8840_9085 77
140 3300039450 Ga0436363_0139691 Ga0436363_0139691_701_946 77
141 3300041460 Ga0451802_1306807 Ga0451802_1306807_260_508 77
142 3300046459 Ga0495629_0063999 Ga0495629_0063999_2261_2509 77
143 3300046476 Ga0495662_0265038 Ga0495662_0265038_28_276 77
144 3300046675 Ga0495657_0212448 Ga0495657_0212448_841_1083 77
145 3300047315 Ga0495581_0534063 Ga0495581_0534063_389_637 77
146 3300047444 Ga0495675_0580629 Ga0495675_0580629_124_372 77
147 3300049568 Ga0501031_0028697 Ga0501031_0028697_207_455 77
148 3300049571 Ga0501034_0051147 Ga0501034_0051147_2011_2259 77
149 3300049572 Ga0501036_0022608 Ga0501036_0022608_1007_1255 77
150 3300049573 Ga0501037_0271113 Ga0501037_0271113_651_899 77
151 3300049574 Ga0501038_0024839 Ga0501038_0024839_3810_4058 77
152 3300049575 Ga0501039_0286275 Ga0501039_0286275_938_1186 77
153 3300049579 Ga0501043_0065942 Ga0501043_0065942_805_1053 77
154 3300049581 Ga0501047_0030305 Ga0501047_0030305_2765_3013 77
155 3300049589 Ga0501073_0738945 Ga0501073_0738945_214_462 77
156 3300049742 Ga0501080_0814452 Ga0501080_0814452_530_778 77
157 3300049822 Ga0501035_0025025 Ga0501035_0025025_1735_1983 77
158 3300049823 Ga0501044_0072689 Ga0501044_0072689_1514_1762 77
159 3300049824 Ga0501045_0088876 Ga0501045_0088876_848_1096 77
160 3300005329 Ga0070683_100778167 Ga0070683_1007781672 78
161 3300005330 Ga0070690_100055382 Ga0070690_1000553822 78
162 3300005334 Ga0068869_100329025 Ga0068869_1003290252 78
163 3300005341 Ga0070691_10172164 Ga0070691_101721642 78
164 3300005344 Ga0070661_101508581 Ga0070661_1015085811 78
165 3300005354 Ga0070675_100893622 Ga0070675_1008936222 78
166 3300005355 Ga0070671_101684271 Ga0070671_1016842711 78
167 3300005434 Ga0070709_10315735 Ga0070709_103157351 78
168 3300005434 Ga0070709_10435447 Ga0070709_104354471 78
169 3300005434 Ga0070709_10953895 Ga0070709_109538951 78
170 3300005435 Ga0070714_100283298 Ga0070714_1002832981 78
171 3300005435 Ga0070714_100618253 Ga0070714_1006182532 78
172 3300005435 Ga0070714_100701643 Ga0070714_1007016432 78
173 3300005435 Ga0070714_101107702 Ga0070714_1011077022 78
174 3300005435 Ga0070714_101604840 Ga0070714_1016048402 78
175 3300005436 Ga0070713_100249244 Ga0070713_1002492441 78
176 3300005436 Ga0070713_101633896 Ga0070713_1016338961 78
177 3300005437 Ga0070710_10077995 Ga0070710_100779954 78
178 3300005437 Ga0070710_10088701 Ga0070710_100887013 78
179 3300005437 Ga0070710_10457206 Ga0070710_104572062 78
180 3300005437 Ga0070710_11099300 Ga0070710_110993002 78
181 3300005439 Ga0070711_100012750 Ga0070711_1000127502 78
182 3300005440 Ga0070705_100018473 Ga0070705_1000184734 78
183 3300005458 Ga0070681_10674733 Ga0070681_106747331 78
184 3300005467 Ga0070706_100483497 Ga0070706_1004834971 78
185 3300005468 Ga0070707_100259475 Ga0070707_1002594752 78
186 3300005471 Ga0070698_100350458 Ga0070698_1003504582 78
187 3300005535 Ga0070684_100342356 Ga0070684_1003423562 78
188 3300005539 Ga0068853_100935707 Ga0068853_1009357072 78
189 3300005545 Ga0070695_100315611 Ga0070695_1003156112 78
190 3300005547 Ga0070693_101265711 Ga0070693_1012657112 78
191 3300005548 Ga0070665_100082418 Ga0070665_1000824185 78
192 3300005563 Ga0068855_100043409 Ga0068855_1000434094 78
193 3300005564 Ga0070664_101038175 Ga0070664_1010381752 78
194 3300005564 Ga0070664_101884539 Ga0070664_1018845391 78
195 3300005577 Ga0068857_100532929 Ga0068857_1005329292 78
196 3300005614 Ga0068856_100141608 Ga0068856_1001416081 78
197 3300005614 Ga0068856_101928667 Ga0068856_1019286671 78
198 3300005616 Ga0068852_100597126 Ga0068852_1005971263 78
199 3300005616 Ga0068852_102585941 Ga0068852_1025859411 78
200 3300005618 Ga0068864_100039258 Ga0068864_1000392583 78
201 3300005618 Ga0068864_101175556 Ga0068864_1011755561 78
202 3300005841 Ga0068863_100135702 Ga0068863_1001357023 78
203 3300005842 Ga0068858_100039859 Ga0068858_1000398595 78
204 3300005843 Ga0068860_100134199 Ga0068860_1001341992 78
205 3300006028 Ga0070717_10348029 Ga0070717_103480292 78
206 3300006028 Ga0070717_10908699 Ga0070717_109086992 78
207 3300006028 Ga0070717_11456826 Ga0070717_114568262 78
208 3300006028 Ga0070717_11504774 Ga0070717_115047741 78
209 3300006163 Ga0070715_10006797 Ga0070715_100067973 78
210 3300006163 Ga0070715_10018682 Ga0070715_100186824 78
211 3300006173 Ga0070716_100077382 Ga0070716_1000773821 78
212 3300006173 Ga0070716_100189516 Ga0070716_1001895162 78
213 3300006175 Ga0070712_100102931 Ga0070712_1001029312 78
214 3300006175 Ga0070712_100241384 Ga0070712_1002413842 78
215 3300006175 Ga0070712_101008824 Ga0070712_1010088242 78
216 3300006175 Ga0070712_101088169 Ga0070712_1010881692 78
217 3300006237 Ga0097621_100007903 Ga0097621_10000790310 78
218 3300006358 Ga0068871_100021758 Ga0068871_1000217583 78
219 3300006871 Ga0075434_101101119 Ga0075434_1011011192 78
220 3300006914 Ga0075436_100299300 Ga0075436_1002993003 78
221 3300007076 Ga0075435_100882691 Ga0075435_1008826912 78
222 3300009098 Ga0105245_10034447 Ga0105245_100344476 78
223 3300009101 Ga0105247_10585715 Ga0105247_105857151 78
224 3300009148 Ga0105243_12793001 Ga0105243_127930011 78
225 3300009174 Ga0105241_10155785 Ga0105241_101557853 78
226 3300009545 Ga0105237_10092550 Ga0105237_100925503 78
227 3300009551 Ga0105238_12039787 Ga0105238_120397872 78
228 3300009553 Ga0105249_11502816 Ga0105249_115028161 78
229 3300010375 Ga0105239_10857671 Ga0105239_108576712 78
230 3300011119 Ga0105246_11028559 Ga0105246_110285592 78
231 3300013102 Ga0157371_11163750 Ga0157371_111637502 78
232 3300013104 Ga0157370_10076283 Ga0157370_100762834 78
233 3300013105 Ga0157369_10146354 Ga0157369_101463542 78
234 3300013105 Ga0157369_10723063 Ga0157369_107230632 78
235 3300013296 Ga0157374_10101651 Ga0157374_101016513 78
236 3300013297 Ga0157378_10962660 Ga0157378_109626602 78
237 3300013306 Ga0163162_10182402 Ga0163162_101824022 78
238 3300013307 Ga0157372_10502436 Ga0157372_105024363 78
239 3300013308 Ga0157375_10038053 Ga0157375_100380534 78
240 3300014325 Ga0163163_10015458 Ga0163163_100154586 78
241 3300014325 Ga0163163_10203058 Ga0163163_102030583 78
242 3300014968 Ga0157379_10073167 Ga0157379_100731674 78
243 3300014969 Ga0157376_10933642 Ga0157376_109336421 78
244 3300020069 Ga0197907_10248340 Ga0197907_102483401 78
245 3300020070 Ga0206356_10292195 Ga0206356_102921952 78
246 3300020077 Ga0206351_10322884 Ga0206351_103228842 78
247 3300020080 Ga0206350_11618886 Ga0206350_116188862 78
248 3300020081 Ga0206354_10522195 Ga0206354_105221952 78
249 3300021388 Ga0213875_10014503 Ga0213875_100145034 78
250 3300021388 Ga0213875_10042294 Ga0213875_100422942 78
251 3300022467 Ga0224712_10030399 Ga0224712_100303994 78
252 3300022467 Ga0224712_10141026 Ga0224712_101410262 78
253 3300025898 Ga0207692_10010145 Ga0207692_100101455 78
254 3300025898 Ga0207692_10029033 Ga0207692_100290335 78
255 3300025898 Ga0207692_10061660 Ga0207692_100616602 78
256 3300025898 Ga0207692_10674206 Ga0207692_106742062 78
257 3300025898 Ga0207692_10821351 Ga0207692_108213511 78
258 3300025905 Ga0207685_10004954 Ga0207685_100049544 78
259 3300025905 Ga0207685_10266466 Ga0207685_102664662 78
260 3300025906 Ga0207699_10020453 Ga0207699_100204533 78
261 3300025906 Ga0207699_10022185 Ga0207699_100221854 78
262 3300025906 Ga0207699_10438784 Ga0207699_104387842 78
263 3300025908 Ga0207643_11016131 Ga0207643_110161312 78
264 3300025910 Ga0207684_10403565 Ga0207684_104035652 78
265 3300025914 Ga0207671_10055156 Ga0207671_100551563 78
266 3300025915 Ga0207693_10045344 Ga0207693_100453444 78
267 3300025915 Ga0207693_10112993 Ga0207693_101129932 78
268 3300025915 Ga0207693_10402908 Ga0207693_104029082 78
269 3300025916 Ga0207663_10067381 Ga0207663_100673812 78
270 3300025916 Ga0207663_11217685 Ga0207663_112176851 78
271 3300025916 Ga0207663_11422879 Ga0207663_114228791 78
272 3300025922 Ga0207646_10527795 Ga0207646_105277952 78
273 3300025924 Ga0207694_10499316 Ga0207694_104993162 78
274 3300025927 Ga0207687_10206836 Ga0207687_102068362 78
275 3300025928 Ga0207700_10002475 Ga0207700_1000247510 78
276 3300025928 Ga0207700_10004682 Ga0207700_100046822 78
277 3300025928 Ga0207700_10012430 Ga0207700_100124306 78
278 3300025929 Ga0207664_10007512 Ga0207664_100075124 78
279 3300025929 Ga0207664_10247927 Ga0207664_102479272 78
280 3300025929 Ga0207664_10323395 Ga0207664_103233952 78
281 3300025929 Ga0207664_10348591 Ga0207664_103485911 78
282 3300025929 Ga0207664_10406636 Ga0207664_104066362 78
283 3300025929 Ga0207664_10859873 Ga0207664_108598732 78
284 3300025929 Ga0207664_11105282 Ga0207664_111052822 78
285 3300025929 Ga0207664_11412417 Ga0207664_114124171 78
286 3300025931 Ga0207644_10544546 Ga0207644_105445462 78
287 3300025931 Ga0207644_11829955 Ga0207644_118299552 78
288 3300025935 Ga0207709_11459291 Ga0207709_114592912 78
289 3300025939 Ga0207665_10032752 Ga0207665_100327524 78
290 3300025944 Ga0207661_10514854 Ga0207661_105148542 78
291 3300025949 Ga0207667_10029339 Ga0207667_100293394 78
292 3300026023 Ga0207677_11361491 Ga0207677_113614912 78
293 3300026041 Ga0207639_12210933 Ga0207639_122109332 78
294 3300026078 Ga0207702_10056901 Ga0207702_100569015 78
295 3300026078 Ga0207702_10406590 Ga0207702_104065902 78
296 3300026088 Ga0207641_10553374 Ga0207641_105533742 78
297 3300026095 Ga0207676_10011596 Ga0207676_100115962 78
298 3300026095 Ga0207676_10914172 Ga0207676_109141722 78
299 3300026116 Ga0207674_10129863 Ga0207674_101298633 78
300 3300026142 Ga0207698_10287883 Ga0207698_102878833 78
301 3300028379 Ga0268266_10029996 Ga0268266_100299964 78
302 3300028381 Ga0268264_10028663 Ga0268264_100286634 78
303 3300031616 Ga0307508_10615040 Ga0307508_106150402 78
304 3300034816 Ga0373930_0133767 Ga0373930_0133767_321_578 78
305 3300035086 Ga0373934_0274228 Ga0373934_0274228_202_462 78
306 3300035086 Ga0373934_0299360 Ga0373934_0299360_95_352 78
307 3300035089 Ga0373944_0020925 Ga0373944_0020925_26_283 78
308 3300035112 Ga0373932_0404827 Ga0373932_0404827_254_511 78
309 3300035113 Ga0373936_0084159 Ga0373936_0084159_253_510 78
310 3300035116 Ga0373945_0319092 Ga0373945_0319092_351_608 78
311 3300035117 Ga0373953_0112115 Ga0373953_0112115_506_763 78
312 3300035118 Ga0373954_0292582 Ga0373954_0292582_446_697 78
313 3300035120 Ga0373957_0043313 Ga0373957_0043313_1415_1672 78
314 3300035170 Ga0373943_0072775 Ga0373943_0072775_1296_1553 78
315 3300035170 Ga0373943_0609411 Ga0373943_0609411_351_608 78
316 3300035172 Ga0373955_0099225 Ga0373955_0099225_706_966 78
317 3300035172 Ga0373955_0507870 Ga0373955_0507870_230_481 78
318 3300035410 Ga0373924_0176543 Ga0373924_0176543_635_892 78
319 3300035410 Ga0373924_0247338 Ga0373924_0247338_389_649 78
320 3300035410 Ga0373924_0552787 Ga0373924_0552787_251_502 78
321 3300035691 Ga0373931_0248686 Ga0373931_0248686_630_887 78
322 3300035695 Ga0373927_0993800 Ga0373927_0993800_267_524 78
323 3300035724 Ga0373933_0142585 Ga0373933_0142585_657_917 78
324 3300035724 Ga0373933_0200359 Ga0373933_0200359_750_1007 78
325 3300035725 Ga0373947_0468150 Ga0373947_0468150_157_414 78
326 3300036401 Ga0373937_0105274 Ga0373937_0105274_2196_2453 78
327 3300036401 Ga0373937_0257489 Ga0373937_0257489_1164_1424 78
328 3300036401 Ga0373937_0343497 Ga0373937_0343497_342_593 78
329 3300036401 Ga0373937_0818313 Ga0373937_0818313_30_287 78
330 3300037068 Ga0373925_0002980 Ga0373925_0002980_5193_5444 78
331 3300037068 Ga0373925_0164427 Ga0373925_0164427_566_823 78
332 3300037068 Ga0373925_0477371 Ga0373925_0477371_714_971 78
333 3300037068 Ga0373925_0609073 Ga0373925_0609073_246_506 78
334 3300037068 Ga0373925_1486462 Ga0373925_1486462_142_399 78
335 3300037853 Ga0436364_0414011 Ga0436364_0414011_3246_3488 78
336 3300037853 Ga0436364_0739436 Ga0436364_0739436_577_825 78
337 3300039447 Ga0436361_0395439 Ga0436361_0395439_210_461 78
338 3300044656 Ga0466969_0007996 Ga0466969_0007996_2638_2880 78
339 3300044656 Ga0466969_0019529 Ga0466969_0019529_793_1047 78
340 3300044684 Ga0466966_0007040 Ga0466966_0007040_1141_1383 78
341 3300044684 Ga0466966_0007200 Ga0466966_0007200_4960_5217 78
342 3300044693 Ga0466961_0000436 Ga0466961_0000436_8856_9113 78
343 3300044693 Ga0466961_0027746 Ga0466961_0027746_1379_1621 78
344 3300044719 Ga0466971_0001300 Ga0466971_0001300_5084_5341 78
345 3300044735 Ga0466968_0268230 Ga0466968_0268230_324_578 78
346 3300044842 Ga0466957_0016273 Ga0466957_0016273_1248_1505 78
347 3300045049 Ga0466959_0010220 Ga0466959_0010220_3332_3589 78
348 3300045836 Ga0466958_0636610 Ga0466958_0636610_411_668 78
349 3300046454 Ga0495592_0006577 Ga0495592_0006577_1953_2204 78
350 3300046454 Ga0495592_0019141 Ga0495592_0019141_734_994 78
351 3300046454 Ga0495592_0051071 Ga0495592_0051071_159_416 78
352 3300046454 Ga0495592_0157133 Ga0495592_0157133_107_358 78
353 3300046455 Ga0495603_0146574 Ga0495603_0146574_49_306 78
354 3300046462 Ga0495651_0001369 Ga0495651_0001369_13943_14200 78
355 3300046462 Ga0495651_0005490 Ga0495651_0005490_5671_5931 78
356 3300046462 Ga0495651_0012552 Ga0495651_0012552_1212_1463 78
357 3300046463 Ga0495653_0010635 Ga0495653_0010635_291_542 78
358 3300046463 Ga0495653_0015934 Ga0495653_0015934_2086_2346 78
359 3300046463 Ga0495653_0029994 Ga0495653_0029994_2411_2668 78
360 3300046463 Ga0495653_0621474 Ga0495653_0621474_296_547 78
361 3300046472 Ga0495580_0181747 Ga0495580_0181747_1157_1414 78
362 3300046475 Ga0495639_0309831 Ga0495639_0309831_502_759 78
363 3300046475 Ga0495639_0617609 Ga0495639_0617609_193_444 78
364 3300046476 Ga0495662_0000786 Ga0495662_0000786_4175_4426 78
365 3300046476 Ga0495662_0020529 Ga0495662_0020529_2077_2334 78
366 3300046477 Ga0495664_0013776 Ga0495664_0013776_1936_2187 78
367 3300046477 Ga0495664_0196269 Ga0495664_0196269_789_1046 78
368 3300046477 Ga0495664_0488162 Ga0495664_0488162_248_508 78
369 3300046499 Ga0495594_0658028 Ga0495594_0658028_209_460 78
370 3300046511 Ga0495608_0005072 Ga0495608_0005072_2629_2889 78
371 3300046511 Ga0495608_0020406 Ga0495608_0020406_1453_1704 78
372 3300046511 Ga0495608_0050212 Ga0495608_0050212_1692_1949 78
373 3300046511 Ga0495608_0096316 Ga0495608_0096316_908_1165 78
374 3300046514 Ga0495618_0015240 Ga0495618_0015240_2429_2674 78
375 3300046514 Ga0495618_0055095 Ga0495618_0055095_398_655 78
376 3300046514 Ga0495618_0115027 Ga0495618_0115027_162_422 78
377 3300046516 Ga0495628_0000710 Ga0495628_0000710_1170_1421 78
378 3300046516 Ga0495628_0008150 Ga0495628_0008150_6261_6521 78
379 3300046516 Ga0495628_0067754 Ga0495628_0067754_395_652 78
380 3300046516 Ga0495628_1046664 Ga0495628_1046664_239_490 78
381 3300046517 Ga0495630_0058747 Ga0495630_0058747_1413_1664 78
382 3300046517 Ga0495630_0379644 Ga0495630_0379644_799_1056 78
383 3300046526 Ga0495666_0015980 Ga0495666_0015980_2541_2792 78
384 3300046526 Ga0495666_0090196 Ga0495666_0090196_210_467 78
385 3300046529 Ga0495652_0015833 Ga0495652_0015833_5670_5930 78
386 3300046529 Ga0495652_0018764 Ga0495652_0018764_2413_2664 78
387 3300046529 Ga0495652_0030748 Ga0495652_0030748_1558_1815 78
388 3300046531 Ga0495665_0006864 Ga0495665_0006864_5073_5324 78
389 3300046533 Ga0495640_0004646 Ga0495640_0004646_794_1045 78
390 3300046533 Ga0495640_0043992 Ga0495640_0043992_1949_2206 78
391 3300046533 Ga0495640_0059300 Ga0495640_0059300_242_502 78
392 3300046533 Ga0495640_0182105 Ga0495640_0182105_85_336 78
393 3300046535 Ga0495586_0016555 Ga0495586_0016555_3256_3513 78
394 3300046536 Ga0495587_0008083 Ga0495587_0008083_6448_6705 78
395 3300046536 Ga0495587_0011368 Ga0495587_0011368_5074_5325 78
396 3300046536 Ga0495587_0012422 Ga0495587_0012422_4692_4952 78
397 3300046536 Ga0495587_0666527 Ga0495587_0666527_256_495 78
398 3300046543 Ga0495645_0002428 Ga0495645_0002428_3464_3715 78
399 3300046543 Ga0495645_0099214 Ga0495645_0099214_1688_1948 78
400 3300046543 Ga0495645_0478454 Ga0495645_0478454_475_732 78
401 3300046543 Ga0495645_0837807 Ga0495645_0837807_157_408 78
402 3300046559 Ga0495667_0000582 Ga0495667_0000582_15479_15739 78
403 3300046559 Ga0495667_0000718 Ga0495667_0000718_9548_9799 78
404 3300046559 Ga0495667_0012096 Ga0495667_0012096_3136_3393 78
405 3300046559 Ga0495667_0406212 Ga0495667_0406212_160_408 78
406 3300046642 Ga0495634_0010584 Ga0495634_0010584_5133_5384 78
407 3300046642 Ga0495634_0065755 Ga0495634_0065755_964_1209 78
408 3300046642 Ga0495634_0300973 Ga0495634_0300973_189_446 78
409 3300046642 Ga0495634_0836412 Ga0495634_0836412_64_315 78
410 3300046663 Ga0495635_0013902 Ga0495635_0013902_164_415 78
411 3300046663 Ga0495635_0036263 Ga0495635_0036263_700_960 78
412 3300046663 Ga0495635_0385366 Ga0495635_0385366_157_417 78
413 3300046663 Ga0495635_0549050 Ga0495635_0549050_341_592 78
414 3300046674 Ga0495588_0120244 Ga0495588_0120244_804_1061 78
415 3300046675 Ga0495657_0002604 Ga0495657_0002604_7783_8043 78
416 3300046675 Ga0495657_0015845 Ga0495657_0015845_794_1045 78
417 3300046675 Ga0495657_0025129 Ga0495657_0025129_3136_3393 78
418 3300046675 Ga0495657_0629802 Ga0495657_0629802_184_423 78
419 3300046678 Ga0495599_0012215 Ga0495599_0012215_1751_2011 78
420 3300046678 Ga0495599_0043725 Ga0495599_0043725_2269_2520 78
421 3300046678 Ga0495599_0114825 Ga0495599_0114825_841_1098 78
422 3300046679 Ga0495623_0010849 Ga0495623_0010849_445_696 78
423 3300046679 Ga0495623_0038854 Ga0495623_0038854_1228_1485 78
424 3300046679 Ga0495623_0340035 Ga0495623_0340035_110_370 78
425 3300046680 Ga0495646_0025849 Ga0495646_0025849_1170_1421 78
426 3300046680 Ga0495646_0028003 Ga0495646_0028003_872_1132 78
427 3300046680 Ga0495646_0080355 Ga0495646_0080355_1359_1616 78
428 3300046680 Ga0495646_0115595 Ga0495646_0115595_1246_1497 78
429 3300046681 Ga0495647_0019153 Ga0495647_0019153_2143_2400 78
430 3300046683 Ga0495658_0040317 Ga0495658_0040317_1446_1703 78
431 3300046689 Ga0495613_0500211 Ga0495613_0500211_498_755 78
432 3300046689 Ga0495613_0592315 Ga0495613_0592315_467_706 78
433 3300046690 Ga0495624_0277251 Ga0495624_0277251_72_329 78
434 3300046809 Ga0495600_0002392 Ga0495600_0002392_3051_3311 78
435 3300046809 Ga0495600_0018948 Ga0495600_0018948_1288_1545 78
436 3300046809 Ga0495600_0060105 Ga0495600_0060105_794_1045 78
437 3300047315 Ga0495581_0020131 Ga0495581_0020131_2617_2868 78
438 3300047315 Ga0495581_0067465 Ga0495581_0067465_1285_1542 78
439 3300047317 Ga0495604_0000228 Ga0495604_0000228_10000_10251 78
440 3300047317 Ga0495604_0002826 Ga0495604_0002826_5170_5430 78
441 3300047317 Ga0495604_0109294 Ga0495604_0109294_1694_1951 78
442 3300047319 Ga0495674_0019926 Ga0495674_0019926_2541_2792 78
443 3300047319 Ga0495674_0042646 Ga0495674_0042646_438_698 78
444 3300047319 Ga0495674_1038019 Ga0495674_1038019_344_589 78
445 3300047319 Ga0495674_1086482 Ga0495674_1086482_326_583 78
446 3300047321 Ga0495676_0751410 Ga0495676_0751410_149_406 78
447 3300047322 Ga0495680_0003754 Ga0495680_0003754_7414_7674 78
448 3300047322 Ga0495680_0049489 Ga0495680_0049489_1135_1392 78
449 3300047322 Ga0495680_0680157 Ga0495680_0680157_100_351 78
450 3300047444 Ga0495675_0004011 Ga0495675_0004011_5389_5640 78
451 3300047444 Ga0495675_0025793 Ga0495675_0025793_2453_2710 78
452 3300047444 Ga0495675_0205291 Ga0495675_0205291_829_1089 78
453 3300047471 Ga0495684_0003724 Ga0495684_0003724_8241_8498 78
454 3300047471 Ga0495684_0014426 Ga0495684_0014426_3796_4056 78
455 3300047471 Ga0495684_0040223 Ga0495684_0040223_922_1173 78
456 3300047471 Ga0495684_0304223 Ga0495684_0304223_86_337 78
457 3300047673 Ga0495593_0049286 Ga0495593_0049286_1297_1548 78
458 3300048088 Ga0495602_0001500 Ga0495602_0001500_4128_4388 78
459 3300048088 Ga0495602_0035177 Ga0495602_0035177_794_1045 78
460 3300048088 Ga0495602_0042702 Ga0495602_0042702_1217_1474 78
461 3300048088 Ga0495602_0758297 Ga0495602_0758297_255_506 78
462 3300048903 Ga0496100_1160927 Ga0496100_1160927_68_325 78
463 3300048904 Ga0496101_0056982 Ga0496101_0056982_624_881 78
464 3300048907 Ga0496104_0002603 Ga0496104_0002603_17_271 78
465 3300048907 Ga0496104_0004158 Ga0496104_0004158_2222_2479 78
466 3300048908 Ga0496105_0009862 Ga0496105_0009862_5228_5485 78
467 3300048908 Ga0496105_0010437 Ga0496105_0010437_1704_1958 78
468 3300048909 Ga0496106_0121141 Ga0496106_0121141_1747_2004 78
469 3300048909 Ga0496106_0339069 Ga0496106_0339069_291_545 78
470 3300048910 Ga0496107_0862765 Ga0496107_0862765_20_277 78
471 3300048911 Ga0496108_0013908 Ga0496108_0013908_2362_2619 78
472 3300048911 Ga0496108_0116034 Ga0496108_0116034_1210_1464 78
473 3300048912 Ga0496109_0096339 Ga0496109_0096339_1631_1885 78
474 3300048912 Ga0496109_0214437 Ga0496109_0214437_372_629 78
475 3300048913 Ga0496110_0082349 Ga0496110_0082349_2240_2494 78
476 3300048913 Ga0496110_0086702 Ga0496110_0086702_569_826 78
477 3300048914 Ga0496111_0003445 Ga0496111_0003445_2799_3056 78
478 3300048915 Ga0496112_0000614 Ga0496112_0000614_17902_18156 78
479 3300048915 Ga0496112_0125550 Ga0496112_0125550_955_1212 78
480 3300048916 Ga0496113_0011389 Ga0496113_0011389_2126_2380 78
481 3300048916 Ga0496113_0072589 Ga0496113_0072589_2197_2454 78
482 3300048917 Ga0496114_0032026 Ga0496114_0032026_1933_2190 78
483 3300048917 Ga0496114_0161670 Ga0496114_0161670_1315_1569 78
484 3300048918 Ga0496115_0032352 Ga0496115_0032352_1259_1513 78
485 3300048918 Ga0496115_0165952 Ga0496115_0165952_1259_1516 78
486 3300048918 Ga0496115_0529571 Ga0496115_0529571_119_370 78
487 3300048929 Ga0496126_0045164 Ga0496126_0045164_1687_1938 78
488 3300048929 Ga0496126_0231337 Ga0496126_0231337_528_779 78
489 3300049823 Ga0501044_0479033 Ga0501044_0479033_586_831 78
490 3300050512 nmdc:mga0n895_59059_c1 nmdc:mga0n895_59059_c1_157_414 78
491 3300050513 nmdc:mga0rr50_406794_c1 nmdc:mga0rr50_406794_c1_423_680 78
492 3300053077 Ga0495601_0032480 Ga0495601_0032480_1719_1970 78
493 3300053077 Ga0495601_0177211 Ga0495601_0177211_826_1086 78
494 3300053077 Ga0495601_0211021 Ga0495601_0211021_866_1123 78
495 3300053077 Ga0495601_0685869 Ga0495601_0685869_161_412 78
496 3300053078 Ga0495612_0032388 Ga0495612_0032388_1505_1762 78
497 3300053078 Ga0495612_0032532 Ga0495612_0032532_1722_1982 78
498 3300053084 Ga0495595_0110183 Ga0495595_0110183_326_583 78
499 3300053085 Ga0495619_0024316 Ga0495619_0024316_404_661 78
500 3300053085 Ga0495619_0148858 Ga0495619_0148858_1167_1418 78
501 3300053085 Ga0495619_0166301 Ga0495619_0166301_1012_1272 78
502 3300053140 Ga0500573_0458277 Ga0500573_0458277_120_371 78
503 3300059491 Ga0587070_058213 Ga0587070_058213_109_360 78
504 3300059503 Ga0587080_070428 Ga0587080_070428_364_606 78
505 3300059505 Ga0587083_0252215 Ga0587083_0252215_109_357 78
506 3300059640 Ga0587067_125448 Ga0587067_125448_103_345 78
507 3300061719 Ga0466962_0000646 Ga0466962_0000646_9725_9982 78
508 3300005434 Ga0070709_11544106 Ga0070709_115441061 79
509 3300005435 Ga0070714_100002366 Ga0070714_10000236610 79
510 3300005436 Ga0070713_100537537 Ga0070713_1005375373 79
511 3300005436 Ga0070713_100949027 Ga0070713_1009490271 79
512 3300005436 Ga0070713_101560868 Ga0070713_1015608682 79
513 3300005436 Ga0070713_102059441 Ga0070713_1020594412 79
514 3300005439 Ga0070711_101340796 Ga0070711_1013407961 79
515 3300005468 Ga0070707_100001170 Ga0070707_1000011705 79
516 3300005468 Ga0070707_100086908 Ga0070707_1000869081 79
517 3300005471 Ga0070698_100000350 Ga0070698_10000035030 79
518 3300005471 Ga0070698_100175181 Ga0070698_1001751814 79
519 3300005471 Ga0070698_101843002 Ga0070698_1018430021 79
520 3300005616 Ga0068852_101212194 Ga0068852_1012121942 79
521 3300006028 Ga0070717_10344856 Ga0070717_103448562 79
522 3300006028 Ga0070717_10486255 Ga0070717_104862552 79
523 3300006028 Ga0070717_11910520 Ga0070717_119105201 79
524 3300006175 Ga0070712_100422685 Ga0070712_1004226852 79
525 3300013105 Ga0157369_10070021 Ga0157369_100700215 79
526 3300020069 Ga0197907_11395272 Ga0197907_113952722 79
527 3300020070 Ga0206356_10463876 Ga0206356_104638762 79
528 3300020076 Ga0206355_1214635 Ga0206355_12146352 79
529 3300020080 Ga0206350_10030057 Ga0206350_100300572 79
530 3300020081 Ga0206354_10870360 Ga0206354_108703602 79
531 3300020610 Ga0154015_1639779 Ga0154015_16397792 79
532 3300021388 Ga0213875_10000956 Ga0213875_1000095613 79
533 3300021388 Ga0213875_10586726 Ga0213875_105867262 79
534 3300025906 Ga0207699_10992616 Ga0207699_109926162 79
535 3300025910 Ga0207684_10013477 Ga0207684_100134778 79
536 3300025922 Ga0207646_10000071 Ga0207646_1000007147 79
537 3300025928 Ga0207700_10472036 Ga0207700_104720363 79
538 3300025929 Ga0207664_10001093 Ga0207664_100010939 79
539 3300028800 Ga0265338_10001163 Ga0265338_1000116334 79
540 3300030522 Ga0307512_10440784 Ga0307512_104407842 79
541 3300031616 Ga0307508_10016193 Ga0307508_100161938 79
542 3300033180 Ga0307510_10040783 Ga0307510_100407834 79
543 3300035086 Ga0373934_0000004 Ga0373934_0000004_85081_85335 79
544 3300035111 Ga0373923_0523177 Ga0373923_0523177_58_336 79
545 3300035113 Ga0373936_0536937 Ga0373936_0536937_115_390 79
546 3300035116 Ga0373945_0119713 Ga0373945_0119713_214_489 79
547 3300035117 Ga0373953_0000281 Ga0373953_0000281_9953_10207 79
548 3300035117 Ga0373953_0428917 Ga0373953_0428917_135_410 79
549 3300035118 Ga0373954_0000410 Ga0373954_0000410_7625_7879 79
550 3300035118 Ga0373954_0150501 Ga0373954_0150501_42_302 79
551 3300035119 Ga0373956_0003293 Ga0373956_0003293_5354_5608 79
552 3300035119 Ga0373956_0115093 Ga0373956_0115093_874_1149 79
553 3300035120 Ga0373957_0002278 Ga0373957_0002278_177_431 79
554 3300035171 Ga0373946_0018705 Ga0373946_0018705_1428_1703 79
555 3300035172 Ga0373955_0000041 Ga0373955_0000041_30651_30905 79
556 3300035410 Ga0373924_0001289 Ga0373924_0001289_3687_3941 79
557 3300035692 Ga0373935_1149551 Ga0373935_1149551_239_514 79
558 3300035724 Ga0373933_0000246 Ga0373933_0000246_9753_10007 79
559 3300035724 Ga0373933_0426112 Ga0373933_0426112_250_525 79
560 3300036401 Ga0373937_0000172 Ga0373937_0000172_20315_20569 79
561 3300037853 Ga0436364_0140940 Ga0436364_0140940_249_503 79
562 3300037853 Ga0436364_0584067 Ga0436364_0584067_74901_75149 79
563 3300039437 Ga0436365_0705632 Ga0436365_0705632_265_540 79
564 3300044684 Ga0466966_0038909 Ga0466966_0038909_1060_1305 79
565 3300044694 Ga0466963_1221569 Ga0466963_1221569_180_437 79
566 3300044719 Ga0466971_0076730 Ga0466971_0076730_314_559 79
567 3300044735 Ga0466968_0209808 Ga0466968_0209808_647_895 79
568 3300044765 Ga0466970_0015532 Ga0466970_0015532_2629_2874 79
569 3300044765 Ga0466970_0672102 Ga0466970_0672102_312_566 79
570 3300044765 Ga0466970_0803495 Ga0466970_0803495_92_349 79
571 3300045049 Ga0466959_0080452 Ga0466959_0080452_447_704 79
572 3300045049 Ga0466959_0663883 Ga0466959_0663883_226_471 79
573 3300045049 Ga0466959_0756776 Ga0466959_0756776_215_463 79
574 3300046454 Ga0495592_0000417 Ga0495592_0000417_20315_20569 79
575 3300046454 Ga0495592_0082763 Ga0495592_0082763_1228_1503 79
576 3300046459 Ga0495629_0190702 Ga0495629_0190702_1100_1375 79
577 3300046461 Ga0495641_0236811 Ga0495641_0236811_492_767 79
578 3300046462 Ga0495651_0000118 Ga0495651_0000118_37846_38100 79
579 3300046463 Ga0495653_0004695 Ga0495653_0004695_38_292 79
580 3300046475 Ga0495639_0187768 Ga0495639_0187768_155_430 79
581 3300046476 Ga0495662_0067471 Ga0495662_0067471_1081_1356 79
582 3300046477 Ga0495664_0860218 Ga0495664_0860218_47_322 79
583 3300046511 Ga0495608_0000156 Ga0495608_0000156_28303_28557 79
584 3300046514 Ga0495618_0158512 Ga0495618_0158512_576_851 79
585 3300046514 Ga0495618_0745498 Ga0495618_0745498_207_461 79
586 3300046516 Ga0495628_0000655 Ga0495628_0000655_21632_21886 79
587 3300046516 Ga0495628_0399610 Ga0495628_0399610_247_522 79
588 3300046517 Ga0495630_0064005 Ga0495630_0064005_2138_2413 79
589 3300046529 Ga0495652_0000436 Ga0495652_0000436_20315_20569 79
590 3300046529 Ga0495652_0185401 Ga0495652_0185401_618_893 79
591 3300046533 Ga0495640_0062145 Ga0495640_0062145_810_1085 79
592 3300046536 Ga0495587_0000045 Ga0495587_0000045_87794_88048 79
593 3300046543 Ga0495645_0046690 Ga0495645_0046690_2404_2679 79
594 3300046543 Ga0495645_0190114 Ga0495645_0190114_479_733 79
595 3300046559 Ga0495667_0000051 Ga0495667_0000051_88709_88963 79
596 3300046559 Ga0495667_0175687 Ga0495667_0175687_1068_1328 79
597 3300046663 Ga0495635_0193271 Ga0495635_0193271_224_499 79
598 3300046675 Ga0495657_0000044 Ga0495657_0000044_87815_88069 79
599 3300046678 Ga0495599_0000127 Ga0495599_0000127_28180_28434 79
600 3300046678 Ga0495599_0277317 Ga0495599_0277317_412_687 79
601 3300046679 Ga0495623_0003177 Ga0495623_0003177_8176_8430 79
602 3300046680 Ga0495646_0005042 Ga0495646_0005042_4824_5078 79
603 3300046680 Ga0495646_0057582 Ga0495646_0057582_350_625 79
604 3300046690 Ga0495624_0071712 Ga0495624_0071712_147_422 79
605 3300046809 Ga0495600_0008863 Ga0495600_0008863_2402_2656 79
606 3300047317 Ga0495604_0000046 Ga0495604_0000046_88727_88981 79
607 3300047317 Ga0495604_0120005 Ga0495604_0120005_918_1193 79
608 3300047319 Ga0495674_0003211 Ga0495674_0003211_1878_2153 79
609 3300047319 Ga0495674_0696598 Ga0495674_0696598_146_406 79
610 3300047321 Ga0495676_0057158 Ga0495676_0057158_750_1025 79
611 3300047322 Ga0495680_0000945 Ga0495680_0000945_11731_11985 79
612 3300047322 Ga0495680_0310591 Ga0495680_0310591_626_871 79
613 3300047444 Ga0495675_0000499 Ga0495675_0000499_4929_5183 79
614 3300047471 Ga0495684_0087800 Ga0495684_0087800_1274_1549 79
615 3300047471 Ga0495684_1005398 Ga0495684_1005398_125_385 79
616 3300048088 Ga0495602_0000665 Ga0495602_0000665_20315_20569 79
617 3300048088 Ga0495602_0104900 Ga0495602_0104900_484_759 79
618 3300048915 Ga0496112_1593134 Ga0496112_1593134_231_488 79
619 3300053077 Ga0495601_0216821 Ga0495601_0216821_382_657 79
620 3300053078 Ga0495612_0014321 Ga0495612_0014321_2582_2857 79
621 3300053084 Ga0495595_0000195 Ga0495595_0000195_12773_13027 79
622 3300059655 Ga0587114_134761 Ga0587114_134761_199_456 79
623 3300061719 Ga0466962_0035824 Ga0466962_0035824_1994_2239 79
624 3300004800 Ga0058861_11672637 Ga0058861_116726372 80
625 3300004803 Ga0058862_12609771 Ga0058862_126097712 80
626 3300005327 Ga0070658_10011984 Ga0070658_100119847 80
627 3300005327 Ga0070658_11417108 Ga0070658_114171082 80
628 3300005329 Ga0070683_100040113 Ga0070683_1000401134 80
629 3300005329 Ga0070683_100408571 Ga0070683_1004085711 80
630 3300005330 Ga0070690_100009520 Ga0070690_1000095203 80
631 3300005333 Ga0070677_10600628 Ga0070677_106006282 80
632 3300005336 Ga0070680_100472138 Ga0070680_1004721382 80
633 3300005336 Ga0070680_100682556 Ga0070680_1006825562 80
634 3300005337 Ga0070682_101536225 Ga0070682_1015362252 80
635 3300005339 Ga0070660_100517110 Ga0070660_1005171101 80
636 3300005339 Ga0070660_101269121 Ga0070660_1012691212 80
637 3300005344 Ga0070661_100213623 Ga0070661_1002136231 80
638 3300005345 Ga0070692_10374080 Ga0070692_103740802 80
639 3300005355 Ga0070671_100165384 Ga0070671_1001653842 80
640 3300005356 Ga0070674_100744850 Ga0070674_1007448502 80
641 3300005364 Ga0070673_100038521 Ga0070673_1000385211 80
642 3300005406 Ga0070703_10085630 Ga0070703_100856302 80
643 3300005434 Ga0070709_10047666 Ga0070709_100476664 80
644 3300005434 Ga0070709_10053200 Ga0070709_100532005 80
645 3300005434 Ga0070709_10176433 Ga0070709_101764333 80
646 3300005435 Ga0070714_100035689 Ga0070714_1000356892 80
647 3300005435 Ga0070714_100043909 Ga0070714_1000439095 80
648 3300005435 Ga0070714_100113551 Ga0070714_1001135512 80
649 3300005435 Ga0070714_100420235 Ga0070714_1004202352 80
650 3300005435 Ga0070714_100659807 Ga0070714_1006598072 80
651 3300005435 Ga0070714_100795801 Ga0070714_1007958012 80
652 3300005435 Ga0070714_101039527 Ga0070714_1010395271 80
653 3300005435 Ga0070714_101638758 Ga0070714_1016387581 80
654 3300005436 Ga0070713_100016977 Ga0070713_1000169775 80
655 3300005436 Ga0070713_100053073 Ga0070713_1000530734 80
656 3300005436 Ga0070713_100130632 Ga0070713_1001306323 80
657 3300005436 Ga0070713_100262886 Ga0070713_1002628863 80
658 3300005436 Ga0070713_100580706 Ga0070713_1005807062 80
659 3300005436 Ga0070713_100687085 Ga0070713_1006870852 80
660 3300005436 Ga0070713_101348329 Ga0070713_1013483291 80
661 3300005436 Ga0070713_101433349 Ga0070713_1014333492 80
662 3300005436 Ga0070713_101881463 Ga0070713_1018814631 80
663 3300005437 Ga0070710_10001320 Ga0070710_100013206 80
664 3300005437 Ga0070710_10039384 Ga0070710_100393842 80
665 3300005437 Ga0070710_10411724 Ga0070710_104117241 80
666 3300005437 Ga0070710_11412628 Ga0070710_114126281 80
667 3300005438 Ga0070701_10960782 Ga0070701_109607821 80
668 3300005439 Ga0070711_100000491 Ga0070711_1000004915 80
669 3300005439 Ga0070711_100016584 Ga0070711_1000165845 80
670 3300005439 Ga0070711_100327400 Ga0070711_1003274003 80
671 3300005439 Ga0070711_100561015 Ga0070711_1005610152 80
672 3300005439 Ga0070711_101245254 Ga0070711_1012452542 80
673 3300005440 Ga0070705_100504767 Ga0070705_1005047672 80
674 3300005444 Ga0070694_100436581 Ga0070694_1004365812 80
675 3300005445 Ga0070708_100006587 Ga0070708_10000658710 80
676 3300005445 Ga0070708_100012652 Ga0070708_1000126526 80
677 3300005445 Ga0070708_100080328 Ga0070708_1000803282 80
678 3300005445 Ga0070708_100379011 Ga0070708_1003790113 80
679 3300005445 Ga0070708_100426597 Ga0070708_1004265972 80
680 3300005445 Ga0070708_100539369 Ga0070708_1005393692 80
681 3300005445 Ga0070708_100683237 Ga0070708_1006832371 80
682 3300005455 Ga0070663_100674356 Ga0070663_1006743562 80
683 3300005455 Ga0070663_101641516 Ga0070663_1016415161 80
684 3300005458 Ga0070681_10141220 Ga0070681_101412204 80
685 3300005458 Ga0070681_10349589 Ga0070681_103495892 80
686 3300005458 Ga0070681_10892248 Ga0070681_108922481 80
687 3300005467 Ga0070706_100009451 Ga0070706_1000094515 80
688 3300005467 Ga0070706_100028300 Ga0070706_1000283005 80
689 3300005467 Ga0070706_100238137 Ga0070706_1002381373 80
690 3300005467 Ga0070706_100252109 Ga0070706_1002521091 80
691 3300005467 Ga0070706_100294440 Ga0070706_1002944403 80
692 3300005467 Ga0070706_100312582 Ga0070706_1003125822 80
693 3300005468 Ga0070707_100037310 Ga0070707_1000373103 80
694 3300005468 Ga0070707_100055617 Ga0070707_1000556175 80
695 3300005468 Ga0070707_100113207 Ga0070707_1001132074 80
696 3300005468 Ga0070707_100142934 Ga0070707_1001429343 80
697 3300005468 Ga0070707_101432501 Ga0070707_1014325011 80
698 3300005468 Ga0070707_101925277 Ga0070707_1019252771 80
699 3300005471 Ga0070698_100000957 Ga0070698_10000095715 80
700 3300005471 Ga0070698_100035043 Ga0070698_1000350435 80
701 3300005471 Ga0070698_100048696 Ga0070698_1000486964 80
702 3300005471 Ga0070698_100066053 Ga0070698_1000660532 80
703 3300005471 Ga0070698_100133559 Ga0070698_1001335592 80
704 3300005471 Ga0070698_100326036 Ga0070698_1003260361 80
705 3300005471 Ga0070698_100612530 Ga0070698_1006125302 80
706 3300005471 Ga0070698_101792033 Ga0070698_1017920332 80
707 3300005518 Ga0070699_100137056 Ga0070699_1001370564 80
708 3300005518 Ga0070699_100229315 Ga0070699_1002293152 80
709 3300005518 Ga0070699_100380804 Ga0070699_1003808042 80
710 3300005535 Ga0070684_100097156 Ga0070684_1000971564 80
711 3300005535 Ga0070684_100221838 Ga0070684_1002218382 80
712 3300005535 Ga0070684_100472097 Ga0070684_1004720972 80
713 3300005536 Ga0070697_100005931 Ga0070697_1000059318 80
714 3300005536 Ga0070697_100044930 Ga0070697_1000449302 80
715 3300005536 Ga0070697_100187224 Ga0070697_1001872243 80
716 3300005536 Ga0070697_100651313 Ga0070697_1006513132 80
717 3300005548 Ga0070665_100235441 Ga0070665_1002354413 80
718 3300005577 Ga0068857_100082356 Ga0068857_1000823564 80
719 3300005577 Ga0068857_100162346 Ga0068857_1001623464 80
720 3300005577 Ga0068857_100300873 Ga0068857_1003008732 80
721 3300005614 Ga0068856_100267775 Ga0068856_1002677753 80
722 3300005614 Ga0068856_100391787 Ga0068856_1003917872 80
723 3300005614 Ga0068856_100556784 Ga0068856_1005567842 80
724 3300005616 Ga0068852_102304688 Ga0068852_1023046882 80
725 3300005618 Ga0068864_100526975 Ga0068864_1005269751 80
726 3300005719 Ga0068861_100250243 Ga0068861_1002502433 80
727 3300005983 Ga0081540_1000250 Ga0081540_100025035 80
728 3300006028 Ga0070717_10000595 Ga0070717_1000059518 80
729 3300006028 Ga0070717_10030253 Ga0070717_100302532 80
730 3300006028 Ga0070717_10034269 Ga0070717_100342694 80
731 3300006028 Ga0070717_10114761 Ga0070717_101147613 80
732 3300006028 Ga0070717_10123370 Ga0070717_101233703 80
733 3300006028 Ga0070717_10166902 Ga0070717_101669023 80
734 3300006028 Ga0070717_10194019 Ga0070717_101940193 80
735 3300006028 Ga0070717_10253428 Ga0070717_102534282 80
736 3300006028 Ga0070717_10704492 Ga0070717_107044922 80
737 3300006028 Ga0070717_10859627 Ga0070717_108596272 80
738 3300006028 Ga0070717_12018134 Ga0070717_120181342 80
739 3300006163 Ga0070715_10155538 Ga0070715_101555381 80
740 3300006163 Ga0070715_10581662 Ga0070715_105816622 80
741 3300006163 Ga0070715_11019986 Ga0070715_110199862 80
742 3300006173 Ga0070716_100002986 Ga0070716_1000029869 80
743 3300006173 Ga0070716_100004137 Ga0070716_1000041374 80
744 3300006173 Ga0070716_100304061 Ga0070716_1003040612 80
745 3300006173 Ga0070716_100883262 Ga0070716_1008832621 80
746 3300006173 Ga0070716_101448088 Ga0070716_1014480882 80
747 3300006175 Ga0070712_100000461 Ga0070712_1000004615 80
748 3300006175 Ga0070712_100022849 Ga0070712_1000228495 80
749 3300006175 Ga0070712_100046905 Ga0070712_1000469054 80
750 3300006175 Ga0070712_100299746 Ga0070712_1002997462 80
751 3300006175 Ga0070712_100820865 Ga0070712_1008208652 80
752 3300006175 Ga0070712_101259931 Ga0070712_1012599312 80
753 3300006237 Ga0097621_100190433 Ga0097621_1001904332 80
754 3300006237 Ga0097621_102058403 Ga0097621_1020584031 80
755 3300006852 Ga0075433_10006954 Ga0075433_1000695410 80
756 3300006871 Ga0075434_100065438 Ga0075434_1000654384 80
757 3300006871 Ga0075434_100395537 Ga0075434_1003955372 80
758 3300006871 Ga0075434_101106231 Ga0075434_1011062312 80
759 3300006871 Ga0075434_102046974 Ga0075434_1020469741 80
760 3300006914 Ga0075436_100029644 Ga0075436_1000296444 80
761 3300006914 Ga0075436_100409271 Ga0075436_1004092712 80
762 3300007076 Ga0075435_100015899 Ga0075435_1000158994 80
763 3300007265 Ga0099794_10065151 Ga0099794_100651512 80
764 3300007265 Ga0099794_10372503 Ga0099794_103725031 80
765 3300007788 Ga0099795_10011048 Ga0099795_100110482 80
766 3300009093 Ga0105240_11324241 Ga0105240_113242411 80
767 3300009093 Ga0105240_12721051 Ga0105240_127210512 80
768 3300009101 Ga0105247_10691761 Ga0105247_106917612 80
769 3300009174 Ga0105241_10513486 Ga0105241_105134862 80
770 3300009176 Ga0105242_11357624 Ga0105242_113576242 80
771 3300009545 Ga0105237_10664482 Ga0105237_106644822 80
772 3300009551 Ga0105238_12822183 Ga0105238_128221832 80
773 3300010159 Ga0099796_10415423 Ga0099796_104154231 80
774 3300010375 Ga0105239_12790518 Ga0105239_127905182 80
775 3300013059 Ga0154012_125040 Ga0154012_1250401 80
776 3300013102 Ga0157371_10111937 Ga0157371_101119372 80
777 3300013102 Ga0157371_10583273 Ga0157371_105832732 80
778 3300013104 Ga0157370_10672125 Ga0157370_106721251 80
779 3300013105 Ga0157369_10172803 Ga0157369_101728032 80
780 3300013105 Ga0157369_10206472 Ga0157369_102064724 80
781 3300013105 Ga0157369_11609267 Ga0157369_116092672 80
782 3300013105 Ga0157369_11625271 Ga0157369_116252711 80
783 3300013296 Ga0157374_10387799 Ga0157374_103877991 80
784 3300013306 Ga0163162_10103045 Ga0163162_101030454 80
785 3300013307 Ga0157372_11130963 Ga0157372_111309632 80
786 3300020069 Ga0197907_11233163 Ga0197907_112331632 80
787 3300020069 Ga0197907_11416400 Ga0197907_114164002 80
788 3300020070 Ga0206356_11150882 Ga0206356_111508822 80
789 3300020070 Ga0206356_11439059 Ga0206356_114390592 80
790 3300020075 Ga0206349_1169648 Ga0206349_11696482 80
791 3300020075 Ga0206349_1457189 Ga0206349_14571892 80
792 3300020075 Ga0206349_1555218 Ga0206349_15552182 80
793 3300020076 Ga0206355_1032308 Ga0206355_10323082 80
794 3300020076 Ga0206355_1487130 Ga0206355_14871302 80
795 3300020077 Ga0206351_10476555 Ga0206351_104765554 80
796 3300020077 Ga0206351_10479162 Ga0206351_104791622 80
797 3300020078 Ga0206352_10444969 Ga0206352_104449692 80
798 3300020078 Ga0206352_10466689 Ga0206352_104666891 80
799 3300020078 Ga0206352_10594696 Ga0206352_105946962 80
800 3300020078 Ga0206352_10871456 Ga0206352_108714564 80
801 3300020080 Ga0206350_10080394 Ga0206350_100803942 80
802 3300020080 Ga0206350_10625460 Ga0206350_106254602 80
803 3300020080 Ga0206350_10800850 Ga0206350_108008502 80
804 3300020081 Ga0206354_10393601 Ga0206354_103936012 80
805 3300020082 Ga0206353_10363191 Ga0206353_103631913 80
806 3300020610 Ga0154015_1032811 Ga0154015_10328114 80
807 3300021384 Ga0213876_10445050 Ga0213876_104450502 80
808 3300021388 Ga0213875_10462994 Ga0213875_104629942 80
809 3300022467 Ga0224712_10002390 Ga0224712_100023904 80
810 3300022467 Ga0224712_10039219 Ga0224712_100392192 80
811 3300022467 Ga0224712_10185905 Ga0224712_101859052 80
812 3300022467 Ga0224712_10373500 Ga0224712_103735002 80
813 3300022734 Ga0224571_111971 Ga0224571_1119712 80
814 3300024225 Ga0224572_1020179 Ga0224572_10201792 80
815 3300024227 Ga0228598_1005048 Ga0228598_10050484 80
816 3300025898 Ga0207692_10001193 Ga0207692_100011939 80
817 3300025898 Ga0207692_10017774 Ga0207692_100177744 80
818 3300025898 Ga0207692_10026148 Ga0207692_100261484 80
819 3300025898 Ga0207692_10111092 Ga0207692_101110923 80
820 3300025898 Ga0207692_10151320 Ga0207692_101513202 80
821 3300025904 Ga0207647_10172408 Ga0207647_101724082 80
822 3300025905 Ga0207685_10338829 Ga0207685_103388292 80
823 3300025905 Ga0207685_10693111 Ga0207685_106931111 80
824 3300025906 Ga0207699_10000107 Ga0207699_1000010746 80
825 3300025906 Ga0207699_10036028 Ga0207699_100360284 80
826 3300025906 Ga0207699_10149433 Ga0207699_101494332 80
827 3300025907 Ga0207645_10033143 Ga0207645_100331434 80
828 3300025909 Ga0207705_10273042 Ga0207705_102730422 80
829 3300025909 Ga0207705_10691701 Ga0207705_106917012 80
830 3300025909 Ga0207705_11514720 Ga0207705_115147201 80
831 3300025910 Ga0207684_10001220 Ga0207684_1000122031 80
832 3300025910 Ga0207684_10026750 Ga0207684_100267502 80
833 3300025910 Ga0207684_10087833 Ga0207684_100878332 80
834 3300025910 Ga0207684_10108575 Ga0207684_101085754 80
835 3300025910 Ga0207684_10138322 Ga0207684_101383222 80
836 3300025910 Ga0207684_10478107 Ga0207684_104781071 80
837 3300025910 Ga0207684_10767717 Ga0207684_107677172 80
838 3300025910 Ga0207684_10840982 Ga0207684_108409822 80
839 3300025911 Ga0207654_11142263 Ga0207654_111422631 80
840 3300025912 Ga0207707_10717493 Ga0207707_107174932 80
841 3300025912 Ga0207707_10754734 Ga0207707_107547341 80
842 3300025913 Ga0207695_10719509 Ga0207695_107195092 80
843 3300025915 Ga0207693_10000536 Ga0207693_1000053620 80
844 3300025915 Ga0207693_10046258 Ga0207693_100462584 80
845 3300025915 Ga0207693_10062052 Ga0207693_100620524 80
846 3300025915 Ga0207693_10182558 Ga0207693_101825582 80
847 3300025915 Ga0207693_10308419 Ga0207693_103084191 80
848 3300025915 Ga0207693_10356136 Ga0207693_103561363 80
849 3300025916 Ga0207663_10002645 Ga0207663_100026456 80
850 3300025916 Ga0207663_10112814 Ga0207663_101128143 80
851 3300025916 Ga0207663_10167043 Ga0207663_101670432 80
852 3300025916 Ga0207663_10489690 Ga0207663_104896901 80
853 3300025916 Ga0207663_10543772 Ga0207663_105437722 80
854 3300025916 Ga0207663_11031751 Ga0207663_110317512 80
855 3300025917 Ga0207660_10705090 Ga0207660_107050901 80
856 3300025917 Ga0207660_11458075 Ga0207660_114580752 80
857 3300025918 Ga0207662_10017924 Ga0207662_100179244 80
858 3300025922 Ga0207646_10004644 Ga0207646_1000464412 80
859 3300025922 Ga0207646_10053134 Ga0207646_100531345 80
860 3300025922 Ga0207646_10081632 Ga0207646_100816324 80
861 3300025922 Ga0207646_10089695 Ga0207646_100896953 80
862 3300025922 Ga0207646_10129584 Ga0207646_101295842 80
863 3300025922 Ga0207646_10273592 Ga0207646_102735922 80
864 3300025928 Ga0207700_10001550 Ga0207700_100015508 80
865 3300025928 Ga0207700_10004514 Ga0207700_100045147 80
866 3300025928 Ga0207700_10005025 Ga0207700_100050259 80
867 3300025928 Ga0207700_10065993 Ga0207700_100659932 80
868 3300025928 Ga0207700_10463627 Ga0207700_104636272 80
869 3300025928 Ga0207700_10707776 Ga0207700_107077762 80
870 3300025928 Ga0207700_10729369 Ga0207700_107293692 80
871 3300025928 Ga0207700_11312096 Ga0207700_113120961 80
872 3300025928 Ga0207700_11427056 Ga0207700_114270562 80
873 3300025929 Ga0207664_10000271 Ga0207664_1000027122 80
874 3300025929 Ga0207664_10001238 Ga0207664_100012385 80
875 3300025929 Ga0207664_10056328 Ga0207664_100563283 80
876 3300025929 Ga0207664_10059312 Ga0207664_100593124 80
877 3300025929 Ga0207664_10083912 Ga0207664_100839122 80
878 3300025929 Ga0207664_10456934 Ga0207664_104569342 80
879 3300025929 Ga0207664_10621560 Ga0207664_106215602 80
880 3300025929 Ga0207664_10764118 Ga0207664_107641182 80
881 3300025929 Ga0207664_11035318 Ga0207664_110353182 80
882 3300025929 Ga0207664_11411711 Ga0207664_114117112 80
883 3300025934 Ga0207686_10884203 Ga0207686_108842032 80
884 3300025937 Ga0207669_10204328 Ga0207669_102043282 80
885 3300025939 Ga0207665_10000930 Ga0207665_100009306 80
886 3300025939 Ga0207665_10004087 Ga0207665_100040875 80
887 3300025939 Ga0207665_10079555 Ga0207665_100795553 80
888 3300025939 Ga0207665_10474529 Ga0207665_104745291 80
889 3300025944 Ga0207661_10187931 Ga0207661_101879311 80
890 3300025945 Ga0207679_10668455 Ga0207679_106684552 80
891 3300025960 Ga0207651_10447834 Ga0207651_104478342 80
892 3300026067 Ga0207678_10012040 Ga0207678_100120408 80
893 3300026078 Ga0207702_10351167 Ga0207702_103511672 80
894 3300026078 Ga0207702_10654278 Ga0207702_106542782 80
895 3300026095 Ga0207676_10899628 Ga0207676_108996282 80
896 3300026116 Ga0207674_10032442 Ga0207674_100324423 80
897 3300026116 Ga0207674_10067802 Ga0207674_100678024 80
898 3300026116 Ga0207674_10275748 Ga0207674_102757482 80
899 3300026118 Ga0207675_100121346 Ga0207675_1001213461 80
900 3300027671 Ga0209588_1115268 Ga0209588_11152681 80
901 3300028379 Ga0268266_10051856 Ga0268266_100518563 80
902 3300028379 Ga0268266_11621160 Ga0268266_116211602 80
903 3300028800 Ga0265338_10006190 Ga0265338_1000619012 80
904 3300028800 Ga0265338_10007955 Ga0265338_100079554 80
905 3300030760 Ga0265762_1094099 Ga0265762_10940992 80
906 3300030888 Ga0265769_117130 Ga0265769_1171301 80
907 3300030963 Ga0265768_107244 Ga0265768_1072442 80
908 3300031090 Ga0265760_10007779 Ga0265760_100077795 80
909 3300031090 Ga0265760_10126069 Ga0265760_101260692 80
910 3300031090 Ga0265760_10328797 Ga0265760_103287971 80
911 3300032120 Ga0316053_114716 Ga0316053_1147161 80
912 3300034817 Ga0373948_0008622 Ga0373948_0008622_333_584 80
913 3300035083 Ga0373926_0005462 Ga0373926_0005462_1616_1870 80
914 3300035083 Ga0373926_0007800 Ga0373926_0007800_2945_3199 80
915 3300035086 Ga0373934_0012410 Ga0373934_0012410_2307_2570 80
916 3300035086 Ga0373934_0039669 Ga0373934_0039669_976_1239 80
917 3300035111 Ga0373923_0000882 Ga0373923_0000882_5887_6150 80
918 3300035111 Ga0373923_0009292 Ga0373923_0009292_1151_1405 80
919 3300035111 Ga0373923_0503805 Ga0373923_0503805_191_454 80
920 3300035111 Ga0373923_0573445 Ga0373923_0573445_122_385 80
921 3300035113 Ga0373936_0011067 Ga0373936_0011067_430_693 80
922 3300035113 Ga0373936_0180219 Ga0373936_0180219_620_883 80
923 3300035116 Ga0373945_0023202 Ga0373945_0023202_797_1051 80
924 3300035116 Ga0373945_0247970 Ga0373945_0247970_74_337 80
925 3300035117 Ga0373953_0017197 Ga0373953_0017197_775_1038 80
926 3300035117 Ga0373953_0020341 Ga0373953_0020341_1559_1810 80
927 3300035118 Ga0373954_0051745 Ga0373954_0051745_1602_1865 80
928 3300035118 Ga0373954_0172827 Ga0373954_0172827_149_412 80
929 3300035118 Ga0373954_0270691 Ga0373954_0270691_45_311 80
930 3300035119 Ga0373956_0011860 Ga0373956_0011860_1016_1279 80
931 3300035120 Ga0373957_0070229 Ga0373957_0070229_153_413 80
932 3300035120 Ga0373957_0499196 Ga0373957_0499196_194_457 80
933 3300035170 Ga0373943_0054217 Ga0373943_0054217_543_797 80
934 3300035170 Ga0373943_0066786 Ga0373943_0066786_1157_1408 80
935 3300035170 Ga0373943_0262213 Ga0373943_0262213_587_850 80
936 3300035171 Ga0373946_0002228 Ga0373946_0002228_1024_1278 80
937 3300035171 Ga0373946_0028833 Ga0373946_0028833_44_307 80
938 3300035171 Ga0373946_0751229 Ga0373946_0751229_183_446 80
939 3300035172 Ga0373955_0010850 Ga0373955_0010850_1056_1307 80
940 3300035172 Ga0373955_0016273 Ga0373955_0016273_1187_1450 80
941 3300035172 Ga0373955_0457218 Ga0373955_0457218_322_585 80
942 3300035410 Ga0373924_0001785 Ga0373924_0001785_2068_2331 80
943 3300035691 Ga0373931_0421898 Ga0373931_0421898_435_686 80
944 3300035691 Ga0373931_1204719 Ga0373931_1204719_19_270 80
945 3300035692 Ga0373935_0019194 Ga0373935_0019194_554_808 80
946 3300035692 Ga0373935_0088777 Ga0373935_0088777_415_666 80
947 3300035692 Ga0373935_0277132 Ga0373935_0277132_316_579 80
948 3300035692 Ga0373935_0334345 Ga0373935_0334345_354_617 80
949 3300035695 Ga0373927_0017574 Ga0373927_0017574_109_363 80
950 3300035695 Ga0373927_0402972 Ga0373927_0402972_448_699 80
951 3300035695 Ga0373927_0847497 Ga0373927_0847497_167_430 80
952 3300035724 Ga0373933_0019494 Ga0373933_0019494_985_1245 80
953 3300035724 Ga0373933_0036950 Ga0373933_0036950_2594_2848 80
954 3300035724 Ga0373933_0067376 Ga0373933_0067376_47_307 80
955 3300035724 Ga0373933_0093485 Ga0373933_0093485_661_924 80
956 3300035725 Ga0373947_0025215 Ga0373947_0025215_2392_2646 80
957 3300035725 Ga0373947_0095616 Ga0373947_0095616_330_581 80
958 3300035725 Ga0373947_0690198 Ga0373947_0690198_99_362 80
959 3300036401 Ga0373937_0046875 Ga0373937_0046875_1801_2064 80
960 3300036401 Ga0373937_0097188 Ga0373937_0097188_632_895 80
961 3300036401 Ga0373937_0107833 Ga0373937_0107833_2233_2487 80
962 3300036401 Ga0373937_0981276 Ga0373937_0981276_94_354 80
963 3300036459 Ga0372808_030735 Ga0372808_030735_369_620 80
964 3300037068 Ga0373925_0000008 Ga0373925_0000008_225044_225295 80
965 3300037068 Ga0373925_0021506 Ga0373925_0021506_2222_2485 80
966 3300037068 Ga0373925_0231173 Ga0373925_0231173_682_936 80
967 3300037068 Ga0373925_0550863 Ga0373925_0550863_668_919 80
968 3300037068 Ga0373925_1081078 Ga0373925_1081078_88_351 80
969 3300037466 Ga0395898_0019597 Ga0395898_0019597_3867_4118 80
970 3300037853 Ga0436364_0354916 Ga0436364_0354916_144_407 80
971 3300037853 Ga0436364_1299143 Ga0436364_1299143_1763_2041 80
972 3300038996 Ga0242420_089115 Ga0242420_089115_102_365 80
973 3300039447 Ga0436361_0162503 Ga0436361_0162503_132_395 80
974 3300039450 Ga0436363_0058422 Ga0436363_0058422_107_367 80
975 3300039450 Ga0436363_0263193 Ga0436363_0263193_122_373 80
976 3300039453 Ga0436362_0981485 Ga0436362_0981485_250_516 80
977 3300041512 Ga0451853_3823468 Ga0451853_3823468_752_1003 80
978 3300044684 Ga0466966_1013221 Ga0466966_1013221_130_381 80
979 3300044694 Ga0466963_0010308 Ga0466963_0010308_1621_1872 80
980 3300044694 Ga0466963_0155863 Ga0466963_0155863_973_1233 80
981 3300044706 Ga0466964_0059264 Ga0466964_0059264_21_272 80
982 3300045836 Ga0466958_0071452 Ga0466958_0071452_1822_2076 80
983 3300045976 Ga0466967_0051501 Ga0466967_0051501_379_630 80
984 3300045976 Ga0466967_1515903 Ga0466967_1515903_301_564 80
985 3300045976 Ga0466967_2228277 Ga0466967_2228277_220_483 80
986 3300046454 Ga0495592_0123994 Ga0495592_0123994_886_1146 80
987 3300046454 Ga0495592_0441844 Ga0495592_0441844_345_599 80
988 3300046455 Ga0495603_0005458 Ga0495603_0005458_1597_1851 80
989 3300046459 Ga0495629_0003658 Ga0495629_0003658_6933_7187 80
990 3300046459 Ga0495629_0046647 Ga0495629_0046647_1617_1880 80
991 3300046461 Ga0495641_0015120 Ga0495641_0015120_2801_3064 80
992 3300046461 Ga0495641_0094606 Ga0495641_0094606_822_1076 80
993 3300046462 Ga0495651_0039080 Ga0495651_0039080_1068_1322 80
994 3300046462 Ga0495651_0040598 Ga0495651_0040598_61_321 80
995 3300046463 Ga0495653_0077665 Ga0495653_0077665_2157_2420 80
996 3300046473 Ga0495582_0005781 Ga0495582_0005781_2092_2355 80
997 3300046473 Ga0495582_0006532 Ga0495582_0006532_1058_1312 80
998 3300046475 Ga0495639_0004481 Ga0495639_0004481_4513_4767 80
999 3300046475 Ga0495639_0077826 Ga0495639_0077826_1234_1497 80
1000 3300046476 Ga0495662_0001119 Ga0495662_0001119_822_1076 80
1001 3300046476 Ga0495662_0002792 Ga0495662_0002792_2884_3147 80
1002 3300046476 Ga0495662_0054790 Ga0495662_0054790_823_1086 80
1003 3300046476 Ga0495662_0355236 Ga0495662_0355236_67_330 80
1004 3300046477 Ga0495664_0064824 Ga0495664_0064824_1852_2112 80
1005 3300046477 Ga0495664_0076801 Ga0495664_0076801_26_289 80
1006 3300046477 Ga0495664_0249823 Ga0495664_0249823_83_346 80
1007 3300046499 Ga0495594_0076428 Ga0495594_0076428_1153_1407 80
1008 3300046511 Ga0495608_0054489 Ga0495608_0054489_1366_1626 80
1009 3300046511 Ga0495608_0128913 Ga0495608_0128913_633_887 80
1010 3300046514 Ga0495618_0032098 Ga0495618_0032098_917_1171 80
1011 3300046516 Ga0495628_0033107 Ga0495628_0033107_554_808 80
1012 3300046516 Ga0495628_0274424 Ga0495628_0274424_956_1216 80
1013 3300046516 Ga0495628_0284788 Ga0495628_0284788_635_895 80
1014 3300046517 Ga0495630_0006810 Ga0495630_0006810_5057_5320 80
1015 3300046517 Ga0495630_0074750 Ga0495630_0074750_1617_1871 80
1016 3300046517 Ga0495630_0719788 Ga0495630_0719788_125_385 80
1017 3300046517 Ga0495630_0878374 Ga0495630_0878374_137_400 80
1018 3300046526 Ga0495666_0019770 Ga0495666_0019770_1232_1495 80
1019 3300046526 Ga0495666_0023514 Ga0495666_0023514_2240_2494 80
1020 3300046529 Ga0495652_0041245 Ga0495652_0041245_1566_1829 80
1021 3300046529 Ga0495652_0090796 Ga0495652_0090796_961_1221 80
1022 3300046529 Ga0495652_0136289 Ga0495652_0136289_861_1115 80
1023 3300046531 Ga0495665_0000621 Ga0495665_0000621_537_800 80
1024 3300046531 Ga0495665_0005365 Ga0495665_0005365_822_1076 80
1025 3300046533 Ga0495640_0006891 Ga0495640_0006891_7875_8129 80
1026 3300046533 Ga0495640_0025588 Ga0495640_0025588_2828_3091 80
1027 3300046535 Ga0495586_0004191 Ga0495586_0004191_391_654 80
1028 3300046535 Ga0495586_0028936 Ga0495586_0028936_1296_1550 80
1029 3300046535 Ga0495586_0566484 Ga0495586_0566484_198_461 80
1030 3300046536 Ga0495587_0020471 Ga0495587_0020471_45_308 80
1031 3300046536 Ga0495587_0123587 Ga0495587_0123587_1175_1438 80
1032 3300046536 Ga0495587_0127799 Ga0495587_0127799_11_271 80
1033 3300046536 Ga0495587_0235053 Ga0495587_0235053_132_395 80
1034 3300046536 Ga0495587_0419832 Ga0495587_0419832_349_603 80
1035 3300046536 Ga0495587_0610173 Ga0495587_0610173_131_382 80
1036 3300046543 Ga0495645_0007460 Ga0495645_0007460_4536_4799 80
1037 3300046543 Ga0495645_0120279 Ga0495645_0120279_1560_1811 80
1038 3300046543 Ga0495645_0131960 Ga0495645_0131960_1432_1695 80
1039 3300046559 Ga0495667_0053174 Ga0495667_0053174_2322_2585 80
1040 3300046559 Ga0495667_0222429 Ga0495667_0222429_733_987 80
1041 3300046642 Ga0495634_0004805 Ga0495634_0004805_1202_1465 80
1042 3300046642 Ga0495634_0011392 Ga0495634_0011392_4916_5170 80
1043 3300046642 Ga0495634_0105576 Ga0495634_0105576_674_934 80
1044 3300046642 Ga0495634_0329434 Ga0495634_0329434_244_507 80
1045 3300046663 Ga0495635_0157690 Ga0495635_0157690_502_756 80
1046 3300046674 Ga0495588_0072823 Ga0495588_0072823_1168_1422 80
1047 3300046675 Ga0495657_0071658 Ga0495657_0071658_1144_1407 80
1048 3300046675 Ga0495657_0076689 Ga0495657_0076689_47_298 80
1049 3300046675 Ga0495657_0325577 Ga0495657_0325577_294_554 80
1050 3300046678 Ga0495599_0013998 Ga0495599_0013998_2208_2471 80
1051 3300046678 Ga0495599_0042554 Ga0495599_0042554_1422_1676 80
1052 3300046679 Ga0495623_0250782 Ga0495623_0250782_344_604 80
1053 3300046679 Ga0495623_0257169 Ga0495623_0257169_647_910 80
1054 3300046680 Ga0495646_0037559 Ga0495646_0037559_2523_2777 80
1055 3300046680 Ga0495646_0130583 Ga0495646_0130583_954_1214 80
1056 3300046681 Ga0495647_0007962 Ga0495647_0007962_1311_1565 80
1057 3300046683 Ga0495658_0016908 Ga0495658_0016908_2507_2761 80
1058 3300046683 Ga0495658_0040926 Ga0495658_0040926_1352_1615 80
1059 3300046683 Ga0495658_0120110 Ga0495658_0120110_1222_1476 80
1060 3300046689 Ga0495613_0009703 Ga0495613_0009703_4746_5009 80
1061 3300046689 Ga0495613_0132721 Ga0495613_0132721_740_994 80
1062 3300046690 Ga0495624_0015997 Ga0495624_0015997_1958_2221 80
1063 3300046690 Ga0495624_0029444 Ga0495624_0029444_1560_1814 80
1064 3300046690 Ga0495624_0045155 Ga0495624_0045155_111_365 80
1065 3300046690 Ga0495624_0487896 Ga0495624_0487896_396_659 80
1066 3300046690 Ga0495624_0712248 Ga0495624_0712248_225_488 80
1067 3300046809 Ga0495600_0028800 Ga0495600_0028800_2309_2563 80
1068 3300046809 Ga0495600_0030913 Ga0495600_0030913_1315_1578 80
1069 3300047315 Ga0495581_0002769 Ga0495581_0002769_5322_5585 80
1070 3300047315 Ga0495581_0018112 Ga0495581_0018112_822_1076 80
1071 3300047317 Ga0495604_0050200 Ga0495604_0050200_2542_2796 80
1072 3300047317 Ga0495604_0099974 Ga0495604_0099974_1016_1279 80
1073 3300047319 Ga0495674_0030826 Ga0495674_0030826_2618_2881 80
1074 3300047319 Ga0495674_0051956 Ga0495674_0051956_1330_1593 80
1075 3300047319 Ga0495674_0129752 Ga0495674_0129752_1556_1810 80
1076 3300047319 Ga0495674_0140784 Ga0495674_0140784_746_1009 80
1077 3300047321 Ga0495676_0030639 Ga0495676_0030639_822_1076 80
1078 3300047322 Ga0495680_0018740 Ga0495680_0018740_2346_2606 80
1079 3300047322 Ga0495680_0238739 Ga0495680_0238739_554_808 80
1080 3300047444 Ga0495675_0025759 Ga0495675_0025759_2564_2818 80
1081 3300047444 Ga0495675_0039038 Ga0495675_0039038_1617_1880 80
1082 3300047471 Ga0495684_0019877 Ga0495684_0019877_4789_5043 80
1083 3300047471 Ga0495684_0066691 Ga0495684_0066691_1144_1407 80
1084 3300047471 Ga0495684_0460732 Ga0495684_0460732_519_779 80
1085 3300047673 Ga0495593_0005718 Ga0495593_0005718_193_456 80
1086 3300047673 Ga0495593_0010589 Ga0495593_0010589_2795_3049 80
1087 3300047673 Ga0495593_0056946 Ga0495593_0056946_94_348 80
1088 3300048088 Ga0495602_0062906 Ga0495602_0062906_1069_1329 80
1089 3300048088 Ga0495602_0086906 Ga0495602_0086906_1016_1279 80
1090 3300048088 Ga0495602_1078528 Ga0495602_1078528_67_321 80
1091 3300048089 Ga0495614_0009295 Ga0495614_0009295_1769_2023 80
1092 3300048089 Ga0495614_0417838 Ga0495614_0417838_253_516 80
1093 3300048903 Ga0496100_1219753 Ga0496100_1219753_189_440 80
1094 3300048904 Ga0496101_0036183 Ga0496101_0036183_3181_3432 80
1095 3300048905 Ga0496102_0224376 Ga0496102_0224376_929_1180 80
1096 3300048905 Ga0496102_0444589 Ga0496102_0444589_577_825 80
1097 3300048905 Ga0496102_1757650 Ga0496102_1757650_24_275 80
1098 3300048907 Ga0496104_0981285 Ga0496104_0981285_356_619 80
1099 3300048911 Ga0496108_0516765 Ga0496108_0516765_104_355 80
1100 3300048911 Ga0496108_1252368 Ga0496108_1252368_211_462 80
1101 3300048912 Ga0496109_1044076 Ga0496109_1044076_334_585 80
1102 3300048915 Ga0496112_0229101 Ga0496112_0229101_1206_1457 80
1103 3300048915 Ga0496112_0246985 Ga0496112_0246985_328_579 80
1104 3300048915 Ga0496112_0250700 Ga0496112_0250700_61_312 80
1105 3300048917 Ga0496114_0311105 Ga0496114_0311105_118_369 80
1106 3300048917 Ga0496114_0485635 Ga0496114_0485635_14_265 80
1107 3300048918 Ga0496115_0740396 Ga0496115_0740396_332_583 80
1108 3300048922 Ga0496119_0182236 Ga0496119_0182236_563_811 80
1109 3300048922 Ga0496119_0357606 Ga0496119_0357606_249_497 80
1110 3300048923 Ga0496120_0206444 Ga0496120_0206444_244_492 80
1111 3300048929 Ga0496126_0439879 Ga0496126_0439879_642_893 80
1112 3300049578 Ga0501042_0269125 Ga0501042_0269125_433_687 80
1113 3300050512 nmdc:mga0n895_247660_c1 nmdc:mga0n895_247660_c1_1368_1622 80
1114 3300050512 nmdc:mga0n895_942547_c1 nmdc:mga0n895_942547_c1_421_672 80
1115 3300050512 nmdc:mga0n895_9995_c1 nmdc:mga0n895_9995_c1_6716_6979 80
1116 3300050513 nmdc:mga0rr50_12608_c1 nmdc:mga0rr50_12608_c1_3173_3436 80
1117 3300050513 nmdc:mga0rr50_1434012_c1 nmdc:mga0rr50_1434012_c1_155_409 80
1118 3300050514 nmdc:mga08x19_39221_c1 nmdc:mga08x19_39221_c1_1633_1896 80
1119 3300050514 nmdc:mga08x19_457442_c1 nmdc:mga08x19_457442_c1_549_800 80
1120 3300050515 nmdc:mga0a205_33530_c2 nmdc:mga0a205_33530_c2_1912_2175 80
1121 3300053077 Ga0495601_0072745 Ga0495601_0072745_44_307 80
1122 3300053077 Ga0495601_0217408 Ga0495601_0217408_370_633 80
1123 3300053077 Ga0495601_0353274 Ga0495601_0353274_218_472 80
1124 3300053078 Ga0495612_0080943 Ga0495612_0080943_131_385 80
1125 3300053078 Ga0495612_0262615 Ga0495612_0262615_300_554 80
1126 3300053078 Ga0495612_0366879 Ga0495612_0366879_28_288 80
1127 3300053084 Ga0495595_0041034 Ga0495595_0041034_227_487 80
1128 3300053084 Ga0495595_0134301 Ga0495595_0134301_441_704 80
1129 3300053084 Ga0495595_0190729 Ga0495595_0190729_532_786 80
1130 3300053085 Ga0495619_0004590 Ga0495619_0004590_6767_7030 80
1131 3300053085 Ga0495619_0025903 Ga0495619_0025903_1094_1348 80
1132 3300053085 Ga0495619_0112143 Ga0495619_0112143_1345_1605 80
1133 3300059477 Ga0587084_033296 Ga0587084_033296_106_357 80
1134 3300059490 Ga0587066_001727 Ga0587066_001727_1667_1918 80
1135 3300059491 Ga0587070_036740 Ga0587070_036740_595_846 80
1136 3300059492 Ga0587073_0003121 Ga0587073_0003121_327_578 80
1137 3300059493 Ga0587077_012592 Ga0587077_012592_1089_1340 80
1138 3300059493 Ga0587077_050479 Ga0587077_050479_212_463 80
1139 3300059503 Ga0587080_027104 Ga0587080_027104_422_673 80
1140 3300059503 Ga0587080_084238 Ga0587080_084238_78_332 80
1141 3300059504 Ga0587082_001729 Ga0587082_001729_491_742 80
1142 3300059505 Ga0587083_0004124 Ga0587083_0004124_1460_1711 80
1143 3300059506 Ga0587085_001484 Ga0587085_001484_1649_1900 80
1144 3300059508 Ga0587088_028666 Ga0587088_028666_564_815 80
1145 3300059510 Ga0587090_022207 Ga0587090_022207_42_293 80
1146 3300059511 Ga0587091_076204 Ga0587091_076204_243_494 80
1147 3300059512 Ga0587092_011852 Ga0587092_011852_784_1035 80
1148 3300059604 Ga0587098_010208 Ga0587098_010208_406_657 80
1149 3300059605 Ga0587106_001831 Ga0587106_001831_81_332 80
1150 3300059622 Ga0587099_014047 Ga0587099_014047_421_672 80
1151 3300059623 Ga0587101_032582 Ga0587101_032582_97_348 80
1152 3300059624 Ga0587109_077802 Ga0587109_077802_441_692 80
1153 3300059640 Ga0587067_089037 Ga0587067_089037_165_416 80
1154 3300059641 Ga0587068_002889 Ga0587068_002889_351_602 80
1155 3300059642 Ga0587069_001640 Ga0587069_001640_206_457 80
1156 3300059643 Ga0587072_025821 Ga0587072_025821_718_969 80
1157 3300059644 Ga0587075_006057 Ga0587075_006057_219_470 80
1158 3300059645 Ga0587076_089987 Ga0587076_089987_376_627 80
1159 3300059647 Ga0587079_004561 Ga0587079_004561_1370_1621 80
1160 3300059647 Ga0587079_165666 Ga0587079_165666_270_530 80
1161 3300059651 Ga0587105_017169 Ga0587105_017169_209_460 80
1162 3300059658 Ga0587119_038793 Ga0587119_038793_355_606 80
1163 3300060344 Ga0587071_026824 Ga0587071_026824_333_584 80
1164 3300060346 Ga0587111_0035881 Ga0587111_0035881_668_919 80
1165 3300003659 JGI25404J52841_10109599 JGI25404J52841_101095991 81
1166 3300004803 Ga0058862_12459020 Ga0058862_124590202 81
1167 3300004803 Ga0058862_12665468 Ga0058862_126654682 81
1168 3300005329 Ga0070683_100593613 Ga0070683_1005936132 81
1169 3300005336 Ga0070680_100359880 Ga0070680_1003598802 81
1170 3300005337 Ga0070682_100160728 Ga0070682_1001607281 81
1171 3300005338 Ga0068868_101946257 Ga0068868_1019462571 81
1172 3300005341 Ga0070691_10625809 Ga0070691_106258092 81
1173 3300005345 Ga0070692_10920214 Ga0070692_109202141 81
1174 3300005355 Ga0070671_100360854 Ga0070671_1003608541 81
1175 3300005356 Ga0070674_100564531 Ga0070674_1005645312 81
1176 3300005434 Ga0070709_10037942 Ga0070709_100379423 81
1177 3300005434 Ga0070709_10231848 Ga0070709_102318482 81
1178 3300005435 Ga0070714_100114113 Ga0070714_1001141132 81
1179 3300005435 Ga0070714_100248669 Ga0070714_1002486692 81
1180 3300005436 Ga0070713_100019967 Ga0070713_1000199673 81
1181 3300005436 Ga0070713_102309641 Ga0070713_1023096411 81
1182 3300005437 Ga0070710_10006445 Ga0070710_100064457 81
1183 3300005437 Ga0070710_10108007 Ga0070710_101080072 81
1184 3300005437 Ga0070710_10812573 Ga0070710_108125732 81
1185 3300005440 Ga0070705_100043660 Ga0070705_1000436604 81
1186 3300005445 Ga0070708_100027392 Ga0070708_1000273925 81
1187 3300005445 Ga0070708_101950408 Ga0070708_1019504082 81
1188 3300005455 Ga0070663_100515427 Ga0070663_1005154272 81
1189 3300005456 Ga0070678_100540596 Ga0070678_1005405962 81
1190 3300005458 Ga0070681_10008205 Ga0070681_100082057 81
1191 3300005467 Ga0070706_100015712 Ga0070706_1000157126 81
1192 3300005467 Ga0070706_100049336 Ga0070706_1000493365 81
1193 3300005467 Ga0070706_100086515 Ga0070706_1000865154 81
1194 3300005468 Ga0070707_100066622 Ga0070707_1000666222 81
1195 3300005468 Ga0070707_100437235 Ga0070707_1004372352 81
1196 3300005468 Ga0070707_101566454 Ga0070707_1015664542 81
1197 3300005471 Ga0070698_100003075 Ga0070698_1000030758 81
1198 3300005471 Ga0070698_100010566 Ga0070698_1000105665 81
1199 3300005471 Ga0070698_100055121 Ga0070698_1000551215 81
1200 3300005530 Ga0070679_100018457 Ga0070679_1000184574 81
1201 3300005535 Ga0070684_100025715 Ga0070684_1000257155 81
1202 3300005536 Ga0070697_100137727 Ga0070697_1001377274 81
1203 3300005536 Ga0070697_100787937 Ga0070697_1007879372 81
1204 3300005544 Ga0070686_101835158 Ga0070686_1018351582 81
1205 3300005545 Ga0070695_100047700 Ga0070695_1000477002 81
1206 3300005545 Ga0070695_100459845 Ga0070695_1004598452 81
1207 3300005546 Ga0070696_100425187 Ga0070696_1004251871 81
1208 3300005547 Ga0070693_100107379 Ga0070693_1001073792 81
1209 3300005563 Ga0068855_100140031 Ga0068855_1001400311 81
1210 3300005614 Ga0068856_100014524 Ga0068856_1000145246 81
1211 3300005618 Ga0068864_100307801 Ga0068864_1003078012 81
1212 3300005719 Ga0068861_100196566 Ga0068861_1001965661 81
1213 3300005841 Ga0068863_100184075 Ga0068863_1001840753 81
1214 3300005983 Ga0081540_1000386 Ga0081540_100038629 81
1215 3300005983 Ga0081540_1063367 Ga0081540_10633673 81
1216 3300006028 Ga0070717_10715708 Ga0070717_107157082 81
1217 3300006028 Ga0070717_10781398 Ga0070717_107813982 81
1218 3300006058 Ga0075432_10030515 Ga0075432_100305153 81
1219 3300006163 Ga0070715_10054324 Ga0070715_100543242 81
1220 3300006173 Ga0070716_100048208 Ga0070716_1000482085 81
1221 3300006173 Ga0070716_100220046 Ga0070716_1002200462 81
1222 3300006237 Ga0097621_100089871 Ga0097621_1000898712 81
1223 3300006358 Ga0068871_101305907 Ga0068871_1013059072 81
1224 3300006844 Ga0075428_100126690 Ga0075428_1001266902 81
1225 3300006871 Ga0075434_100011518 Ga0075434_1000115185 81
1226 3300006871 Ga0075434_102528183 Ga0075434_1025281832 81
1227 3300006914 Ga0075436_100031389 Ga0075436_1000313891 81
1228 3300006914 Ga0075436_100073634 Ga0075436_1000736344 81
1229 3300007076 Ga0075435_100023557 Ga0075435_1000235574 81
1230 3300009093 Ga0105240_11224281 Ga0105240_112242812 81
1231 3300009094 Ga0111539_10060235 Ga0111539_100602354 81
1232 3300009098 Ga0105245_10568890 Ga0105245_105688903 81
1233 3300009101 Ga0105247_10048592 Ga0105247_100485922 81
1234 3300009147 Ga0114129_10070952 Ga0114129_100709523 81
1235 3300009147 Ga0114129_10514110 Ga0114129_105141103 81
1236 3300009174 Ga0105241_10729830 Ga0105241_107298302 81
1237 3300009177 Ga0105248_11381702 Ga0105248_113817022 81
1238 3300009553 Ga0105249_13312531 Ga0105249_133125312 81
1239 3300010375 Ga0105239_10507145 Ga0105239_105071452 81
1240 3300013104 Ga0157370_10045631 Ga0157370_100456316 81
1241 3300013104 Ga0157370_10235583 Ga0157370_102355832 81
1242 3300013105 Ga0157369_10091955 Ga0157369_100919554 81
1243 3300013296 Ga0157374_11470293 Ga0157374_114702931 81
1244 3300013297 Ga0157378_12514810 Ga0157378_125148101 81
1245 3300013306 Ga0163162_11302768 Ga0163162_113027682 81
1246 3300013308 Ga0157375_12033296 Ga0157375_120332961 81
1247 3300014745 Ga0157377_10976640 Ga0157377_109766402 81
1248 3300014969 Ga0157376_10211504 Ga0157376_102115042 81
1249 3300017792 Ga0163161_12088251 Ga0163161_120882512 81
1250 3300020069 Ga0197907_10533194 Ga0197907_105331942 81
1251 3300020070 Ga0206356_11028082 Ga0206356_110280822 81
1252 3300020075 Ga0206349_1250825 Ga0206349_12508255 81
1253 3300020077 Ga0206351_10835893 Ga0206351_108358932 81
1254 3300020080 Ga0206350_11262342 Ga0206350_112623422 81
1255 3300020081 Ga0206354_10030221 Ga0206354_100302213 81
1256 3300020082 Ga0206353_11203152 Ga0206353_112031522 81
1257 3300020610 Ga0154015_1189455 Ga0154015_11894552 81
1258 3300022467 Ga0224712_10001308 Ga0224712_100013085 81
1259 3300022467 Ga0224712_10607313 Ga0224712_106073131 81
1260 3300025898 Ga0207692_10049198 Ga0207692_100491982 81
1261 3300025898 Ga0207692_10512806 Ga0207692_105128062 81
1262 3300025900 Ga0207710_10660114 Ga0207710_106601142 81
1263 3300025905 Ga0207685_10042062 Ga0207685_100420623 81
1264 3300025906 Ga0207699_10006535 Ga0207699_100065356 81
1265 3300025906 Ga0207699_10088672 Ga0207699_100886724 81
1266 3300025909 Ga0207705_10969496 Ga0207705_109694962 81
1267 3300025910 Ga0207684_10003611 Ga0207684_100036115 81
1268 3300025910 Ga0207684_10100671 Ga0207684_101006713 81
1269 3300025910 Ga0207684_10214318 Ga0207684_102143182 81
1270 3300025910 Ga0207684_10598062 Ga0207684_105980622 81
1271 3300025911 Ga0207654_10144195 Ga0207654_101441952 81
1272 3300025912 Ga0207707_10007735 Ga0207707_100077354 81
1273 3300025915 Ga0207693_10144815 Ga0207693_101448152 81
1274 3300025916 Ga0207663_10007401 Ga0207663_100074013 81
1275 3300025917 Ga0207660_10037618 Ga0207660_100376182 81
1276 3300025919 Ga0207657_10114392 Ga0207657_101143924 81
1277 3300025921 Ga0207652_10034294 Ga0207652_100342943 81
1278 3300025922 Ga0207646_10129012 Ga0207646_101290122 81
1279 3300025922 Ga0207646_10285365 Ga0207646_102853653 81
1280 3300025926 Ga0207659_11450511 Ga0207659_114505112 81
1281 3300025927 Ga0207687_10405182 Ga0207687_104051822 81
1282 3300025928 Ga0207700_10049768 Ga0207700_100497684 81
1283 3300025928 Ga0207700_10271899 Ga0207700_102718993 81
1284 3300025929 Ga0207664_10011579 Ga0207664_100115793 81
1285 3300025929 Ga0207664_10102521 Ga0207664_101025212 81
1286 3300025929 Ga0207664_10143079 Ga0207664_101430793 81
1287 3300025931 Ga0207644_10409747 Ga0207644_104097473 81
1288 3300025937 Ga0207669_11788768 Ga0207669_117887682 81
1289 3300025939 Ga0207665_10099311 Ga0207665_100993113 81
1290 3300025944 Ga0207661_10169614 Ga0207661_101696142 81
1291 3300025949 Ga0207667_11132378 Ga0207667_111323782 81
1292 3300025949 Ga0207667_11383335 Ga0207667_113833352 81
1293 3300026067 Ga0207678_10698743 Ga0207678_106987432 81
1294 3300026078 Ga0207702_10148153 Ga0207702_101481532 81
1295 3300026088 Ga0207641_11545494 Ga0207641_115454941 81
1296 3300026095 Ga0207676_10168694 Ga0207676_101686942 81
1297 3300026118 Ga0207675_100220071 Ga0207675_1002200713 81
1298 3300030760 Ga0265762_1027256 Ga0265762_10272562 81
1299 3300031090 Ga0265760_10047941 Ga0265760_100479412 81
1300 3300033545 Ga0316214_1008309 Ga0316214_10083092 81
1301 3300033547 Ga0316212_1002286 Ga0316212_10022864 81
1302 3300034816 Ga0373930_0012007 Ga0373930_0012007_629_880 81
1303 3300034817 Ga0373948_0095202 Ga0373948_0095202_410_661 81
1304 3300034818 Ga0373950_0033546 Ga0373950_0033546_181_432 81
1305 3300034819 Ga0373958_0002333 Ga0373958_0002333_1530_1781 81
1306 3300034820 Ga0373959_0022243 Ga0373959_0022243_345_596 81
1307 3300034957 Ga0373938_0038944 Ga0373938_0038944_207_458 81
1308 3300035083 Ga0373926_0007865 Ga0373926_0007865_811_1083 81
1309 3300035085 Ga0373929_0034622 Ga0373929_0034622_155_406 81
1310 3300035086 Ga0373934_0002460 Ga0373934_0002460_538_798 81
1311 3300035086 Ga0373934_0003132 Ga0373934_0003132_133_381 81
1312 3300035088 Ga0373940_0005189 Ga0373940_0005189_2048_2299 81
1313 3300035089 Ga0373944_0040761 Ga0373944_0040761_1057_1305 81
1314 3300035090 Ga0373949_0005906 Ga0373949_0005906_395_646 81
1315 3300035092 Ga0373952_0022867 Ga0373952_0022867_835_1086 81
1316 3300035111 Ga0373923_0051177 Ga0373923_0051177_747_995 81
1317 3300035113 Ga0373936_0012964 Ga0373936_0012964_509_757 81
1318 3300035114 Ga0373939_0008923 Ga0373939_0008923_1023_1274 81
1319 3300035115 Ga0373941_0004510 Ga0373941_0004510_976_1227 81
1320 3300035116 Ga0373945_0053342 Ga0373945_0053342_488_736 81
1321 3300035117 Ga0373953_0003073 Ga0373953_0003073_3490_3738 81
1322 3300035118 Ga0373954_0010607 Ga0373954_0010607_509_757 81
1323 3300035119 Ga0373956_0030009 Ga0373956_0030009_1027_1275 81
1324 3300035119 Ga0373956_0035072 Ga0373956_0035072_1267_1527 81
1325 3300035120 Ga0373957_0004557 Ga0373957_0004557_3271_3519 81
1326 3300035120 Ga0373957_0060236 Ga0373957_0060236_957_1208 81
1327 3300035121 Ga0373960_0100661 Ga0373960_0100661_609_860 81
1328 3300035170 Ga0373943_0298372 Ga0373943_0298372_28_276 81
1329 3300035171 Ga0373946_0455851 Ga0373946_0455851_202_459 81
1330 3300035172 Ga0373955_0031903 Ga0373955_0031903_2156_2407 81
1331 3300035172 Ga0373955_0742847 Ga0373955_0742847_19_267 81
1332 3300035241 Ga0373961_0015177 Ga0373961_0015177_1435_1686 81
1333 3300035242 Ga0373962_0016675 Ga0373962_0016675_526_777 81
1334 3300035242 Ga0373962_0120678 Ga0373962_0120678_32_283 81
1335 3300035410 Ga0373924_0021163 Ga0373924_0021163_286_537 81
1336 3300035410 Ga0373924_0259242 Ga0373924_0259242_392_652 81
1337 3300035691 Ga0373931_0023564 Ga0373931_0023564_2332_2583 81
1338 3300035692 Ga0373935_0000397 Ga0373935_0000397_22047_22319 81
1339 3300035692 Ga0373935_0066596 Ga0373935_0066596_2035_2283 81
1340 3300035692 Ga0373935_0404795 Ga0373935_0404795_431_679 81
1341 3300035695 Ga0373927_0030691 Ga0373927_0030691_2070_2318 81
1342 3300035695 Ga0373927_0310249 Ga0373927_0310249_101_349 81
1343 3300035724 Ga0373933_0000589 Ga0373933_0000589_8218_8466 81
1344 3300035724 Ga0373933_0008104 Ga0373933_0008104_3428_3679 81
1345 3300035724 Ga0373933_0035910 Ga0373933_0035910_1035_1295 81
1346 3300035725 Ga0373947_0000015 Ga0373947_0000015_26407_26679 81
1347 3300035725 Ga0373947_0038877 Ga0373947_0038877_909_1157 81
1348 3300035725 Ga0373947_0332386 Ga0373947_0332386_734_982 81
1349 3300036401 Ga0373937_0001641 Ga0373937_0001641_2576_2824 81
1350 3300036401 Ga0373937_0005259 Ga0373937_0005259_1635_1886 81
1351 3300036401 Ga0373937_0069490 Ga0373937_0069490_1356_1616 81
1352 3300036459 Ga0372808_038148 Ga0372808_038148_129_386 81
1353 3300037068 Ga0373925_0090223 Ga0373925_0090223_899_1147 81
1354 3300037853 Ga0436364_1348865 Ga0436364_1348865_632_901 81
1355 3300037853 Ga0436364_1491783 Ga0436364_1491783_286_564 81
1356 3300038996 Ga0242420_013561 Ga0242420_013561_677_922 81
1357 3300044656 Ga0466969_0315286 Ga0466969_0315286_318_569 81
1358 3300045976 Ga0466967_0145517 Ga0466967_0145517_48_299 81
1359 3300045976 Ga0466967_2437758 Ga0466967_2437758_28_279 81
1360 3300046454 Ga0495592_0037650 Ga0495592_0037650_473_721 81
1361 3300046454 Ga0495592_0115907 Ga0495592_0115907_954_1205 81
1362 3300046454 Ga0495592_0259603 Ga0495592_0259603_774_1034 81
1363 3300046454 Ga0495592_0486884 Ga0495592_0486884_15_263 81
1364 3300046455 Ga0495603_0068270 Ga0495603_0068270_1298_1546 81
1365 3300046459 Ga0495629_0010633 Ga0495629_0010633_2091_2339 81
1366 3300046459 Ga0495629_0035301 Ga0495629_0035301_749_997 81
1367 3300046461 Ga0495641_0005412 Ga0495641_0005412_2487_2735 81
1368 3300046462 Ga0495651_0022293 Ga0495651_0022293_1577_1825 81
1369 3300046462 Ga0495651_0034943 Ga0495651_0034943_1088_1348 81
1370 3300046462 Ga0495651_0118880 Ga0495651_0118880_1431_1679 81
1371 3300046462 Ga0495651_0297179 Ga0495651_0297179_217_468 81
1372 3300046463 Ga0495653_0008844 Ga0495653_0008844_6178_6426 81
1373 3300046463 Ga0495653_0058098 Ga0495653_0058098_1087_1347 81
1374 3300046463 Ga0495653_0327307 Ga0495653_0327307_52_300 81
1375 3300046472 Ga0495580_0020255 Ga0495580_0020255_2679_2927 81
1376 3300046472 Ga0495580_0098939 Ga0495580_0098939_51_299 81
1377 3300046473 Ga0495582_0004077 Ga0495582_0004077_2132_2380 81
1378 3300046475 Ga0495639_0023902 Ga0495639_0023902_1694_1942 81
1379 3300046475 Ga0495639_0163197 Ga0495639_0163197_477_725 81
1380 3300046476 Ga0495662_0009413 Ga0495662_0009413_1913_2161 81
1381 3300046476 Ga0495662_0018235 Ga0495662_0018235_2116_2364 81
1382 3300046477 Ga0495664_0025298 Ga0495664_0025298_287_535 81
1383 3300046499 Ga0495594_0115603 Ga0495594_0115603_368_616 81
1384 3300046511 Ga0495608_0022430 Ga0495608_0022430_3500_3748 81
1385 3300046511 Ga0495608_0033635 Ga0495608_0033635_3184_3432 81
1386 3300046511 Ga0495608_0291588 Ga0495608_0291588_485_745 81
1387 3300046514 Ga0495618_0091593 Ga0495618_0091593_1090_1338 81
1388 3300046516 Ga0495628_0121328 Ga0495628_0121328_423_671 81
1389 3300046517 Ga0495630_0003977 Ga0495630_0003977_3065_3313 81
1390 3300046517 Ga0495630_0414255 Ga0495630_0414255_32_280 81
1391 3300046517 Ga0495630_0616680 Ga0495630_0616680_156_416 81
1392 3300046526 Ga0495666_0010337 Ga0495666_0010337_2056_2304 81
1393 3300046529 Ga0495652_0037734 Ga0495652_0037734_2480_2740 81
1394 3300046529 Ga0495652_0163758 Ga0495652_0163758_784_1032 81
1395 3300046531 Ga0495665_0003341 Ga0495665_0003341_7583_7831 81
1396 3300046531 Ga0495665_0051778 Ga0495665_0051778_946_1194 81
1397 3300046533 Ga0495640_0019687 Ga0495640_0019687_3033_3281 81
1398 3300046533 Ga0495640_0571623 Ga0495640_0571623_413_670 81
1399 3300046536 Ga0495587_0007032 Ga0495587_0007032_4569_4817 81
1400 3300046536 Ga0495587_0069523 Ga0495587_0069523_591_851 81
1401 3300046543 Ga0495645_0271210 Ga0495645_0271210_585_842 81
1402 3300046543 Ga0495645_0459746 Ga0495645_0459746_442_690 81
1403 3300046559 Ga0495667_0088095 Ga0495667_0088095_798_1046 81
1404 3300046559 Ga0495667_0099513 Ga0495667_0099513_653_913 81
1405 3300046559 Ga0495667_0104055 Ga0495667_0104055_1124_1372 81
1406 3300046642 Ga0495634_0009667 Ga0495634_0009667_5786_6034 81
1407 3300046642 Ga0495634_0017849 Ga0495634_0017849_2351_2599 81
1408 3300046663 Ga0495635_0008596 Ga0495635_0008596_977_1225 81
1409 3300046663 Ga0495635_0117650 Ga0495635_0117650_104_352 81
1410 3300046663 Ga0495635_0228069 Ga0495635_0228069_988_1236 81
1411 3300046663 Ga0495635_0269084 Ga0495635_0269084_126_386 81
1412 3300046674 Ga0495588_0295289 Ga0495588_0295289_491_739 81
1413 3300046675 Ga0495657_0009900 Ga0495657_0009900_2824_3072 81
1414 3300046675 Ga0495657_0034610 Ga0495657_0034610_2598_2858 81
1415 3300046678 Ga0495599_0014707 Ga0495599_0014707_2252_2500 81
1416 3300046678 Ga0495599_0188826 Ga0495599_0188826_10_261 81
1417 3300046679 Ga0495623_0023740 Ga0495623_0023740_432_680 81
1418 3300046679 Ga0495623_0028555 Ga0495623_0028555_2623_2883 81
1419 3300046679 Ga0495623_0036654 Ga0495623_0036654_935_1186 81
1420 3300046680 Ga0495646_0039852 Ga0495646_0039852_2342_2590 81
1421 3300046681 Ga0495647_0393803 Ga0495647_0393803_365_613 81
1422 3300046683 Ga0495658_0307965 Ga0495658_0307965_733_981 81
1423 3300046689 Ga0495613_0019401 Ga0495613_0019401_2113_2361 81
1424 3300046690 Ga0495624_0167336 Ga0495624_0167336_542_790 81
1425 3300046809 Ga0495600_0007406 Ga0495600_0007406_3737_3985 81
1426 3300046809 Ga0495600_0031250 Ga0495600_0031250_2241_2489 81
1427 3300047315 Ga0495581_0004995 Ga0495581_0004995_2253_2501 81
1428 3300047315 Ga0495581_0024095 Ga0495581_0024095_2677_2925 81
1429 3300047317 Ga0495604_0022707 Ga0495604_0022707_2335_2595 81
1430 3300047317 Ga0495604_0049620 Ga0495604_0049620_967_1215 81
1431 3300047319 Ga0495674_0003442 Ga0495674_0003442_9454_9702 81
1432 3300047319 Ga0495674_0432957 Ga0495674_0432957_779_1027 81
1433 3300047319 Ga0495674_0683723 Ga0495674_0683723_527_775 81
1434 3300047319 Ga0495674_0854150 Ga0495674_0854150_99_356 81
1435 3300047321 Ga0495676_0017937 Ga0495676_0017937_925_1173 81
1436 3300047321 Ga0495676_0049985 Ga0495676_0049985_2836_3090 81
1437 3300047322 Ga0495680_0017697 Ga0495680_0017697_2071_2319 81
1438 3300047322 Ga0495680_0018327 Ga0495680_0018327_2079_2327 81
1439 3300047322 Ga0495680_0233940 Ga0495680_0233940_395_655 81
1440 3300047444 Ga0495675_0002981 Ga0495675_0002981_1093_1341 81
1441 3300047444 Ga0495675_0041553 Ga0495675_0041553_1054_1314 81
1442 3300047471 Ga0495684_0014182 Ga0495684_0014182_2071_2319 81
1443 3300047471 Ga0495684_0179952 Ga0495684_0179952_975_1223 81
1444 3300047673 Ga0495593_0129651 Ga0495593_0129651_470_718 81
1445 3300048088 Ga0495602_0011883 Ga0495602_0011883_5552_5812 81
1446 3300048088 Ga0495602_0013415 Ga0495602_0013415_3489_3737 81
1447 3300048088 Ga0495602_0023155 Ga0495602_0023155_1883_2134 81
1448 3300048089 Ga0495614_0023989 Ga0495614_0023989_1423_1671 81
1449 3300048903 Ga0496100_0763645 Ga0496100_0763645_339_590 81
1450 3300048904 Ga0496101_0098911 Ga0496101_0098911_1082_1333 81
1451 3300048905 Ga0496102_0123810 Ga0496102_0123810_1518_1769 81
1452 3300048907 Ga0496104_0362099 Ga0496104_0362099_850_1101 81
1453 3300048908 Ga0496105_0075214 Ga0496105_0075214_2364_2615 81
1454 3300048909 Ga0496106_0131481 Ga0496106_0131481_1053_1304 81
1455 3300048910 Ga0496107_0266296 Ga0496107_0266296_858_1109 81
1456 3300048911 Ga0496108_0056764 Ga0496108_0056764_1275_1526 81
1457 3300048912 Ga0496109_0345827 Ga0496109_0345827_941_1192 81
1458 3300048913 Ga0496110_0527163 Ga0496110_0527163_248_499 81
1459 3300048914 Ga0496111_0720493 Ga0496111_0720493_79_330 81
1460 3300048915 Ga0496112_0086248 Ga0496112_0086248_1886_2137 81
1461 3300048916 Ga0496113_0138830 Ga0496113_0138830_648_899 81
1462 3300048917 Ga0496114_0010063 Ga0496114_0010063_1079_1330 81
1463 3300048918 Ga0496115_0028817 Ga0496115_0028817_2141_2392 81
1464 3300048929 Ga0496126_0029650 Ga0496126_0029650_4578_4835 81
1465 3300050507 nmdc:mga05p37_14396_c1 nmdc:mga05p37_14396_c1_6194_6445 81
1466 3300050507 nmdc:mga05p37_556200_c1 nmdc:mga05p37_556200_c1_810_1058 81
1467 3300050510 nmdc:mga06r32_918288_c1 nmdc:mga06r32_918288_c1_330_581 81
1468 3300050512 nmdc:mga0n895_128857_c1 nmdc:mga0n895_128857_c1_1938_2189 81
1469 3300050512 nmdc:mga0n895_61232_c1 nmdc:mga0n895_61232_c1_3088_3336 81
1470 3300050513 nmdc:mga0rr50_23626_c1 nmdc:mga0rr50_23626_c1_1608_1856 81
1471 3300050513 nmdc:mga0rr50_43037_c1 nmdc:mga0rr50_43037_c1_1417_1668 81
1472 3300050514 nmdc:mga08x19_287282_c1 nmdc:mga08x19_287282_c1_94_345 81
1473 3300050515 nmdc:mga0a205_115115_c1 nmdc:mga0a205_115115_c1_495_746 81
1474 3300053077 Ga0495601_0188972 Ga0495601_0188972_942_1190 81
1475 3300053078 Ga0495612_0062319 Ga0495612_0062319_1081_1329 81
1476 3300053084 Ga0495595_0006650 Ga0495595_0006650_2411_2659 81
1477 3300053085 Ga0495619_0236964 Ga0495619_0236964_1001_1249 81
1478 3300059504 Ga0587082_068501 Ga0587082_068501_405_650 81
1479 3300059505 Ga0587083_0026501 Ga0587083_0026501_590_847 81
1480 3300059630 Ga0587128_115180 Ga0587128_115180_138_389 81
1481 3300059645 Ga0587076_198908 Ga0587076_198908_176_427 81

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00137

ATP-synt_C

ATP synthase subunit C

30

92

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
7ajf-assembly1.cif.gz_P bovine atp synthase dimer state2:state2 0.7909 12 78
1rty-assembly1.cif.gz_A crystal structure of bacillus subtilis yvqk, a putative atp-binding cobalamin adenosyltransferase, the north east structural genomics target sr128 0.7809 23 69
1rty-assembly1.cif.gz_C crystal structure of bacillus subtilis yvqk, a putative atp-binding cobalamin adenosyltransferase, the north east structural genomics target sr128 0.7808 22 69
7ajf-assembly1.cif.gz_K bovine atp synthase dimer state2:state2 0.7643 12 78
6zbb-assembly1.cif.gz_K bovine atp synthase fo domain 0.7609 14 78
ID Description Score Start End Superfamily
1rtyA00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7809 23 69 1.20.1200.10
1rtyC00 Mainly Alpha;Up-down Bundle;Hypothetical Protein Ta1238; Chain: A;;Cobalamin adenosyltransferase-like 0.7808 22 69 1.20.1200.10
af_Q9VDT4_85_169_1.20.120.550 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);Membrane associated eicosanoid/glutathione metabolism-like domain 0.7673 19 76 1.20.120.550
1l6tA00 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7344 1 80 1.20.20.10
af_P56383_73_144_1.20.20.10 Mainly Alpha;Up-down Bundle;F1FO ATP Synthase;F1F0 ATP synthase subunit C 0.7314 16 78 1.20.20.10
ID Description Score Start End GO Terms
AF-A0A178U5K6-F1-model_v4 Cytochrome c oxidase subunit 3 0.881 14 81 GO:0004129
GO:0005739
GO:0008289
GO:0015986
GO:0019646
GO:0045263
AF-A0A2W5NEF7-F1-model_v4 DUF304 domain-containing protein 0.8453 15 78 GO:0016020
AF-R5H6R0-F1-model_v4 deleted 0.8434 19 79
AF-A0A327J5F3-F1-model_v4 Uncharacterized protein 0.8426 20 77
AF-A0A4Q6E1L7-F1-model_v4 MotA/TolQ/ExbB proton channel domain-containing protein 0.8363 22 76 GO:0005886
GO:0097588

Feature Viewer

pLDDT pTM Quality
90.09 0.66 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map