F494246

General Info

Members Datasets Scaffolds Average Seq Length
1477 312 1477 65

Family's Representative Sequence

Representative Sequence 3300025321|Ga0207656_10061210|Ga0207656_100612102
Length 79
Sequence MLDDPEQLGRRAVPGVLSEFRGQRIQAGTQLAVLEPGTEVIHGPYADELKARMEWQRLTFRDRCAATERYSICVEPVLQ

Samples

Sample ID Description Type Environment
1 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
4 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
7 3300002067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C1 Metagenome Rhizosphere
8 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
9 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
10 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
11 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
12 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
13 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
17 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
18 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
19 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
20 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
21 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
22 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
23 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
24 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
25 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
26 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
27 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
28 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
29 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
30 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
31 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
32 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
33 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
34 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
35 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
36 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
37 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
38 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
39 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
40 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
41 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
42 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
43 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
53 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
54 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
55 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
56 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
57 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
58 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
59 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
60 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
61 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
62 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
63 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
64 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
65 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
66 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
67 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
68 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
69 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
70 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
71 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
72 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
73 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
74 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
78 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
79 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
80 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
81 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
82 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
83 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
84 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
85 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
86 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
87 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
88 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
98 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
99 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
100 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
101 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
102 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
103 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
104 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
105 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
106 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
107 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
108 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
109 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
110 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
111 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
112 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
113 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
114 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
115 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
117 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
118 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
119 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
120 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
121 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
122 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
123 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
124 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
125 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
126 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
127 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
128 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
129 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
130 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
131 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
132 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
133 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
134 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
135 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
189 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
190 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
191 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
192 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
193 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
194 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
195 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
196 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
197 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
198 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
199 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
200 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
201 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
202 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
203 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
204 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
205 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
206 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
207 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
208 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
209 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
210 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
211 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
212 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
213 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
214 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
215 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
216 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
217 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
218 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
219 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
220 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
221 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
222 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
223 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
224 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
225 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
226 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
227 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
228 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
229 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
230 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
231 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
232 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
233 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
234 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
235 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
236 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
237 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
238 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
239 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
240 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
241 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
242 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
243 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
244 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
245 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
246 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
247 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
248 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
249 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
250 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
251 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
252 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
253 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
254 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
255 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
256 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
257 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
258 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
259 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
260 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
261 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
262 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
263 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
264 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
265 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
266 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
267 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
268 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
269 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
270 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
271 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
272 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
273 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
274 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
275 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
276 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
277 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
278 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
279 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
280 3300049656 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G3_B_0_drought Metagenome Rhizosphere
281 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
282 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
283 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
284 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
285 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
286 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
287 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
288 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
289 3300049678 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought Metagenome Rhizosphere
290 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
291 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
292 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
293 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
294 3300049706 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J2_B_2_control Metagenome Rhizosphere
295 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
296 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
297 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
298 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
299 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
300 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
301 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
302 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
303 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
304 3300049779 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_A_7_drought Metagenome Rhizosphere
305 3300049850 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J4_A_0_control Metagenome Rhizosphere
306 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
307 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
308 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
309 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
310 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
311 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
312 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.53
Metatranscriptomes 0.47
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.2
Nodule 0
Rhizoplane 6.36
Rhizosphere 93.23
Stem 0
Stem Tuber 0
Unclassified 0.2

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24741J21665_1030203 3300001915 Bacteria 813
2 JGI24752J21851_1001942 3300001976 Bacteria 2752
3 JGI24752J21851_1009443 3300001976 Bacteria 1273
4 JGI24740J21852_10000820 3300001979 Bacteria 13657
5 JGI24740J21852_10014275 3300001979 Bacteria 2935
6 JGI24740J21852_10133481 3300001979 Bacteria 619
7 JGI24740J21852_10144758 3300001979 Bacteria 591
8 JGI24739J22299_10172537 3300001989 Bacteria 637
9 JGI24737J22298_10001222 3300001990 Bacteria 9059
10 JGI24737J22298_10057321 3300001990 Bacteria 1176
11 JGI24737J22298_10080279 3300001990 Bacteria 971
12 JGI24737J22298_10124615 3300001990 Bacteria 761
13 JGI24737J22298_10163584 3300001990 Bacteria 657
14 JGI24737J22298_10215178 3300001990 Bacteria 567
15 JGI24737J22298_10230994 3300001990 Bacteria 546
16 JGI24743J22301_10046200 3300001991 Bacteria 881
17 JGI24743J22301_10114044 3300001991 Bacteria 589
18 JGI24735J21928_10038740 3300002067 Bacteria 1394
19 JGI24735J21928_10066058 3300002067 Bacteria 1038
20 JGI24735J21928_10247023 3300002067 Bacteria 520
21 JGI24735J21928_10250054 3300002067 Bacteria 517
22 JGI24735J21928_10256650 3300002067 Bacteria 510
23 JGI24745J21846_1006264 3300002073 Bacteria 1316
24 JGI24748J21848_1016082 3300002074 Bacteria 893
25 JGI24738J21930_10006975 3300002075 Bacteria 2626
26 JGI24738J21930_10102923 3300002075 Bacteria 610
27 JGI24744J21845_10040727 3300002077 Bacteria 869
28 JGI24034J26672_10120324 3300002239 Bacteria 507
29 JGI24751J29686_10070449 3300002459 Unclassified 721
30 Ga0065712_10174204 3300005290 Bacteria 1226
31 Ga0065715_10382029 3300005293 Bacteria 906
32 Ga0070658_10007648 3300005327 Bacteria 8713
33 Ga0070658_10020996 3300005327 Bacteria 5231
34 Ga0070658_10149077 3300005327 Bacteria 1957
35 Ga0070658_10197075 3300005327 Bacteria 1698
36 Ga0070658_10231249 3300005327 Bacteria 1565
37 Ga0070658_10399085 3300005327 Bacteria 1181
38 Ga0070658_10543773 3300005327 Bacteria 1005
39 Ga0070658_10706131 3300005327 Bacteria 875
40 Ga0070658_10744611 3300005327 Bacteria 851
41 Ga0070658_10993560 3300005327 Bacteria 730
42 Ga0070658_11336976 3300005327 Bacteria 622
43 Ga0070658_11579503 3300005327 Bacteria 568
44 Ga0070658_11659747 3300005327 Bacteria 553
45 Ga0070658_11994679 3300005327 Bacteria 501
46 Ga0070676_10119104 3300005328 Bacteria 1654
47 Ga0070676_10164511 3300005328 Bacteria 1430
48 Ga0070676_10205379 3300005328 Bacteria 1294
49 Ga0070676_10370968 3300005328 Bacteria 989
50 Ga0070676_10394923 3300005328 Bacteria 961
51 Ga0070676_10501789 3300005328 Bacteria 861
52 Ga0070676_10556397 3300005328 Bacteria 822
53 Ga0070676_10847062 3300005328 Bacteria 678
54 Ga0070676_10847096 3300005328 Bacteria 678
55 Ga0070676_11427023 3300005328 Bacteria 531
56 Ga0070683_100006609 3300005329 Bacteria 9739
57 Ga0070683_100011545 3300005329 Bacteria 7644
58 Ga0070683_100185036 3300005329 Bacteria 1977
59 Ga0070683_100241044 3300005329 Bacteria 1720
60 Ga0070683_100712912 3300005329 Bacteria 961
61 Ga0070690_100067028 3300005330 Bacteria 2325
62 Ga0070690_100117380 3300005330 Bacteria 1782
63 Ga0070690_100590306 3300005330 Bacteria 842
64 Ga0070670_100001335 3300005331 Bacteria 19717
65 Ga0070670_100001653 3300005331 Bacteria 18063
66 Ga0070670_100095991 3300005331 Bacteria 2550
67 Ga0070670_100111644 3300005331 Bacteria 2356
68 Ga0070670_100301143 3300005331 Bacteria 1402
69 Ga0070670_100430095 3300005331 Bacteria 1168
70 Ga0070670_100453464 3300005331 Bacteria 1137
71 Ga0070670_100583071 3300005331 Bacteria 999
72 Ga0070670_100795677 3300005331 Bacteria 854
73 Ga0070670_101335418 3300005331 Bacteria 657
74 Ga0070670_101492589 3300005331 Bacteria 620
75 Ga0068869_100238868 3300005334 Bacteria 1447
76 Ga0068869_100269846 3300005334 Bacteria 1365
77 Ga0068869_100307172 3300005334 Bacteria 1282
78 Ga0068869_100593567 3300005334 Bacteria 935
79 Ga0068869_101575326 3300005334 Bacteria 584
80 Ga0070666_10000283 3300005335 Bacteria 33586
81 Ga0070666_10000310 3300005335 Bacteria 31154
82 Ga0070666_10030361 3300005335 Bacteria 3560
83 Ga0070666_10034024 3300005335 Bacteria 3377
84 Ga0070666_10050124 3300005335 Bacteria 2807
85 Ga0070666_10080127 3300005335 Bacteria 2231
86 Ga0070666_10302477 3300005335 Bacteria 1139
87 Ga0070666_10465715 3300005335 Bacteria 914
88 Ga0070666_10572385 3300005335 Bacteria 823
89 Ga0070666_10634835 3300005335 Bacteria 781
90 Ga0070680_100000105 3300005336 Bacteria 48515
91 Ga0070680_100401376 3300005336 Bacteria 1168
92 Ga0070680_100603918 3300005336 Bacteria 942
93 Ga0070680_100941638 3300005336 Bacteria 745
94 Ga0070680_101134918 3300005336 Bacteria 676
95 Ga0070682_100377575 3300005337 Bacteria 1065
96 Ga0070682_100533091 3300005337 Bacteria 915
97 Ga0070682_100613822 3300005337 Bacteria 861
98 Ga0070682_100966406 3300005337 Bacteria 705
99 Ga0068868_100001238 3300005338 Bacteria 17534
100 Ga0068868_100100964 3300005338 Bacteria 2334
101 Ga0068868_100155545 3300005338 Bacteria 1885
102 Ga0068868_100455396 3300005338 Bacteria 1113
103 Ga0068868_100593453 3300005338 Bacteria 980
104 Ga0068868_101901009 3300005338 Bacteria 564
105 Ga0068868_102296008 3300005338 Bacteria 515
106 Ga0070660_100011633 3300005339 Bacteria 6264
107 Ga0070660_100085990 3300005339 Bacteria 2474
108 Ga0070660_100183395 3300005339 Bacteria 1694
109 Ga0070660_100365612 3300005339 Bacteria 1189
110 Ga0070660_100478647 3300005339 Bacteria 1034
111 Ga0070660_100495173 3300005339 Bacteria 1016
112 Ga0070660_100523402 3300005339 Bacteria 988
113 Ga0070660_100539599 3300005339 Bacteria 972
114 Ga0070660_100622078 3300005339 Bacteria 903
115 Ga0070660_100800433 3300005339 Bacteria 793
116 Ga0070660_100952889 3300005339 Bacteria 725
117 Ga0070660_101000261 3300005339 Bacteria 706
118 Ga0070660_101038869 3300005339 Bacteria 693
119 Ga0070660_101054474 3300005339 Bacteria 687
120 Ga0070660_101425263 3300005339 Bacteria 589
121 Ga0070660_101691649 3300005339 Bacteria 539
122 Ga0070660_101716161 3300005339 Bacteria 535
123 Ga0070660_101910944 3300005339 Unclassified 506
124 Ga0070689_101215811 3300005340 Bacteria 677
125 Ga0070687_100450557 3300005343 Bacteria 856
126 Ga0070687_100540821 3300005343 Bacteria 791
127 Ga0070687_100816678 3300005343 Unclassified 662
128 Ga0070687_101511288 3300005343 Bacteria 505
129 Ga0070661_100009351 3300005344 Bacteria 6779
130 Ga0070661_100013626 3300005344 Bacteria 5709
131 Ga0070661_100040464 3300005344 Bacteria 3401
132 Ga0070661_100049952 3300005344 Bacteria 3061
133 Ga0070661_100064189 3300005344 Bacteria 2698
134 Ga0070661_100108178 3300005344 Bacteria 2074
135 Ga0070661_100227858 3300005344 Bacteria 1431
136 Ga0070661_100331912 3300005344 Bacteria 1190
137 Ga0070661_100440690 3300005344 Bacteria 1035
138 Ga0070661_100460781 3300005344 Bacteria 1012
139 Ga0070661_100600751 3300005344 Bacteria 889
140 Ga0070661_100916648 3300005344 Bacteria 724
141 Ga0070661_101030110 3300005344 Bacteria 684
142 Ga0070661_101114935 3300005344 Bacteria 658
143 Ga0070661_101619954 3300005344 Bacteria 547
144 Ga0070692_10972505 3300005345 Bacteria 592
145 Ga0070668_100021205 3300005347 Bacteria 4911
146 Ga0070668_100658697 3300005347 Bacteria 920
147 Ga0070668_100859496 3300005347 Bacteria 809
148 Ga0070668_100903205 3300005347 Bacteria 790
149 Ga0070668_101061186 3300005347 Bacteria 730
150 Ga0070669_100309042 3300005353 Bacteria 1274
151 Ga0070669_100781374 3300005353 Bacteria 811
152 Ga0070669_101134278 3300005353 Bacteria 674
153 Ga0070669_101399577 3300005353 Bacteria 607
154 Ga0070675_100398771 3300005354 Bacteria 1227
155 Ga0070675_100616054 3300005354 Bacteria 985
156 Ga0070675_101046159 3300005354 Bacteria 750
157 Ga0070675_101279237 3300005354 Bacteria 676
158 Ga0070671_100000254 3300005355 Bacteria 35845
159 Ga0070671_100003074 3300005355 Bacteria 12977
160 Ga0070671_100015173 3300005355 Bacteria 6222
161 Ga0070671_100021967 3300005355 Bacteria 5212
162 Ga0070671_100039994 3300005355 Bacteria 3893
163 Ga0070671_100047992 3300005355 Bacteria 3550
164 Ga0070671_100117613 3300005355 Bacteria 2235
165 Ga0070671_100276620 3300005355 Bacteria 1427
166 Ga0070671_100532918 3300005355 Bacteria 1012
167 Ga0070671_100587857 3300005355 Bacteria 962
168 Ga0070671_101414222 3300005355 Bacteria 615
169 Ga0070671_101731920 3300005355 Unclassified 555
170 Ga0070674_100004945 3300005356 Bacteria 7637
171 Ga0070674_100014558 3300005356 Bacteria 4893
172 Ga0070674_100146667 3300005356 Bacteria 1777
173 Ga0070674_100186910 3300005356 Bacteria 1591
174 Ga0070674_100847075 3300005356 Bacteria 793
175 Ga0070674_101356587 3300005356 Bacteria 635
176 Ga0070674_101465656 3300005356 Bacteria 613
177 Ga0070674_102196715 3300005356 Unclassified 504
178 Ga0070673_100000583 3300005364 Bacteria 19787
179 Ga0070673_100011572 3300005364 Bacteria 6028
180 Ga0070673_100052903 3300005364 Bacteria 3187
181 Ga0070673_100078220 3300005364 Bacteria 2675
182 Ga0070673_100235889 3300005364 Bacteria 1588
183 Ga0070673_100458780 3300005364 Bacteria 1147
184 Ga0070673_100784804 3300005364 Bacteria 879
185 Ga0070673_100915383 3300005364 Bacteria 814
186 Ga0070673_101020626 3300005364 Bacteria 771
187 Ga0070673_101087904 3300005364 Bacteria 746
188 Ga0070673_101204516 3300005364 Bacteria 709
189 Ga0070673_101653376 3300005364 Bacteria 605
190 Ga0070688_100376706 3300005365 Bacteria 1045
191 Ga0070688_101649153 3300005365 Unclassified 524
192 Ga0070659_100012580 3300005366 Bacteria 6275
193 Ga0070659_100060384 3300005366 Bacteria 2994
194 Ga0070659_100137302 3300005366 Bacteria 1989
195 Ga0070659_100224663 3300005366 Bacteria 1551
196 Ga0070659_100244496 3300005366 Bacteria 1486
197 Ga0070659_100279116 3300005366 Bacteria 1390
198 Ga0070659_100292253 3300005366 Bacteria 1357
199 Ga0070659_100413752 3300005366 Bacteria 1140
200 Ga0070659_100497536 3300005366 Bacteria 1039
201 Ga0070659_100543090 3300005366 Bacteria 994
202 Ga0070659_100608151 3300005366 Bacteria 940
203 Ga0070659_100683630 3300005366 Bacteria 886
204 Ga0070659_100750025 3300005366 Bacteria 847
205 Ga0070659_100804422 3300005366 Bacteria 818
206 Ga0070659_100824905 3300005366 Bacteria 807
207 Ga0070659_100938641 3300005366 Bacteria 757
208 Ga0070659_101134101 3300005366 Bacteria 690
209 Ga0070659_101209244 3300005366 Bacteria 668
210 Ga0070659_101465180 3300005366 Bacteria 608
211 Ga0070659_101759561 3300005366 Bacteria 555
212 Ga0070659_101860382 3300005366 Bacteria 539
213 Ga0070667_100003923 3300005367 Bacteria 12636
214 Ga0070667_100033487 3300005367 Bacteria 4295
215 Ga0070667_100253168 3300005367 Bacteria 1575
216 Ga0070667_100322774 3300005367 Bacteria 1393
217 Ga0070667_100349700 3300005367 Bacteria 1338
218 Ga0070667_100399884 3300005367 Unclassified 1250
219 Ga0070667_100668066 3300005367 Bacteria 960
220 Ga0070709_11002062 3300005434 Bacteria 664
221 Ga0070714_100017124 3300005435 Bacteria 5867
222 Ga0070714_100029454 3300005435 Bacteria 4564
223 Ga0070714_100078884 3300005435 Bacteria 2862
224 Ga0070714_100100217 3300005435 Bacteria 2551
225 Ga0070714_100219025 3300005435 Bacteria 1748
226 Ga0070714_100477507 3300005435 Bacteria 1187
227 Ga0070713_100007547 3300005436 Bacteria 7643
228 Ga0070713_100150682 3300005436 Bacteria 2069
229 Ga0070710_10883968 3300005437 Bacteria 644
230 Ga0070663_100002096 3300005455 Bacteria 11158
231 Ga0070663_100008906 3300005455 Bacteria 6197
232 Ga0070663_100021712 3300005455 Bacteria 4275
233 Ga0070663_100077013 3300005455 Bacteria 2440
234 Ga0070663_100185110 3300005455 Bacteria 1618
235 Ga0070663_100325488 3300005455 Bacteria 1237
236 Ga0070663_100338124 3300005455 Bacteria 1215
237 Ga0070663_100355164 3300005455 Bacteria 1188
238 Ga0070663_101029704 3300005455 Bacteria 717
239 Ga0070663_101148823 3300005455 Bacteria 681
240 Ga0070678_100000535 3300005456 Bacteria 18515
241 Ga0070678_100001844 3300005456 Bacteria 11442
242 Ga0070678_100005279 3300005456 Bacteria 7445
243 Ga0070678_100023817 3300005456 Bacteria 4087
244 Ga0070678_100188968 3300005456 Bacteria 1692
245 Ga0070678_101847070 3300005456 Bacteria 570
246 Ga0070662_100002227 3300005457 Bacteria 11895
247 Ga0070662_100002402 3300005457 Bacteria 11504
248 Ga0070662_100004510 3300005457 Bacteria 8821
249 Ga0070662_100018065 3300005457 Bacteria 4765
250 Ga0070662_100026161 3300005457 Bacteria 4039
251 Ga0070662_100054849 3300005457 Bacteria 2889
252 Ga0070662_100095520 3300005457 Bacteria 2240
253 Ga0070662_100106721 3300005457 Bacteria 2128
254 Ga0070662_100226278 3300005457 Bacteria 1494
255 Ga0070662_100247468 3300005457 Bacteria 1432
256 Ga0070662_100267684 3300005457 Bacteria 1379
257 Ga0070662_100291647 3300005457 Bacteria 1323
258 Ga0070662_100335397 3300005457 Bacteria 1236
259 Ga0070662_100381738 3300005457 Bacteria 1160
260 Ga0070662_100456869 3300005457 Bacteria 1061
261 Ga0070662_100560480 3300005457 Bacteria 958
262 Ga0070662_100700904 3300005457 Bacteria 857
263 Ga0070662_101063984 3300005457 Bacteria 694
264 Ga0070662_101948897 3300005457 Bacteria 508
265 Ga0070681_10053910 3300005458 Bacteria 4007
266 Ga0070681_10354014 3300005458 Bacteria 1378
267 Ga0070681_11169627 3300005458 Bacteria 691
268 Ga0070681_11373928 3300005458 Bacteria 630
269 Ga0070681_12018682 3300005458 Bacteria 505
270 Ga0068867_100046363 3300005459 Bacteria 3192
271 Ga0068867_100069425 3300005459 Bacteria 2632
272 Ga0068867_100088674 3300005459 Bacteria 2344
273 Ga0068867_100090917 3300005459 Bacteria 2316
274 Ga0068867_100101809 3300005459 Bacteria 2195
275 Ga0068867_100402804 3300005459 Bacteria 1154
276 Ga0068867_100468241 3300005459 Bacteria 1077
277 Ga0068867_100570617 3300005459 Bacteria 983
278 Ga0070685_11263194 3300005466 Unclassified 563
279 Ga0070679_100000125 3300005530 Bacteria 61348
280 Ga0070679_100124322 3300005530 Bacteria 2563
281 Ga0070679_100288822 3300005530 Bacteria 1592
282 Ga0070679_100429365 3300005530 Bacteria 1266
283 Ga0070679_100936611 3300005530 Bacteria 810
284 Ga0070679_102083284 3300005530 Bacteria 517
285 Ga0070684_100110713 3300005535 Bacteria 2462
286 Ga0070684_101371123 3300005535 Bacteria 666
287 Ga0068853_100290705 3300005539 Bacteria 1509
288 Ga0068853_100508400 3300005539 Bacteria 1138
289 Ga0068853_100699618 3300005539 Bacteria 967
290 Ga0068853_100870749 3300005539 Bacteria 864
291 Ga0068853_100883541 3300005539 Bacteria 858
292 Ga0068853_100954273 3300005539 Bacteria 825
293 Ga0068853_101038109 3300005539 Bacteria 790
294 Ga0068853_101199849 3300005539 Bacteria 733
295 Ga0068853_101212548 3300005539 Bacteria 729
296 Ga0070672_100099465 3300005543 Bacteria 2357
297 Ga0070672_100134528 3300005543 Bacteria 2035
298 Ga0070672_100166146 3300005543 Bacteria 1833
299 Ga0070672_100200921 3300005543 Bacteria 1667
300 Ga0070672_100213126 3300005543 Bacteria 1618
301 Ga0070672_100279117 3300005543 Bacteria 1412
302 Ga0070672_100524000 3300005543 Bacteria 1027
303 Ga0070672_101054121 3300005543 Bacteria 722
304 Ga0070672_101139392 3300005543 Bacteria 694
305 Ga0070686_100132414 3300005544 Bacteria 1726
306 Ga0070686_100587448 3300005544 Bacteria 876
307 Ga0070686_101643176 3300005544 Bacteria 544
308 Ga0070695_100135459 3300005545 Bacteria 1702
309 Ga0070696_100003697 3300005546 Bacteria 10202
310 Ga0070693_100071738 3300005547 Bacteria 2042
311 Ga0070665_100003665 3300005548 Bacteria 16274
312 Ga0070665_100007295 3300005548 Bacteria 11245
313 Ga0070665_100302382 3300005548 Bacteria 1603
314 Ga0070665_100958757 3300005548 Bacteria 868
315 Ga0068855_100028371 3300005563 Bacteria 6695
316 Ga0068855_100309820 3300005563 Bacteria 1747
317 Ga0068855_100420759 3300005563 Bacteria 1461
318 Ga0068855_100575125 3300005563 Bacteria 1217
319 Ga0068855_101024567 3300005563 Bacteria 866
320 Ga0068855_101130545 3300005563 Bacteria 817
321 Ga0068855_101819573 3300005563 Bacteria 618
322 Ga0068855_102095083 3300005563 Bacteria 570
323 Ga0070664_100000849 3300005564 Bacteria 23590
324 Ga0070664_100005049 3300005564 Bacteria 10581
325 Ga0070664_100008252 3300005564 Bacteria 8422
326 Ga0070664_100108775 3300005564 Bacteria 2417
327 Ga0070664_100134931 3300005564 Bacteria 2170
328 Ga0070664_100302779 3300005564 Bacteria 1445
329 Ga0070664_100397536 3300005564 Bacteria 1260
330 Ga0070664_100400216 3300005564 Bacteria 1255
331 Ga0070664_100706240 3300005564 Bacteria 940
332 Ga0070664_100839857 3300005564 Bacteria 860
333 Ga0070664_101113578 3300005564 Bacteria 744
334 Ga0070664_101240631 3300005564 Bacteria 704
335 Ga0070664_101525009 3300005564 Bacteria 632
336 Ga0070664_101601952 3300005564 Bacteria 617
337 Ga0070664_101974500 3300005564 Bacteria 554
338 Ga0070664_102089519 3300005564 Bacteria 537
339 Ga0068857_100015879 3300005577 Bacteria 6590
340 Ga0068857_100032296 3300005577 Bacteria 4629
341 Ga0068857_101122869 3300005577 Bacteria 759
342 Ga0068857_101174410 3300005577 Bacteria 743
343 Ga0068854_100017190 3300005578 Bacteria 4836
344 Ga0068854_100043084 3300005578 Bacteria 3197
345 Ga0068854_100261514 3300005578 Bacteria 1386
346 Ga0068854_100307900 3300005578 Bacteria 1284
347 Ga0068854_100457835 3300005578 Bacteria 1067
348 Ga0068854_100649677 3300005578 Bacteria 905
349 Ga0068854_100655535 3300005578 Bacteria 902
350 Ga0068854_100787774 3300005578 Bacteria 828
351 Ga0068854_100920375 3300005578 Bacteria 769
352 Ga0068854_101072291 3300005578 Bacteria 717
353 Ga0068854_101436036 3300005578 Bacteria 625
354 Ga0068854_102176472 3300005578 Bacteria 513
355 Ga0068856_100017850 3300005614 Bacteria 6883
356 Ga0068856_100024446 3300005614 Bacteria 5881
357 Ga0068856_100093630 3300005614 Bacteria 2990
358 Ga0068856_100134918 3300005614 Bacteria 2474
359 Ga0068856_100243250 3300005614 Bacteria 1814
360 Ga0068856_100360005 3300005614 Bacteria 1473
361 Ga0068856_101293071 3300005614 Bacteria 745
362 Ga0068856_101561266 3300005614 Bacteria 673
363 Ga0068856_102431636 3300005614 Bacteria 531
364 Ga0068852_100041423 3300005616 Bacteria 3892
365 Ga0068852_100096746 3300005616 Bacteria 2654
366 Ga0068852_100151345 3300005616 Bacteria 2158
367 Ga0068852_100210185 3300005616 Bacteria 1845
368 Ga0068852_100280766 3300005616 Bacteria 1605
369 Ga0068852_100342399 3300005616 Bacteria 1458
370 Ga0068852_100445707 3300005616 Bacteria 1281
371 Ga0068852_100486013 3300005616 Bacteria 1228
372 Ga0068852_100815923 3300005616 Bacteria 947
373 Ga0068852_100916293 3300005616 Bacteria 894
374 Ga0068852_101499525 3300005616 Bacteria 697
375 Ga0068852_101774092 3300005616 Bacteria 639
376 Ga0068859_100021759 3300005617 Bacteria 6431
377 Ga0068859_100113309 3300005617 Bacteria 2776
378 Ga0068859_100303609 3300005617 Bacteria 1690
379 Ga0068859_100774246 3300005617 Bacteria 1048
380 Ga0068859_102436246 3300005617 Bacteria 576
381 Ga0068864_100000872 3300005618 Bacteria 25408
382 Ga0068864_100002756 3300005618 Bacteria 14495
383 Ga0068864_100010414 3300005618 Bacteria 7681
384 Ga0068864_100013622 3300005618 Bacteria 6741
385 Ga0068864_100024899 3300005618 Bacteria 5035
386 Ga0068864_100125822 3300005618 Bacteria 2297
387 Ga0068864_100180681 3300005618 Bacteria 1929
388 Ga0068864_100191354 3300005618 Bacteria 1876
389 Ga0068864_100326000 3300005618 Bacteria 1443
390 Ga0068864_100749623 3300005618 Bacteria 957
391 Ga0068864_101737695 3300005618 Bacteria 629
392 Ga0068864_102435500 3300005618 Bacteria 530
393 Ga0068866_10015925 3300005718 Bacteria 3350
394 Ga0068866_10082002 3300005718 Bacteria 1734
395 Ga0068866_10086471 3300005718 Bacteria 1697
396 Ga0068866_11254335 3300005718 Unclassified 537
397 Ga0068861_100724186 3300005719 Bacteria 927
398 Ga0068861_101280496 3300005719 Bacteria 712
399 Ga0068851_10024005 3300005834 Bacteria 2983
400 Ga0068851_10028398 3300005834 Bacteria 2764
401 Ga0068851_10082299 3300005834 Bacteria 1683
402 Ga0068851_10092489 3300005834 Bacteria 1594
403 Ga0068851_10376695 3300005834 Bacteria 831
404 Ga0068851_10399209 3300005834 Bacteria 809
405 Ga0068851_10707220 3300005834 Bacteria 620
406 Ga0068851_10966785 3300005834 Bacteria 536
407 Ga0068870_10253483 3300005840 Bacteria 1092
408 Ga0068870_10897434 3300005840 Bacteria 626
409 Ga0068863_100005100 3300005841 Bacteria 12955
410 Ga0068863_100022498 3300005841 Bacteria 6019
411 Ga0068863_100029062 3300005841 Bacteria 5280
412 Ga0068863_100055414 3300005841 Bacteria 3754
413 Ga0068863_100106276 3300005841 Bacteria 2671
414 Ga0068863_100121268 3300005841 Bacteria 2493
415 Ga0068863_102115551 3300005841 Bacteria 573
416 Ga0068858_100015061 3300005842 Bacteria 7274
417 Ga0068858_100024268 3300005842 Bacteria 5651
418 Ga0068858_100051068 3300005842 Bacteria 3826
419 Ga0068858_100166486 3300005842 Bacteria 2077
420 Ga0068858_100315811 3300005842 Bacteria 1492
421 Ga0068858_100384816 3300005842 Bacteria 1346
422 Ga0068858_101766025 3300005842 Bacteria 611
423 Ga0068858_101965865 3300005842 Bacteria 578
424 Ga0068858_102229476 3300005842 Bacteria 541
425 Ga0068860_100148716 3300005843 Bacteria 2255
426 Ga0068860_100157926 3300005843 Bacteria 2186
427 Ga0068860_100251295 3300005843 Bacteria 1722
428 Ga0068860_100284073 3300005843 Bacteria 1618
429 Ga0068862_100002905 3300005844 Bacteria 14978
430 Ga0068862_100018869 3300005844 Bacteria 5747
431 Ga0068862_100178521 3300005844 Bacteria 1905
432 Ga0068862_102293254 3300005844 Bacteria 551
433 Ga0081539_10038916 3300005985 Bacteria 2812
434 Ga0070717_10007563 3300006028 Bacteria 8074
435 Ga0070717_10085135 3300006028 Bacteria 2660
436 Ga0070717_10795085 3300006028 Bacteria 860
437 Ga0070716_100053635 3300006173 Bacteria 2300
438 Ga0070716_100270196 3300006173 Bacteria 1168
439 Ga0075366_10273148 3300006195 Bacteria 1032
440 Ga0097621_100014821 3300006237 Bacteria 5847
441 Ga0097621_100079098 3300006237 Bacteria 2732
442 Ga0097621_100191561 3300006237 Bacteria 1771
443 Ga0097621_100423256 3300006237 Bacteria 1196
444 Ga0097621_102148304 3300006237 Bacteria 534
445 Ga0068871_100004251 3300006358 Bacteria 9926
446 Ga0068871_100019676 3300006358 Bacteria 5157
447 Ga0068871_100028951 3300006358 Bacteria 4347
448 Ga0068871_100107597 3300006358 Bacteria 2342
449 Ga0068871_101450396 3300006358 Bacteria 648
450 Ga0068871_101982759 3300006358 Bacteria 554
451 Ga0075429_100956340 3300006880 Bacteria 749
452 Ga0068865_100008259 3300006881 Bacteria 6428
453 Ga0068865_100013612 3300006881 Bacteria 5147
454 Ga0068865_100127343 3300006881 Bacteria 1903
455 Ga0068865_100405267 3300006881 Bacteria 1118
456 Ga0068865_100505089 3300006881 Bacteria 1009
457 Ga0068865_100709931 3300006881 Bacteria 860
458 Ga0075436_101291373 3300006914 Bacteria 552
459 Ga0097620_100021760 3300006931 Bacteria 6431
460 Ga0097620_100113302 3300006931 Bacteria 2776
461 Ga0097620_100303609 3300006931 Bacteria 1690
462 Ga0097620_100774186 3300006931 Bacteria 1048
463 Ga0097620_102436119 3300006931 Bacteria 576
464 Ga0105251_10015523 3300009011 Bacteria 4158
465 Ga0105240_10452693 3300009093 Bacteria 1436
466 Ga0105245_10056104 3300009098 Bacteria 3540
467 Ga0105245_10309212 3300009098 Bacteria 1553
468 Ga0105245_10405012 3300009098 Bacteria 1364
469 Ga0105245_10538611 3300009098 Bacteria 1188
470 Ga0105245_11631970 3300009098 Bacteria 697
471 Ga0105245_13082772 3300009098 Bacteria 516
472 Ga0105247_11789783 3300009101 Unclassified 511
473 Ga0105243_10091446 3300009148 Bacteria 2506
474 Ga0105243_10861216 3300009148 Bacteria 898
475 Ga0105243_12823086 3300009148 Bacteria 526
476 Ga0105241_10056493 3300009174 Bacteria 3009
477 Ga0105241_10180805 3300009174 Bacteria 1749
478 Ga0105241_11424256 3300009174 Bacteria 664
479 Ga0105242_10007915 3300009176 Bacteria 8181
480 Ga0105242_10615318 3300009176 Bacteria 1051
481 Ga0105242_12262357 3300009176 Bacteria 589
482 Ga0105248_10002216 3300009177 Bacteria 21499
483 Ga0105248_10004542 3300009177 Bacteria 15358
484 Ga0105248_10009267 3300009177 Bacteria 10835
485 Ga0105248_10010267 3300009177 Bacteria 10307
486 Ga0105248_10015217 3300009177 Bacteria 8477
487 Ga0105248_10389683 3300009177 Bacteria 1569
488 Ga0105248_10445748 3300009177 Bacteria 1458
489 Ga0105248_10726360 3300009177 Bacteria 1121
490 Ga0105248_10852527 3300009177 Bacteria 1028
491 Ga0105248_10967085 3300009177 Bacteria 962
492 Ga0105248_11316497 3300009177 Bacteria 817
493 Ga0105248_12524735 3300009177 Bacteria 586
494 Ga0105237_10228008 3300009545 Bacteria 1864
495 Ga0105237_10508789 3300009545 Bacteria 1211
496 Ga0105238_10146944 3300009551 Bacteria 2333
497 Ga0105238_10595595 3300009551 Bacteria 1113
498 Ga0105238_11165260 3300009551 Bacteria 795
499 Ga0105238_11320986 3300009551 Bacteria 747
500 Ga0105238_11508719 3300009551 Bacteria 701
501 Ga0105249_10358950 3300009553 Bacteria 1478
502 Ga0105249_13034712 3300009553 Bacteria 539
503 Ga0105239_10246096 3300010375 Bacteria 2008
504 Ga0105239_11048304 3300010375 Bacteria 938
505 Ga0105239_13517485 3300010375 Bacteria 509
506 Ga0105246_10487422 3300011119 Bacteria 1044
507 Ga0105246_10516536 3300011119 Bacteria 1017
508 Ga0105246_11816703 3300011119 Bacteria 583
509 Ga0157337_1017938 3300012483 Bacteria 627
510 Ga0157327_1066446 3300012512 Bacteria 550
511 Ga0157373_10012569 3300013100 Bacteria 6223
512 Ga0157373_10105063 3300013100 Bacteria 1986
513 Ga0157373_10165468 3300013100 Bacteria 1556
514 Ga0157373_10213594 3300013100 Bacteria 1360
515 Ga0157373_10286788 3300013100 Bacteria 1167
516 Ga0157373_10347482 3300013100 Bacteria 1058
517 Ga0157373_11039683 3300013100 Bacteria 613
518 Ga0157373_11127588 3300013100 Bacteria 589
519 Ga0157371_10076707 3300013102 Bacteria 2367
520 Ga0157371_10087142 3300013102 Bacteria 2211
521 Ga0157371_10196332 3300013102 Bacteria 1446
522 Ga0157371_10201848 3300013102 Bacteria 1425
523 Ga0157371_10283325 3300013102 Bacteria 1197
524 Ga0157371_10286938 3300013102 Bacteria 1190
525 Ga0157371_10313716 3300013102 Bacteria 1137
526 Ga0157371_10350910 3300013102 Bacteria 1074
527 Ga0157371_10423610 3300013102 Bacteria 976
528 Ga0157371_10692552 3300013102 Bacteria 762
529 Ga0157371_10751741 3300013102 Bacteria 732
530 Ga0157370_10011062 3300013104 Bacteria 9459
531 Ga0157370_10030037 3300013104 Bacteria 5326
532 Ga0157370_10151261 3300013104 Bacteria 2160
533 Ga0157370_10363859 3300013104 Bacteria 1333
534 Ga0157370_10771807 3300013104 Bacteria 875
535 Ga0157370_11577061 3300013104 Bacteria 590
536 Ga0157369_10102872 3300013105 Bacteria 3043
537 Ga0157369_10955140 3300013105 Bacteria 878
538 Ga0157369_10979518 3300013105 Bacteria 866
539 Ga0157369_11553122 3300013105 Bacteria 673
540 Ga0157369_11863072 3300013105 Bacteria 611
541 Ga0157369_12031509 3300013105 Bacteria 583
542 Ga0157369_12571015 3300013105 Bacteria 515
543 Ga0157374_10001338 3300013296 Bacteria 20964
544 Ga0157374_10017845 3300013296 Bacteria 6253
545 Ga0157374_10182797 3300013296 Bacteria 2049
546 Ga0157374_10385287 3300013296 Bacteria 1397
547 Ga0157374_10661264 3300013296 Bacteria 1057
548 Ga0157374_11069606 3300013296 Bacteria 827
549 Ga0157374_12237005 3300013296 Bacteria 574
550 Ga0157378_10054494 3300013297 Bacteria 3560
551 Ga0157378_10240338 3300013297 Bacteria 1729
552 Ga0157378_10669056 3300013297 Bacteria 1055
553 Ga0157378_10794360 3300013297 Bacteria 972
554 Ga0157378_12178293 3300013297 Bacteria 605
555 Ga0157378_12547728 3300013297 Bacteria 564
556 Ga0163162_10004270 3300013306 Bacteria 13747
557 Ga0163162_10198813 3300013306 Bacteria 2133
558 Ga0163162_10205967 3300013306 Bacteria 2096
559 Ga0163162_10250212 3300013306 Bacteria 1904
560 Ga0163162_10285340 3300013306 Bacteria 1783
561 Ga0163162_11493893 3300013306 Bacteria 770
562 Ga0157372_10200569 3300013307 Bacteria 2311
563 Ga0157372_10237787 3300013307 Bacteria 2113
564 Ga0157372_10786270 3300013307 Bacteria 1106
565 Ga0157372_11016469 3300013307 Bacteria 960
566 Ga0157372_11194372 3300013307 Bacteria 879
567 Ga0157372_12375581 3300013307 Bacteria 609
568 Ga0157372_13038727 3300013307 Bacteria 536
569 Ga0157375_10000709 3300013308 Bacteria 29414
570 Ga0157375_10147144 3300013308 Bacteria 2487
571 Ga0157375_10288913 3300013308 Bacteria 1803
572 Ga0157375_10372558 3300013308 Bacteria 1594
573 Ga0157375_11213385 3300013308 Bacteria 885
574 Ga0157375_12104976 3300013308 Bacteria 671
575 Ga0163163_10001535 3300014325 Bacteria 19461
576 Ga0163163_10142112 3300014325 Bacteria 2443
577 Ga0163163_10550998 3300014325 Bacteria 1216
578 Ga0163163_10787559 3300014325 Bacteria 1014
579 Ga0157380_10849429 3300014326 Bacteria 934
580 Ga0157377_10521592 3300014745 Bacteria 834
581 Ga0157377_11080142 3300014745 Bacteria 613
582 Ga0157379_10059211 3300014968 Bacteria 3425
583 Ga0157379_10065631 3300014968 Bacteria 3245
584 Ga0157379_10164490 3300014968 Bacteria 2002
585 Ga0157379_10566020 3300014968 Bacteria 1058
586 Ga0157379_11758267 3300014968 Bacteria 608
587 Ga0157376_10036799 3300014969 Bacteria 3967
588 Ga0157376_11385404 3300014969 Unclassified 734
589 Ga0163161_10892209 3300017792 Bacteria 753
590 Ga0163161_11160223 3300017792 Bacteria 666
591 Ga0206356_10258742 3300020070 Bacteria 790
592 Ga0206351_10919540 3300020077 Bacteria 635
593 Ga0206352_11233162 3300020078 Bacteria 1589
594 Ga0206350_11632685 3300020080 Bacteria 1546
595 Ga0206353_10953672 3300020082 Bacteria 773
596 Ga0206353_11941657 3300020082 Bacteria 1929
597 Ga0213876_10009687 3300021384 Bacteria 5186
598 Ga0224712_10417387 3300022467 Bacteria 641
599 Ga0207697_10028655 3300025315 Bacteria 2278
600 Ga0207697_10092153 3300025315 Bacteria 1285
601 Ga0207697_10179128 3300025315 Bacteria 928
602 Ga0207656_10056580 3300025321 Bacteria 1710
603 Ga0207656_10061210 3300025321 Bacteria 1652
604 Ga0207656_10202070 3300025321 Bacteria 960
605 Ga0207656_10270634 3300025321 Bacteria 836
606 Ga0207656_10277241 3300025321 Bacteria 826
607 Ga0207656_10389658 3300025321 Bacteria 699
608 Ga0207656_10535764 3300025321 Bacteria 596
609 Ga0207656_10622503 3300025321 Bacteria 551
610 Ga0207692_11056632 3300025898 Bacteria 537
611 Ga0207642_10058275 3300025899 Bacteria 1781
612 Ga0207642_10085873 3300025899 Bacteria 1541
613 Ga0207642_10086185 3300025899 Bacteria 1539
614 Ga0207642_10307117 3300025899 Bacteria 922
615 Ga0207710_10007786 3300025900 Bacteria 4535
616 Ga0207688_10019885 3300025901 Bacteria 3661
617 Ga0207688_10169592 3300025901 Bacteria 1297
618 Ga0207688_10210485 3300025901 Bacteria 1168
619 Ga0207688_10290692 3300025901 Bacteria 998
620 Ga0207688_10440341 3300025901 Bacteria 811
621 Ga0207688_10491844 3300025901 Bacteria 768
622 Ga0207688_10515162 3300025901 Bacteria 750
623 Ga0207680_10000858 3300025903 Bacteria 14331
624 Ga0207680_10012121 3300025903 Bacteria 4382
625 Ga0207680_10025838 3300025903 Bacteria 3244
626 Ga0207680_10027430 3300025903 Bacteria 3171
627 Ga0207680_10195447 3300025903 Bacteria 1376
628 Ga0207680_10372136 3300025903 Bacteria 1006
629 Ga0207680_10435824 3300025903 Bacteria 929
630 Ga0207680_10486927 3300025903 Bacteria 878
631 Ga0207680_10868578 3300025903 Bacteria 647
632 Ga0207647_10012922 3300025904 Bacteria 5802
633 Ga0207647_10074936 3300025904 Bacteria 2037
634 Ga0207647_10078290 3300025904 Bacteria 1986
635 Ga0207647_10083380 3300025904 Bacteria 1914
636 Ga0207647_10121279 3300025904 Bacteria 1541
637 Ga0207647_10194904 3300025904 Bacteria 1173
638 Ga0207647_10228106 3300025904 Bacteria 1072
639 Ga0207647_10422031 3300025904 Bacteria 750
640 Ga0207647_10429976 3300025904 Bacteria 741
641 Ga0207647_10445091 3300025904 Bacteria 726
642 Ga0207699_10732809 3300025906 Bacteria 725
643 Ga0207699_11384550 3300025906 Bacteria 520
644 Ga0207645_10057978 3300025907 Bacteria 2472
645 Ga0207645_10066436 3300025907 Bacteria 2305
646 Ga0207645_10162011 3300025907 Bacteria 1463
647 Ga0207645_10224063 3300025907 Bacteria 1240
648 Ga0207645_10369463 3300025907 Bacteria 961
649 Ga0207645_10375320 3300025907 Bacteria 954
650 Ga0207645_10842641 3300025907 Bacteria 623
651 Ga0207645_11045960 3300025907 Bacteria 552
652 Ga0207645_11237647 3300025907 Bacteria 500
653 Ga0207643_10194020 3300025908 Bacteria 1234
654 Ga0207643_10345026 3300025908 Bacteria 934
655 Ga0207705_10000067 3300025909 Bacteria 136004
656 Ga0207705_10013453 3300025909 Bacteria 5902
657 Ga0207705_10051307 3300025909 Bacteria 2969
658 Ga0207705_10249244 3300025909 Bacteria 1354
659 Ga0207705_10283588 3300025909 Bacteria 1268
660 Ga0207705_10284869 3300025909 Bacteria 1265
661 Ga0207705_10289422 3300025909 Bacteria 1255
662 Ga0207705_10638112 3300025909 Bacteria 828
663 Ga0207705_10657089 3300025909 Bacteria 815
664 Ga0207705_10927854 3300025909 Bacteria 674
665 Ga0207705_11456647 3300025909 Bacteria 519
666 Ga0207705_11511858 3300025909 Bacteria 508
667 Ga0207654_10088800 3300025911 Bacteria 1879
668 Ga0207654_10172031 3300025911 Bacteria 1407
669 Ga0207654_10255902 3300025911 Bacteria 1175
670 Ga0207654_11121038 3300025911 Bacteria 573
671 Ga0207707_10045420 3300025912 Bacteria 3828
672 Ga0207707_10421225 3300025912 Bacteria 1145
673 Ga0207707_11117800 3300025912 Bacteria 641
674 Ga0207707_11306613 3300025912 Bacteria 582
675 Ga0207695_11192391 3300025913 Unclassified 641
676 Ga0207695_11194601 3300025913 Bacteria 641
677 Ga0207671_10260190 3300025914 Bacteria 1366
678 Ga0207693_10089718 3300025915 Bacteria 2409
679 Ga0207663_11235143 3300025916 Bacteria 602
680 Ga0207660_10012534 3300025917 Bacteria 5550
681 Ga0207660_10471812 3300025917 Bacteria 1016
682 Ga0207660_10736118 3300025917 Bacteria 805
683 Ga0207662_10389164 3300025918 Bacteria 943
684 Ga0207662_10456189 3300025918 Bacteria 875
685 Ga0207657_10002936 3300025919 Bacteria 18291
686 Ga0207657_10006174 3300025919 Bacteria 12455
687 Ga0207657_10015619 3300025919 Bacteria 7346
688 Ga0207657_10019566 3300025919 Bacteria 6424
689 Ga0207657_10110140 3300025919 Bacteria 2275
690 Ga0207657_10137975 3300025919 Bacteria 1994
691 Ga0207657_10197595 3300025919 Bacteria 1619
692 Ga0207657_10288758 3300025919 Bacteria 1301
693 Ga0207657_10310593 3300025919 Bacteria 1248
694 Ga0207657_10423825 3300025919 Bacteria 1046
695 Ga0207657_10485098 3300025919 Bacteria 969
696 Ga0207657_10772310 3300025919 Bacteria 744
697 Ga0207657_10897535 3300025919 Bacteria 683
698 Ga0207657_10939136 3300025919 Bacteria 665
699 Ga0207657_11441010 3300025919 Bacteria 516
700 Ga0207649_10021561 3300025920 Bacteria 3711
701 Ga0207649_10029075 3300025920 Bacteria 3261
702 Ga0207649_10037552 3300025920 Bacteria 2926
703 Ga0207649_10057151 3300025920 Bacteria 2439
704 Ga0207649_10073254 3300025920 Bacteria 2194
705 Ga0207649_10102504 3300025920 Bacteria 1897
706 Ga0207649_10389392 3300025920 Bacteria 1041
707 Ga0207649_10405164 3300025920 Bacteria 1021
708 Ga0207649_10650288 3300025920 Bacteria 814
709 Ga0207649_10677038 3300025920 Bacteria 799
710 Ga0207649_10685779 3300025920 Bacteria 794
711 Ga0207649_10789851 3300025920 Bacteria 740
712 Ga0207649_11269948 3300025920 Bacteria 582
713 Ga0207649_11421693 3300025920 Bacteria 549
714 Ga0207652_10000058 3300025921 Bacteria 113620
715 Ga0207652_10268141 3300025921 Bacteria 1540
716 Ga0207652_10594578 3300025921 Bacteria 993
717 Ga0207652_10950392 3300025921 Bacteria 757
718 Ga0207681_10125129 3300025923 Bacteria 1892
719 Ga0207681_10296471 3300025923 Bacteria 1278
720 Ga0207681_10439068 3300025923 Bacteria 1060
721 Ga0207681_10448748 3300025923 Bacteria 1049
722 Ga0207681_11200242 3300025923 Bacteria 637
723 Ga0207694_10013651 3300025924 Bacteria 6122
724 Ga0207694_11087936 3300025924 Bacteria 677
725 Ga0207694_11375130 3300025924 Bacteria 597
726 Ga0207650_10018262 3300025925 Bacteria 4919
727 Ga0207650_10021162 3300025925 Bacteria 4597
728 Ga0207650_10076513 3300025925 Bacteria 2528
729 Ga0207650_10136820 3300025925 Bacteria 1922
730 Ga0207650_10263846 3300025925 Bacteria 1398
731 Ga0207650_10284589 3300025925 Bacteria 1347
732 Ga0207650_10387558 3300025925 Bacteria 1155
733 Ga0207650_10675353 3300025925 Bacteria 872
734 Ga0207650_10863619 3300025925 Bacteria 768
735 Ga0207650_11507124 3300025925 Bacteria 571
736 Ga0207659_10275887 3300025926 Bacteria 1373
737 Ga0207659_10453146 3300025926 Bacteria 1081
738 Ga0207659_11642196 3300025926 Bacteria 548
739 Ga0207687_10101399 3300025927 Bacteria 2119
740 Ga0207687_10206864 3300025927 Bacteria 1537
741 Ga0207687_10376384 3300025927 Bacteria 1162
742 Ga0207687_11003742 3300025927 Bacteria 716
743 Ga0207700_10713826 3300025928 Bacteria 895
744 Ga0207700_11108356 3300025928 Bacteria 708
745 Ga0207664_10040239 3300025929 Bacteria 3633
746 Ga0207664_10055008 3300025929 Bacteria 3156
747 Ga0207664_10089114 3300025929 Bacteria 2526
748 Ga0207664_10150001 3300025929 Bacteria 1980
749 Ga0207664_10239551 3300025929 Bacteria 1579
750 Ga0207664_11208664 3300025929 Bacteria 674
751 Ga0207644_10000202 3300025931 Bacteria 41988
752 Ga0207644_10000240 3300025931 Bacteria 37642
753 Ga0207644_10000433 3300025931 Bacteria 27154
754 Ga0207644_10001112 3300025931 Bacteria 17264
755 Ga0207644_10015996 3300025931 Bacteria 5044
756 Ga0207644_10016242 3300025931 Bacteria 5008
757 Ga0207644_10076272 3300025931 Bacteria 2466
758 Ga0207644_10331969 3300025931 Bacteria 1231
759 Ga0207644_10575200 3300025931 Bacteria 934
760 Ga0207644_10776433 3300025931 Bacteria 801
761 Ga0207644_10876130 3300025931 Bacteria 752
762 Ga0207644_11394893 3300025931 Bacteria 588
763 Ga0207690_10012321 3300025932 Bacteria 5117
764 Ga0207690_10061003 3300025932 Bacteria 2562
765 Ga0207690_10104774 3300025932 Bacteria 2027
766 Ga0207690_10129917 3300025932 Bacteria 1842
767 Ga0207690_10154241 3300025932 Bacteria 1705
768 Ga0207690_10219565 3300025932 Bacteria 1454
769 Ga0207690_10337433 3300025932 Bacteria 1189
770 Ga0207690_10388756 3300025932 Bacteria 1110
771 Ga0207690_10442341 3300025932 Bacteria 1043
772 Ga0207690_10475579 3300025932 Bacteria 1008
773 Ga0207690_10505204 3300025932 Bacteria 978
774 Ga0207690_10550645 3300025932 Bacteria 938
775 Ga0207690_10562843 3300025932 Bacteria 928
776 Ga0207690_10611317 3300025932 Bacteria 890
777 Ga0207690_10670303 3300025932 Bacteria 851
778 Ga0207690_11190019 3300025932 Bacteria 636
779 Ga0207690_11252063 3300025932 Bacteria 620
780 Ga0207706_10004931 3300025933 Bacteria 12463
781 Ga0207706_10034789 3300025933 Bacteria 4482
782 Ga0207706_10036991 3300025933 Bacteria 4335
783 Ga0207706_10077831 3300025933 Bacteria 2917
784 Ga0207706_10081955 3300025933 Bacteria 2835
785 Ga0207706_10124254 3300025933 Bacteria 2270
786 Ga0207706_10159098 3300025933 Bacteria 1986
787 Ga0207706_10187790 3300025933 Bacteria 1814
788 Ga0207706_10208243 3300025933 Bacteria 1714
789 Ga0207706_10210292 3300025933 Bacteria 1705
790 Ga0207706_10220564 3300025933 Bacteria 1660
791 Ga0207706_10256363 3300025933 Bacteria 1527
792 Ga0207706_10274562 3300025933 Bacteria 1471
793 Ga0207706_10276493 3300025933 Bacteria 1465
794 Ga0207706_10346850 3300025933 Bacteria 1291
795 Ga0207706_10396987 3300025933 Bacteria 1196
796 Ga0207706_10408254 3300025933 Bacteria 1177
797 Ga0207686_10112814 3300025934 Bacteria 1837
798 Ga0207686_10307469 3300025934 Bacteria 1180
799 Ga0207686_10607859 3300025934 Bacteria 861
800 Ga0207686_11078786 3300025934 Unclassified 654
801 Ga0207709_10087137 3300025935 Bacteria 2029
802 Ga0207709_10461481 3300025935 Bacteria 984
803 Ga0207670_10582217 3300025936 Bacteria 917
804 Ga0207669_10011672 3300025937 Bacteria 4286
805 Ga0207669_10022124 3300025937 Bacteria 3371
806 Ga0207669_10038501 3300025937 Bacteria 2754
807 Ga0207669_10120755 3300025937 Bacteria 1778
808 Ga0207669_10155446 3300025937 Bacteria 1608
809 Ga0207669_10224042 3300025937 Bacteria 1382
810 Ga0207669_10636888 3300025937 Bacteria 870
811 Ga0207704_10006846 3300025938 Bacteria 5343
812 Ga0207704_10075300 3300025938 Bacteria 2158
813 Ga0207704_10165196 3300025938 Bacteria 1580
814 Ga0207704_10683129 3300025938 Bacteria 848
815 Ga0207665_10072741 3300025939 Bacteria 2349
816 Ga0207691_10003424 3300025940 Bacteria 15425
817 Ga0207691_10044408 3300025940 Bacteria 4092
818 Ga0207691_10077999 3300025940 Bacteria 2983
819 Ga0207691_10143918 3300025940 Bacteria 2099
820 Ga0207691_10196418 3300025940 Bacteria 1758
821 Ga0207691_10224576 3300025940 Bacteria 1628
822 Ga0207691_10267407 3300025940 Bacteria 1473
823 Ga0207691_10470350 3300025940 Bacteria 1069
824 Ga0207691_11625021 3300025940 Bacteria 525
825 Ga0207711_10000190 3300025941 Bacteria 65723
826 Ga0207711_10001101 3300025941 Bacteria 25793
827 Ga0207711_10001163 3300025941 Bacteria 25054
828 Ga0207711_10080518 3300025941 Bacteria 2845
829 Ga0207711_10099528 3300025941 Bacteria 2570
830 Ga0207711_10161368 3300025941 Bacteria 2029
831 Ga0207711_10363288 3300025941 Bacteria 1341
832 Ga0207711_10404337 3300025941 Bacteria 1269
833 Ga0207711_10845875 3300025941 Bacteria 851
834 Ga0207711_10887301 3300025941 Bacteria 829
835 Ga0207711_11029650 3300025941 Bacteria 763
836 Ga0207711_11500192 3300025941 Bacteria 617
837 Ga0207711_11921149 3300025941 Bacteria 535
838 Ga0207689_10199759 3300025942 Bacteria 1650
839 Ga0207689_10226174 3300025942 Bacteria 1546
840 Ga0207689_10269074 3300025942 Bacteria 1411
841 Ga0207689_10372655 3300025942 Bacteria 1188
842 Ga0207689_10400675 3300025942 Bacteria 1144
843 Ga0207689_10574636 3300025942 Bacteria 947
844 Ga0207689_11389050 3300025942 Bacteria 589
845 Ga0207661_10003282 3300025944 Bacteria 11224
846 Ga0207661_10014353 3300025944 Bacteria 5804
847 Ga0207661_10275758 3300025944 Bacteria 1502
848 Ga0207679_10005385 3300025945 Bacteria 8016
849 Ga0207679_10017240 3300025945 Bacteria 4813
850 Ga0207679_10034099 3300025945 Bacteria 3589
851 Ga0207679_10102649 3300025945 Bacteria 2240
852 Ga0207679_10165087 3300025945 Bacteria 1817
853 Ga0207679_10197227 3300025945 Bacteria 1679
854 Ga0207679_10201215 3300025945 Bacteria 1664
855 Ga0207679_10239787 3300025945 Bacteria 1536
856 Ga0207679_10242433 3300025945 Bacteria 1528
857 Ga0207679_10508173 3300025945 Bacteria 1076
858 Ga0207679_10548170 3300025945 Bacteria 1037
859 Ga0207679_11022894 3300025945 Bacteria 757
860 Ga0207679_11175524 3300025945 Bacteria 704
861 Ga0207679_11301507 3300025945 Bacteria 667
862 Ga0207667_10000828 3300025949 Bacteria 39983
863 Ga0207667_10081677 3300025949 Bacteria 3348
864 Ga0207667_10171425 3300025949 Bacteria 2230
865 Ga0207667_10624119 3300025949 Bacteria 1085
866 Ga0207651_10001355 3300025960 Bacteria 11086
867 Ga0207651_10010068 3300025960 Bacteria 5218
868 Ga0207651_10023049 3300025960 Bacteria 3821
869 Ga0207651_10024038 3300025960 Bacteria 3761
870 Ga0207651_10068684 3300025960 Bacteria 2499
871 Ga0207651_10073064 3300025960 Bacteria 2437
872 Ga0207651_10107482 3300025960 Bacteria 2085
873 Ga0207651_10330504 3300025960 Bacteria 1277
874 Ga0207651_10486682 3300025960 Bacteria 1064
875 Ga0207651_10730039 3300025960 Bacteria 874
876 Ga0207651_11059110 3300025960 Bacteria 726
877 Ga0207651_11935219 3300025960 Bacteria 530
878 Ga0207712_12106031 3300025961 Bacteria 505
879 Ga0207668_10015108 3300025972 Bacteria 4792
880 Ga0207668_10341447 3300025972 Bacteria 1249
881 Ga0207668_10559256 3300025972 Bacteria 992
882 Ga0207668_11296081 3300025972 Bacteria 656
883 Ga0207668_11726594 3300025972 Bacteria 565
884 Ga0207668_11749989 3300025972 Bacteria 561
885 Ga0207668_11914272 3300025972 Bacteria 535
886 Ga0207640_10013461 3300025981 Bacteria 4690
887 Ga0207640_10179305 3300025981 Bacteria 1587
888 Ga0207640_10188238 3300025981 Bacteria 1554
889 Ga0207640_10351968 3300025981 Bacteria 1184
890 Ga0207640_10417275 3300025981 Bacteria 1097
891 Ga0207640_10453250 3300025981 Bacteria 1058
892 Ga0207640_10714915 3300025981 Bacteria 860
893 Ga0207640_11563665 3300025981 Unclassified 594
894 Ga0207640_11645389 3300025981 Bacteria 579
895 Ga0207640_11806459 3300025981 Bacteria 553
896 Ga0207658_10003080 3300025986 Bacteria 11918
897 Ga0207658_10007754 3300025986 Bacteria 7315
898 Ga0207658_10036918 3300025986 Bacteria 3506
899 Ga0207658_10128259 3300025986 Bacteria 2033
900 Ga0207658_10142846 3300025986 Bacteria 1940
901 Ga0207658_10307884 3300025986 Bacteria 1367
902 Ga0207658_10314825 3300025986 Bacteria 1353
903 Ga0207658_10618103 3300025986 Bacteria 974
904 Ga0207677_10002372 3300026023 Bacteria 9865
905 Ga0207677_10004220 3300026023 Bacteria 7694
906 Ga0207677_10720370 3300026023 Bacteria 887
907 Ga0207677_11176878 3300026023 Bacteria 701
908 Ga0207677_12166317 3300026023 Bacteria 517
909 Ga0207677_12177108 3300026023 Bacteria 516
910 Ga0207703_10005645 3300026035 Bacteria 10047
911 Ga0207703_10040477 3300026035 Bacteria 3730
912 Ga0207703_10078399 3300026035 Bacteria 2745
913 Ga0207703_10198753 3300026035 Bacteria 1780
914 Ga0207703_10650457 3300026035 Bacteria 1000
915 Ga0207703_11140040 3300026035 Bacteria 749
916 Ga0207639_10023762 3300026041 Bacteria 4428
917 Ga0207639_10070161 3300026041 Bacteria 2736
918 Ga0207639_10750776 3300026041 Bacteria 907
919 Ga0207639_10838583 3300026041 Bacteria 858
920 Ga0207639_10910437 3300026041 Bacteria 822
921 Ga0207639_10948705 3300026041 Bacteria 805
922 Ga0207639_11015890 3300026041 Bacteria 777
923 Ga0207639_11248295 3300026041 Bacteria 697
924 Ga0207639_11506424 3300026041 Bacteria 631
925 Ga0207639_11568317 3300026041 Bacteria 618
926 Ga0207639_11728562 3300026041 Bacteria 586
927 Ga0207678_10002816 3300026067 Bacteria 15773
928 Ga0207678_10017909 3300026067 Bacteria 6222
929 Ga0207678_10019305 3300026067 Bacteria 5988
930 Ga0207678_10085167 3300026067 Bacteria 2702
931 Ga0207678_10102916 3300026067 Bacteria 2438
932 Ga0207678_10110270 3300026067 Bacteria 2348
933 Ga0207678_10138254 3300026067 Bacteria 2079
934 Ga0207678_10247697 3300026067 Bacteria 1526
935 Ga0207678_10299535 3300026067 Bacteria 1382
936 Ga0207678_10790407 3300026067 Bacteria 837
937 Ga0207678_11578616 3300026067 Bacteria 578
938 Ga0207678_11808857 3300026067 Bacteria 535
939 Ga0207702_10010020 3300026078 Bacteria 7946
940 Ga0207702_10023280 3300026078 Bacteria 5136
941 Ga0207702_10049867 3300026078 Bacteria 3533
942 Ga0207702_10104370 3300026078 Bacteria 2508
943 Ga0207702_10119452 3300026078 Bacteria 2357
944 Ga0207702_10573452 3300026078 Bacteria 1106
945 Ga0207702_11347199 3300026078 Bacteria 708
946 Ga0207702_11922416 3300026078 Bacteria 583
947 Ga0207702_12124371 3300026078 Bacteria 551
948 Ga0207641_10004938 3300026088 Bacteria 11453
949 Ga0207641_10011626 3300026088 Bacteria 7228
950 Ga0207641_10130182 3300026088 Bacteria 2258
951 Ga0207641_10160851 3300026088 Bacteria 2041
952 Ga0207641_10198922 3300026088 Bacteria 1846
953 Ga0207641_10224525 3300026088 Bacteria 1743
954 Ga0207641_10980107 3300026088 Bacteria 841
955 Ga0207641_11730628 3300026088 Bacteria 627
956 Ga0207641_12267920 3300026088 Bacteria 543
957 Ga0207648_10004449 3300026089 Bacteria 14373
958 Ga0207648_10022651 3300026089 Bacteria 5639
959 Ga0207648_10077565 3300026089 Bacteria 2897
960 Ga0207648_10270991 3300026089 Bacteria 1517
961 Ga0207648_10282927 3300026089 Bacteria 1483
962 Ga0207648_11054591 3300026089 Bacteria 762
963 Ga0207648_11629854 3300026089 Bacteria 606
964 Ga0207676_10003729 3300026095 Bacteria 10772
965 Ga0207676_10037955 3300026095 Bacteria 3675
966 Ga0207676_10077798 3300026095 Bacteria 2684
967 Ga0207676_10151408 3300026095 Bacteria 1998
968 Ga0207676_10172183 3300026095 Bacteria 1887
969 Ga0207676_10187750 3300026095 Bacteria 1816
970 Ga0207676_10255806 3300026095 Bacteria 1578
971 Ga0207676_10291426 3300026095 Bacteria 1486
972 Ga0207676_10459615 3300026095 Bacteria 1202
973 Ga0207676_11433594 3300026095 Bacteria 687
974 Ga0207676_12377334 3300026095 Bacteria 527
975 Ga0207674_10001184 3300026116 Bacteria 33891
976 Ga0207674_10006685 3300026116 Bacteria 13547
977 Ga0207674_10007011 3300026116 Bacteria 13171
978 Ga0207674_10026673 3300026116 Bacteria 6129
979 Ga0207674_10382559 3300026116 Bacteria 1361
980 Ga0207674_11076251 3300026116 Bacteria 773
981 Ga0207674_11214166 3300026116 Bacteria 724
982 Ga0207675_100476239 3300026118 Bacteria 1240
983 Ga0207675_101303015 3300026118 Bacteria 747
984 Ga0207675_102085088 3300026118 Bacteria 584
985 Ga0207683_10000541 3300026121 Bacteria 34994
986 Ga0207683_10006217 3300026121 Bacteria 10236
987 Ga0207683_10006279 3300026121 Bacteria 10187
988 Ga0207683_10047283 3300026121 Bacteria 3768
989 Ga0207683_10070921 3300026121 Bacteria 3079
990 Ga0207698_10035156 3300026142 Bacteria 3662
991 Ga0207698_10038503 3300026142 Bacteria 3534
992 Ga0207698_10071793 3300026142 Bacteria 2749
993 Ga0207698_10268724 3300026142 Bacteria 1571
994 Ga0207698_10275974 3300026142 Bacteria 1552
995 Ga0207698_10486428 3300026142 Bacteria 1198
996 Ga0207698_10524307 3300026142 Bacteria 1157
997 Ga0207698_10722195 3300026142 Bacteria 993
998 Ga0207698_10818191 3300026142 Bacteria 935
999 Ga0207698_10875490 3300026142 Bacteria 904
1000 Ga0207698_10880051 3300026142 Bacteria 902
1001 Ga0207698_11044070 3300026142 Bacteria 829
1002 Ga0207698_11120541 3300026142 Bacteria 800
1003 Ga0207698_11639586 3300026142 Bacteria 659
1004 Ga0207698_12242417 3300026142 Bacteria 558
1005 Ga0207698_12504069 3300026142 Bacteria 526
1006 Ga0209974_10088868 3300027876 Bacteria 1070
1007 Ga0268266_10122451 3300028379 Bacteria 2316
1008 Ga0268266_10679840 3300028379 Bacteria 991
1009 Ga0268266_11678604 3300028379 Bacteria 610
1010 Ga0268265_10002225 3300028380 Bacteria 14916
1011 Ga0268265_10038427 3300028380 Bacteria 3521
1012 Ga0268264_10125114 3300028381 Bacteria 2271
1013 Ga0268264_10337165 3300028381 Bacteria 1431
1014 Ga0268264_10344953 3300028381 Bacteria 1416
1015 Ga0268264_10430233 3300028381 Bacteria 1275
1016 Ga0268264_11158428 3300028381 Bacteria 782
1017 Ga0307408_100069773 3300031548 Bacteria 2592
1018 Ga0307408_101004220 3300031548 Bacteria 769
1019 Ga0307408_101758644 3300031548 Bacteria 592
1020 Ga0307405_10035072 3300031731 Bacteria 2992
1021 Ga0307405_10040894 3300031731 Bacteria 2811
1022 Ga0307413_10669105 3300031824 Bacteria 858
1023 Ga0307410_10000590 3300031852 Bacteria 14938
1024 Ga0307410_10137547 3300031852 Bacteria 1802
1025 Ga0307410_10352569 3300031852 Bacteria 1176
1026 Ga0307406_10189701 3300031901 Bacteria 1503
1027 Ga0307406_10277897 3300031901 Bacteria 1276
1028 Ga0307406_10968618 3300031901 Bacteria 728
1029 Ga0307406_11100159 3300031901 Bacteria 686
1030 Ga0307407_10030474 3300031903 Bacteria 2910
1031 Ga0307412_10081937 3300031911 Bacteria 2232
1032 Ga0307412_10425709 3300031911 Bacteria 1087
1033 Ga0307412_12319573 3300031911 Bacteria 501
1034 Ga0307409_100081992 3300031995 Bacteria 2609
1035 Ga0307409_100257459 3300031995 Bacteria 1599
1036 Ga0307409_100989758 3300031995 Bacteria 858
1037 Ga0307409_102558891 3300031995 Bacteria 539
1038 Ga0307416_100010787 3300032002 Bacteria 6054
1039 Ga0307416_100026708 3300032002 Bacteria 4259
1040 Ga0307416_100462031 3300032002 Bacteria 1325
1041 Ga0307416_100924487 3300032002 Bacteria 973
1042 Ga0307416_102421266 3300032002 Bacteria 624
1043 Ga0307414_10011964 3300032004 Bacteria 5116
1044 Ga0307414_10155268 3300032004 Bacteria 1810
1045 Ga0307414_10776419 3300032004 Bacteria 872
1046 Ga0307414_11014635 3300032004 Bacteria 764
1047 Ga0307411_10088884 3300032005 Bacteria 2150
1048 Ga0307411_10153551 3300032005 Bacteria 1714
1049 Ga0307411_10246717 3300032005 Bacteria 1401
1050 Ga0307411_12110300 3300032005 Bacteria 527
1051 Ga0307415_100029789 3300032126 Bacteria 3493
1052 Ga0307415_100069870 3300032126 Bacteria 2464
1053 Ga0307415_100226187 3300032126 Bacteria 1503
1054 Ga0373930_0145300 3300034816 Bacteria 592
1055 Ga0373944_0107865 3300035089 Bacteria 947
1056 Ga0373951_0169917 3300035091 Bacteria 621
1057 Ga0373960_0234681 3300035121 Bacteria 661
1058 Ga0373943_0115462 3300035170 Bacteria 1421
1059 Ga0373943_0341532 3300035170 Bacteria 857
1060 Ga0373946_0003074 3300035171 Bacteria 5910
1061 Ga0373961_0268742 3300035241 Bacteria 622
1062 Ga0373962_0317726 3300035242 Bacteria 556
1063 Ga0373931_0486733 3300035691 Bacteria 794
1064 Ga0373931_0963371 3300035691 Bacteria 576
1065 Ga0373935_0009428 3300035692 Bacteria 5839
1066 Ga0373935_0154046 3300035692 Bacteria 1562
1067 Ga0373927_0040667 3300035695 Bacteria 3016
1068 Ga0373947_0050338 3300035725 Bacteria 2505
1069 Ga0373925_0011268 3300037068 Bacteria 6486
1070 Ga0373925_0878854 3300037068 Bacteria 739
1071 Ga0395899_0000157 3300037312 Bacteria 103574
1072 Ga0395899_0001390 3300037312 Bacteria 20752
1073 Ga0395899_0013545 3300037312 Bacteria 6233
1074 Ga0395899_0020408 3300037312 Bacteria 5023
1075 Ga0395899_0023877 3300037312 Bacteria 4626
1076 Ga0395899_0031730 3300037312 Bacteria 3969
1077 Ga0395899_0042493 3300037312 Bacteria 3393
1078 Ga0395899_0046136 3300037312 Bacteria 3245
1079 Ga0395899_0052140 3300037312 Bacteria 3033
1080 Ga0395899_0083816 3300037312 Bacteria 2318
1081 Ga0395899_0090780 3300037312 Bacteria 2214
1082 Ga0395899_0100498 3300037312 Bacteria 2089
1083 Ga0395899_0201469 3300037312 Bacteria 1387
1084 Ga0395899_0210193 3300037312 Bacteria 1352
1085 Ga0395899_0243399 3300037312 Bacteria 1237
1086 Ga0395899_0349569 3300037312 Bacteria 989
1087 Ga0395899_0446401 3300037312 Bacteria 848
1088 Ga0395899_0509438 3300037312 Bacteria 779
1089 Ga0395899_0642568 3300037312 Bacteria 671
1090 Ga0395899_0700167 3300037312 Bacteria 635
1091 Ga0395899_0992525 3300037312 Unclassified 507
1092 Ga0395900_0000290 3300037418 Bacteria 75444
1093 Ga0395900_0003952 3300037418 Bacteria 15826
1094 Ga0395900_0014785 3300037418 Bacteria 7953
1095 Ga0395900_0014822 3300037418 Bacteria 7941
1096 Ga0395900_0018129 3300037418 Bacteria 7183
1097 Ga0395900_0020090 3300037418 Bacteria 6813
1098 Ga0395900_0020825 3300037418 Bacteria 6701
1099 Ga0395900_0036939 3300037418 Bacteria 5035
1100 Ga0395900_0044319 3300037418 Bacteria 4584
1101 Ga0395900_0060619 3300037418 Bacteria 3893
1102 Ga0395900_0075483 3300037418 Bacteria 3465
1103 Ga0395900_0086288 3300037418 Bacteria 3225
1104 Ga0395900_0086795 3300037418 Bacteria 3216
1105 Ga0395900_0095073 3300037418 Bacteria 3061
1106 Ga0395900_0104942 3300037418 Bacteria 2903
1107 Ga0395900_0107628 3300037418 Bacteria 2864
1108 Ga0395900_0122503 3300037418 Bacteria 2667
1109 Ga0395900_0127721 3300037418 Bacteria 2606
1110 Ga0395900_0161987 3300037418 Bacteria 2281
1111 Ga0395900_0209951 3300037418 Bacteria 1966
1112 Ga0395900_0221797 3300037418 Bacteria 1905
1113 Ga0395900_0293014 3300037418 Bacteria 1615
1114 Ga0395900_0341549 3300037418 Bacteria 1473
1115 Ga0395900_0375818 3300037418 Bacteria 1390
1116 Ga0395900_0432245 3300037418 Bacteria 1275
1117 Ga0395900_0451928 3300037418 Bacteria 1241
1118 Ga0395900_0661677 3300037418 Bacteria 980
1119 Ga0395900_0665975 3300037418 Bacteria 976
1120 Ga0395900_0708120 3300037418 Bacteria 940
1121 Ga0395900_1103648 3300037418 Bacteria 710
1122 Ga0395900_1185697 3300037418 Bacteria 679
1123 Ga0395900_1231847 3300037418 Unclassified 663
1124 Ga0395900_1555794 3300037418 Bacteria 573
1125 Ga0395900_1587535 3300037418 Bacteria 566
1126 Ga0395900_1721789 3300037418 Bacteria 538
1127 Ga0395898_0000054 3300037466 Bacteria 279561
1128 Ga0395898_0002720 3300037466 Bacteria 20390
1129 Ga0395898_0041487 3300037466 Bacteria 4545
1130 Ga0395898_0041985 3300037466 Bacteria 4515
1131 Ga0395898_0046301 3300037466 Bacteria 4272
1132 Ga0395898_0046969 3300037466 Bacteria 4239
1133 Ga0395898_0052359 3300037466 Bacteria 3988
1134 Ga0395898_0057268 3300037466 Bacteria 3798
1135 Ga0395898_0065390 3300037466 Bacteria 3525
1136 Ga0395898_0069837 3300037466 Bacteria 3397
1137 Ga0395898_0173463 3300037466 Bacteria 2061
1138 Ga0395898_0203661 3300037466 Bacteria 1888
1139 Ga0395898_0223892 3300037466 Bacteria 1794
1140 Ga0395898_0326835 3300037466 Bacteria 1462
1141 Ga0395898_0475663 3300037466 Bacteria 1189
1142 Ga0395898_0581945 3300037466 Bacteria 1062
1143 Ga0395898_0854023 3300037466 Bacteria 849
1144 Ga0395898_1606105 3300037466 Bacteria 574
1145 Ga0395898_1796082 3300037466 Bacteria 534
1146 Ga0395905_0000046 3300037471 Bacteria 240463
1147 Ga0395905_0001572 3300037471 Bacteria 27278
1148 Ga0395905_0003151 3300037471 Bacteria 17763
1149 Ga0395905_0005360 3300037471 Bacteria 13103
1150 Ga0395905_0016020 3300037471 Bacteria 7125
1151 Ga0395905_0020508 3300037471 Bacteria 6260
1152 Ga0395905_0023513 3300037471 Bacteria 5822
1153 Ga0395905_0027535 3300037471 Bacteria 5360
1154 Ga0395905_0068985 3300037471 Bacteria 3311
1155 Ga0395905_0072360 3300037471 Bacteria 3232
1156 Ga0395905_0077191 3300037471 Bacteria 3121
1157 Ga0395905_0077929 3300037471 Bacteria 3105
1158 Ga0395905_0078343 3300037471 Bacteria 3097
1159 Ga0395905_0094451 3300037471 Bacteria 2805
1160 Ga0395905_0094554 3300037471 Bacteria 2804
1161 Ga0395905_0096163 3300037471 Bacteria 2780
1162 Ga0395905_0105085 3300037471 Bacteria 2651
1163 Ga0395905_0127984 3300037471 Bacteria 2388
1164 Ga0395905_0144701 3300037471 Bacteria 2236
1165 Ga0395905_0151282 3300037471 Bacteria 2183
1166 Ga0395905_0170486 3300037471 Bacteria 2044
1167 Ga0395905_0181816 3300037471 Bacteria 1974
1168 Ga0395905_0212656 3300037471 Bacteria 1811
1169 Ga0395905_0241831 3300037471 Bacteria 1686
1170 Ga0395905_0322253 3300037471 Bacteria 1435
1171 Ga0395905_0360990 3300037471 Bacteria 1345
1172 Ga0395905_0425651 3300037471 Bacteria 1224
1173 Ga0395905_0428528 3300037471 Bacteria 1219
1174 Ga0395905_0563607 3300037471 Bacteria 1040
1175 Ga0395905_0644468 3300037471 Bacteria 961
1176 Ga0395905_0720569 3300037471 Bacteria 900
1177 Ga0395905_0724210 3300037471 Bacteria 897
1178 Ga0395905_0960792 3300037471 Bacteria 757
1179 Ga0395905_0965464 3300037471 Bacteria 755
1180 Ga0395905_0995036 3300037471 Bacteria 741
1181 Ga0395905_1021041 3300037471 Bacteria 730
1182 Ga0395905_1095155 3300037471 Bacteria 700
1183 Ga0395905_1343540 3300037471 Bacteria 619
1184 Ga0395905_1343699 3300037471 Bacteria 619
1185 Ga0395905_1351036 3300037471 Bacteria 616
1186 Ga0395905_1530593 3300037471 Bacteria 571
1187 Ga0395905_1655699 3300037471 Bacteria 545
1188 Ga0395901_0000102 3300038443 Bacteria 115611
1189 Ga0395901_0009987 3300038443 Bacteria 9619
1190 Ga0395901_0027314 3300038443 Bacteria 5863
1191 Ga0395901_0051655 3300038443 Bacteria 4274
1192 Ga0395901_0067150 3300038443 Bacteria 3734
1193 Ga0395901_0075939 3300038443 Bacteria 3505
1194 Ga0395901_0095127 3300038443 Bacteria 3121
1195 Ga0395901_0098148 3300038443 Bacteria 3071
1196 Ga0395901_0099504 3300038443 Bacteria 3049
1197 Ga0395901_0100893 3300038443 Bacteria 3028
1198 Ga0395901_0103003 3300038443 Bacteria 2995
1199 Ga0395901_0104502 3300038443 Bacteria 2972
1200 Ga0395901_0108342 3300038443 Bacteria 2916
1201 Ga0395901_0108459 3300038443 Bacteria 2914
1202 Ga0395901_0125847 3300038443 Bacteria 2693
1203 Ga0395901_0140253 3300038443 Bacteria 2540
1204 Ga0395901_0215121 3300038443 Bacteria 2010
1205 Ga0395901_0219151 3300038443 Bacteria 1989
1206 Ga0395901_0235131 3300038443 Bacteria 1912
1207 Ga0395901_0254870 3300038443 Bacteria 1827
1208 Ga0395901_0282691 3300038443 Bacteria 1723
1209 Ga0395901_0292912 3300038443 Bacteria 1688
1210 Ga0395901_0433636 3300038443 Bacteria 1346
1211 Ga0395901_0456146 3300038443 Bacteria 1307
1212 Ga0395901_0471642 3300038443 Bacteria 1281
1213 Ga0395901_0537735 3300038443 Bacteria 1185
1214 Ga0395901_0557499 3300038443 Bacteria 1161
1215 Ga0395901_0804905 3300038443 Bacteria 928
1216 Ga0395901_0836976 3300038443 Bacteria 906
1217 Ga0395901_0870912 3300038443 Bacteria 884
1218 Ga0395901_1150572 3300038443 Bacteria 744
1219 Ga0395901_2161055 3300038443 Unclassified 501
1220 Ga0436365_0628446 3300039437 Bacteria 4034
1221 Ga0436363_0841606 3300039450 Bacteria 1412
1222 Ga0436362_0982029 3300039453 Bacteria 593
1223 Ga0439465_0019013 3300041413 Bacteria 2148
1224 Ga0451791_0605526 3300041451 Bacteria 530
1225 Ga0439448_0006453 3300042005 Bacteria 3373
1226 Ga0439432_033878 3300042006 Bacteria 1642
1227 Ga0439449_0116571 3300042007 Bacteria 991
1228 Ga0439458_0000066 3300042157 Bacteria 18748
1229 Ga0439458_0000821 3300042157 Bacteria 7996
1230 Ga0439464_0007789 3300042439 Bacteria 2803
1231 Ga0466969_0214927 3300044656 Bacteria 875
1232 Ga0466969_0314500 3300044656 Bacteria 709
1233 Ga0466972_0338767 3300044658 Bacteria 703
1234 Ga0466965_0130341 3300044683 Bacteria 1304
1235 Ga0466966_0009646 3300044684 Bacteria 6389
1236 Ga0466966_0015113 3300044684 Bacteria 5107
1237 Ga0466966_0028898 3300044684 Bacteria 3609
1238 Ga0466966_0088701 3300044684 Bacteria 1922
1239 Ga0466966_0215937 3300044684 Bacteria 1158
1240 Ga0466966_0516164 3300044684 Bacteria 719
1241 Ga0466966_0526889 3300044684 Bacteria 711
1242 Ga0466961_0020851 3300044693 Bacteria 4217
1243 Ga0466961_0070512 3300044693 Bacteria 2219
1244 Ga0466961_0155034 3300044693 Bacteria 1429
1245 Ga0466961_0237014 3300044693 Bacteria 1122
1246 Ga0466961_0345888 3300044693 Bacteria 905
1247 Ga0466961_0399464 3300044693 Bacteria 834
1248 Ga0466961_0479026 3300044693 Bacteria 752
1249 Ga0466961_0560656 3300044693 Bacteria 688
1250 Ga0466963_0017335 3300044694 Bacteria 4489
1251 Ga0466963_0130887 3300044694 Bacteria 1733
1252 Ga0466963_0141138 3300044694 Bacteria 1669
1253 Ga0466963_0163812 3300044694 Bacteria 1548
1254 Ga0466963_0192897 3300044694 Bacteria 1423
1255 Ga0466963_0248461 3300044694 Bacteria 1248
1256 Ga0466963_0262744 3300044694 Bacteria 1212
1257 Ga0466963_0298684 3300044694 Bacteria 1132
1258 Ga0466963_0378074 3300044694 Bacteria 998
1259 Ga0466964_0171943 3300044706 Bacteria 1021
1260 Ga0466964_0286135 3300044706 Bacteria 826
1261 Ga0466964_0292999 3300044706 Bacteria 818
1262 Ga0466971_0046646 3300044719 Bacteria 1947
1263 Ga0466971_0138711 3300044719 Bacteria 1132
1264 Ga0466971_0348379 3300044719 Bacteria 716
1265 Ga0466971_0558279 3300044719 Bacteria 568
1266 Ga0466968_0109024 3300044735 Bacteria 1243
1267 Ga0466970_0017530 3300044765 Bacteria 3701
1268 Ga0466970_0063664 3300044765 Bacteria 1977
1269 Ga0466970_0113247 3300044765 Bacteria 1482
1270 Ga0466970_0185484 3300044765 Bacteria 1155
1271 Ga0466970_0315193 3300044765 Bacteria 884
1272 Ga0466970_0349659 3300044765 Bacteria 839
1273 Ga0466970_0478077 3300044765 Bacteria 716
1274 Ga0466957_0006425 3300044842 Bacteria 6638
1275 Ga0466957_0084698 3300044842 Bacteria 1979
1276 Ga0466957_0109757 3300044842 Bacteria 1748
1277 Ga0466957_0204014 3300044842 Bacteria 1300
1278 Ga0466957_0315285 3300044842 Bacteria 1054
1279 Ga0466957_0510065 3300044842 Bacteria 835
1280 Ga0466957_0753835 3300044842 Bacteria 689
1281 Ga0466957_1022146 3300044842 Bacteria 594
1282 Ga0466960_0117390 3300044901 Bacteria 1390
1283 Ga0466960_0211385 3300044901 Bacteria 1064
1284 Ga0466960_0369547 3300044901 Bacteria 821
1285 Ga0466960_0793578 3300044901 Bacteria 573
1286 Ga0466959_0009432 3300045049 Bacteria 6940
1287 Ga0466959_0026456 3300045049 Bacteria 4300
1288 Ga0466959_0058688 3300045049 Bacteria 2802
1289 Ga0466959_0236413 3300045049 Bacteria 1263
1290 Ga0466959_0343338 3300045049 Bacteria 1018
1291 Ga0466959_0586274 3300045049 Bacteria 750
1292 Ga0466959_0766889 3300045049 Bacteria 645
1293 Ga0466959_0801343 3300045049 Bacteria 630
1294 Ga0466958_0034962 3300045836 Bacteria 3000
1295 Ga0466958_0101943 3300045836 Bacteria 1785
1296 Ga0466958_0137366 3300045836 Bacteria 1538
1297 Ga0466958_0476283 3300045836 Bacteria 809
1298 Ga0466967_0046141 3300045976 Bacteria 3791
1299 Ga0466967_0047294 3300045976 Bacteria 3750
1300 Ga0466967_0067182 3300045976 Bacteria 3197
1301 Ga0466967_0138031 3300045976 Bacteria 2269
1302 Ga0466967_0164371 3300045976 Bacteria 2085
1303 Ga0466967_0316596 3300045976 Bacteria 1504
1304 Ga0466967_0340984 3300045976 Bacteria 1449
1305 Ga0466967_0520994 3300045976 Bacteria 1168
1306 Ga0466967_0648957 3300045976 Bacteria 1043
1307 Ga0466967_0676055 3300045976 Bacteria 1022
1308 Ga0466967_0878347 3300045976 Bacteria 891
1309 Ga0466967_1339545 3300045976 Bacteria 713
1310 Ga0466967_1349291 3300045976 Bacteria 710
1311 Ga0466967_1533279 3300045976 Bacteria 664
1312 Ga0466967_1854063 3300045976 Bacteria 600
1313 Ga0466967_1971996 3300045976 Bacteria 580
1314 Ga0495629_0415706 3300046459 Bacteria 913
1315 Ga0495629_0564499 3300046459 Bacteria 763
1316 Ga0495580_0178355 3300046472 Bacteria 1467
1317 Ga0495580_0710712 3300046472 Bacteria 657
1318 Ga0495639_0330139 3300046475 Bacteria 764
1319 Ga0495606_0457018 3300046507 Bacteria 653
1320 Ga0495643_0240782 3300046522 Bacteria 849
1321 Ga0495642_0213298 3300046528 Bacteria 842
1322 Ga0495642_0303303 3300046528 Bacteria 700
1323 Ga0495665_0136337 3300046531 Bacteria 1284
1324 Ga0495598_0000209 3300046537 Bacteria 10261
1325 Ga0495621_0000044 3300046539 Bacteria 24707
1326 Ga0495621_0027770 3300046539 Bacteria 1919
1327 Ga0495633_0051086 3300046558 Bacteria 1948
1328 Ga0495668_0013713 3300046616 Bacteria 4769
1329 Ga0495668_0067414 3300046616 Bacteria 1969
1330 Ga0495647_0022062 3300046681 Bacteria 2299
1331 Ga0495669_0001914 3300046684 Bacteria 8541
1332 Ga0495669_0030612 3300046684 Bacteria 2362
1333 Ga0495670_0000148 3300046691 Bacteria 30968
1334 Ga0495677_0010234 3300047445 Bacteria 3448
1335 Ga0495677_0103821 3300047445 Bacteria 1077
1336 Ga0495677_0429328 3300047445 Bacteria 523
1337 Ga0495615_0166319 3300048090 Bacteria 665
1338 Ga0496100_0003087 3300048903 Bacteria 8619
1339 Ga0496100_0216656 3300048903 Bacteria 1403
1340 Ga0496100_0719779 3300048903 Bacteria 779
1341 Ga0496101_0000216 3300048904 Bacteria 43445
1342 Ga0496101_0012977 3300048904 Bacteria 5572
1343 Ga0496101_0119966 3300048904 Bacteria 1987
1344 Ga0496101_0147023 3300048904 Bacteria 1800
1345 Ga0496101_0222775 3300048904 Bacteria 1464
1346 Ga0496101_1121014 3300048904 Bacteria 617
1347 Ga0496102_0008344 3300048905 Bacteria 8873
1348 Ga0496102_0145102 3300048905 Bacteria 2227
1349 Ga0496102_0985027 3300048905 Bacteria 764
1350 Ga0496102_1082011 3300048905 Bacteria 722
1351 Ga0496103_0007319 3300048906 Bacteria 6580
1352 Ga0496103_0104194 3300048906 Bacteria 1798
1353 Ga0496103_0124170 3300048906 Bacteria 1645
1354 Ga0496103_0285815 3300048906 Bacteria 1061
1355 Ga0496103_0464906 3300048906 Bacteria 811
1356 Ga0496103_0646708 3300048906 Bacteria 672
1357 Ga0496104_0126276 3300048907 Bacteria 2456
1358 Ga0496104_0524008 3300048907 Bacteria 1096
1359 Ga0496104_0581169 3300048907 Bacteria 1031
1360 Ga0496104_1463066 3300048907 Bacteria 586
1361 Ga0496105_0096082 3300048908 Bacteria 2447
1362 Ga0496105_0110876 3300048908 Bacteria 2265
1363 Ga0496105_0116977 3300048908 Bacteria 2199
1364 Ga0496105_0482621 3300048908 Bacteria 975
1365 Ga0496106_0054220 3300048909 Bacteria 3029
1366 Ga0496106_0139337 3300048909 Bacteria 1907
1367 Ga0496106_0333473 3300048909 Bacteria 1218
1368 Ga0496106_0398949 3300048909 Bacteria 1105
1369 Ga0496106_0474296 3300048909 Bacteria 1005
1370 Ga0496106_0887063 3300048909 Bacteria 705
1371 Ga0496107_0000258 3300048910 Bacteria 28128
1372 Ga0496107_0061294 3300048910 Bacteria 2723
1373 Ga0496107_0156668 3300048910 Bacteria 1686
1374 Ga0496107_0317104 3300048910 Bacteria 1160
1375 Ga0496107_0684840 3300048910 Bacteria 755
1376 Ga0496107_0850114 3300048910 Bacteria 667
1377 Ga0496107_1350462 3300048910 Bacteria 509
1378 Ga0496108_0002458 3300048911 Bacteria 14825
1379 Ga0496108_0003907 3300048911 Bacteria 11970
1380 Ga0496108_0011359 3300048911 Bacteria 7239
1381 Ga0496108_0188213 3300048911 Bacteria 1788
1382 Ga0496108_0582999 3300048911 Bacteria 975
1383 Ga0496108_0751143 3300048911 Bacteria 844
1384 Ga0496108_0939835 3300048911 Bacteria 741
1385 Ga0496109_0014422 3300048912 Bacteria 6876
1386 Ga0496109_0051461 3300048912 Bacteria 3751
1387 Ga0496109_0106408 3300048912 Bacteria 2605
1388 Ga0496109_0142380 3300048912 Bacteria 2242
1389 Ga0496109_0163553 3300048912 Bacteria 2085
1390 Ga0496109_0193699 3300048912 Bacteria 1910
1391 Ga0496109_0633998 3300048912 Bacteria 1005
1392 Ga0496109_1064588 3300048912 Bacteria 746
1393 Ga0496109_1193638 3300048912 Bacteria 698
1394 Ga0496109_1714325 3300048912 Bacteria 562
1395 Ga0496110_0002729 3300048913 Bacteria 13338
1396 Ga0496110_0006466 3300048913 Bacteria 9287
1397 Ga0496110_0008298 3300048913 Bacteria 8353
1398 Ga0496110_0061673 3300048913 Bacteria 3310
1399 Ga0496110_1065487 3300048913 Bacteria 716
1400 Ga0496110_1669602 3300048913 Bacteria 547
1401 Ga0496111_0000858 3300048914 Bacteria 16474
1402 Ga0496111_0131310 3300048914 Bacteria 1853
1403 Ga0496111_0141052 3300048914 Bacteria 1785
1404 Ga0496111_0327166 3300048914 Bacteria 1135
1405 Ga0496111_0339760 3300048914 Bacteria 1111
1406 Ga0496111_0340359 3300048914 Bacteria 1110
1407 Ga0496111_0529529 3300048914 Bacteria 866
1408 Ga0496112_0001994 3300048915 Bacteria 16154
1409 Ga0496112_0006536 3300048915 Bacteria 10252
1410 Ga0496112_0007277 3300048915 Bacteria 9809
1411 Ga0496112_0007592 3300048915 Bacteria 9636
1412 Ga0496112_0025631 3300048915 Bacteria 5663
1413 Ga0496112_0056958 3300048915 Bacteria 3848
1414 Ga0496112_0199533 3300048915 Bacteria 1960
1415 Ga0496112_0536595 3300048915 Bacteria 1104
1416 Ga0496112_0626498 3300048915 Bacteria 1006
1417 Ga0496112_0638950 3300048915 Bacteria 995
1418 Ga0496112_1438070 3300048915 Bacteria 604
1419 Ga0496113_0001774 3300048916 Bacteria 12237
1420 Ga0496113_0012372 3300048916 Bacteria 5734
1421 Ga0496113_0273365 3300048916 Bacteria 1350
1422 Ga0496113_0367633 3300048916 Bacteria 1154
1423 Ga0496113_0487073 3300048916 Bacteria 990
1424 Ga0496113_0573399 3300048916 Bacteria 904
1425 Ga0496113_0667444 3300048916 Bacteria 831
1426 Ga0496113_1283363 3300048916 Bacteria 570
1427 Ga0496114_0000016 3300048917 Bacteria 274656
1428 Ga0496114_0051175 3300048917 Bacteria 3438
1429 Ga0496114_0952242 3300048917 Bacteria 741
1430 Ga0496115_0711719 3300048918 Bacteria 788
1431 Ga0501067_0056371 3300049583 Bacteria 2177
1432 Ga0501068_0924016 3300049584 Bacteria 574
1433 Ga0501069_0078190 3300049585 Bacteria 1860
1434 Ga0501070_0024533 3300049586 Bacteria 5057
1435 Ga0501070_1489430 3300049586 Bacteria 512
1436 Ga0501202_009622 3300049652 Bacteria 1781
1437 Ga0501209_231289 3300049656 Unclassified 575
1438 Ga0501209_257557 3300049656 Bacteria 546
1439 Ga0501216_042464 3300049660 Bacteria 873
1440 Ga0501217_027652 3300049661 Bacteria 1378
1441 Ga0501223_093277 3300049663 Bacteria 614
1442 Ga0501235_019544 3300049669 Bacteria 1503
1443 Ga0501235_034614 3300049669 Bacteria 1146
1444 Ga0501235_124473 3300049669 Bacteria 648
1445 Ga0501240_061907 3300049673 Bacteria 662
1446 Ga0501242_006701 3300049674 Bacteria 1319
1447 Ga0501243_123251 3300049675 Bacteria 538
1448 Ga0501247_003032 3300049677 Bacteria 1783
1449 Ga0501248_014299 3300049678 Bacteria 752
1450 Ga0501258_005637 3300049687 Bacteria 1219
1451 Ga0501259_057714 3300049688 Bacteria 804
1452 Ga0501221_069178 3300049704 Bacteria 830
1453 Ga0501225_0015497 3300049705 Bacteria 2121
1454 Ga0501225_0126029 3300049705 Bacteria 764
1455 Ga0501229_031274 3300049706 Bacteria 731
1456 Ga0501234_022239 3300049707 Bacteria 1012
1457 Ga0501234_068581 3300049707 Bacteria 610
1458 Ga0501262_005532 3300049759 Bacteria 1493
1459 Ga0501263_003065 3300049760 Bacteria 1758
1460 Ga0501266_061530 3300049763 Bacteria 601
1461 Ga0501267_025905 3300049764 Bacteria 669
1462 Ga0501268_000282 3300049765 Bacteria 5208
1463 Ga0501270_050076 3300049767 Bacteria 754
1464 Ga0501270_173714 3300049767 Bacteria 505
1465 Ga0501273_010550 3300049770 Bacteria 1137
1466 Ga0501279_050100 3300049775 Bacteria 660
1467 Ga0501283_044209 3300049779 Bacteria 777
1468 Ga0501283_078408 3300049779 Bacteria 618
1469 Ga0501204_009159 3300049850 Bacteria 1140
1470 nmdc:mga0k408_218035_c1 3300050493 Bacteria 1139
1471 nmdc:mga05p37_1734789_c1 3300050507 Bacteria 606
1472 nmdc:mga09592_926365_c1 3300050508 Bacteria 731
1473 Ga0495619_0946472 3300053085 Bacteria 578
1474 Ga0500658_0000032 3300053134 Bacteria 90863
1475 Ga0501082_1585717 3300060353 Unclassified 572
1476 Ga0466962_0044709 3300061719 Bacteria 2118
1477 Ga0466962_0255975 3300061719 Bacteria 861

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300025321 Ga0207656_10061210 Ga0207656_100612102 63
2 3300001979 JGI24740J21852_10000820 JGI24740J21852_100008202 64
3 3300001979 JGI24740J21852_10014275 JGI24740J21852_100142753 64
4 3300005327 Ga0070658_10007648 Ga0070658_100076485 64
5 3300005329 Ga0070683_100006609 Ga0070683_1000066096 64
6 3300005336 Ga0070680_100000105 Ga0070680_1000001053 64
7 3300005339 Ga0070660_100011633 Ga0070660_1000116332 64
8 3300005345 Ga0070692_10972505 Ga0070692_109725052 64
9 3300005455 Ga0070663_100002096 Ga0070663_1000020969 64
10 3300005458 Ga0070681_10053910 Ga0070681_100539102 64
11 3300005530 Ga0070679_100000125 Ga0070679_10000012560 64
12 3300005563 Ga0068855_100028371 Ga0068855_1000283712 64
13 3300005578 Ga0068854_100261514 Ga0068854_1002615142 64
14 3300005614 Ga0068856_100017850 Ga0068856_1000178503 64
15 3300013104 Ga0157370_10011062 Ga0157370_1001106210 64
16 3300013105 Ga0157369_10102872 Ga0157369_101028723 64
17 3300020070 Ga0206356_10258742 Ga0206356_102587422 64
18 3300020077 Ga0206351_10919540 Ga0206351_109195402 64
19 3300020078 Ga0206352_11233162 Ga0206352_112331622 64
20 3300020080 Ga0206350_11632685 Ga0206350_116326852 64
21 3300020082 Ga0206353_11941657 Ga0206353_119416572 64
22 3300022467 Ga0224712_10417387 Ga0224712_104173872 64
23 3300025904 Ga0207647_10074936 Ga0207647_100749362 64
24 3300025909 Ga0207705_10000067 Ga0207705_100000679 64
25 3300025912 Ga0207707_10045420 Ga0207707_100454204 64
26 3300025917 Ga0207660_10012534 Ga0207660_100125342 64
27 3300025919 Ga0207657_10019566 Ga0207657_100195665 64
28 3300025921 Ga0207652_10000058 Ga0207652_1000005859 64
29 3300025944 Ga0207661_10014353 Ga0207661_100143536 64
30 3300025949 Ga0207667_10000828 Ga0207667_100008289 64
31 3300025981 Ga0207640_10188238 Ga0207640_101882382 64
32 3300026067 Ga0207678_10002816 Ga0207678_1000281613 64
33 3300026078 Ga0207702_10023280 Ga0207702_100232803 64
34 3300037312 Ga0395899_0046136 Ga0395899_0046136_551_745 64
35 3300037418 Ga0395900_0018129 Ga0395900_0018129_3775_3969 64
36 3300037418 Ga0395900_0075483 Ga0395900_0075483_562_756 64
37 3300037418 Ga0395900_0432245 Ga0395900_0432245_793_987 64
38 3300037466 Ga0395898_0065390 Ga0395898_0065390_114_308 64
39 3300037466 Ga0395898_0203661 Ga0395898_0203661_793_987 64
40 3300037466 Ga0395898_0326835 Ga0395898_0326835_793_987 64
41 3300037471 Ga0395905_0096163 Ga0395905_0096163_2525_2719 64
42 3300038443 Ga0395901_0108459 Ga0395901_0108459_561_755 64
43 3300038443 Ga0395901_0282691 Ga0395901_0282691_793_987 64
44 3300001915 JGI24741J21665_1030203 JGI24741J21665_10302033 65
45 3300001976 JGI24752J21851_1001942 JGI24752J21851_10019423 65
46 3300001976 JGI24752J21851_1009443 JGI24752J21851_10094432 65
47 3300001979 JGI24740J21852_10133481 JGI24740J21852_101334812 65
48 3300001979 JGI24740J21852_10144758 JGI24740J21852_101447582 65
49 3300001989 JGI24739J22299_10172537 JGI24739J22299_101725371 65
50 3300001990 JGI24737J22298_10001222 JGI24737J22298_1000122211 65
51 3300001990 JGI24737J22298_10057321 JGI24737J22298_100573212 65
52 3300001990 JGI24737J22298_10080279 JGI24737J22298_100802792 65
53 3300001990 JGI24737J22298_10124615 JGI24737J22298_101246152 65
54 3300001990 JGI24737J22298_10163584 JGI24737J22298_101635842 65
55 3300001990 JGI24737J22298_10215178 JGI24737J22298_102151782 65
56 3300001990 JGI24737J22298_10230994 JGI24737J22298_102309942 65
57 3300001991 JGI24743J22301_10046200 JGI24743J22301_100462001 65
58 3300001991 JGI24743J22301_10114044 JGI24743J22301_101140442 65
59 3300002067 JGI24735J21928_10038740 JGI24735J21928_100387402 65
60 3300002067 JGI24735J21928_10066058 JGI24735J21928_100660582 65
61 3300002067 JGI24735J21928_10247023 JGI24735J21928_102470232 65
62 3300002067 JGI24735J21928_10250054 JGI24735J21928_102500542 65
63 3300002067 JGI24735J21928_10256650 JGI24735J21928_102566502 65
64 3300002073 JGI24745J21846_1006264 JGI24745J21846_10062642 65
65 3300002074 JGI24748J21848_1016082 JGI24748J21848_10160822 65
66 3300002075 JGI24738J21930_10006975 JGI24738J21930_100069752 65
67 3300002075 JGI24738J21930_10102923 JGI24738J21930_101029231 65
68 3300002077 JGI24744J21845_10040727 JGI24744J21845_100407272 65
69 3300002239 JGI24034J26672_10120324 JGI24034J26672_101203242 65
70 3300002459 JGI24751J29686_10070449 JGI24751J29686_100704491 65
71 3300005290 Ga0065712_10174204 Ga0065712_101742042 65
72 3300005293 Ga0065715_10382029 Ga0065715_103820292 65
73 3300005327 Ga0070658_10020996 Ga0070658_100209962 65
74 3300005327 Ga0070658_10149077 Ga0070658_101490771 65
75 3300005327 Ga0070658_10197075 Ga0070658_101970752 65
76 3300005327 Ga0070658_10231249 Ga0070658_102312491 65
77 3300005327 Ga0070658_10399085 Ga0070658_103990852 65
78 3300005327 Ga0070658_10543773 Ga0070658_105437732 65
79 3300005327 Ga0070658_10706131 Ga0070658_107061312 65
80 3300005327 Ga0070658_10744611 Ga0070658_107446112 65
81 3300005327 Ga0070658_10993560 Ga0070658_109935602 65
82 3300005327 Ga0070658_11336976 Ga0070658_113369762 65
83 3300005327 Ga0070658_11579503 Ga0070658_115795032 65
84 3300005327 Ga0070658_11659747 Ga0070658_116597472 65
85 3300005327 Ga0070658_11994679 Ga0070658_119946791 65
86 3300005328 Ga0070676_10119104 Ga0070676_101191042 65
87 3300005328 Ga0070676_10164511 Ga0070676_101645112 65
88 3300005328 Ga0070676_10205379 Ga0070676_102053792 65
89 3300005328 Ga0070676_10370968 Ga0070676_103709682 65
90 3300005328 Ga0070676_10394923 Ga0070676_103949232 65
91 3300005328 Ga0070676_10501789 Ga0070676_105017892 65
92 3300005328 Ga0070676_10556397 Ga0070676_105563972 65
93 3300005328 Ga0070676_10847062 Ga0070676_108470622 65
94 3300005328 Ga0070676_10847096 Ga0070676_108470962 65
95 3300005328 Ga0070676_11427023 Ga0070676_114270232 65
96 3300005329 Ga0070683_100011545 Ga0070683_1000115456 65
97 3300005329 Ga0070683_100185036 Ga0070683_1001850362 65
98 3300005329 Ga0070683_100241044 Ga0070683_1002410442 65
99 3300005329 Ga0070683_100712912 Ga0070683_1007129122 65
100 3300005330 Ga0070690_100067028 Ga0070690_1000670283 65
101 3300005330 Ga0070690_100117380 Ga0070690_1001173802 65
102 3300005330 Ga0070690_100590306 Ga0070690_1005903062 65
103 3300005331 Ga0070670_100001335 Ga0070670_1000013356 65
104 3300005331 Ga0070670_100001653 Ga0070670_1000016539 65
105 3300005331 Ga0070670_100095991 Ga0070670_1000959912 65
106 3300005331 Ga0070670_100111644 Ga0070670_1001116442 65
107 3300005331 Ga0070670_100301143 Ga0070670_1003011432 65
108 3300005331 Ga0070670_100430095 Ga0070670_1004300952 65
109 3300005331 Ga0070670_100453464 Ga0070670_1004534642 65
110 3300005331 Ga0070670_100583071 Ga0070670_1005830712 65
111 3300005331 Ga0070670_100795677 Ga0070670_1007956772 65
112 3300005331 Ga0070670_101335418 Ga0070670_1013354182 65
113 3300005331 Ga0070670_101492589 Ga0070670_1014925892 65
114 3300005334 Ga0068869_100238868 Ga0068869_1002388682 65
115 3300005334 Ga0068869_100269846 Ga0068869_1002698462 65
116 3300005334 Ga0068869_100307172 Ga0068869_1003071722 65
117 3300005334 Ga0068869_100593567 Ga0068869_1005935672 65
118 3300005334 Ga0068869_101575326 Ga0068869_1015753262 65
119 3300005335 Ga0070666_10000283 Ga0070666_1000028328 65
120 3300005335 Ga0070666_10000310 Ga0070666_1000031030 65
121 3300005335 Ga0070666_10030361 Ga0070666_100303612 65
122 3300005335 Ga0070666_10034024 Ga0070666_100340243 65
123 3300005335 Ga0070666_10050124 Ga0070666_100501243 65
124 3300005335 Ga0070666_10080127 Ga0070666_100801273 65
125 3300005335 Ga0070666_10302477 Ga0070666_103024772 65
126 3300005335 Ga0070666_10465715 Ga0070666_104657151 65
127 3300005335 Ga0070666_10572385 Ga0070666_105723852 65
128 3300005335 Ga0070666_10634835 Ga0070666_106348352 65
129 3300005336 Ga0070680_100401376 Ga0070680_1004013762 65
130 3300005336 Ga0070680_100603918 Ga0070680_1006039182 65
131 3300005336 Ga0070680_100941638 Ga0070680_1009416382 65
132 3300005336 Ga0070680_101134918 Ga0070680_1011349182 65
133 3300005337 Ga0070682_100377575 Ga0070682_1003775752 65
134 3300005337 Ga0070682_100533091 Ga0070682_1005330912 65
135 3300005337 Ga0070682_100613822 Ga0070682_1006138222 65
136 3300005337 Ga0070682_100966406 Ga0070682_1009664062 65
137 3300005338 Ga0068868_100001238 Ga0068868_1000012388 65
138 3300005338 Ga0068868_100100964 Ga0068868_1001009642 65
139 3300005338 Ga0068868_100155545 Ga0068868_1001555452 65
140 3300005338 Ga0068868_100455396 Ga0068868_1004553962 65
141 3300005338 Ga0068868_100593453 Ga0068868_1005934532 65
142 3300005338 Ga0068868_101901009 Ga0068868_1019010092 65
143 3300005338 Ga0068868_102296008 Ga0068868_1022960082 65
144 3300005339 Ga0070660_100085990 Ga0070660_1000859902 65
145 3300005339 Ga0070660_100183395 Ga0070660_1001833952 65
146 3300005339 Ga0070660_100365612 Ga0070660_1003656122 65
147 3300005339 Ga0070660_100478647 Ga0070660_1004786472 65
148 3300005339 Ga0070660_100495173 Ga0070660_1004951732 65
149 3300005339 Ga0070660_100523402 Ga0070660_1005234022 65
150 3300005339 Ga0070660_100539599 Ga0070660_1005395992 65
151 3300005339 Ga0070660_100622078 Ga0070660_1006220782 65
152 3300005339 Ga0070660_100800433 Ga0070660_1008004332 65
153 3300005339 Ga0070660_100952889 Ga0070660_1009528892 65
154 3300005339 Ga0070660_101000261 Ga0070660_1010002611 65
155 3300005339 Ga0070660_101038869 Ga0070660_1010388692 65
156 3300005339 Ga0070660_101054474 Ga0070660_1010544742 65
157 3300005339 Ga0070660_101425263 Ga0070660_1014252632 65
158 3300005339 Ga0070660_101691649 Ga0070660_1016916492 65
159 3300005339 Ga0070660_101716161 Ga0070660_1017161612 65
160 3300005339 Ga0070660_101910944 Ga0070660_1019109442 65
161 3300005340 Ga0070689_101215811 Ga0070689_1012158112 65
162 3300005343 Ga0070687_100450557 Ga0070687_1004505572 65
163 3300005343 Ga0070687_100540821 Ga0070687_1005408212 65
164 3300005343 Ga0070687_100816678 Ga0070687_1008166781 65
165 3300005343 Ga0070687_101511288 Ga0070687_1015112882 65
166 3300005344 Ga0070661_100009351 Ga0070661_1000093512 65
167 3300005344 Ga0070661_100013626 Ga0070661_1000136263 65
168 3300005344 Ga0070661_100040464 Ga0070661_1000404642 65
169 3300005344 Ga0070661_100049952 Ga0070661_1000499522 65
170 3300005344 Ga0070661_100064189 Ga0070661_1000641892 65
171 3300005344 Ga0070661_100108178 Ga0070661_1001081782 65
172 3300005344 Ga0070661_100227858 Ga0070661_1002278582 65
173 3300005344 Ga0070661_100331912 Ga0070661_1003319122 65
174 3300005344 Ga0070661_100440690 Ga0070661_1004406902 65
175 3300005344 Ga0070661_100460781 Ga0070661_1004607812 65
176 3300005344 Ga0070661_100600751 Ga0070661_1006007512 65
177 3300005344 Ga0070661_100916648 Ga0070661_1009166482 65
178 3300005344 Ga0070661_101030110 Ga0070661_1010301102 65
179 3300005344 Ga0070661_101114935 Ga0070661_1011149352 65
180 3300005344 Ga0070661_101619954 Ga0070661_1016199542 65
181 3300005347 Ga0070668_100021205 Ga0070668_1000212054 65
182 3300005347 Ga0070668_100658697 Ga0070668_1006586971 65
183 3300005347 Ga0070668_100859496 Ga0070668_1008594962 65
184 3300005347 Ga0070668_100903205 Ga0070668_1009032052 65
185 3300005347 Ga0070668_101061186 Ga0070668_1010611861 65
186 3300005353 Ga0070669_100309042 Ga0070669_1003090422 65
187 3300005353 Ga0070669_100781374 Ga0070669_1007813742 65
188 3300005353 Ga0070669_101134278 Ga0070669_1011342782 65
189 3300005353 Ga0070669_101399577 Ga0070669_1013995772 65
190 3300005354 Ga0070675_100398771 Ga0070675_1003987712 65
191 3300005354 Ga0070675_100616054 Ga0070675_1006160542 65
192 3300005354 Ga0070675_101046159 Ga0070675_1010461592 65
193 3300005354 Ga0070675_101279237 Ga0070675_1012792372 65
194 3300005355 Ga0070671_100000254 Ga0070671_10000025419 65
195 3300005355 Ga0070671_100003074 Ga0070671_1000030742 65
196 3300005355 Ga0070671_100015173 Ga0070671_1000151732 65
197 3300005355 Ga0070671_100021967 Ga0070671_1000219674 65
198 3300005355 Ga0070671_100039994 Ga0070671_1000399942 65
199 3300005355 Ga0070671_100047992 Ga0070671_1000479923 65
200 3300005355 Ga0070671_100117613 Ga0070671_1001176133 65
201 3300005355 Ga0070671_100276620 Ga0070671_1002766202 65
202 3300005355 Ga0070671_100532918 Ga0070671_1005329182 65
203 3300005355 Ga0070671_100587857 Ga0070671_1005878572 65
204 3300005355 Ga0070671_101414222 Ga0070671_1014142221 65
205 3300005355 Ga0070671_101731920 Ga0070671_1017319201 65
206 3300005356 Ga0070674_100004945 Ga0070674_1000049456 65
207 3300005356 Ga0070674_100014558 Ga0070674_1000145584 65
208 3300005356 Ga0070674_100146667 Ga0070674_1001466672 65
209 3300005356 Ga0070674_100186910 Ga0070674_1001869102 65
210 3300005356 Ga0070674_100847075 Ga0070674_1008470752 65
211 3300005356 Ga0070674_101356587 Ga0070674_1013565871 65
212 3300005356 Ga0070674_101465656 Ga0070674_1014656561 65
213 3300005356 Ga0070674_102196715 Ga0070674_1021967151 65
214 3300005364 Ga0070673_100000583 Ga0070673_10000058314 65
215 3300005364 Ga0070673_100011572 Ga0070673_1000115724 65
216 3300005364 Ga0070673_100052903 Ga0070673_1000529033 65
217 3300005364 Ga0070673_100078220 Ga0070673_1000782202 65
218 3300005364 Ga0070673_100235889 Ga0070673_1002358892 65
219 3300005364 Ga0070673_100458780 Ga0070673_1004587802 65
220 3300005364 Ga0070673_100784804 Ga0070673_1007848041 65
221 3300005364 Ga0070673_100915383 Ga0070673_1009153832 65
222 3300005364 Ga0070673_101020626 Ga0070673_1010206262 65
223 3300005364 Ga0070673_101087904 Ga0070673_1010879042 65
224 3300005364 Ga0070673_101204516 Ga0070673_1012045161 65
225 3300005364 Ga0070673_101653376 Ga0070673_1016533762 65
226 3300005365 Ga0070688_100376706 Ga0070688_1003767062 65
227 3300005365 Ga0070688_101649153 Ga0070688_1016491532 65
228 3300005366 Ga0070659_100012580 Ga0070659_1000125804 65
229 3300005366 Ga0070659_100060384 Ga0070659_1000603842 65
230 3300005366 Ga0070659_100137302 Ga0070659_1001373022 65
231 3300005366 Ga0070659_100224663 Ga0070659_1002246632 65
232 3300005366 Ga0070659_100244496 Ga0070659_1002444962 65
233 3300005366 Ga0070659_100279116 Ga0070659_1002791162 65
234 3300005366 Ga0070659_100292253 Ga0070659_1002922531 65
235 3300005366 Ga0070659_100413752 Ga0070659_1004137522 65
236 3300005366 Ga0070659_100497536 Ga0070659_1004975362 65
237 3300005366 Ga0070659_100543090 Ga0070659_1005430902 65
238 3300005366 Ga0070659_100608151 Ga0070659_1006081512 65
239 3300005366 Ga0070659_100683630 Ga0070659_1006836302 65
240 3300005366 Ga0070659_100750025 Ga0070659_1007500252 65
241 3300005366 Ga0070659_100804422 Ga0070659_1008044222 65
242 3300005366 Ga0070659_100824905 Ga0070659_1008249051 65
243 3300005366 Ga0070659_100938641 Ga0070659_1009386412 65
244 3300005366 Ga0070659_101134101 Ga0070659_1011341012 65
245 3300005366 Ga0070659_101209244 Ga0070659_1012092442 65
246 3300005366 Ga0070659_101465180 Ga0070659_1014651802 65
247 3300005366 Ga0070659_101759561 Ga0070659_1017595612 65
248 3300005366 Ga0070659_101860382 Ga0070659_1018603822 65
249 3300005367 Ga0070667_100003923 Ga0070667_1000039239 65
250 3300005367 Ga0070667_100033487 Ga0070667_1000334872 65
251 3300005367 Ga0070667_100253168 Ga0070667_1002531682 65
252 3300005367 Ga0070667_100322774 Ga0070667_1003227742 65
253 3300005367 Ga0070667_100349700 Ga0070667_1003497002 65
254 3300005367 Ga0070667_100399884 Ga0070667_1003998842 65
255 3300005367 Ga0070667_100668066 Ga0070667_1006680662 65
256 3300005434 Ga0070709_11002062 Ga0070709_110020621 65
257 3300005435 Ga0070714_100017124 Ga0070714_1000171248 65
258 3300005435 Ga0070714_100029454 Ga0070714_1000294544 65
259 3300005435 Ga0070714_100078884 Ga0070714_1000788842 65
260 3300005435 Ga0070714_100100217 Ga0070714_1001002172 65
261 3300005435 Ga0070714_100219025 Ga0070714_1002190252 65
262 3300005435 Ga0070714_100477507 Ga0070714_1004775072 65
263 3300005436 Ga0070713_100007547 Ga0070713_1000075476 65
264 3300005436 Ga0070713_100150682 Ga0070713_1001506822 65
265 3300005437 Ga0070710_10883968 Ga0070710_108839682 65
266 3300005455 Ga0070663_100008906 Ga0070663_1000089065 65
267 3300005455 Ga0070663_100021712 Ga0070663_1000217122 65
268 3300005455 Ga0070663_100077013 Ga0070663_1000770132 65
269 3300005455 Ga0070663_100185110 Ga0070663_1001851101 65
270 3300005455 Ga0070663_100325488 Ga0070663_1003254881 65
271 3300005455 Ga0070663_100338124 Ga0070663_1003381242 65
272 3300005455 Ga0070663_100355164 Ga0070663_1003551642 65
273 3300005455 Ga0070663_101029704 Ga0070663_1010297042 65
274 3300005455 Ga0070663_101148823 Ga0070663_1011488232 65
275 3300005456 Ga0070678_100000535 Ga0070678_10000053510 65
276 3300005456 Ga0070678_100001844 Ga0070678_1000018442 65
277 3300005456 Ga0070678_100005279 Ga0070678_1000052794 65
278 3300005456 Ga0070678_100023817 Ga0070678_1000238172 65
279 3300005456 Ga0070678_100188968 Ga0070678_1001889682 65
280 3300005456 Ga0070678_101847070 Ga0070678_1018470702 65
281 3300005457 Ga0070662_100002227 Ga0070662_10000222711 65
282 3300005457 Ga0070662_100002402 Ga0070662_10000240212 65
283 3300005457 Ga0070662_100004510 Ga0070662_1000045104 65
284 3300005457 Ga0070662_100018065 Ga0070662_1000180654 65
285 3300005457 Ga0070662_100026161 Ga0070662_1000261615 65
286 3300005457 Ga0070662_100054849 Ga0070662_1000548493 65
287 3300005457 Ga0070662_100095520 Ga0070662_1000955202 65
288 3300005457 Ga0070662_100106721 Ga0070662_1001067213 65
289 3300005457 Ga0070662_100226278 Ga0070662_1002262782 65
290 3300005457 Ga0070662_100247468 Ga0070662_1002474682 65
291 3300005457 Ga0070662_100267684 Ga0070662_1002676842 65
292 3300005457 Ga0070662_100291647 Ga0070662_1002916472 65
293 3300005457 Ga0070662_100335397 Ga0070662_1003353972 65
294 3300005457 Ga0070662_100381738 Ga0070662_1003817382 65
295 3300005457 Ga0070662_100456869 Ga0070662_1004568692 65
296 3300005457 Ga0070662_100560480 Ga0070662_1005604802 65
297 3300005457 Ga0070662_100700904 Ga0070662_1007009042 65
298 3300005457 Ga0070662_101063984 Ga0070662_1010639841 65
299 3300005457 Ga0070662_101948897 Ga0070662_1019488972 65
300 3300005458 Ga0070681_10354014 Ga0070681_103540142 65
301 3300005458 Ga0070681_11169627 Ga0070681_111696272 65
302 3300005458 Ga0070681_11373928 Ga0070681_113739281 65
303 3300005458 Ga0070681_12018682 Ga0070681_120186822 65
304 3300005459 Ga0068867_100046363 Ga0068867_1000463634 65
305 3300005459 Ga0068867_100069425 Ga0068867_1000694253 65
306 3300005459 Ga0068867_100088674 Ga0068867_1000886743 65
307 3300005459 Ga0068867_100090917 Ga0068867_1000909172 65
308 3300005459 Ga0068867_100101809 Ga0068867_1001018092 65
309 3300005459 Ga0068867_100402804 Ga0068867_1004028042 65
310 3300005459 Ga0068867_100468241 Ga0068867_1004682412 65
311 3300005459 Ga0068867_100570617 Ga0068867_1005706172 65
312 3300005466 Ga0070685_11263194 Ga0070685_112631942 65
313 3300005530 Ga0070679_100124322 Ga0070679_1001243222 65
314 3300005530 Ga0070679_100288822 Ga0070679_1002888222 65
315 3300005530 Ga0070679_100429365 Ga0070679_1004293652 65
316 3300005530 Ga0070679_100936611 Ga0070679_1009366112 65
317 3300005530 Ga0070679_102083284 Ga0070679_1020832842 65
318 3300005535 Ga0070684_100110713 Ga0070684_1001107132 65
319 3300005535 Ga0070684_101371123 Ga0070684_1013711232 65
320 3300005539 Ga0068853_100290705 Ga0068853_1002907052 65
321 3300005539 Ga0068853_100508400 Ga0068853_1005084002 65
322 3300005539 Ga0068853_100699618 Ga0068853_1006996182 65
323 3300005539 Ga0068853_100870749 Ga0068853_1008707492 65
324 3300005539 Ga0068853_100883541 Ga0068853_1008835412 65
325 3300005539 Ga0068853_100954273 Ga0068853_1009542732 65
326 3300005539 Ga0068853_101038109 Ga0068853_1010381092 65
327 3300005539 Ga0068853_101199849 Ga0068853_1011998492 65
328 3300005539 Ga0068853_101212548 Ga0068853_1012125482 65
329 3300005543 Ga0070672_100099465 Ga0070672_1000994653 65
330 3300005543 Ga0070672_100134528 Ga0070672_1001345282 65
331 3300005543 Ga0070672_100166146 Ga0070672_1001661462 65
332 3300005543 Ga0070672_100200921 Ga0070672_1002009212 65
333 3300005543 Ga0070672_100213126 Ga0070672_1002131262 65
334 3300005543 Ga0070672_100279117 Ga0070672_1002791172 65
335 3300005543 Ga0070672_100524000 Ga0070672_1005240002 65
336 3300005543 Ga0070672_101054121 Ga0070672_1010541212 65
337 3300005543 Ga0070672_101139392 Ga0070672_1011393922 65
338 3300005544 Ga0070686_100132414 Ga0070686_1001324142 65
339 3300005544 Ga0070686_100587448 Ga0070686_1005874482 65
340 3300005544 Ga0070686_101643176 Ga0070686_1016431762 65
341 3300005545 Ga0070695_100135459 Ga0070695_1001354592 65
342 3300005546 Ga0070696_100003697 Ga0070696_1000036973 65
343 3300005547 Ga0070693_100071738 Ga0070693_1000717382 65
344 3300005548 Ga0070665_100003665 Ga0070665_1000036652 65
345 3300005548 Ga0070665_100007295 Ga0070665_10000729511 65
346 3300005548 Ga0070665_100302382 Ga0070665_1003023822 65
347 3300005548 Ga0070665_100958757 Ga0070665_1009587572 65
348 3300005563 Ga0068855_100309820 Ga0068855_1003098202 65
349 3300005563 Ga0068855_100420759 Ga0068855_1004207592 65
350 3300005563 Ga0068855_100575125 Ga0068855_1005751251 65
351 3300005563 Ga0068855_101024567 Ga0068855_1010245672 65
352 3300005563 Ga0068855_101130545 Ga0068855_1011305452 65
353 3300005563 Ga0068855_101819573 Ga0068855_1018195732 65
354 3300005563 Ga0068855_102095083 Ga0068855_1020950832 65
355 3300005564 Ga0070664_100000849 Ga0070664_10000084917 65
356 3300005564 Ga0070664_100005049 Ga0070664_1000050496 65
357 3300005564 Ga0070664_100008252 Ga0070664_1000082526 65
358 3300005564 Ga0070664_100108775 Ga0070664_1001087752 65
359 3300005564 Ga0070664_100134931 Ga0070664_1001349312 65
360 3300005564 Ga0070664_100302779 Ga0070664_1003027792 65
361 3300005564 Ga0070664_100397536 Ga0070664_1003975362 65
362 3300005564 Ga0070664_100400216 Ga0070664_1004002162 65
363 3300005564 Ga0070664_100706240 Ga0070664_1007062402 65
364 3300005564 Ga0070664_100839857 Ga0070664_1008398572 65
365 3300005564 Ga0070664_101113578 Ga0070664_1011135782 65
366 3300005564 Ga0070664_101240631 Ga0070664_1012406312 65
367 3300005564 Ga0070664_101525009 Ga0070664_1015250092 65
368 3300005564 Ga0070664_101601952 Ga0070664_1016019522 65
369 3300005564 Ga0070664_101974500 Ga0070664_1019745001 65
370 3300005564 Ga0070664_102089519 Ga0070664_1020895192 65
371 3300005577 Ga0068857_100015879 Ga0068857_1000158798 65
372 3300005577 Ga0068857_100032296 Ga0068857_1000322966 65
373 3300005577 Ga0068857_101122869 Ga0068857_1011228692 65
374 3300005577 Ga0068857_101174410 Ga0068857_1011744102 65
375 3300005578 Ga0068854_100017190 Ga0068854_1000171904 65
376 3300005578 Ga0068854_100043084 Ga0068854_1000430843 65
377 3300005578 Ga0068854_100307900 Ga0068854_1003079002 65
378 3300005578 Ga0068854_100457835 Ga0068854_1004578352 65
379 3300005578 Ga0068854_100649677 Ga0068854_1006496771 65
380 3300005578 Ga0068854_100655535 Ga0068854_1006555352 65
381 3300005578 Ga0068854_100787774 Ga0068854_1007877742 65
382 3300005578 Ga0068854_100920375 Ga0068854_1009203752 65
383 3300005578 Ga0068854_101072291 Ga0068854_1010722912 65
384 3300005578 Ga0068854_101436036 Ga0068854_1014360362 65
385 3300005578 Ga0068854_102176472 Ga0068854_1021764722 65
386 3300005614 Ga0068856_100024446 Ga0068856_1000244466 65
387 3300005614 Ga0068856_100093630 Ga0068856_1000936302 65
388 3300005614 Ga0068856_100134918 Ga0068856_1001349182 65
389 3300005614 Ga0068856_100243250 Ga0068856_1002432502 65
390 3300005614 Ga0068856_100360005 Ga0068856_1003600052 65
391 3300005614 Ga0068856_101293071 Ga0068856_1012930712 65
392 3300005614 Ga0068856_101561266 Ga0068856_1015612662 65
393 3300005614 Ga0068856_102431636 Ga0068856_1024316362 65
394 3300005616 Ga0068852_100041423 Ga0068852_1000414234 65
395 3300005616 Ga0068852_100096746 Ga0068852_1000967462 65
396 3300005616 Ga0068852_100151345 Ga0068852_1001513452 65
397 3300005616 Ga0068852_100210185 Ga0068852_1002101852 65
398 3300005616 Ga0068852_100280766 Ga0068852_1002807662 65
399 3300005616 Ga0068852_100342399 Ga0068852_1003423992 65
400 3300005616 Ga0068852_100445707 Ga0068852_1004457072 65
401 3300005616 Ga0068852_100486013 Ga0068852_1004860132 65
402 3300005616 Ga0068852_100815923 Ga0068852_1008159232 65
403 3300005616 Ga0068852_100916293 Ga0068852_1009162932 65
404 3300005616 Ga0068852_101499525 Ga0068852_1014995252 65
405 3300005616 Ga0068852_101774092 Ga0068852_1017740922 65
406 3300005617 Ga0068859_100021759 Ga0068859_1000217596 65
407 3300005617 Ga0068859_100113309 Ga0068859_1001133093 65
408 3300005617 Ga0068859_100303609 Ga0068859_1003036092 65
409 3300005617 Ga0068859_100774246 Ga0068859_1007742462 65
410 3300005617 Ga0068859_102436246 Ga0068859_1024362462 65
411 3300005618 Ga0068864_100000872 Ga0068864_1000008723 65
412 3300005618 Ga0068864_100002756 Ga0068864_1000027563 65
413 3300005618 Ga0068864_100010414 Ga0068864_1000104147 65
414 3300005618 Ga0068864_100013622 Ga0068864_1000136226 65
415 3300005618 Ga0068864_100024899 Ga0068864_1000248995 65
416 3300005618 Ga0068864_100125822 Ga0068864_1001258223 65
417 3300005618 Ga0068864_100180681 Ga0068864_1001806812 65
418 3300005618 Ga0068864_100191354 Ga0068864_1001913542 65
419 3300005618 Ga0068864_100326000 Ga0068864_1003260002 65
420 3300005618 Ga0068864_100749623 Ga0068864_1007496232 65
421 3300005618 Ga0068864_101737695 Ga0068864_1017376952 65
422 3300005618 Ga0068864_102435500 Ga0068864_1024355002 65
423 3300005718 Ga0068866_10015925 Ga0068866_100159255 65
424 3300005718 Ga0068866_10082002 Ga0068866_100820022 65
425 3300005718 Ga0068866_10086471 Ga0068866_100864712 65
426 3300005718 Ga0068866_11254335 Ga0068866_112543351 65
427 3300005719 Ga0068861_100724186 Ga0068861_1007241862 65
428 3300005719 Ga0068861_101280496 Ga0068861_1012804962 65
429 3300005834 Ga0068851_10024005 Ga0068851_100240052 65
430 3300005834 Ga0068851_10028398 Ga0068851_100283983 65
431 3300005834 Ga0068851_10082299 Ga0068851_100822992 65
432 3300005834 Ga0068851_10092489 Ga0068851_100924892 65
433 3300005834 Ga0068851_10376695 Ga0068851_103766952 65
434 3300005834 Ga0068851_10399209 Ga0068851_103992092 65
435 3300005834 Ga0068851_10707220 Ga0068851_107072202 65
436 3300005834 Ga0068851_10966785 Ga0068851_109667852 65
437 3300005840 Ga0068870_10253483 Ga0068870_102534832 65
438 3300005840 Ga0068870_10897434 Ga0068870_108974342 65
439 3300005841 Ga0068863_100005100 Ga0068863_1000051003 65
440 3300005841 Ga0068863_100022498 Ga0068863_1000224982 65
441 3300005841 Ga0068863_100029062 Ga0068863_1000290622 65
442 3300005841 Ga0068863_100055414 Ga0068863_1000554143 65
443 3300005841 Ga0068863_100106276 Ga0068863_1001062762 65
444 3300005841 Ga0068863_100121268 Ga0068863_1001212682 65
445 3300005841 Ga0068863_102115551 Ga0068863_1021155512 65
446 3300005842 Ga0068858_100015061 Ga0068858_1000150615 65
447 3300005842 Ga0068858_100024268 Ga0068858_1000242683 65
448 3300005842 Ga0068858_100051068 Ga0068858_1000510682 65
449 3300005842 Ga0068858_100166486 Ga0068858_1001664862 65
450 3300005842 Ga0068858_100315811 Ga0068858_1003158112 65
451 3300005842 Ga0068858_100384816 Ga0068858_1003848162 65
452 3300005842 Ga0068858_101766025 Ga0068858_1017660252 65
453 3300005842 Ga0068858_101965865 Ga0068858_1019658652 65
454 3300005842 Ga0068858_102229476 Ga0068858_1022294762 65
455 3300005843 Ga0068860_100148716 Ga0068860_1001487162 65
456 3300005843 Ga0068860_100157926 Ga0068860_1001579262 65
457 3300005843 Ga0068860_100251295 Ga0068860_1002512952 65
458 3300005843 Ga0068860_100284073 Ga0068860_1002840732 65
459 3300005844 Ga0068862_100002905 Ga0068862_10000290517 65
460 3300005844 Ga0068862_100018869 Ga0068862_1000188694 65
461 3300005844 Ga0068862_100178521 Ga0068862_1001785212 65
462 3300005844 Ga0068862_102293254 Ga0068862_1022932542 65
463 3300005985 Ga0081539_10038916 Ga0081539_100389162 65
464 3300006028 Ga0070717_10007563 Ga0070717_100075637 65
465 3300006028 Ga0070717_10085135 Ga0070717_100851353 65
466 3300006028 Ga0070717_10795085 Ga0070717_107950852 65
467 3300006173 Ga0070716_100053635 Ga0070716_1000536353 65
468 3300006173 Ga0070716_100270196 Ga0070716_1002701962 65
469 3300006195 Ga0075366_10273148 Ga0075366_102731482 65
470 3300006237 Ga0097621_100014821 Ga0097621_1000148212 65
471 3300006237 Ga0097621_100079098 Ga0097621_1000790982 65
472 3300006237 Ga0097621_100191561 Ga0097621_1001915612 65
473 3300006237 Ga0097621_100423256 Ga0097621_1004232561 65
474 3300006237 Ga0097621_102148304 Ga0097621_1021483042 65
475 3300006358 Ga0068871_100004251 Ga0068871_1000042513 65
476 3300006358 Ga0068871_100019676 Ga0068871_1000196764 65
477 3300006358 Ga0068871_100028951 Ga0068871_1000289512 65
478 3300006358 Ga0068871_100107597 Ga0068871_1001075973 65
479 3300006358 Ga0068871_101450396 Ga0068871_1014503962 65
480 3300006358 Ga0068871_101982759 Ga0068871_1019827591 65
481 3300006880 Ga0075429_100956340 Ga0075429_1009563402 65
482 3300006881 Ga0068865_100008259 Ga0068865_1000082592 65
483 3300006881 Ga0068865_100013612 Ga0068865_1000136123 65
484 3300006881 Ga0068865_100127343 Ga0068865_1001273432 65
485 3300006881 Ga0068865_100405267 Ga0068865_1004052672 65
486 3300006881 Ga0068865_100505089 Ga0068865_1005050892 65
487 3300006881 Ga0068865_100709931 Ga0068865_1007099312 65
488 3300006914 Ga0075436_101291373 Ga0075436_1012913732 65
489 3300006931 Ga0097620_100021760 Ga0097620_1000217606 65
490 3300006931 Ga0097620_100113302 Ga0097620_1001133023 65
491 3300006931 Ga0097620_100303609 Ga0097620_1003036092 65
492 3300006931 Ga0097620_100774186 Ga0097620_1007741862 65
493 3300006931 Ga0097620_102436119 Ga0097620_1024361192 65
494 3300009011 Ga0105251_10015523 Ga0105251_100155232 65
495 3300009093 Ga0105240_10452693 Ga0105240_104526932 65
496 3300009098 Ga0105245_10056104 Ga0105245_100561043 65
497 3300009098 Ga0105245_10309212 Ga0105245_103092122 65
498 3300009098 Ga0105245_10405012 Ga0105245_104050122 65
499 3300009098 Ga0105245_10538611 Ga0105245_105386112 65
500 3300009098 Ga0105245_11631970 Ga0105245_116319702 65
501 3300009098 Ga0105245_13082772 Ga0105245_130827722 65
502 3300009101 Ga0105247_11789783 Ga0105247_117897832 65
503 3300009148 Ga0105243_10091446 Ga0105243_100914462 65
504 3300009148 Ga0105243_10861216 Ga0105243_108612162 65
505 3300009148 Ga0105243_12823086 Ga0105243_128230862 65
506 3300009174 Ga0105241_10056493 Ga0105241_100564933 65
507 3300009174 Ga0105241_10180805 Ga0105241_101808052 65
508 3300009174 Ga0105241_11424256 Ga0105241_114242562 65
509 3300009176 Ga0105242_10007915 Ga0105242_100079152 65
510 3300009176 Ga0105242_10615318 Ga0105242_106153182 65
511 3300009176 Ga0105242_12262357 Ga0105242_122623571 65
512 3300009177 Ga0105248_10002216 Ga0105248_1000221618 65
513 3300009177 Ga0105248_10004542 Ga0105248_100045425 65
514 3300009177 Ga0105248_10009267 Ga0105248_1000926710 65
515 3300009177 Ga0105248_10010267 Ga0105248_100102672 65
516 3300009177 Ga0105248_10015217 Ga0105248_100152175 65
517 3300009177 Ga0105248_10389683 Ga0105248_103896832 65
518 3300009177 Ga0105248_10445748 Ga0105248_104457482 65
519 3300009177 Ga0105248_10726360 Ga0105248_107263601 65
520 3300009177 Ga0105248_10852527 Ga0105248_108525272 65
521 3300009177 Ga0105248_10967085 Ga0105248_109670852 65
522 3300009177 Ga0105248_11316497 Ga0105248_113164972 65
523 3300009177 Ga0105248_12524735 Ga0105248_125247351 65
524 3300009545 Ga0105237_10228008 Ga0105237_102280082 65
525 3300009545 Ga0105237_10508789 Ga0105237_105087892 65
526 3300009551 Ga0105238_10146944 Ga0105238_101469442 65
527 3300009551 Ga0105238_10595595 Ga0105238_105955952 65
528 3300009551 Ga0105238_11165260 Ga0105238_111652602 65
529 3300009551 Ga0105238_11320986 Ga0105238_113209862 65
530 3300009551 Ga0105238_11508719 Ga0105238_115087192 65
531 3300009553 Ga0105249_10358950 Ga0105249_103589502 65
532 3300009553 Ga0105249_13034712 Ga0105249_130347122 65
533 3300010375 Ga0105239_10246096 Ga0105239_102460962 65
534 3300010375 Ga0105239_11048304 Ga0105239_110483042 65
535 3300010375 Ga0105239_13517485 Ga0105239_135174852 65
536 3300011119 Ga0105246_10487422 Ga0105246_104874222 65
537 3300011119 Ga0105246_10516536 Ga0105246_105165362 65
538 3300011119 Ga0105246_11816703 Ga0105246_118167032 65
539 3300012483 Ga0157337_1017938 Ga0157337_10179382 65
540 3300012512 Ga0157327_1066446 Ga0157327_10664462 65
541 3300013100 Ga0157373_10012569 Ga0157373_100125692 65
542 3300013100 Ga0157373_10105063 Ga0157373_101050632 65
543 3300013100 Ga0157373_10165468 Ga0157373_101654681 65
544 3300013100 Ga0157373_10213594 Ga0157373_102135942 65
545 3300013100 Ga0157373_10286788 Ga0157373_102867882 65
546 3300013100 Ga0157373_10347482 Ga0157373_103474822 65
547 3300013100 Ga0157373_11039683 Ga0157373_110396832 65
548 3300013100 Ga0157373_11127588 Ga0157373_111275881 65
549 3300013102 Ga0157371_10076707 Ga0157371_100767072 65
550 3300013102 Ga0157371_10087142 Ga0157371_100871422 65
551 3300013102 Ga0157371_10196332 Ga0157371_101963322 65
552 3300013102 Ga0157371_10201848 Ga0157371_102018482 65
553 3300013102 Ga0157371_10283325 Ga0157371_102833252 65
554 3300013102 Ga0157371_10286938 Ga0157371_102869382 65
555 3300013102 Ga0157371_10313716 Ga0157371_103137162 65
556 3300013102 Ga0157371_10350910 Ga0157371_103509102 65
557 3300013102 Ga0157371_10423610 Ga0157371_104236102 65
558 3300013102 Ga0157371_10692552 Ga0157371_106925522 65
559 3300013102 Ga0157371_10751741 Ga0157371_107517412 65
560 3300013104 Ga0157370_10030037 Ga0157370_100300375 65
561 3300013104 Ga0157370_10151261 Ga0157370_101512613 65
562 3300013104 Ga0157370_10363859 Ga0157370_103638591 65
563 3300013104 Ga0157370_10771807 Ga0157370_107718072 65
564 3300013104 Ga0157370_11577061 Ga0157370_115770611 65
565 3300013105 Ga0157369_10955140 Ga0157369_109551401 65
566 3300013105 Ga0157369_10979518 Ga0157369_109795182 65
567 3300013105 Ga0157369_11553122 Ga0157369_115531222 65
568 3300013105 Ga0157369_11863072 Ga0157369_118630722 65
569 3300013105 Ga0157369_12031509 Ga0157369_120315092 65
570 3300013105 Ga0157369_12571015 Ga0157369_125710152 65
571 3300013296 Ga0157374_10001338 Ga0157374_1000133814 65
572 3300013296 Ga0157374_10017845 Ga0157374_100178456 65
573 3300013296 Ga0157374_10182797 Ga0157374_101827972 65
574 3300013296 Ga0157374_10385287 Ga0157374_103852872 65
575 3300013296 Ga0157374_10661264 Ga0157374_106612642 65
576 3300013296 Ga0157374_11069606 Ga0157374_110696062 65
577 3300013296 Ga0157374_12237005 Ga0157374_122370052 65
578 3300013297 Ga0157378_10054494 Ga0157378_100544945 65
579 3300013297 Ga0157378_10240338 Ga0157378_102403382 65
580 3300013297 Ga0157378_10669056 Ga0157378_106690562 65
581 3300013297 Ga0157378_10794360 Ga0157378_107943602 65
582 3300013297 Ga0157378_12178293 Ga0157378_121782932 65
583 3300013297 Ga0157378_12547728 Ga0157378_125477282 65
584 3300013306 Ga0163162_10004270 Ga0163162_100042705 65
585 3300013306 Ga0163162_10198813 Ga0163162_101988132 65
586 3300013306 Ga0163162_10205967 Ga0163162_102059672 65
587 3300013306 Ga0163162_10250212 Ga0163162_102502122 65
588 3300013306 Ga0163162_10285340 Ga0163162_102853402 65
589 3300013306 Ga0163162_11493893 Ga0163162_114938932 65
590 3300013307 Ga0157372_10200569 Ga0157372_102005692 65
591 3300013307 Ga0157372_10237787 Ga0157372_102377872 65
592 3300013307 Ga0157372_10786270 Ga0157372_107862702 65
593 3300013307 Ga0157372_11016469 Ga0157372_110164692 65
594 3300013307 Ga0157372_11194372 Ga0157372_111943722 65
595 3300013307 Ga0157372_12375581 Ga0157372_123755812 65
596 3300013307 Ga0157372_13038727 Ga0157372_130387271 65
597 3300013308 Ga0157375_10000709 Ga0157375_100007097 65
598 3300013308 Ga0157375_10147144 Ga0157375_101471442 65
599 3300013308 Ga0157375_10288913 Ga0157375_102889132 65
600 3300013308 Ga0157375_10372558 Ga0157375_103725582 65
601 3300013308 Ga0157375_11213385 Ga0157375_112133852 65
602 3300013308 Ga0157375_12104976 Ga0157375_121049762 65
603 3300014325 Ga0163163_10001535 Ga0163163_1000153512 65
604 3300014325 Ga0163163_10142112 Ga0163163_101421122 65
605 3300014325 Ga0163163_10550998 Ga0163163_105509982 65
606 3300014325 Ga0163163_10787559 Ga0163163_107875592 65
607 3300014326 Ga0157380_10849429 Ga0157380_108494292 65
608 3300014745 Ga0157377_10521592 Ga0157377_105215922 65
609 3300014745 Ga0157377_11080142 Ga0157377_110801422 65
610 3300014968 Ga0157379_10059211 Ga0157379_100592112 65
611 3300014968 Ga0157379_10065631 Ga0157379_100656312 65
612 3300014968 Ga0157379_10164490 Ga0157379_101644902 65
613 3300014968 Ga0157379_10566020 Ga0157379_105660202 65
614 3300014968 Ga0157379_11758267 Ga0157379_117582672 65
615 3300014969 Ga0157376_10036799 Ga0157376_100367993 65
616 3300014969 Ga0157376_11385404 Ga0157376_113854042 65
617 3300017792 Ga0163161_10892209 Ga0163161_108922092 65
618 3300017792 Ga0163161_11160223 Ga0163161_111602232 65
619 3300020082 Ga0206353_10953672 Ga0206353_109536722 65
620 3300021384 Ga0213876_10009687 Ga0213876_100096874 65
621 3300025315 Ga0207697_10028655 Ga0207697_100286552 65
622 3300025315 Ga0207697_10092153 Ga0207697_100921532 65
623 3300025315 Ga0207697_10179128 Ga0207697_101791281 65
624 3300025321 Ga0207656_10056580 Ga0207656_100565802 65
625 3300025321 Ga0207656_10202070 Ga0207656_102020702 65
626 3300025321 Ga0207656_10270634 Ga0207656_102706342 65
627 3300025321 Ga0207656_10277241 Ga0207656_102772412 65
628 3300025321 Ga0207656_10389658 Ga0207656_103896582 65
629 3300025321 Ga0207656_10535764 Ga0207656_105357642 65
630 3300025321 Ga0207656_10622503 Ga0207656_106225032 65
631 3300025898 Ga0207692_11056632 Ga0207692_110566322 65
632 3300025899 Ga0207642_10058275 Ga0207642_100582752 65
633 3300025899 Ga0207642_10085873 Ga0207642_100858732 65
634 3300025899 Ga0207642_10086185 Ga0207642_100861852 65
635 3300025899 Ga0207642_10307117 Ga0207642_103071172 65
636 3300025900 Ga0207710_10007786 Ga0207710_100077862 65
637 3300025901 Ga0207688_10019885 Ga0207688_100198854 65
638 3300025901 Ga0207688_10169592 Ga0207688_101695922 65
639 3300025901 Ga0207688_10210485 Ga0207688_102104852 65
640 3300025901 Ga0207688_10290692 Ga0207688_102906922 65
641 3300025901 Ga0207688_10440341 Ga0207688_104403412 65
642 3300025901 Ga0207688_10491844 Ga0207688_104918442 65
643 3300025901 Ga0207688_10515162 Ga0207688_105151622 65
644 3300025903 Ga0207680_10000858 Ga0207680_100008583 65
645 3300025903 Ga0207680_10012121 Ga0207680_100121212 65
646 3300025903 Ga0207680_10025838 Ga0207680_100258382 65
647 3300025903 Ga0207680_10027430 Ga0207680_100274303 65
648 3300025903 Ga0207680_10195447 Ga0207680_101954472 65
649 3300025903 Ga0207680_10372136 Ga0207680_103721362 65
650 3300025903 Ga0207680_10435824 Ga0207680_104358242 65
651 3300025903 Ga0207680_10486927 Ga0207680_104869272 65
652 3300025903 Ga0207680_10868578 Ga0207680_108685782 65
653 3300025904 Ga0207647_10012922 Ga0207647_100129222 65
654 3300025904 Ga0207647_10078290 Ga0207647_100782902 65
655 3300025904 Ga0207647_10083380 Ga0207647_100833802 65
656 3300025904 Ga0207647_10121279 Ga0207647_101212792 65
657 3300025904 Ga0207647_10194904 Ga0207647_101949042 65
658 3300025904 Ga0207647_10228106 Ga0207647_102281061 65
659 3300025904 Ga0207647_10422031 Ga0207647_104220312 65
660 3300025904 Ga0207647_10429976 Ga0207647_104299762 65
661 3300025904 Ga0207647_10445091 Ga0207647_104450912 65
662 3300025906 Ga0207699_10732809 Ga0207699_107328092 65
663 3300025906 Ga0207699_11384550 Ga0207699_113845501 65
664 3300025907 Ga0207645_10057978 Ga0207645_100579782 65
665 3300025907 Ga0207645_10066436 Ga0207645_100664363 65
666 3300025907 Ga0207645_10162011 Ga0207645_101620112 65
667 3300025907 Ga0207645_10224063 Ga0207645_102240632 65
668 3300025907 Ga0207645_10369463 Ga0207645_103694632 65
669 3300025907 Ga0207645_10375320 Ga0207645_103753202 65
670 3300025907 Ga0207645_10842641 Ga0207645_108426411 65
671 3300025907 Ga0207645_11045960 Ga0207645_110459601 65
672 3300025907 Ga0207645_11237647 Ga0207645_112376471 65
673 3300025908 Ga0207643_10194020 Ga0207643_101940202 65
674 3300025908 Ga0207643_10345026 Ga0207643_103450262 65
675 3300025909 Ga0207705_10013453 Ga0207705_100134532 65
676 3300025909 Ga0207705_10051307 Ga0207705_100513071 65
677 3300025909 Ga0207705_10249244 Ga0207705_102492442 65
678 3300025909 Ga0207705_10283588 Ga0207705_102835882 65
679 3300025909 Ga0207705_10284869 Ga0207705_102848692 65
680 3300025909 Ga0207705_10289422 Ga0207705_102894222 65
681 3300025909 Ga0207705_10638112 Ga0207705_106381121 65
682 3300025909 Ga0207705_10657089 Ga0207705_106570892 65
683 3300025909 Ga0207705_10927854 Ga0207705_109278542 65
684 3300025909 Ga0207705_11456647 Ga0207705_114566472 65
685 3300025909 Ga0207705_11511858 Ga0207705_115118581 65
686 3300025911 Ga0207654_10088800 Ga0207654_100888002 65
687 3300025911 Ga0207654_10172031 Ga0207654_101720312 65
688 3300025911 Ga0207654_10255902 Ga0207654_102559022 65
689 3300025911 Ga0207654_11121038 Ga0207654_111210382 65
690 3300025912 Ga0207707_10421225 Ga0207707_104212252 65
691 3300025912 Ga0207707_11117800 Ga0207707_111178002 65
692 3300025912 Ga0207707_11306613 Ga0207707_113066132 65
693 3300025913 Ga0207695_11192391 Ga0207695_111923912 65
694 3300025913 Ga0207695_11194601 Ga0207695_111946012 65
695 3300025914 Ga0207671_10260190 Ga0207671_102601902 65
696 3300025915 Ga0207693_10089718 Ga0207693_100897181 65
697 3300025916 Ga0207663_11235143 Ga0207663_112351432 65
698 3300025917 Ga0207660_10471812 Ga0207660_104718122 65
699 3300025917 Ga0207660_10736118 Ga0207660_107361182 65
700 3300025918 Ga0207662_10389164 Ga0207662_103891642 65
701 3300025918 Ga0207662_10456189 Ga0207662_104561892 65
702 3300025919 Ga0207657_10002936 Ga0207657_1000293614 65
703 3300025919 Ga0207657_10006174 Ga0207657_1000617413 65
704 3300025919 Ga0207657_10015619 Ga0207657_100156194 65
705 3300025919 Ga0207657_10110140 Ga0207657_101101402 65
706 3300025919 Ga0207657_10137975 Ga0207657_101379752 65
707 3300025919 Ga0207657_10197595 Ga0207657_101975952 65
708 3300025919 Ga0207657_10288758 Ga0207657_102887582 65
709 3300025919 Ga0207657_10310593 Ga0207657_103105932 65
710 3300025919 Ga0207657_10423825 Ga0207657_104238252 65
711 3300025919 Ga0207657_10485098 Ga0207657_104850982 65
712 3300025919 Ga0207657_10772310 Ga0207657_107723101 65
713 3300025919 Ga0207657_10897535 Ga0207657_108975352 65
714 3300025919 Ga0207657_10939136 Ga0207657_109391362 65
715 3300025919 Ga0207657_11441010 Ga0207657_114410102 65
716 3300025920 Ga0207649_10021561 Ga0207649_100215612 65
717 3300025920 Ga0207649_10029075 Ga0207649_100290753 65
718 3300025920 Ga0207649_10037552 Ga0207649_100375522 65
719 3300025920 Ga0207649_10057151 Ga0207649_100571512 65
720 3300025920 Ga0207649_10073254 Ga0207649_100732542 65
721 3300025920 Ga0207649_10102504 Ga0207649_101025042 65
722 3300025920 Ga0207649_10389392 Ga0207649_103893922 65
723 3300025920 Ga0207649_10405164 Ga0207649_104051642 65
724 3300025920 Ga0207649_10650288 Ga0207649_106502882 65
725 3300025920 Ga0207649_10677038 Ga0207649_106770382 65
726 3300025920 Ga0207649_10685779 Ga0207649_106857792 65
727 3300025920 Ga0207649_10789851 Ga0207649_107898512 65
728 3300025920 Ga0207649_11269948 Ga0207649_112699482 65
729 3300025920 Ga0207649_11421693 Ga0207649_114216932 65
730 3300025921 Ga0207652_10268141 Ga0207652_102681412 65
731 3300025921 Ga0207652_10594578 Ga0207652_105945782 65
732 3300025921 Ga0207652_10950392 Ga0207652_109503922 65
733 3300025923 Ga0207681_10125129 Ga0207681_101251292 65
734 3300025923 Ga0207681_10296471 Ga0207681_102964712 65
735 3300025923 Ga0207681_10439068 Ga0207681_104390682 65
736 3300025923 Ga0207681_10448748 Ga0207681_104487482 65
737 3300025923 Ga0207681_11200242 Ga0207681_112002421 65
738 3300025924 Ga0207694_10013651 Ga0207694_100136513 65
739 3300025924 Ga0207694_11087936 Ga0207694_110879362 65
740 3300025924 Ga0207694_11375130 Ga0207694_113751302 65
741 3300025925 Ga0207650_10018262 Ga0207650_100182623 65
742 3300025925 Ga0207650_10021162 Ga0207650_100211623 65
743 3300025925 Ga0207650_10076513 Ga0207650_100765133 65
744 3300025925 Ga0207650_10136820 Ga0207650_101368202 65
745 3300025925 Ga0207650_10263846 Ga0207650_102638461 65
746 3300025925 Ga0207650_10284589 Ga0207650_102845892 65
747 3300025925 Ga0207650_10387558 Ga0207650_103875582 65
748 3300025925 Ga0207650_10675353 Ga0207650_106753532 65
749 3300025925 Ga0207650_10863619 Ga0207650_108636192 65
750 3300025925 Ga0207650_11507124 Ga0207650_115071242 65
751 3300025926 Ga0207659_10275887 Ga0207659_102758872 65
752 3300025926 Ga0207659_10453146 Ga0207659_104531462 65
753 3300025926 Ga0207659_11642196 Ga0207659_116421962 65
754 3300025927 Ga0207687_10101399 Ga0207687_101013992 65
755 3300025927 Ga0207687_10206864 Ga0207687_102068642 65
756 3300025927 Ga0207687_10376384 Ga0207687_103763842 65
757 3300025927 Ga0207687_11003742 Ga0207687_110037422 65
758 3300025928 Ga0207700_10713826 Ga0207700_107138262 65
759 3300025928 Ga0207700_11108356 Ga0207700_111083562 65
760 3300025929 Ga0207664_10040239 Ga0207664_100402393 65
761 3300025929 Ga0207664_10055008 Ga0207664_100550084 65
762 3300025929 Ga0207664_10089114 Ga0207664_100891143 65
763 3300025929 Ga0207664_10150001 Ga0207664_101500012 65
764 3300025929 Ga0207664_10239551 Ga0207664_102395512 65
765 3300025929 Ga0207664_11208664 Ga0207664_112086642 65
766 3300025931 Ga0207644_10000202 Ga0207644_1000020241 65
767 3300025931 Ga0207644_10000240 Ga0207644_100002402 65
768 3300025931 Ga0207644_10000433 Ga0207644_1000043326 65
769 3300025931 Ga0207644_10001112 Ga0207644_1000111222 65
770 3300025931 Ga0207644_10015996 Ga0207644_100159964 65
771 3300025931 Ga0207644_10016242 Ga0207644_100162425 65
772 3300025931 Ga0207644_10076272 Ga0207644_100762722 65
773 3300025931 Ga0207644_10331969 Ga0207644_103319692 65
774 3300025931 Ga0207644_10575200 Ga0207644_105752002 65
775 3300025931 Ga0207644_10776433 Ga0207644_107764332 65
776 3300025931 Ga0207644_10876130 Ga0207644_108761302 65
777 3300025931 Ga0207644_11394893 Ga0207644_113948932 65
778 3300025932 Ga0207690_10012321 Ga0207690_100123215 65
779 3300025932 Ga0207690_10061003 Ga0207690_100610032 65
780 3300025932 Ga0207690_10104774 Ga0207690_101047742 65
781 3300025932 Ga0207690_10129917 Ga0207690_101299171 65
782 3300025932 Ga0207690_10154241 Ga0207690_101542412 65
783 3300025932 Ga0207690_10219565 Ga0207690_102195652 65
784 3300025932 Ga0207690_10337433 Ga0207690_103374332 65
785 3300025932 Ga0207690_10388756 Ga0207690_103887562 65
786 3300025932 Ga0207690_10442341 Ga0207690_104423412 65
787 3300025932 Ga0207690_10475579 Ga0207690_104755792 65
788 3300025932 Ga0207690_10505204 Ga0207690_105052042 65
789 3300025932 Ga0207690_10550645 Ga0207690_105506452 65
790 3300025932 Ga0207690_10562843 Ga0207690_105628432 65
791 3300025932 Ga0207690_10611317 Ga0207690_106113172 65
792 3300025932 Ga0207690_10670303 Ga0207690_106703032 65
793 3300025932 Ga0207690_11190019 Ga0207690_111900192 65
794 3300025932 Ga0207690_11252063 Ga0207690_112520631 65
795 3300025933 Ga0207706_10004931 Ga0207706_100049314 65
796 3300025933 Ga0207706_10034789 Ga0207706_100347893 65
797 3300025933 Ga0207706_10036991 Ga0207706_100369913 65
798 3300025933 Ga0207706_10077831 Ga0207706_100778312 65
799 3300025933 Ga0207706_10081955 Ga0207706_100819551 65
800 3300025933 Ga0207706_10124254 Ga0207706_101242543 65
801 3300025933 Ga0207706_10159098 Ga0207706_101590982 65
802 3300025933 Ga0207706_10187790 Ga0207706_101877902 65
803 3300025933 Ga0207706_10208243 Ga0207706_102082432 65
804 3300025933 Ga0207706_10210292 Ga0207706_102102922 65
805 3300025933 Ga0207706_10220564 Ga0207706_102205642 65
806 3300025933 Ga0207706_10256363 Ga0207706_102563632 65
807 3300025933 Ga0207706_10274562 Ga0207706_102745622 65
808 3300025933 Ga0207706_10276493 Ga0207706_102764932 65
809 3300025933 Ga0207706_10346850 Ga0207706_103468502 65
810 3300025933 Ga0207706_10396987 Ga0207706_103969871 65
811 3300025933 Ga0207706_10408254 Ga0207706_104082542 65
812 3300025934 Ga0207686_10112814 Ga0207686_101128142 65
813 3300025934 Ga0207686_10307469 Ga0207686_103074692 65
814 3300025934 Ga0207686_10607859 Ga0207686_106078592 65
815 3300025934 Ga0207686_11078786 Ga0207686_110787862 65
816 3300025935 Ga0207709_10087137 Ga0207709_100871372 65
817 3300025935 Ga0207709_10461481 Ga0207709_104614812 65
818 3300025936 Ga0207670_10582217 Ga0207670_105822172 65
819 3300025937 Ga0207669_10011672 Ga0207669_100116722 65
820 3300025937 Ga0207669_10022124 Ga0207669_100221243 65
821 3300025937 Ga0207669_10038501 Ga0207669_100385012 65
822 3300025937 Ga0207669_10120755 Ga0207669_101207552 65
823 3300025937 Ga0207669_10155446 Ga0207669_101554462 65
824 3300025937 Ga0207669_10224042 Ga0207669_102240422 65
825 3300025937 Ga0207669_10636888 Ga0207669_106368882 65
826 3300025938 Ga0207704_10006846 Ga0207704_100068462 65
827 3300025938 Ga0207704_10075300 Ga0207704_100753003 65
828 3300025938 Ga0207704_10165196 Ga0207704_101651962 65
829 3300025938 Ga0207704_10683129 Ga0207704_106831292 65
830 3300025939 Ga0207665_10072741 Ga0207665_100727412 65
831 3300025940 Ga0207691_10003424 Ga0207691_100034249 65
832 3300025940 Ga0207691_10044408 Ga0207691_100444083 65
833 3300025940 Ga0207691_10077999 Ga0207691_100779992 65
834 3300025940 Ga0207691_10143918 Ga0207691_101439182 65
835 3300025940 Ga0207691_10196418 Ga0207691_101964182 65
836 3300025940 Ga0207691_10224576 Ga0207691_102245762 65
837 3300025940 Ga0207691_10267407 Ga0207691_102674072 65
838 3300025940 Ga0207691_10470350 Ga0207691_104703502 65
839 3300025940 Ga0207691_11625021 Ga0207691_116250212 65
840 3300025941 Ga0207711_10000190 Ga0207711_1000019024 65
841 3300025941 Ga0207711_10001101 Ga0207711_100011013 65
842 3300025941 Ga0207711_10001163 Ga0207711_1000116312 65
843 3300025941 Ga0207711_10080518 Ga0207711_100805182 65
844 3300025941 Ga0207711_10099528 Ga0207711_100995282 65
845 3300025941 Ga0207711_10161368 Ga0207711_101613682 65
846 3300025941 Ga0207711_10363288 Ga0207711_103632882 65
847 3300025941 Ga0207711_10404337 Ga0207711_104043372 65
848 3300025941 Ga0207711_10845875 Ga0207711_108458751 65
849 3300025941 Ga0207711_10887301 Ga0207711_108873012 65
850 3300025941 Ga0207711_11029650 Ga0207711_110296501 65
851 3300025941 Ga0207711_11500192 Ga0207711_115001921 65
852 3300025941 Ga0207711_11921149 Ga0207711_119211491 65
853 3300025942 Ga0207689_10199759 Ga0207689_101997592 65
854 3300025942 Ga0207689_10226174 Ga0207689_102261742 65
855 3300025942 Ga0207689_10269074 Ga0207689_102690742 65
856 3300025942 Ga0207689_10372655 Ga0207689_103726552 65
857 3300025942 Ga0207689_10400675 Ga0207689_104006752 65
858 3300025942 Ga0207689_10574636 Ga0207689_105746362 65
859 3300025942 Ga0207689_11389050 Ga0207689_113890502 65
860 3300025944 Ga0207661_10003282 Ga0207661_100032828 65
861 3300025944 Ga0207661_10275758 Ga0207661_102757582 65
862 3300025945 Ga0207679_10005385 Ga0207679_100053852 65
863 3300025945 Ga0207679_10017240 Ga0207679_100172402 65
864 3300025945 Ga0207679_10034099 Ga0207679_100340993 65
865 3300025945 Ga0207679_10102649 Ga0207679_101026492 65
866 3300025945 Ga0207679_10165087 Ga0207679_101650872 65
867 3300025945 Ga0207679_10197227 Ga0207679_101972272 65
868 3300025945 Ga0207679_10201215 Ga0207679_102012152 65
869 3300025945 Ga0207679_10239787 Ga0207679_102397872 65
870 3300025945 Ga0207679_10242433 Ga0207679_102424332 65
871 3300025945 Ga0207679_10508173 Ga0207679_105081732 65
872 3300025945 Ga0207679_10548170 Ga0207679_105481702 65
873 3300025945 Ga0207679_11022894 Ga0207679_110228942 65
874 3300025945 Ga0207679_11175524 Ga0207679_111755242 65
875 3300025945 Ga0207679_11301507 Ga0207679_113015072 65
876 3300025949 Ga0207667_10081677 Ga0207667_100816774 65
877 3300025949 Ga0207667_10171425 Ga0207667_101714252 65
878 3300025949 Ga0207667_10624119 Ga0207667_106241192 65
879 3300025960 Ga0207651_10001355 Ga0207651_100013559 65
880 3300025960 Ga0207651_10010068 Ga0207651_100100682 65
881 3300025960 Ga0207651_10023049 Ga0207651_100230494 65
882 3300025960 Ga0207651_10024038 Ga0207651_100240384 65
883 3300025960 Ga0207651_10068684 Ga0207651_100686842 65
884 3300025960 Ga0207651_10073064 Ga0207651_100730641 65
885 3300025960 Ga0207651_10107482 Ga0207651_101074822 65
886 3300025960 Ga0207651_10330504 Ga0207651_103305042 65
887 3300025960 Ga0207651_10486682 Ga0207651_104866822 65
888 3300025960 Ga0207651_10730039 Ga0207651_107300392 65
889 3300025960 Ga0207651_11059110 Ga0207651_110591102 65
890 3300025960 Ga0207651_11935219 Ga0207651_119352192 65
891 3300025961 Ga0207712_12106031 Ga0207712_121060312 65
892 3300025972 Ga0207668_10015108 Ga0207668_100151083 65
893 3300025972 Ga0207668_10341447 Ga0207668_103414472 65
894 3300025972 Ga0207668_10559256 Ga0207668_105592561 65
895 3300025972 Ga0207668_11296081 Ga0207668_112960812 65
896 3300025972 Ga0207668_11726594 Ga0207668_117265941 65
897 3300025972 Ga0207668_11749989 Ga0207668_117499892 65
898 3300025972 Ga0207668_11914272 Ga0207668_119142722 65
899 3300025981 Ga0207640_10013461 Ga0207640_100134613 65
900 3300025981 Ga0207640_10179305 Ga0207640_101793052 65
901 3300025981 Ga0207640_10351968 Ga0207640_103519682 65
902 3300025981 Ga0207640_10417275 Ga0207640_104172752 65
903 3300025981 Ga0207640_10453250 Ga0207640_104532501 65
904 3300025981 Ga0207640_10714915 Ga0207640_107149152 65
905 3300025981 Ga0207640_11563665 Ga0207640_115636652 65
906 3300025981 Ga0207640_11645389 Ga0207640_116453892 65
907 3300025981 Ga0207640_11806459 Ga0207640_118064592 65
908 3300025986 Ga0207658_10003080 Ga0207658_100030809 65
909 3300025986 Ga0207658_10007754 Ga0207658_100077548 65
910 3300025986 Ga0207658_10036918 Ga0207658_100369182 65
911 3300025986 Ga0207658_10128259 Ga0207658_101282592 65
912 3300025986 Ga0207658_10142846 Ga0207658_101428462 65
913 3300025986 Ga0207658_10307884 Ga0207658_103078842 65
914 3300025986 Ga0207658_10314825 Ga0207658_103148252 65
915 3300025986 Ga0207658_10618103 Ga0207658_106181032 65
916 3300026023 Ga0207677_10002372 Ga0207677_100023724 65
917 3300026023 Ga0207677_10004220 Ga0207677_100042202 65
918 3300026023 Ga0207677_10720370 Ga0207677_107203702 65
919 3300026023 Ga0207677_11176878 Ga0207677_111768782 65
920 3300026023 Ga0207677_12166317 Ga0207677_121663172 65
921 3300026023 Ga0207677_12177108 Ga0207677_121771081 65
922 3300026035 Ga0207703_10005645 Ga0207703_100056458 65
923 3300026035 Ga0207703_10040477 Ga0207703_100404772 65
924 3300026035 Ga0207703_10078399 Ga0207703_100783992 65
925 3300026035 Ga0207703_10198753 Ga0207703_101987532 65
926 3300026035 Ga0207703_10650457 Ga0207703_106504572 65
927 3300026035 Ga0207703_11140040 Ga0207703_111400402 65
928 3300026041 Ga0207639_10023762 Ga0207639_100237622 65
929 3300026041 Ga0207639_10070161 Ga0207639_100701613 65
930 3300026041 Ga0207639_10750776 Ga0207639_107507762 65
931 3300026041 Ga0207639_10838583 Ga0207639_108385832 65
932 3300026041 Ga0207639_10910437 Ga0207639_109104372 65
933 3300026041 Ga0207639_10948705 Ga0207639_109487052 65
934 3300026041 Ga0207639_11015890 Ga0207639_110158902 65
935 3300026041 Ga0207639_11248295 Ga0207639_112482952 65
936 3300026041 Ga0207639_11506424 Ga0207639_115064242 65
937 3300026041 Ga0207639_11568317 Ga0207639_115683172 65
938 3300026041 Ga0207639_11728562 Ga0207639_117285622 65
939 3300026067 Ga0207678_10017909 Ga0207678_100179094 65
940 3300026067 Ga0207678_10019305 Ga0207678_100193052 65
941 3300026067 Ga0207678_10085167 Ga0207678_100851672 65
942 3300026067 Ga0207678_10102916 Ga0207678_101029162 65
943 3300026067 Ga0207678_10110270 Ga0207678_101102702 65
944 3300026067 Ga0207678_10138254 Ga0207678_101382542 65
945 3300026067 Ga0207678_10247697 Ga0207678_102476972 65
946 3300026067 Ga0207678_10299535 Ga0207678_102995352 65
947 3300026067 Ga0207678_10790407 Ga0207678_107904072 65
948 3300026067 Ga0207678_11578616 Ga0207678_115786162 65
949 3300026067 Ga0207678_11808857 Ga0207678_118088571 65
950 3300026078 Ga0207702_10010020 Ga0207702_100100202 65
951 3300026078 Ga0207702_10049867 Ga0207702_100498673 65
952 3300026078 Ga0207702_10104370 Ga0207702_101043702 65
953 3300026078 Ga0207702_10119452 Ga0207702_101194522 65
954 3300026078 Ga0207702_10573452 Ga0207702_105734521 65
955 3300026078 Ga0207702_11347199 Ga0207702_113471992 65
956 3300026078 Ga0207702_11922416 Ga0207702_119224162 65
957 3300026078 Ga0207702_12124371 Ga0207702_121243712 65
958 3300026088 Ga0207641_10004938 Ga0207641_100049386 65
959 3300026088 Ga0207641_10011626 Ga0207641_100116262 65
960 3300026088 Ga0207641_10130182 Ga0207641_101301823 65
961 3300026088 Ga0207641_10160851 Ga0207641_101608512 65
962 3300026088 Ga0207641_10198922 Ga0207641_101989222 65
963 3300026088 Ga0207641_10224525 Ga0207641_102245252 65
964 3300026088 Ga0207641_10980107 Ga0207641_109801072 65
965 3300026088 Ga0207641_11730628 Ga0207641_117306282 65
966 3300026088 Ga0207641_12267920 Ga0207641_122679202 65
967 3300026089 Ga0207648_10004449 Ga0207648_1000444913 65
968 3300026089 Ga0207648_10022651 Ga0207648_100226512 65
969 3300026089 Ga0207648_10077565 Ga0207648_100775653 65
970 3300026089 Ga0207648_10270991 Ga0207648_102709912 65
971 3300026089 Ga0207648_10282927 Ga0207648_102829272 65
972 3300026089 Ga0207648_11054591 Ga0207648_110545912 65
973 3300026089 Ga0207648_11629854 Ga0207648_116298541 65
974 3300026095 Ga0207676_10003729 Ga0207676_100037296 65
975 3300026095 Ga0207676_10037955 Ga0207676_100379554 65
976 3300026095 Ga0207676_10077798 Ga0207676_100777982 65
977 3300026095 Ga0207676_10151408 Ga0207676_101514082 65
978 3300026095 Ga0207676_10172183 Ga0207676_101721832 65
979 3300026095 Ga0207676_10187750 Ga0207676_101877502 65
980 3300026095 Ga0207676_10255806 Ga0207676_102558062 65
981 3300026095 Ga0207676_10291426 Ga0207676_102914262 65
982 3300026095 Ga0207676_10459615 Ga0207676_104596152 65
983 3300026095 Ga0207676_11433594 Ga0207676_114335942 65
984 3300026095 Ga0207676_12377334 Ga0207676_123773341 65
985 3300026116 Ga0207674_10001184 Ga0207674_1000118427 65
986 3300026116 Ga0207674_10006685 Ga0207674_1000668512 65
987 3300026116 Ga0207674_10007011 Ga0207674_1000701113 65
988 3300026116 Ga0207674_10026673 Ga0207674_100266735 65
989 3300026116 Ga0207674_10382559 Ga0207674_103825592 65
990 3300026116 Ga0207674_11076251 Ga0207674_110762512 65
991 3300026116 Ga0207674_11214166 Ga0207674_112141662 65
992 3300026118 Ga0207675_100476239 Ga0207675_1004762392 65
993 3300026118 Ga0207675_101303015 Ga0207675_1013030152 65
994 3300026118 Ga0207675_102085088 Ga0207675_1020850882 65
995 3300026121 Ga0207683_10000541 Ga0207683_1000054128 65
996 3300026121 Ga0207683_10006217 Ga0207683_100062179 65
997 3300026121 Ga0207683_10006279 Ga0207683_100062792 65
998 3300026121 Ga0207683_10047283 Ga0207683_100472833 65
999 3300026121 Ga0207683_10070921 Ga0207683_100709214 65
1000 3300026142 Ga0207698_10035156 Ga0207698_100351562 65
1001 3300026142 Ga0207698_10038503 Ga0207698_100385032 65
1002 3300026142 Ga0207698_10071793 Ga0207698_100717932 65
1003 3300026142 Ga0207698_10268724 Ga0207698_102687242 65
1004 3300026142 Ga0207698_10275974 Ga0207698_102759742 65
1005 3300026142 Ga0207698_10486428 Ga0207698_104864282 65
1006 3300026142 Ga0207698_10524307 Ga0207698_105243072 65
1007 3300026142 Ga0207698_10722195 Ga0207698_107221952 65
1008 3300026142 Ga0207698_10818191 Ga0207698_108181912 65
1009 3300026142 Ga0207698_10875490 Ga0207698_108754902 65
1010 3300026142 Ga0207698_10880051 Ga0207698_108800512 65
1011 3300026142 Ga0207698_11044070 Ga0207698_110440702 65
1012 3300026142 Ga0207698_11120541 Ga0207698_111205412 65
1013 3300026142 Ga0207698_11639586 Ga0207698_116395862 65
1014 3300026142 Ga0207698_12242417 Ga0207698_122424171 65
1015 3300026142 Ga0207698_12504069 Ga0207698_125040692 65
1016 3300027876 Ga0209974_10088868 Ga0209974_100888682 65
1017 3300028379 Ga0268266_10122451 Ga0268266_101224512 65
1018 3300028379 Ga0268266_10679840 Ga0268266_106798402 65
1019 3300028379 Ga0268266_11678604 Ga0268266_116786042 65
1020 3300028380 Ga0268265_10002225 Ga0268265_100022252 65
1021 3300028380 Ga0268265_10038427 Ga0268265_100384276 65
1022 3300028381 Ga0268264_10125114 Ga0268264_101251142 65
1023 3300028381 Ga0268264_10337165 Ga0268264_103371652 65
1024 3300028381 Ga0268264_10344953 Ga0268264_103449532 65
1025 3300028381 Ga0268264_10430233 Ga0268264_104302332 65
1026 3300028381 Ga0268264_11158428 Ga0268264_111584282 65
1027 3300031548 Ga0307408_100069773 Ga0307408_1000697732 65
1028 3300031548 Ga0307408_101004220 Ga0307408_1010042202 65
1029 3300031548 Ga0307408_101758644 Ga0307408_1017586441 65
1030 3300031731 Ga0307405_10035072 Ga0307405_100350722 65
1031 3300031731 Ga0307405_10040894 Ga0307405_100408942 65
1032 3300031824 Ga0307413_10669105 Ga0307413_106691052 65
1033 3300031852 Ga0307410_10000590 Ga0307410_100005906 65
1034 3300031852 Ga0307410_10137547 Ga0307410_101375472 65
1035 3300031852 Ga0307410_10352569 Ga0307410_103525692 65
1036 3300031901 Ga0307406_10189701 Ga0307406_101897012 65
1037 3300031901 Ga0307406_10277897 Ga0307406_102778971 65
1038 3300031901 Ga0307406_10968618 Ga0307406_109686182 65
1039 3300031901 Ga0307406_11100159 Ga0307406_111001592 65
1040 3300031903 Ga0307407_10030474 Ga0307407_100304743 65
1041 3300031911 Ga0307412_10081937 Ga0307412_100819372 65
1042 3300031911 Ga0307412_10425709 Ga0307412_104257092 65
1043 3300031911 Ga0307412_12319573 Ga0307412_123195732 65
1044 3300031995 Ga0307409_100081992 Ga0307409_1000819923 65
1045 3300031995 Ga0307409_100257459 Ga0307409_1002574592 65
1046 3300031995 Ga0307409_100989758 Ga0307409_1009897582 65
1047 3300031995 Ga0307409_102558891 Ga0307409_1025588912 65
1048 3300032002 Ga0307416_100010787 Ga0307416_1000107872 65
1049 3300032002 Ga0307416_100026708 Ga0307416_1000267082 65
1050 3300032002 Ga0307416_100462031 Ga0307416_1004620312 65
1051 3300032002 Ga0307416_100924487 Ga0307416_1009244872 65
1052 3300032002 Ga0307416_102421266 Ga0307416_1024212662 65
1053 3300032004 Ga0307414_10011964 Ga0307414_100119643 65
1054 3300032004 Ga0307414_10155268 Ga0307414_101552682 65
1055 3300032004 Ga0307414_10776419 Ga0307414_107764192 65
1056 3300032004 Ga0307414_11014635 Ga0307414_110146352 65
1057 3300032005 Ga0307411_10088884 Ga0307411_100888842 65
1058 3300032005 Ga0307411_10153551 Ga0307411_101535512 65
1059 3300032005 Ga0307411_10246717 Ga0307411_102467172 65
1060 3300032005 Ga0307411_12110300 Ga0307411_121103002 65
1061 3300032126 Ga0307415_100029789 Ga0307415_1000297893 65
1062 3300032126 Ga0307415_100069870 Ga0307415_1000698702 65
1063 3300032126 Ga0307415_100226187 Ga0307415_1002261872 65
1064 3300034816 Ga0373930_0145300 Ga0373930_0145300_130_327 65
1065 3300035089 Ga0373944_0107865 Ga0373944_0107865_537_734 65
1066 3300035091 Ga0373951_0169917 Ga0373951_0169917_302_499 65
1067 3300035121 Ga0373960_0234681 Ga0373960_0234681_429_626 65
1068 3300035170 Ga0373943_0115462 Ga0373943_0115462_937_1134 65
1069 3300035170 Ga0373943_0341532 Ga0373943_0341532_128_325 65
1070 3300035171 Ga0373946_0003074 Ga0373946_0003074_3613_3810 65
1071 3300035241 Ga0373961_0268742 Ga0373961_0268742_150_350 65
1072 3300035242 Ga0373962_0317726 Ga0373962_0317726_112_309 65
1073 3300035691 Ga0373931_0486733 Ga0373931_0486733_94_291 65
1074 3300035691 Ga0373931_0963371 Ga0373931_0963371_234_431 65
1075 3300035692 Ga0373935_0009428 Ga0373935_0009428_5369_5566 65
1076 3300035692 Ga0373935_0154046 Ga0373935_0154046_94_291 65
1077 3300035695 Ga0373927_0040667 Ga0373927_0040667_1711_1908 65
1078 3300035725 Ga0373947_0050338 Ga0373947_0050338_1659_1856 65
1079 3300037068 Ga0373925_0011268 Ga0373925_0011268_4645_4842 65
1080 3300037068 Ga0373925_0878854 Ga0373925_0878854_431_628 65
1081 3300037312 Ga0395899_0000157 Ga0395899_0000157_102119_102316 65
1082 3300037312 Ga0395899_0001390 Ga0395899_0001390_17014_17211 65
1083 3300037312 Ga0395899_0013545 Ga0395899_0013545_2919_3116 65
1084 3300037312 Ga0395899_0020408 Ga0395899_0020408_3517_3714 65
1085 3300037312 Ga0395899_0023877 Ga0395899_0023877_429_626 65
1086 3300037312 Ga0395899_0031730 Ga0395899_0031730_2816_3013 65
1087 3300037312 Ga0395899_0042493 Ga0395899_0042493_3177_3374 65
1088 3300037312 Ga0395899_0052140 Ga0395899_0052140_1069_1281 65
1089 3300037312 Ga0395899_0083816 Ga0395899_0083816_1900_2097 65
1090 3300037312 Ga0395899_0090780 Ga0395899_0090780_934_1146 65
1091 3300037312 Ga0395899_0100498 Ga0395899_0100498_1629_1826 65
1092 3300037312 Ga0395899_0201469 Ga0395899_0201469_989_1186 65
1093 3300037312 Ga0395899_0210193 Ga0395899_0210193_113_310 65
1094 3300037312 Ga0395899_0243399 Ga0395899_0243399_406_603 65
1095 3300037312 Ga0395899_0349569 Ga0395899_0349569_759_968 65
1096 3300037312 Ga0395899_0446401 Ga0395899_0446401_14_211 65
1097 3300037312 Ga0395899_0509438 Ga0395899_0509438_279_476 65
1098 3300037312 Ga0395899_0642568 Ga0395899_0642568_375_572 65
1099 3300037312 Ga0395899_0700167 Ga0395899_0700167_417_614 65
1100 3300037312 Ga0395899_0992525 Ga0395899_0992525_75_272 65
1101 3300037418 Ga0395900_0000290 Ga0395900_0000290_64668_64865 65
1102 3300037418 Ga0395900_0003952 Ga0395900_0003952_971_1168 65
1103 3300037418 Ga0395900_0014785 Ga0395900_0014785_449_658 65
1104 3300037418 Ga0395900_0014822 Ga0395900_0014822_1471_1668 65
1105 3300037418 Ga0395900_0020090 Ga0395900_0020090_2429_2626 65
1106 3300037418 Ga0395900_0020825 Ga0395900_0020825_3849_4046 65
1107 3300037418 Ga0395900_0036939 Ga0395900_0036939_4175_4372 65
1108 3300037418 Ga0395900_0044319 Ga0395900_0044319_2144_2341 65
1109 3300037418 Ga0395900_0060619 Ga0395900_0060619_980_1177 65
1110 3300037418 Ga0395900_0086288 Ga0395900_0086288_2711_2908 65
1111 3300037418 Ga0395900_0086795 Ga0395900_0086795_944_1141 65
1112 3300037418 Ga0395900_0095073 Ga0395900_0095073_2785_2997 65
1113 3300037418 Ga0395900_0104942 Ga0395900_0104942_1877_2074 65
1114 3300037418 Ga0395900_0107628 Ga0395900_0107628_436_645 65
1115 3300037418 Ga0395900_0122503 Ga0395900_0122503_1491_1688 65
1116 3300037418 Ga0395900_0127721 Ga0395900_0127721_825_1022 65
1117 3300037418 Ga0395900_0161987 Ga0395900_0161987_168_389 65
1118 3300037418 Ga0395900_0209951 Ga0395900_0209951_179_376 65
1119 3300037418 Ga0395900_0221797 Ga0395900_0221797_1112_1321 65
1120 3300037418 Ga0395900_0293014 Ga0395900_0293014_430_627 65
1121 3300037418 Ga0395900_0341549 Ga0395900_0341549_414_611 65
1122 3300037418 Ga0395900_0375818 Ga0395900_0375818_851_1048 65
1123 3300037418 Ga0395900_0451928 Ga0395900_0451928_399_596 65
1124 3300037418 Ga0395900_0661677 Ga0395900_0661677_218_415 65
1125 3300037418 Ga0395900_0665975 Ga0395900_0665975_457_654 65
1126 3300037418 Ga0395900_0708120 Ga0395900_0708120_640_837 65
1127 3300037418 Ga0395900_1103648 Ga0395900_1103648_380_577 65
1128 3300037418 Ga0395900_1185697 Ga0395900_1185697_366_563 65
1129 3300037418 Ga0395900_1231847 Ga0395900_1231847_113_310 65
1130 3300037418 Ga0395900_1555794 Ga0395900_1555794_93_290 65
1131 3300037418 Ga0395900_1587535 Ga0395900_1587535_136_333 65
1132 3300037418 Ga0395900_1721789 Ga0395900_1721789_295_492 65
1133 3300037466 Ga0395898_0000054 Ga0395898_0000054_209951_210148 65
1134 3300037466 Ga0395898_0002720 Ga0395898_0002720_16137_16334 65
1135 3300037466 Ga0395898_0041487 Ga0395898_0041487_1646_1843 65
1136 3300037466 Ga0395898_0041985 Ga0395898_0041985_2077_2289 65
1137 3300037466 Ga0395898_0046301 Ga0395898_0046301_1699_1896 65
1138 3300037466 Ga0395898_0046969 Ga0395898_0046969_2762_2971 65
1139 3300037466 Ga0395898_0052359 Ga0395898_0052359_236_433 65
1140 3300037466 Ga0395898_0057268 Ga0395898_0057268_667_864 65
1141 3300037466 Ga0395898_0069837 Ga0395898_0069837_2124_2321 65
1142 3300037466 Ga0395898_0173463 Ga0395898_0173463_165_374 65
1143 3300037466 Ga0395898_0223892 Ga0395898_0223892_957_1169 65
1144 3300037466 Ga0395898_0475663 Ga0395898_0475663_259_456 65
1145 3300037466 Ga0395898_0581945 Ga0395898_0581945_542_739 65
1146 3300037466 Ga0395898_0854023 Ga0395898_0854023_568_765 65
1147 3300037466 Ga0395898_1606105 Ga0395898_1606105_71_268 65
1148 3300037466 Ga0395898_1796082 Ga0395898_1796082_35_244 65
1149 3300037471 Ga0395905_0000046 Ga0395905_0000046_170957_171154 65
1150 3300037471 Ga0395905_0001572 Ga0395905_0001572_12249_12458 65
1151 3300037471 Ga0395905_0003151 Ga0395905_0003151_14722_14919 65
1152 3300037471 Ga0395905_0005360 Ga0395905_0005360_6234_6431 65
1153 3300037471 Ga0395905_0016020 Ga0395905_0016020_4660_4857 65
1154 3300037471 Ga0395905_0020508 Ga0395905_0020508_3397_3609 65
1155 3300037471 Ga0395905_0023513 Ga0395905_0023513_5399_5596 65
1156 3300037471 Ga0395905_0027535 Ga0395905_0027535_1270_1467 65
1157 3300037471 Ga0395905_0068985 Ga0395905_0068985_1206_1403 65
1158 3300037471 Ga0395905_0072360 Ga0395905_0072360_1188_1385 65
1159 3300037471 Ga0395905_0077191 Ga0395905_0077191_1851_2063 65
1160 3300037471 Ga0395905_0077929 Ga0395905_0077929_2258_2455 65
1161 3300037471 Ga0395905_0078343 Ga0395905_0078343_1168_1365 65
1162 3300037471 Ga0395905_0094451 Ga0395905_0094451_830_1027 65
1163 3300037471 Ga0395905_0094554 Ga0395905_0094554_289_489 65
1164 3300037471 Ga0395905_0105085 Ga0395905_0105085_361_558 65
1165 3300037471 Ga0395905_0127984 Ga0395905_0127984_939_1148 65
1166 3300037471 Ga0395905_0144701 Ga0395905_0144701_1718_1915 65
1167 3300037471 Ga0395905_0151282 Ga0395905_0151282_865_1062 65
1168 3300037471 Ga0395905_0170486 Ga0395905_0170486_756_953 65
1169 3300037471 Ga0395905_0181816 Ga0395905_0181816_145_342 65
1170 3300037471 Ga0395905_0212656 Ga0395905_0212656_990_1199 65
1171 3300037471 Ga0395905_0241831 Ga0395905_0241831_674_871 65
1172 3300037471 Ga0395905_0322253 Ga0395905_0322253_1175_1372 65
1173 3300037471 Ga0395905_0360990 Ga0395905_0360990_219_416 65
1174 3300037471 Ga0395905_0425651 Ga0395905_0425651_112_309 65
1175 3300037471 Ga0395905_0428528 Ga0395905_0428528_265_462 65
1176 3300037471 Ga0395905_0563607 Ga0395905_0563607_142_339 65
1177 3300037471 Ga0395905_0644468 Ga0395905_0644468_287_484 65
1178 3300037471 Ga0395905_0720569 Ga0395905_0720569_682_879 65
1179 3300037471 Ga0395905_0724210 Ga0395905_0724210_169_366 65
1180 3300037471 Ga0395905_0960792 Ga0395905_0960792_255_467 65
1181 3300037471 Ga0395905_0965464 Ga0395905_0965464_335_535 65
1182 3300037471 Ga0395905_0995036 Ga0395905_0995036_73_270 65
1183 3300037471 Ga0395905_1021041 Ga0395905_1021041_460_657 65
1184 3300037471 Ga0395905_1095155 Ga0395905_1095155_441_638 65
1185 3300037471 Ga0395905_1343540 Ga0395905_1343540_397_594 65
1186 3300037471 Ga0395905_1343699 Ga0395905_1343699_210_407 65
1187 3300037471 Ga0395905_1351036 Ga0395905_1351036_50_247 65
1188 3300037471 Ga0395905_1530593 Ga0395905_1530593_53_250 65
1189 3300037471 Ga0395905_1655699 Ga0395905_1655699_20_217 65
1190 3300038443 Ga0395901_0000102 Ga0395901_0000102_52963_53160 65
1191 3300038443 Ga0395901_0009987 Ga0395901_0009987_2279_2488 65
1192 3300038443 Ga0395901_0027314 Ga0395901_0027314_227_439 65
1193 3300038443 Ga0395901_0051655 Ga0395901_0051655_2721_2918 65
1194 3300038443 Ga0395901_0067150 Ga0395901_0067150_2780_2977 65
1195 3300038443 Ga0395901_0075939 Ga0395901_0075939_2227_2439 65
1196 3300038443 Ga0395901_0095127 Ga0395901_0095127_2612_2809 65
1197 3300038443 Ga0395901_0098148 Ga0395901_0098148_286_483 65
1198 3300038443 Ga0395901_0099504 Ga0395901_0099504_1372_1569 65
1199 3300038443 Ga0395901_0100893 Ga0395901_0100893_2105_2302 65
1200 3300038443 Ga0395901_0103003 Ga0395901_0103003_1504_1701 65
1201 3300038443 Ga0395901_0104502 Ga0395901_0104502_89_286 65
1202 3300038443 Ga0395901_0108342 Ga0395901_0108342_2692_2901 65
1203 3300038443 Ga0395901_0125847 Ga0395901_0125847_1517_1714 65
1204 3300038443 Ga0395901_0140253 Ga0395901_0140253_519_716 65
1205 3300038443 Ga0395901_0215121 Ga0395901_0215121_737_934 65
1206 3300038443 Ga0395901_0219151 Ga0395901_0219151_539_736 65
1207 3300038443 Ga0395901_0235131 Ga0395901_0235131_528_749 65
1208 3300038443 Ga0395901_0254870 Ga0395901_0254870_980_1177 65
1209 3300038443 Ga0395901_0292912 Ga0395901_0292912_965_1162 65
1210 3300038443 Ga0395901_0433636 Ga0395901_0433636_999_1208 65
1211 3300038443 Ga0395901_0456146 Ga0395901_0456146_840_1037 65
1212 3300038443 Ga0395901_0471642 Ga0395901_0471642_572_772 65
1213 3300038443 Ga0395901_0537735 Ga0395901_0537735_932_1144 65
1214 3300038443 Ga0395901_0557499 Ga0395901_0557499_815_1012 65
1215 3300038443 Ga0395901_0804905 Ga0395901_0804905_469_678 65
1216 3300038443 Ga0395901_0836976 Ga0395901_0836976_238_435 65
1217 3300038443 Ga0395901_0870912 Ga0395901_0870912_264_461 65
1218 3300038443 Ga0395901_1150572 Ga0395901_1150572_318_515 65
1219 3300038443 Ga0395901_2161055 Ga0395901_2161055_255_452 65
1220 3300039437 Ga0436365_0628446 Ga0436365_0628446_1815_2012 65
1221 3300039450 Ga0436363_0841606 Ga0436363_0841606_710_907 65
1222 3300039453 Ga0436362_0982029 Ga0436362_0982029_224_421 65
1223 3300041413 Ga0439465_0019013 Ga0439465_0019013_1154_1351 65
1224 3300041451 Ga0451791_0605526 Ga0451791_0605526_17_214 65
1225 3300042005 Ga0439448_0006453 Ga0439448_0006453_803_1012 65
1226 3300042006 Ga0439432_033878 Ga0439432_033878_694_891 65
1227 3300042007 Ga0439449_0116571 Ga0439449_0116571_751_948 65
1228 3300042157 Ga0439458_0000066 Ga0439458_0000066_17096_17305 65
1229 3300042157 Ga0439458_0000821 Ga0439458_0000821_675_872 65
1230 3300042439 Ga0439464_0007789 Ga0439464_0007789_675_872 65
1231 3300044656 Ga0466969_0214927 Ga0466969_0214927_184_396 65
1232 3300044656 Ga0466969_0314500 Ga0466969_0314500_136_333 65
1233 3300044658 Ga0466972_0338767 Ga0466972_0338767_294_491 65
1234 3300044683 Ga0466965_0130341 Ga0466965_0130341_276_473 65
1235 3300044684 Ga0466966_0009646 Ga0466966_0009646_5540_5737 65
1236 3300044684 Ga0466966_0015113 Ga0466966_0015113_3508_3705 65
1237 3300044684 Ga0466966_0028898 Ga0466966_0028898_882_1079 65
1238 3300044684 Ga0466966_0088701 Ga0466966_0088701_1158_1355 65
1239 3300044684 Ga0466966_0215937 Ga0466966_0215937_374_589 65
1240 3300044684 Ga0466966_0516164 Ga0466966_0516164_398_595 65
1241 3300044684 Ga0466966_0526889 Ga0466966_0526889_250_447 65
1242 3300044693 Ga0466961_0020851 Ga0466961_0020851_3230_3427 65
1243 3300044693 Ga0466961_0070512 Ga0466961_0070512_1166_1363 65
1244 3300044693 Ga0466961_0155034 Ga0466961_0155034_234_431 65
1245 3300044693 Ga0466961_0237014 Ga0466961_0237014_174_389 65
1246 3300044693 Ga0466961_0345888 Ga0466961_0345888_459_656 65
1247 3300044693 Ga0466961_0399464 Ga0466961_0399464_228_425 65
1248 3300044693 Ga0466961_0479026 Ga0466961_0479026_306_503 65
1249 3300044693 Ga0466961_0560656 Ga0466961_0560656_318_515 65
1250 3300044694 Ga0466963_0017335 Ga0466963_0017335_2150_2347 65
1251 3300044694 Ga0466963_0130887 Ga0466963_0130887_1335_1532 65
1252 3300044694 Ga0466963_0141138 Ga0466963_0141138_1337_1534 65
1253 3300044694 Ga0466963_0163812 Ga0466963_0163812_821_1033 65
1254 3300044694 Ga0466963_0192897 Ga0466963_0192897_161_373 65
1255 3300044694 Ga0466963_0248461 Ga0466963_0248461_351_548 65
1256 3300044694 Ga0466963_0262744 Ga0466963_0262744_159_356 65
1257 3300044694 Ga0466963_0298684 Ga0466963_0298684_812_1024 65
1258 3300044694 Ga0466963_0378074 Ga0466963_0378074_698_895 65
1259 3300044706 Ga0466964_0171943 Ga0466964_0171943_280_477 65
1260 3300044706 Ga0466964_0286135 Ga0466964_0286135_422_619 65
1261 3300044706 Ga0466964_0292999 Ga0466964_0292999_580_777 65
1262 3300044719 Ga0466971_0046646 Ga0466971_0046646_731_928 65
1263 3300044719 Ga0466971_0138711 Ga0466971_0138711_470_685 65
1264 3300044719 Ga0466971_0348379 Ga0466971_0348379_427_624 65
1265 3300044719 Ga0466971_0558279 Ga0466971_0558279_235_432 65
1266 3300044735 Ga0466968_0109024 Ga0466968_0109024_693_890 65
1267 3300044765 Ga0466970_0017530 Ga0466970_0017530_1490_1687 65
1268 3300044765 Ga0466970_0063664 Ga0466970_0063664_722_919 65
1269 3300044765 Ga0466970_0113247 Ga0466970_0113247_1247_1444 65
1270 3300044765 Ga0466970_0185484 Ga0466970_0185484_463_660 65
1271 3300044765 Ga0466970_0315193 Ga0466970_0315193_515_730 65
1272 3300044765 Ga0466970_0349659 Ga0466970_0349659_580_777 65
1273 3300044765 Ga0466970_0478077 Ga0466970_0478077_447_644 65
1274 3300044842 Ga0466957_0006425 Ga0466957_0006425_6051_6248 65
1275 3300044842 Ga0466957_0084698 Ga0466957_0084698_925_1122 65
1276 3300044842 Ga0466957_0109757 Ga0466957_0109757_447_644 65
1277 3300044842 Ga0466957_0204014 Ga0466957_0204014_529_726 65
1278 3300044842 Ga0466957_0315285 Ga0466957_0315285_173_370 65
1279 3300044842 Ga0466957_0510065 Ga0466957_0510065_213_410 65
1280 3300044842 Ga0466957_0753835 Ga0466957_0753835_90_287 65
1281 3300044842 Ga0466957_1022146 Ga0466957_1022146_160_357 65
1282 3300044901 Ga0466960_0117390 Ga0466960_0117390_1047_1244 65
1283 3300044901 Ga0466960_0211385 Ga0466960_0211385_663_860 65
1284 3300044901 Ga0466960_0369547 Ga0466960_0369547_190_387 65
1285 3300044901 Ga0466960_0793578 Ga0466960_0793578_325_522 65
1286 3300045049 Ga0466959_0009432 Ga0466959_0009432_505_717 65
1287 3300045049 Ga0466959_0026456 Ga0466959_0026456_3128_3325 65
1288 3300045049 Ga0466959_0058688 Ga0466959_0058688_981_1178 65
1289 3300045049 Ga0466959_0236413 Ga0466959_0236413_892_1089 65
1290 3300045049 Ga0466959_0343338 Ga0466959_0343338_501_698 65
1291 3300045049 Ga0466959_0586274 Ga0466959_0586274_259_456 65
1292 3300045049 Ga0466959_0766889 Ga0466959_0766889_255_452 65
1293 3300045049 Ga0466959_0801343 Ga0466959_0801343_146_343 65
1294 3300045836 Ga0466958_0034962 Ga0466958_0034962_2382_2579 65
1295 3300045836 Ga0466958_0101943 Ga0466958_0101943_1392_1589 65
1296 3300045836 Ga0466958_0137366 Ga0466958_0137366_1180_1377 65
1297 3300045836 Ga0466958_0476283 Ga0466958_0476283_408_605 65
1298 3300045976 Ga0466967_0046141 Ga0466967_0046141_2775_2972 65
1299 3300045976 Ga0466967_0047294 Ga0466967_0047294_297_494 65
1300 3300045976 Ga0466967_0067182 Ga0466967_0067182_1480_1677 65
1301 3300045976 Ga0466967_0138031 Ga0466967_0138031_372_569 65
1302 3300045976 Ga0466967_0164371 Ga0466967_0164371_1584_1796 65
1303 3300045976 Ga0466967_0316596 Ga0466967_0316596_418_615 65
1304 3300045976 Ga0466967_0340984 Ga0466967_0340984_318_515 65
1305 3300045976 Ga0466967_0520994 Ga0466967_0520994_894_1094 65
1306 3300045976 Ga0466967_0648957 Ga0466967_0648957_744_959 65
1307 3300045976 Ga0466967_0676055 Ga0466967_0676055_507_704 65
1308 3300045976 Ga0466967_0878347 Ga0466967_0878347_402_599 65
1309 3300045976 Ga0466967_1339545 Ga0466967_1339545_80_277 65
1310 3300045976 Ga0466967_1349291 Ga0466967_1349291_71_268 65
1311 3300045976 Ga0466967_1533279 Ga0466967_1533279_265_462 65
1312 3300045976 Ga0466967_1854063 Ga0466967_1854063_130_327 65
1313 3300045976 Ga0466967_1971996 Ga0466967_1971996_181_378 65
1314 3300046459 Ga0495629_0415706 Ga0495629_0415706_369_581 65
1315 3300046459 Ga0495629_0564499 Ga0495629_0564499_207_419 65
1316 3300046472 Ga0495580_0178355 Ga0495580_0178355_258_470 65
1317 3300046472 Ga0495580_0710712 Ga0495580_0710712_386_583 65
1318 3300046475 Ga0495639_0330139 Ga0495639_0330139_496_708 65
1319 3300046507 Ga0495606_0457018 Ga0495606_0457018_56_253 65
1320 3300046522 Ga0495643_0240782 Ga0495643_0240782_309_506 65
1321 3300046528 Ga0495642_0213298 Ga0495642_0213298_25_222 65
1322 3300046528 Ga0495642_0303303 Ga0495642_0303303_189_386 65
1323 3300046531 Ga0495665_0136337 Ga0495665_0136337_794_991 65
1324 3300046537 Ga0495598_0000209 Ga0495598_0000209_7716_7913 65
1325 3300046539 Ga0495621_0000044 Ga0495621_0000044_14207_14404 65
1326 3300046539 Ga0495621_0027770 Ga0495621_0027770_1378_1575 65
1327 3300046558 Ga0495633_0051086 Ga0495633_0051086_702_899 65
1328 3300046616 Ga0495668_0013713 Ga0495668_0013713_3892_4089 65
1329 3300046616 Ga0495668_0067414 Ga0495668_0067414_1566_1763 65
1330 3300046681 Ga0495647_0022062 Ga0495647_0022062_684_896 65
1331 3300046684 Ga0495669_0001914 Ga0495669_0001914_3848_4045 65
1332 3300046684 Ga0495669_0030612 Ga0495669_0030612_787_984 65
1333 3300046691 Ga0495670_0000148 Ga0495670_0000148_1074_1271 65
1334 3300047445 Ga0495677_0010234 Ga0495677_0010234_948_1145 65
1335 3300047445 Ga0495677_0103821 Ga0495677_0103821_782_979 65
1336 3300047445 Ga0495677_0429328 Ga0495677_0429328_181_378 65
1337 3300048090 Ga0495615_0166319 Ga0495615_0166319_196_393 65
1338 3300048903 Ga0496100_0003087 Ga0496100_0003087_5767_5964 65
1339 3300048903 Ga0496100_0216656 Ga0496100_0216656_741_938 65
1340 3300048903 Ga0496100_0719779 Ga0496100_0719779_43_240 65
1341 3300048904 Ga0496101_0000216 Ga0496101_0000216_9654_9851 65
1342 3300048904 Ga0496101_0012977 Ga0496101_0012977_2918_3115 65
1343 3300048904 Ga0496101_0119966 Ga0496101_0119966_422_619 65
1344 3300048904 Ga0496101_0147023 Ga0496101_0147023_654_866 65
1345 3300048904 Ga0496101_0222775 Ga0496101_0222775_719_916 65
1346 3300048904 Ga0496101_1121014 Ga0496101_1121014_163_360 65
1347 3300048905 Ga0496102_0008344 Ga0496102_0008344_2895_3092 65
1348 3300048905 Ga0496102_0145102 Ga0496102_0145102_1204_1401 65
1349 3300048905 Ga0496102_0985027 Ga0496102_0985027_122_319 65
1350 3300048905 Ga0496102_1082011 Ga0496102_1082011_52_264 65
1351 3300048906 Ga0496103_0007319 Ga0496103_0007319_5136_5333 65
1352 3300048906 Ga0496103_0104194 Ga0496103_0104194_583_813 65
1353 3300048906 Ga0496103_0124170 Ga0496103_0124170_1256_1453 65
1354 3300048906 Ga0496103_0285815 Ga0496103_0285815_753_950 65
1355 3300048906 Ga0496103_0464906 Ga0496103_0464906_362_574 65
1356 3300048906 Ga0496103_0646708 Ga0496103_0646708_402_599 65
1357 3300048907 Ga0496104_0126276 Ga0496104_0126276_727_924 65
1358 3300048907 Ga0496104_0524008 Ga0496104_0524008_120_317 65
1359 3300048907 Ga0496104_0581169 Ga0496104_0581169_733_930 65
1360 3300048907 Ga0496104_1463066 Ga0496104_1463066_177_374 65
1361 3300048908 Ga0496105_0096082 Ga0496105_0096082_1377_1574 65
1362 3300048908 Ga0496105_0110876 Ga0496105_0110876_207_404 65
1363 3300048908 Ga0496105_0116977 Ga0496105_0116977_363_560 65
1364 3300048908 Ga0496105_0482621 Ga0496105_0482621_574_804 65
1365 3300048909 Ga0496106_0054220 Ga0496106_0054220_626_823 65
1366 3300048909 Ga0496106_0139337 Ga0496106_0139337_750_947 65
1367 3300048909 Ga0496106_0333473 Ga0496106_0333473_725_937 65
1368 3300048909 Ga0496106_0398949 Ga0496106_0398949_340_537 65
1369 3300048909 Ga0496106_0474296 Ga0496106_0474296_456_653 65
1370 3300048909 Ga0496106_0887063 Ga0496106_0887063_190_387 65
1371 3300048910 Ga0496107_0000258 Ga0496107_0000258_10501_10698 65
1372 3300048910 Ga0496107_0061294 Ga0496107_0061294_1475_1672 65
1373 3300048910 Ga0496107_0156668 Ga0496107_0156668_654_851 65
1374 3300048910 Ga0496107_0317104 Ga0496107_0317104_753_950 65
1375 3300048910 Ga0496107_0684840 Ga0496107_0684840_543_740 65
1376 3300048910 Ga0496107_0850114 Ga0496107_0850114_186_383 65
1377 3300048910 Ga0496107_1350462 Ga0496107_1350462_199_396 65
1378 3300048911 Ga0496108_0002458 Ga0496108_0002458_10562_10759 65
1379 3300048911 Ga0496108_0003907 Ga0496108_0003907_397_594 65
1380 3300048911 Ga0496108_0011359 Ga0496108_0011359_5978_6175 65
1381 3300048911 Ga0496108_0188213 Ga0496108_0188213_165_377 65
1382 3300048911 Ga0496108_0582999 Ga0496108_0582999_149_346 65
1383 3300048911 Ga0496108_0751143 Ga0496108_0751143_454_651 65
1384 3300048911 Ga0496108_0939835 Ga0496108_0939835_456_653 65
1385 3300048912 Ga0496109_0014422 Ga0496109_0014422_3779_3976 65
1386 3300048912 Ga0496109_0051461 Ga0496109_0051461_1729_1926 65
1387 3300048912 Ga0496109_0106408 Ga0496109_0106408_312_524 65
1388 3300048912 Ga0496109_0142380 Ga0496109_0142380_627_824 65
1389 3300048912 Ga0496109_0163553 Ga0496109_0163553_614_811 65
1390 3300048912 Ga0496109_0193699 Ga0496109_0193699_1044_1241 65
1391 3300048912 Ga0496109_0633998 Ga0496109_0633998_626_823 65
1392 3300048912 Ga0496109_1064588 Ga0496109_1064588_270_467 65
1393 3300048912 Ga0496109_1193638 Ga0496109_1193638_280_477 65
1394 3300048912 Ga0496109_1714325 Ga0496109_1714325_213_410 65
1395 3300048913 Ga0496110_0002729 Ga0496110_0002729_9669_9866 65
1396 3300048913 Ga0496110_0006466 Ga0496110_0006466_6327_6524 65
1397 3300048913 Ga0496110_0008298 Ga0496110_0008298_7727_7924 65
1398 3300048913 Ga0496110_0061673 Ga0496110_0061673_728_925 65
1399 3300048913 Ga0496110_1065487 Ga0496110_1065487_350_547 65
1400 3300048913 Ga0496110_1669602 Ga0496110_1669602_124_321 65
1401 3300048914 Ga0496111_0000858 Ga0496111_0000858_6200_6397 65
1402 3300048914 Ga0496111_0131310 Ga0496111_0131310_471_668 65
1403 3300048914 Ga0496111_0141052 Ga0496111_0141052_428_625 65
1404 3300048914 Ga0496111_0327166 Ga0496111_0327166_199_396 65
1405 3300048914 Ga0496111_0339760 Ga0496111_0339760_288_485 65
1406 3300048914 Ga0496111_0340359 Ga0496111_0340359_626_823 65
1407 3300048914 Ga0496111_0529529 Ga0496111_0529529_625_822 65
1408 3300048915 Ga0496112_0001994 Ga0496112_0001994_15133_15345 65
1409 3300048915 Ga0496112_0006536 Ga0496112_0006536_3944_4141 65
1410 3300048915 Ga0496112_0007277 Ga0496112_0007277_3049_3246 65
1411 3300048915 Ga0496112_0007592 Ga0496112_0007592_4950_5147 65
1412 3300048915 Ga0496112_0025631 Ga0496112_0025631_3081_3278 65
1413 3300048915 Ga0496112_0056958 Ga0496112_0056958_2265_2462 65
1414 3300048915 Ga0496112_0199533 Ga0496112_0199533_679_876 65
1415 3300048915 Ga0496112_0536595 Ga0496112_0536595_139_336 65
1416 3300048915 Ga0496112_0626498 Ga0496112_0626498_674_871 65
1417 3300048915 Ga0496112_0638950 Ga0496112_0638950_553_750 65
1418 3300048915 Ga0496112_1438070 Ga0496112_1438070_270_467 65
1419 3300048916 Ga0496113_0001774 Ga0496113_0001774_2653_2850 65
1420 3300048916 Ga0496113_0012372 Ga0496113_0012372_1323_1535 65
1421 3300048916 Ga0496113_0273365 Ga0496113_0273365_352_549 65
1422 3300048916 Ga0496113_0367633 Ga0496113_0367633_750_947 65
1423 3300048916 Ga0496113_0487073 Ga0496113_0487073_241_438 65
1424 3300048916 Ga0496113_0573399 Ga0496113_0573399_387_584 65
1425 3300048916 Ga0496113_0667444 Ga0496113_0667444_385_582 65
1426 3300048916 Ga0496113_1283363 Ga0496113_1283363_109_306 65
1427 3300048917 Ga0496114_0000016 Ga0496114_0000016_69215_69412 65
1428 3300048917 Ga0496114_0051175 Ga0496114_0051175_144_341 65
1429 3300048917 Ga0496114_0952242 Ga0496114_0952242_54_251 65
1430 3300048918 Ga0496115_0711719 Ga0496115_0711719_67_264 65
1431 3300049583 Ga0501067_0056371 Ga0501067_0056371_1355_1552 65
1432 3300049584 Ga0501068_0924016 Ga0501068_0924016_357_554 65
1433 3300049585 Ga0501069_0078190 Ga0501069_0078190_870_1067 65
1434 3300049586 Ga0501070_0024533 Ga0501070_0024533_3953_4165 65
1435 3300049586 Ga0501070_1489430 Ga0501070_1489430_260_472 65
1436 3300049652 Ga0501202_009622 Ga0501202_009622_1138_1335 65
1437 3300049656 Ga0501209_231289 Ga0501209_231289_253_450 65
1438 3300049656 Ga0501209_257557 Ga0501209_257557_39_236 65
1439 3300049660 Ga0501216_042464 Ga0501216_042464_290_487 65
1440 3300049661 Ga0501217_027652 Ga0501217_027652_706_903 65
1441 3300049663 Ga0501223_093277 Ga0501223_093277_393_590 65
1442 3300049669 Ga0501235_019544 Ga0501235_019544_212_409 65
1443 3300049669 Ga0501235_034614 Ga0501235_034614_463_660 65
1444 3300049669 Ga0501235_124473 Ga0501235_124473_156_371 65
1445 3300049673 Ga0501240_061907 Ga0501240_061907_259_456 65
1446 3300049674 Ga0501242_006701 Ga0501242_006701_262_459 65
1447 3300049675 Ga0501243_123251 Ga0501243_123251_223_420 65
1448 3300049677 Ga0501247_003032 Ga0501247_003032_912_1109 65
1449 3300049678 Ga0501248_014299 Ga0501248_014299_225_422 65
1450 3300049687 Ga0501258_005637 Ga0501258_005637_471_668 65
1451 3300049688 Ga0501259_057714 Ga0501259_057714_511_708 65
1452 3300049704 Ga0501221_069178 Ga0501221_069178_447_644 65
1453 3300049705 Ga0501225_0015497 Ga0501225_0015497_393_590 65
1454 3300049705 Ga0501225_0126029 Ga0501225_0126029_227_424 65
1455 3300049706 Ga0501229_031274 Ga0501229_031274_391_588 65
1456 3300049707 Ga0501234_022239 Ga0501234_022239_118_315 65
1457 3300049707 Ga0501234_068581 Ga0501234_068581_158_355 65
1458 3300049759 Ga0501262_005532 Ga0501262_005532_941_1138 65
1459 3300049760 Ga0501263_003065 Ga0501263_003065_266_463 65
1460 3300049763 Ga0501266_061530 Ga0501266_061530_55_252 65
1461 3300049764 Ga0501267_025905 Ga0501267_025905_446_643 65
1462 3300049765 Ga0501268_000282 Ga0501268_000282_3556_3753 65
1463 3300049767 Ga0501270_050076 Ga0501270_050076_229_426 65
1464 3300049767 Ga0501270_173714 Ga0501270_173714_296_493 65
1465 3300049770 Ga0501273_010550 Ga0501273_010550_610_807 65
1466 3300049775 Ga0501279_050100 Ga0501279_050100_441_638 65
1467 3300049779 Ga0501283_044209 Ga0501283_044209_189_386 65
1468 3300049779 Ga0501283_078408 Ga0501283_078408_259_456 65
1469 3300049850 Ga0501204_009159 Ga0501204_009159_43_240 65
1470 3300050493 nmdc:mga0k408_218035_c1 nmdc:mga0k408_218035_c1_777_974 65
1471 3300050507 nmdc:mga05p37_1734789_c1 nmdc:mga05p37_1734789_c1_152_349 65
1472 3300050508 nmdc:mga09592_926365_c1 nmdc:mga09592_926365_c1_109_306 65
1473 3300053085 Ga0495619_0946472 Ga0495619_0946472_362_559 65
1474 3300053134 Ga0500658_0000032 Ga0500658_0000032_46768_46965 65
1475 3300060353 Ga0501082_1585717 Ga0501082_1585717_82_279 65
1476 3300061719 Ga0466962_0044709 Ga0466962_0044709_397_594 65
1477 3300061719 Ga0466962_0255975 Ga0466962_0255975_512_709 65

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF13773

DUF4170

Domain of unknown function (DUF4170)

13

75

0.91

Structural Annotation

Top 5 Hits

ID Description Score Start End
4ued-assembly1.cif.gz_A complex of human eif4e with the 4e binding protein 4e-bp1 0.5494 4 61
6u06-assembly4.cif.gz_D discovery of lysine-targeted eif4e inhibitors through covalent docking 0.5488 4 61
5j5o-assembly4.cif.gz_D translation initiation factor 4e in complex with m7gppppg mrna 5' cap analog 0.5479 4 61
5j5y-assembly3.cif.gz_C translation initiation factor 4e in complex with m2(7,2'o)gppccl2ppg mrna 5' cap analog 0.5473 4 61
4dt6-assembly1.cif.gz_A co-crystal structure of eif4e with inhibitor 0.5447 4 61
ID Description Score Start End Superfamily
af_V5QQR7_1_86_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.8061 3 64 2.60.40.10
af_V5QQR7_1_86_2.60.40.10 Mainly Beta;Sandwich;Immunoglobulin-like;Immunoglobulins 0.6569 3 64 2.60.40.10
af_Q2FWU7_1_95_3.40.1350.100 Alpha Beta;3-Layer(aba) Sandwich;Trna Endonuclease; Chain: A, domain 1; 0.5766 3 61 3.40.1350.100
af_P10100_283_361_3.30.70.1070 Alpha Beta;2-Layer Sandwich;Alpha-Beta Plaits;Sporulation related repeat 0.5722 1 61 3.30.70.1070
af_I1MEZ1_51_202_3.30.760.10 Alpha Beta;2-Layer Sandwich;RNA Cap, Translation Initiation Factor Eif4e;RNA Cap, Translation Initiation Factor Eif4e 0.5653 3 63 3.30.760.10
ID Description Score Start End GO Terms
AF-A0A840ATB6-F1-model_v4 DUF4170 domain-containing protein 0.9343 3 61
AF-I4YMR9-F1-model_v4 DUF4170 domain-containing protein 0.9325 3 62
AF-A0A418UX92-F1-model_v4 DUF4170 domain-containing protein 0.93 2 62
AF-A0A1G8WIW4-F1-model_v4 DUF4170 domain-containing protein 0.9284 2 65
AF-A0A5N3P9K4-F1-model_v4 DUF4170 domain-containing protein 0.9277 1 63

Feature Viewer

pLDDT pTM Quality
86.09 0.68 Medium
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map