F493931

General Info

Members Datasets Scaffolds Average Seq Length
1434 589 1202 463

Family's Representative Sequence

Representative Sequence 3300042016|Ga0439463_000021|Ga0439463_000021_490_2067
Length 525
Sequence MARRFAAFASKLRSYKEDAIATQDAIACLTGVAVRAHITVIIFCSTTFKAFFSDCRRTAMSSYDVVILGGGPGGYNAAIRAGQLGLKAACVEGRATLGGTCLNVGCMPSKALLHASELYDAAMGKEFAELGIEVKPRLNLAQMMKQKDDSVAGLTKGIEFLFRKNKVDWIKGWGHIDGPGQVTVTDSAGGKTRLQARDIVIATGSEPTPLPGVEIDNRRILDSTGALSLGEVPRHLVVIGAGVIGLELGSVWRRLGAQVTVVEYLDRICPGVDGETGKTLQRALAKQGIAFKLGTKVSSASTSANGVQLSIEPAAGGTAELLEADYVLVAIGRRPYTQGLGLENVGLSTDPRGMLANRQHRTEAPGVWVIGDVTSGPMLAHKAEDEAMACIEQIVGKAGEVNYNLIPSVIYTKPELASVGKTEEQLKAEGRAYKAGKFPFTANSRAKINHETEGFAKVLADAQTDEILGVHLVGPSVSEMIGEYCVAMEFSASAEDIALTCHPHPTRSEALRQAAMDVEGMATQM

Samples

Sample ID Description Type Environment
1 2124908027 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v1 Metagenome Rhizosphere
2 2510917020 Caulobacter sp. AP07 Isolate Rhizosphere
3 2511231004 Pseudomonas sp. GM102 Isolate Nodule
4 2511231006 Pseudomonas sp. GM17 Isolate Nodule
5 2511231007 Pseudomonas sp. GM18 Isolate Nodule
6 2511231008 Pseudomonas sp. GM21 Isolate Nodule
7 2511231010 Pseudomonas sp. GM25 Isolate Nodule
8 2511231011 Pseudomonas sp. GM30 Isolate Nodule
9 2511231012 Pseudomonas sp. GM33 Isolate Nodule
10 2511231014 Pseudomonas sp. GM48 Isolate Nodule
11 2511231015 Pseudomonas sp. GM49 Isolate Nodule
12 2511231016 Pseudomonas sp. GM50 Isolate Nodule
13 2511231017 Pseudomonas sp. GM55 Isolate Nodule
14 2511231018 Pseudomonas sp. GM60 Isolate Nodule
15 2511231019 Pseudomonas sp. GM67 Isolate Nodule
16 2511231020 Pseudomonas sp. GM74 Isolate Nodule
17 2511231021 Pseudomonas sp. GM78 Isolate Nodule
18 2511231022 Pseudomonas sp. GM79 Isolate Nodule
19 2511231023 Pseudomonas sp. GM80 Isolate Nodule
20 2511231024 Pseudomonas sp. GM84 Isolate Nodule
21 2511231031 Pseudomonas sp. GM16 Isolate Nodule
22 2511231156 Pseudomonas ogarae F113 Isolate Rhizosphere
23 2511231221 Azospirillum lipoferum 4B Isolate Rhizosphere
24 2512047018 Pseudomonas chlororaphis chlororaphis GP72 Isolate Rhizosphere
25 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
26 2554235132 Pseudomonas aeruginosa PGPR2 Isolate Unclassified
27 2554235231 Pseudomonas putida MTCC 5279 Isolate Unclassified
28 2582580891 Pseudomonas chlororaphis YL-1 Isolate Unclassified
29 2582581279 Caulobacter henricii OK261 Isolate Rhizosphere
30 2582581280 Caulobacter henricii CF287 Isolate Rhizosphere
31 2582581293 Caulobacter henricii YR570 Isolate Rhizosphere
32 2585427687 Pedobacter borealis DSM 19626 Isolate Rhizosphere
33 2585428106 Caulobacter sp. OV484 Isolate Rhizosphere
34 2597489887 Pseudomonas chlororaphis aureofaciens 30-84 Isolate Rhizosphere
35 2599185185 Pseudomonas sp. NFPP07 Isolate Rhizoplane
36 2599185188 Pseudomonas sp. NFACC45 Isolate Rhizoplane
37 2599185212 Pseudomonas sp. NFACC15-1 Isolate Rhizoplane
38 2599185248 Pseudomonas sp. NFACC08-1 Isolate Rhizoplane
39 2599185257 Pseudomonas sp. NFACC41-3 Isolate Rhizoplane
40 2599185289 Pseudomonas sp. NFACC51 Isolate Rhizoplane
41 2599185291 Pseudomonas sp. NFACC48-1 Isolate Rhizoplane
42 2599185300 Pseudomonas sp. NFACC39-1 Isolate Rhizoplane
43 2599185302 Pseudomonas sp. NFACC43 Isolate Rhizoplane
44 2599185304 Pseudomonas sp. NFACC47-1 Isolate Rhizoplane
45 2599185305 Pseudomonas sp. NFACC07-1 Isolate Rhizoplane
46 2599185306 Pseudomonas sp. NFACC16-2 Isolate Rhizoplane
47 2599185307 Pseudomonas sp. NFACC02 Isolate Rhizoplane
48 2599185308 Pseudomonas sp. NFACC17-2 Isolate Rhizoplane
49 2599185309 Pseudomonas sp. NFACC49-2 Isolate Rhizoplane
50 2599185310 Pseudomonas sp. NFACC09-4 Isolate Rhizoplane
51 2599185311 Pseudomonas sp. NFACC04-2 Isolate Rhizoplane
52 2599185312 Pseudomonas sp. NFACC32-1 Isolate Rhizoplane
53 2599185313 Pseudomonas sp. NFACC05-1 Isolate Rhizoplane
54 2599185314 Pseudomonas sp. NFACC23-1 Isolate Rhizoplane
55 2599185315 Pseudomonas sp. NFACC44-2 Isolate Rhizoplane
56 2599185316 Pseudomonas sp. NFACC52 Isolate Rhizoplane
57 2599185317 Pseudomonas sp. NFACC06-1 Isolate Rhizoplane
58 2599185318 Pseudomonas sp. NFACC13-1 Isolate Rhizoplane
59 2599185320 Pseudomonas sp. NFACC36 Isolate Rhizoplane
60 2599185321 Pseudomonas sp. NFACC54 Isolate Rhizoplane
61 2599185322 Pseudomonas sp. NFACC14 Isolate Rhizoplane
62 2599185323 Pseudomonas sp. NFACC37-1 Isolate Rhizoplane
63 2599185324 Pseudomonas sp. NFACC46-3 Isolate Rhizoplane
64 2599185325 Pseudomonas sp. NFACC56-3 Isolate Rhizoplane
65 2599185353 Staphylococcus sp. NFPP34 Isolate Rhizoplane
66 2600254930 Pseudomonas sp. NFIX10 Isolate Rhizoplane
67 2600254931 Pseudomonas sp. NFIX28 Isolate Rhizoplane
68 2600254943 Staphylococcus pasteuri NFIX07 Isolate Rhizoplane
69 2600254954 Pseudomonas sp. NFACC19-2 Isolate Rhizoplane
70 2600255283 Pseudomonas sp. NFR16 Isolate Rhizoplane
71 2600255318 Pseudomonas putida NFIX47 Isolate Rhizoplane
72 2600255389 Pseudomonas sp. NFPP33 Isolate Rhizoplane
73 2603880185 Pseudomonas sp. NFIX46 Isolate Rhizoplane
74 2603880199 Pseudomonas sp. NFIX49 Isolate Rhizoplane
75 2606217733 Pseudomonas aeruginosa NFHH01 Isolate Rhizoplane
76 2623620443 Pseudomonas sp. DR 5-09 Isolate Unclassified
77 2623620446 Pseudomonas sp. GR 6-02 Isolate Unclassified
78 2643221545 Caulobacter sp. Root1455 Isolate Unclassified
79 2643221552 Caulobacter sp. Root1472 Isolate Unclassified
80 2643221565 Pseudomonas sp. Root562 Isolate Unclassified
81 2643221583 Caulobacter sp. Root655 Isolate Unclassified
82 2643221584 Caulobacter sp. Root656 Isolate Unclassified
83 2643221589 Pseudomonas sp. Root68 Isolate Unclassified
84 2643221598 Phenylobacterium sp. Root700 Isolate Unclassified
85 2643221602 Pseudomonas sp. Root71 Isolate Unclassified
86 2643221614 Phenylobacterium sp. Root77 Isolate Unclassified
87 2643221633 Pseudomonas sp. Root329 Isolate Unclassified
88 2643221640 Caulobacter sp. Root342 Isolate Unclassified
89 2643221642 Caulobacter sp. Root343 Isolate Unclassified
90 2643221650 Pseudomonas sp. Root401 Isolate Unclassified
91 2643221661 Phenylobacterium sp. Root1277 Isolate Unclassified
92 2643221666 Phenylobacterium sp. Root1290 Isolate Unclassified
93 2643221691 Caulobacter sp. Root487D2Y Isolate Unclassified
94 2651869719 Genome Sequence of Pseudomonas fluorescens UM270 Isolate Rhizosphere
95 2667528170 Pseudomonas sp. NFACC50-1 Isolate Rhizoplane
96 2667528176 Pseudomonas sp. NFACC11-2 Isolate Rhizoplane
97 2671180172 Pseudomonas sp. NFIX51 Isolate Rhizoplane
98 2675903515 Pseudomonas thivervalensis DSM 13194 Isolate Unclassified
99 2713897148 Pseudomonas fluorescens SF39a Isolate Rhizosphere
100 2713897149 Pseudomonas fluorescens SF4c Isolate Rhizosphere
101 2718217725 Pseudomonas fluorescens CREA-C16 Isolate Rhizosphere
102 2721755487 Sphingobacterium sp. B29 Isolate Rhizosphere
103 2738541273 Elizabethkingia sp. YR214 Isolate Unclassified
104 2738541283 Pedobacter sp. OK701 Isolate Unclassified
105 2738541284 Pedobacter sp. YR016 Isolate Unclassified
106 2738541302 Pedobacter sp. CF074 Isolate Unclassified
107 2738543004 Pseudomonas sp. GV085 Isolate Unclassified
108 2738543015 Pseudomonas sp. GV041 Isolate Unclassified
109 2738543020 Pseudomonas sp. GV054 Isolate Unclassified
110 2738543021 Pseudomonas sp. GV071 Isolate Unclassified
111 2738543023 Pedobacter sp. OK628 Isolate Unclassified
112 2738543025 Pseudomonas sp. GV091 Isolate Unclassified
113 2739367651 Pedobacter sp. OK291 Isolate Unclassified
114 2739367656 Pedobacter sp. CF523 Isolate Unclassified
115 2739367663 Pedobacter sp. YR510 Isolate Unclassified
116 2740892503 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
117 2744054620 Pseudomonas thivervalensis LMG 21626 Isolate Unclassified
118 2744054657 Brevibacillus sp. SKDU10 Isolate Unclassified
119 2765235841 Pseudomonas putida AA7 Isolate Unclassified
120 2773857670 Pseudomonas sp. 478 Isolate Unclassified
121 2773857673 Pseudomonas sp. 443 Isolate Unclassified
122 2775506987 Pedobacter ginsengisoli T01R-27 Isolate Unclassified
123 2784132063 Pseudomonas sp. 424 Isolate Unclassified
124 2784132072 Pseudomonas sp. 460 Isolate Unclassified
125 2791355048 Caulobacter flavus CGMCC1 15093 Isolate Rhizosphere
126 2791355520 Pseudomonas sp. s211(2017) Isolate Unclassified
127 2806310737 Pseudomonas mosselii BS011 Isolate Unclassified
128 2806310745 Pseudomonas mosselii PtA1 Isolate Unclassified
129 2808606377 Pseudomonas sp. SJZ083 Isolate Rhizosphere
130 2808606379 Pseudomonas sp. SJZ079 Isolate Rhizosphere
131 2808606381 Pseudomonas sp. SJZ077 Isolate Rhizosphere
132 2808606382 Pseudomonas sp. SJZ080 Isolate Rhizosphere
133 2808606445 Pseudomonas sp. SJZ131 Isolate Rhizosphere
134 2816332336 Brevibacillus laterosporus ZQ2 Isolate Unclassified
135 2818991435 Caulobacter henricii 536 Isolate Unclassified
136 2818991437 Pedobacter terrae 518 Isolate Unclassified
137 2818991454 Caulobacter rhizosphaerae 3260 Isolate Rhizosphere
138 2818991456 Pseudomonas koreensis 3286 Isolate Rhizosphere
139 2823421272 Pseudomonas mendocina S5.2 Isolate Rhizoplane
140 2825651385 Pseudomonas brassicacearum L13-6-12 Isolate Rhizosphere
141 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
142 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
143 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
144 2842722452 Pedobacter sp. R-72249 Isolate Unclassified
145 2842805378 Pseudomonas sp. R-72599 Isolate Unclassified
146 2842832357 Pseudomonas sp. R-72164 Isolate Unclassified
147 2842843487 Pseudomonas sp. R-72074 Isolate Unclassified
148 2842854478 Pseudomonas sp. R-71998 Isolate Unclassified
149 2842909656 Pedobacter sp. R-72393 Isolate Unclassified
150 2843744320 Caulobacter flavus RHGG3 Isolate Unclassified
151 2849281842 Pedobacter sp. AK013 Isolate Rhizosphere
152 2849560528 Caulobacter zeae 410 Isolate Unclassified
153 2849573788 Caulobacter endophyticus 774 Isolate Unclassified
154 2851153111 Caulobacter radicis 736 Isolate Unclassified
155 2852627209 Pedobacter sp. AK017 Isolate Rhizosphere
156 2852657418 Pseudomonas sp. JAI115 Isolate Rhizosphere
157 2857504554 Caulobacter sp. R-72291 Isolate Unclassified
158 2857627736 Pedobacter sp. R-74587 Isolate Unclassified
159 2860339153 Pseudomonas sp. JAI111 Isolate Rhizosphere
160 2874168670 Mesorhizobium kowhaii Ach-343 Isolate Nodule
161 2878029506 Pseudomonas fluorescens DR397 Isolate Rhizosphere
162 2880230671 Pseudomonas fluorescens LBUM677 Isolate Unclassified
163 2881644220 Siminovitchia terrae LMG 29736 Isolate Rhizosphere
164 2884960567 Caulobacter sp. 602-1 Isolate Rhizosphere
165 2896317667 Sphingobacterium sp. SGR-19 Isolate Rhizosphere
166 2898329390 Caulobacter sp. 602-2 Isolate Rhizosphere
167 2898713307 Sphingobacterium sp. SGG-5 Isolate Rhizosphere
168 2902048731 Pedobacter ureilyticus THG-T11 Isolate Rhizosphere
169 2904445276 Pedobacter terrae 1734 Isolate Rhizosphere
170 2904518522 Pseudomonas fluorescens 4488 Isolate Rhizosphere
171 2904550169 Stutzerimonas stutzeri 1099 Isolate Rhizosphere
172 2904780799 Sphingobacterium sp. 1304 Isolate Rhizosphere
173 2912963787 Pseudomonas sp. R32 Isolate Rhizosphere
174 2913036834 Pseudomonas viciae 11K1 Isolate Rhizosphere
175 2919063839 Pseudomonas pharyngis 1098 Isolate Rhizosphere
176 2919177583 Sphingobacterium sp. 2149 Isolate Rhizosphere
177 2919186247 Pedobacter africanus 2697 Isolate Rhizosphere
178 2919385768 Pseudomonas sp. 2957 Isolate Unclassified
179 2919456309 Pseudomonas sp. 3296 Isolate Rhizosphere
180 2919481497 Pseudomonas brassicacearum 3432 Isolate Unclassified
181 2919487758 Pseudomonas koreensis 3441 Isolate Unclassified
182 2919501602 Pseudomonas alcaliphila 3512 Isolate Unclassified
183 2919697872 Pseudomonas frederiksbergensis 4169 Isolate Unclassified
184 2923153595 Pseudomonas chlororaphis piscium PCL1391 Isolate Unclassified
185 2923586266 Pseudomonas fluorescens 1550 Isolate Rhizosphere
186 2924710171 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.2 Isolate Nodule
187 2926063275 Pseudomonas sp. 3400 Isolate Unclassified
188 2928531327 Caulobacter sp. 1776 Isolate Rhizosphere
189 2929144301 Pseudomonas sp. R-71838 Hybrid assembly Isolate Unclassified
190 2931369376 Pseudomonas fluorescens DR133 Isolate Rhizosphere
191 2931396565 Pseudomonas sp. DR48 Isolate Rhizosphere
192 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
193 2939636861 Pseudomonas sp. 2725 Isolate Rhizosphere
194 2939651529 Pseudomonas sp. 2835 Isolate Rhizosphere
195 2939664404 Pedobacter africanus 2990 Isolate Rhizosphere
196 2945928738 Pseudomonas cedrina W1I11 Isolate Rhizosphere
197 2945997725 Pedobacter sp. W3I1 Isolate Rhizosphere
198 2954016120 Flavobacterium sp. W4I14 Isolate Rhizosphere
199 2964375228 Anaerobacillus alkaliphilus B16-10 Isolate Rhizosphere
200 2969304461 Pseudomonas sp. R84 Isolate Rhizosphere
201 2974289157 Pseudomonas fluorescens SORGH_AS 191 Isolate Unclassified
202 2977898635 Mesorhizobium sp. M7A.T.Ca.TU.009.01.3.1 Isolate Nodule
203 2984286254 Pseudomonas chlororaphis aurantiaca JD37 Isolate Rhizosphere
204 2998139840 Pseudomonas iranensis SWRI54 Isolate Rhizosphere
205 3007395558 Pseudomonas chlororaphis PCL1601 Isolate Rhizosphere
206 3007419365 Pseudomonas vanderleydeniana RW8P3 Isolate Unclassified
207 3007511990 Pseudomonas fluorescens G20-18 Isolate Rhizosphere
208 3007614139 Pseudomonas sp. PB106 Isolate Unclassified
209 3007619802 Pseudomonas sp. PB120 Isolate Unclassified
210 3007718800 Pseudomonas fluorescens BW11P2 Isolate Rhizosphere
211 3007803356 Pseudomonas sp. CM27 Isolate Unclassified
212 3007861166 Pseudomonas hamedanensis SWRI65 Isolate Rhizosphere
213 3007866637 Pseudomonas marvdashtae SWRI102 Isolate Rhizosphere
214 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
215 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
216 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
217 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
218 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
219 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
220 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
221 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
222 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
223 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
224 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
225 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
226 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
227 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
228 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
229 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
230 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
231 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
232 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
233 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
234 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
235 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
236 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
237 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
238 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
239 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
240 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
241 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
242 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
243 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
244 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
245 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
246 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
247 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
248 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
249 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
250 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
251 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
252 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
253 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
254 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
255 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
256 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
257 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
258 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
259 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
260 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
261 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
262 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
263 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
264 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
265 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
266 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
267 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
268 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
269 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
270 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
271 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
272 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
273 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
274 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
275 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
276 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
277 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
278 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
279 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
280 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
281 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
282 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
283 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
284 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
285 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
286 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
287 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
288 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
289 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
290 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
291 3300015682 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_A01 Metagenome Rhizosphere
292 3300015684 Plant tissue microbial consortia from sugarcane, Campinas, Sao Paulo, Brazil - 002.2_F02 Metagenome Unclassified
293 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
294 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
295 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
296 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
297 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
298 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
299 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
300 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
301 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
302 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
303 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
304 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
305 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
306 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
307 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
308 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
309 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
310 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
311 3300025735 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
312 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
313 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
315 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
316 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
318 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
319 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
320 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
321 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
322 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
323 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
324 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
325 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
326 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
327 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
328 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
329 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
330 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
331 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
332 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
333 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
334 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
335 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
336 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
337 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
338 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
339 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
340 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
341 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
342 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
343 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
344 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
345 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
346 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
347 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
348 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
349 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
350 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
351 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
352 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
353 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
354 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
355 3300030734 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 5 Metagenome Rhizosphere
356 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
357 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
358 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
359 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
360 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
361 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
362 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
363 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
364 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
365 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
366 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
367 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
368 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
369 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
370 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
371 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
372 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
373 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
374 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
375 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
376 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
377 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
378 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
379 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
380 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
381 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
382 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
383 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
384 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
385 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
386 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
387 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
388 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
389 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
390 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
391 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
392 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
393 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
394 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
395 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
396 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
397 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
398 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
399 3300042121 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515D_E14_082716_2398 Metagenome Rhizosphere
400 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
401 3300042124 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_082716_2423 Metagenome Rhizosphere
402 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
403 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
404 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
405 3300042138 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0624L_E14_072516_1379 Metagenome Rhizosphere
406 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
407 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
408 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
409 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
410 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
411 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
412 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
413 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
414 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
415 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
416 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
417 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
418 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
419 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
420 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
421 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
422 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
423 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
424 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
425 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
426 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
427 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
428 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
429 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
430 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
431 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
432 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
433 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
434 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
435 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
436 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
437 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
438 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
439 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
440 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
441 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
442 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
443 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
444 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
445 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
446 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
447 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
448 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
449 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
450 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
451 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
452 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
453 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
454 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
455 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
456 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
457 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
458 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
459 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
460 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
461 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
462 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
463 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
464 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
465 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
466 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
467 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
468 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
469 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
470 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
471 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
472 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
473 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
474 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
475 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
476 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
477 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
478 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
479 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
480 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
481 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
482 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
483 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
484 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
485 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
486 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
487 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
488 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
489 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
490 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
491 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
492 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
493 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
494 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
495 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
496 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
497 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
498 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
499 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
500 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
501 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
502 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
503 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
504 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
505 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
506 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
507 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
508 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
509 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
510 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
511 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
512 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
513 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
514 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
515 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
516 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
517 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
518 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
519 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
520 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
521 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
522 3300049671 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_A_3_drought Metagenome Rhizosphere
523 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
524 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
525 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
526 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
527 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
528 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
529 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
530 3300049853 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F4_A_2_drought Metagenome Rhizosphere
531 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
532 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
533 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
534 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
535 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
536 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
537 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
538 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
539 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
540 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
541 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
542 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
543 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
544 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
545 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
546 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
547 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
548 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
549 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
550 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
551 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
552 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
553 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
554 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
555 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
556 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
557 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
558 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
559 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
560 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
561 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
562 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
563 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
564 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
565 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
566 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
567 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
568 3300053735 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 endosphere Metagenome Endosphere
569 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
570 8011350971 Pseudomonas sp. 30_B Isolate Rhizosphere
571 8015687852 Pseudomonas chlororaphis aurantiaca RP4 Isolate Rhizosphere
572 8019775933 Pseudomonas sp. PvR083 Isolate Rhizosphere
573 8029995093 Pseudomonas atacamensis SM1 Isolate Rhizosphere
574 8034962539 Pseudomonas sediminis PI11 Isolate Rhizosphere
575 8052494512 Pseudomonas putida LD6 Isolate Unclassified
576 8054929484 Pseudomonas vlassakiae RW4S1 Isolate Rhizosphere
577 8055588893 Parapedobacter lycopersici KACC 18788 Isolate Rhizosphere
578 8055770955 Pseudomonas chlororaphis qlu-1 Isolate Rhizosphere
579 8055878733 Pseudomonas palmensis BBB001 Isolate Rhizosphere
580 8056115690 Pseudomonas muyukensis COW39 Isolate Rhizosphere
581 8056120720 Pseudomonas maumuensis COW77 Isolate Rhizosphere
582 8056125926 Pseudomonas azerbaijanorientalis SWRI123 Isolate Rhizosphere
583 8056137416 Pseudomonas fakonensis COW40 Isolate Rhizosphere
584 8056143049 Pseudomonas alvandae SWRI17 Isolate Rhizosphere
585 8056155041 Pseudomonas farris SWRI79 Isolate Rhizosphere
586 8056166840 Pseudomonas triticicola SWRI88 Isolate Rhizosphere
587 8056172158 Pseudomonas ekonensis COR58 Isolate Rhizosphere
588 8056177738 Pseudomonas azerbaijanoccidentalis SWRI74 Isolate Rhizosphere
589 8056569372 Pseudomonas serboccidentalis IT-P374 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 83.82
Metatranscriptomes 0
Isolates 16.18

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 8.16
Nodule 2.44
Rhizoplane 4.32
Rhizosphere 73.36
Stem 0
Stem Tuber 0
Unclassified 11.72

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MRS2a_Contig_81 2124908027 Bacteria 34847
2 JGI25152J39213_1000007 3300002773 Bacteria 156012
3 JGI25150J39212_1000013 3300002774 Bacteria 182307
4 JGI25151J46595_10000004 3300003187 Bacteria 494006
5 JGI25153J46596_10000004 3300003215 Bacteria 494006
6 Ga0055526_1023555 3300003771 Bacteria 2050
7 Ga0055537_1000985 3300003773 Bacteria 12928
8 Ga0055536_1000055 3300003781 Bacteria 107659
9 Ga0055536_1000071 3300003781 Bacteria 93563
10 Ga0055536_1000171 3300003781 Bacteria 54346
11 Ga0055536_1000257 3300003781 Bacteria 41866
12 Ga0055528_1004889 3300003790 Bacteria 6336
13 Ga0055530_10000068 3300003791 Bacteria 92189
14 Ga0055530_10000077 3300003791 Bacteria 84280
15 Ga0055530_10000501 3300003791 Bacteria 33974
16 Ga0055540_1000106 3300003792 Bacteria 92189
17 Ga0055540_1000172 3300003792 Bacteria 64142
18 Ga0055540_1000410 3300003792 Bacteria 34685
19 Ga0055531_10000540 3300003794 Bacteria 33484
20 Ga0065165_1000294 3300005262 Bacteria 84454
21 Ga0065714_10000447 3300005288 Bacteria 5039
22 Ga0065714_10002191 3300005288 Bacteria 100067
23 Ga0065714_10002560 3300005288 Bacteria 20002
24 Ga0065714_10002902 3300005288 Bacteria 19219
25 Ga0065714_10005642 3300005288 Bacteria 10563
26 Ga0065714_10005804 3300005288 Bacteria 5443
27 Ga0065714_10013340 3300005288 Bacteria 2412
28 Ga0065714_10064634 3300005288 Bacteria 26814
29 Ga0065714_10065178 3300005288 Bacteria 12192
30 Ga0065714_10080610 3300005288 Bacteria 2426
31 Ga0065704_10000458 3300005289 Bacteria 20141
32 Ga0065704_10000533 3300005289 Bacteria 17263
33 Ga0065704_10002205 3300005289 Bacteria 5645
34 Ga0065704_10070235 3300005289 Bacteria 53570
35 Ga0070670_100000004 3300005331 Bacteria 392110
36 Ga0068869_100082425 3300005334 Bacteria 2404
37 Ga0070666_10060244 3300005335 Bacteria 2569
38 Ga0070680_100042257 3300005336 Bacteria 3698
39 Ga0070680_100054793 3300005336 Bacteria 3257
40 Ga0068868_100074562 3300005338 Bacteria 2710
41 Ga0070660_100044788 3300005339 Bacteria 3385
42 Ga0070668_100000684 3300005347 Bacteria 23084
43 Ga0070668_100000986 3300005347 Bacteria 19969
44 Ga0070668_100017483 3300005347 Bacteria 5376
45 Ga0070668_100062078 3300005347 Bacteria 2895
46 Ga0070669_100000251 3300005353 Bacteria 44090
47 Ga0070669_100005805 3300005353 Bacteria 8900
48 Ga0070671_100003368 3300005355 Bacteria 12466
49 Ga0070671_100003524 3300005355 Bacteria 12231
50 Ga0070671_100061950 3300005355 Bacteria 3115
51 Ga0070659_100001101 3300005366 Bacteria 19729
52 Ga0070659_100162359 3300005366 Bacteria 1827
53 Ga0070667_100000115 3300005367 Bacteria 102912
54 Ga0070667_100001604 3300005367 Bacteria 20239
55 Ga0070667_100007198 3300005367 Bacteria 9247
56 Ga0070685_10003229 3300005466 Bacteria 8292
57 Ga0070679_100062480 3300005530 Bacteria 3713
58 Ga0070665_100000157 3300005548 Bacteria 124344
59 Ga0070665_100000347 3300005548 Bacteria 69815
60 Ga0070665_100000395 3300005548 Bacteria 64323
61 Ga0070665_100001733 3300005548 Bacteria 24953
62 Ga0070665_100006210 3300005548 Bacteria 12222
63 Ga0068855_100031312 3300005563 Bacteria 6352
64 Ga0068856_100021439 3300005614 Bacteria 6282
65 Ga0068859_100028999 3300005617 Bacteria 5552
66 Ga0068859_100104780 3300005617 Bacteria 2888
67 Ga0068864_100000175 3300005618 Bacteria 59231
68 Ga0068864_100000522 3300005618 Bacteria 33095
69 Ga0068863_100000076 3300005841 Bacteria 109412
70 Ga0068863_100000308 3300005841 Bacteria 50279
71 Ga0068863_100002055 3300005841 Bacteria 19936
72 Ga0068863_100075960 3300005841 Bacteria 3178
73 Ga0068863_100095238 3300005841 Bacteria 2826
74 Ga0068863_100110566 3300005841 Bacteria 2617
75 Ga0068858_100000079 3300005842 Bacteria 100753
76 Ga0068858_100003236 3300005842 Bacteria 16249
77 Ga0068858_100010456 3300005842 Bacteria 8791
78 Ga0068860_100000212 3300005843 Bacteria 91248
79 Ga0068860_100000299 3300005843 Bacteria 68847
80 Ga0068860_100022987 3300005843 Bacteria 6029
81 Ga0068860_100048075 3300005843 Bacteria 4066
82 Ga0068862_100000285 3300005844 Bacteria 56176
83 Ga0068862_100007856 3300005844 Bacteria 8824
84 Ga0068862_100054100 3300005844 Bacteria 3437
85 Ga0075368_10012668 3300006042 Bacteria 3089
86 Ga0075364_10104013 3300006051 Bacteria 1891
87 Ga0075432_10000027 3300006058 Bacteria 26985
88 Ga0075432_10006759 3300006058 Bacteria 3907
89 Ga0075432_10017049 3300006058 Bacteria 2478
90 Ga0075362_10050359 3300006177 Bacteria 1862
91 Ga0075367_10019130 3300006178 Bacteria 3793
92 Ga0075428_100072504 3300006844 Bacteria 3762
93 Ga0075428_100253453 3300006844 Bacteria 1896
94 Ga0075430_100057373 3300006846 Bacteria 3275
95 Ga0075429_100001471 3300006880 Bacteria 19370
96 Ga0075436_100121368 3300006914 Bacteria 1828
97 Ga0097620_100029000 3300006931 Bacteria 5552
98 Ga0097620_100104782 3300006931 Bacteria 2888
99 Ga0099823_1000078 3300006944 Bacteria 46731
100 Ga0099823_1007403 3300006944 Bacteria 11143
101 Ga0079104_1000189 3300006946 Bacteria 86039
102 Ga0079104_1000262 3300006946 Bacteria 69874
103 Ga0079104_1004139 3300006946 Bacteria 6349
104 Ga0099795_10000428 3300007788 Bacteria 7748
105 Ga0105251_10000563 3300009011 Bacteria 34868
106 Ga0105251_10000804 3300009011 Bacteria 28409
107 Ga0105251_10002253 3300009011 Bacteria 15324
108 Ga0105251_10036865 3300009011 Bacteria 2403
109 Ga0105251_10042713 3300009011 Bacteria 2198
110 Ga0105244_10001174 3300009036 Bacteria 21675
111 Ga0105244_10001715 3300009036 Bacteria 17313
112 Ga0105244_10002614 3300009036 Bacteria 13496
113 Ga0105244_10003548 3300009036 Bacteria 11081
114 Ga0105244_10009928 3300009036 Bacteria 5806
115 Ga0105244_10024038 3300009036 Bacteria 3330
116 Ga0105244_10029508 3300009036 Bacteria 2930
117 Ga0105244_10046058 3300009036 Bacteria 2242
118 Ga0105244_10085814 3300009036 Bacteria 1553
119 Ga0105250_10000247 3300009092 Bacteria 44888
120 Ga0105250_10008837 3300009092 Bacteria 4263
121 Ga0105250_10031362 3300009092 Bacteria 2134
122 Ga0105240_10003928 3300009093 Bacteria 22958
123 Ga0105240_10067731 3300009093 Bacteria 4425
124 Ga0114129_10083587 3300009147 Bacteria 4434
125 Ga0105243_10000018 3300009148 Bacteria 227618
126 Ga0105243_10000342 3300009148 Bacteria 50696
127 Ga0105243_10001040 3300009148 Bacteria 25421
128 Ga0105243_10001458 3300009148 Bacteria 20764
129 Ga0105243_10155666 3300009148 Bacteria 1965
130 Ga0105242_10093478 3300009176 Bacteria 2535
131 Ga0105248_10019301 3300009177 Bacteria 7543
132 Ga0105248_10048390 3300009177 Bacteria 4770
133 Ga0105248_10123729 3300009177 Bacteria 2917
134 Ga0105248_10148476 3300009177 Bacteria 2645
135 Ga0105237_10000399 3300009545 Bacteria 61795
136 Ga0105249_10000396 3300009553 Bacteria 42056
137 Ga0105249_10006749 3300009553 Bacteria 10002
138 Ga0099796_10001771 3300010159 Bacteria 4508
139 Ga0105239_10000300 3300010375 Bacteria 73306
140 Ga0105239_10213075 3300010375 Bacteria 2165
141 Ga0105246_10000129 3300011119 Bacteria 35026
142 Ga0105246_10012643 3300011119 Bacteria 5273
143 Ga0157373_10000120 3300013100 Bacteria 60625
144 Ga0157373_10000293 3300013100 Bacteria 40237
145 Ga0157373_10000532 3300013100 Bacteria 29743
146 Ga0157373_10009920 3300013100 Bacteria 7020
147 Ga0157373_10010052 3300013100 Bacteria 6972
148 Ga0157373_10021214 3300013100 Bacteria 4716
149 Ga0157371_10000027 3300013102 Bacteria 269243
150 Ga0157371_10000432 3300013102 Bacteria 51445
151 Ga0157371_10002564 3300013102 Bacteria 17239
152 Ga0157371_10007217 3300013102 Bacteria 9027
153 Ga0157371_10017512 3300013102 Bacteria 5321
154 Ga0157370_10002182 3300013104 Bacteria 23875
155 Ga0157370_10003977 3300013104 Bacteria 17184
156 Ga0157370_10005172 3300013104 Bacteria 14712
157 Ga0157370_10007656 3300013104 Bacteria 11722
158 Ga0157370_10012632 3300013104 Bacteria 8749
159 Ga0157370_10018935 3300013104 Bacteria 6922
160 Ga0157370_10032962 3300013104 Bacteria 5053
161 Ga0157370_10042481 3300013104 Bacteria 4381
162 Ga0157370_10053571 3300013104 Bacteria 3846
163 Ga0157370_10139796 3300013104 Bacteria 2256
164 Ga0157369_10000053 3300013105 Bacteria 162962
165 Ga0157369_10000523 3300013105 Bacteria 50640
166 Ga0157369_10008306 3300013105 Bacteria 11899
167 Ga0157374_10316738 3300013296 Bacteria 1545
168 Ga0157378_10147270 3300013297 Bacteria 2191
169 Ga0163162_10000706 3300013306 Bacteria 30913
170 Ga0163162_10000911 3300013306 Bacteria 27485
171 Ga0163162_10059327 3300013306 Bacteria 3858
172 Ga0163162_10202188 3300013306 Bacteria 2115
173 Ga0157372_10000601 3300013307 Bacteria 39211
174 Ga0157375_10247366 3300013308 Bacteria 1944
175 Ga0157375_10253832 3300013308 Bacteria 1919
176 Ga0163163_10085926 3300014325 Bacteria 3154
177 Ga0182008_10000021 3300014497 Bacteria 227140
178 Ga0182008_10000124 3300014497 Bacteria 58644
179 Ga0182008_10000221 3300014497 Bacteria 44804
180 Ga0182008_10000618 3300014497 Bacteria 26104
181 Ga0182008_10001981 3300014497 Bacteria 13143
182 Ga0182008_10002959 3300014497 Bacteria 10451
183 Ga0182008_10012276 3300014497 Bacteria 4523
184 Ga0157379_10068488 3300014968 Bacteria 3173
185 Ga0182006_1000126 3300015261 Bacteria 81813
186 Ga0182006_1000294 3300015261 Bacteria 43965
187 Ga0182006_1000314 3300015261 Bacteria 42419
188 Ga0182006_1000575 3300015261 Bacteria 27068
189 Ga0182006_1001146 3300015261 Bacteria 16819
190 Ga0182006_1002381 3300015261 Bacteria 10303
191 Ga0182006_1005380 3300015261 Bacteria 6118
192 Ga0182006_1006053 3300015261 Bacteria 5662
193 Ga0182006_1016356 3300015261 Bacteria 3164
194 Ga0182007_10000005 3300015262 Bacteria 442702
195 Ga0182007_10000178 3300015262 Bacteria 43223
196 Ga0182007_10001957 3300015262 Bacteria 10652
197 Ga0182007_10002566 3300015262 Bacteria 8943
198 Ga0182005_1000274 3300015265 Bacteria 32736
199 Ga0182005_1000939 3300015265 Bacteria 12714
200 Ga0183373_1007 3300015682 Bacteria 282776
201 Ga0183365_10001 3300015684 Bacteria 2090444
202 Ga0163161_10000250 3300017792 Bacteria 47823
203 Ga0163161_10000354 3300017792 Bacteria 38694
204 Ga0163161_10000383 3300017792 Bacteria 37194
205 Ga0163161_10000423 3300017792 Bacteria 35592
206 Ga0163161_10001625 3300017792 Bacteria 16530
207 Ga0163161_10002969 3300017792 Bacteria 12020
208 Ga0163161_10018558 3300017792 Bacteria 4874
209 Ga0163161_10076367 3300017792 Bacteria 2459
210 Ga0163161_10102062 3300017792 Bacteria 2136
211 Ga0213876_10008012 3300021384 Bacteria 5728
212 Ga0209563_100264 3300025230 Bacteria 23048
213 Ga0207425_1000008 3300025245 Bacteria 618024
214 Ga0209026_1001901 3300025250 Bacteria 8480
215 Ga0209129_1000042 3300025258 Bacteria 305537
216 Ga0209565_1000271 3300025263 Bacteria 52663
217 Ga0209673_1001417 3300025273 Bacteria 23080
218 Ga0209675_1001895 3300025291 Bacteria 11278
219 Ga0209675_1004874 3300025291 Bacteria 5806
220 Ga0209676_1000015 3300025292 Bacteria 784458
221 Ga0209676_1000039 3300025292 Bacteria 443158
222 Ga0209676_1000262 3300025292 Bacteria 111061
223 Ga0209676_1000271 3300025292 Bacteria 108269
224 Ga0209676_1000278 3300025292 Bacteria 106516
225 Ga0209676_1000394 3300025292 Bacteria 79789
226 Ga0209676_1000765 3300025292 Bacteria 43254
227 Ga0209025_1000020 3300025294 Bacteria 618024
228 Ga0209564_1001539 3300025295 Bacteria 22846
229 Ga0209564_1031906 3300025295 Bacteria 1598
230 Ga0209758_1000022 3300025297 Bacteria 618024
231 Ga0209758_1003600 3300025297 Bacteria 13861
232 Ga0209758_1006335 3300025297 Bacteria 8575
233 Ga0209758_1006627 3300025297 Bacteria 8204
234 Ga0209050_1000030 3300025298 Bacteria 463381
235 Ga0209050_1000033 3300025298 Bacteria 442615
236 Ga0209050_1000053 3300025298 Bacteria 349521
237 Ga0209050_1000061 3300025298 Bacteria 321435
238 Ga0209050_1000241 3300025298 Bacteria 118446
239 Ga0209050_1001230 3300025298 Bacteria 29705
240 Ga0209051_1000012 3300025303 Bacteria 595474
241 Ga0209051_1000203 3300025303 Bacteria 105272
242 Ga0209051_1000222 3300025303 Bacteria 95911
243 Ga0209051_1000983 3300025303 Bacteria 27625
244 Ga0209257_1000036 3300025304 Bacteria 616006
245 Ga0209257_1000143 3300025304 Bacteria 199975
246 Ga0209257_1000316 3300025304 Bacteria 102171
247 Ga0209257_1000725 3300025304 Bacteria 50294
248 Ga0209257_1005627 3300025304 Bacteria 8676
249 Ga0207696_1000055 3300025711 Bacteria 258289
250 Ga0207696_1000180 3300025711 Bacteria 98909
251 Ga0207696_1000184 3300025711 Bacteria 97606
252 Ga0207696_1001047 3300025711 Bacteria 16395
253 Ga0207696_1001175 3300025711 Bacteria 14931
254 Ga0207655_1000116 3300025728 Bacteria 161950
255 Ga0207655_1000663 3300025728 Bacteria 40591
256 Ga0207655_1000757 3300025728 Bacteria 36205
257 Ga0207655_1001282 3300025728 Bacteria 23875
258 Ga0207655_1003150 3300025728 Bacteria 12465
259 Ga0207655_1003167 3300025728 Bacteria 12418
260 Ga0207655_1004158 3300025728 Bacteria 10388
261 Ga0207655_1004449 3300025728 Bacteria 9935
262 Ga0207655_1006715 3300025728 Bacteria 7577
263 Ga0207655_1028168 3300025728 Bacteria 2655
264 Ga0207713_1000188 3300025735 Bacteria 86627
265 Ga0207713_1000588 3300025735 Bacteria 35973
266 Ga0207713_1000717 3300025735 Bacteria 30979
267 Ga0207713_1001114 3300025735 Bacteria 22942
268 Ga0207713_1001134 3300025735 Bacteria 22613
269 Ga0207713_1004218 3300025735 Bacteria 9407
270 Ga0207713_1005034 3300025735 Bacteria 8401
271 Ga0207713_1010633 3300025735 Bacteria 5074
272 Ga0207713_1013351 3300025735 Bacteria 4334
273 Ga0207713_1014187 3300025735 Bacteria 4155
274 Ga0207705_10000635 3300025909 Bacteria 29374
275 Ga0207707_10211178 3300025912 Bacteria 1690
276 Ga0207695_10001594 3300025913 Bacteria 36848
277 Ga0207695_10003219 3300025913 Bacteria 23241
278 Ga0207695_10037489 3300025913 Bacteria 5231
279 Ga0207695_10064349 3300025913 Bacteria 3777
280 Ga0207671_10001451 3300025914 Bacteria 27374
281 Ga0207660_10008125 3300025917 Bacteria 6790
282 Ga0207657_10014297 3300025919 Bacteria 7754
283 Ga0207652_10005251 3300025921 Bacteria 10522
284 Ga0207681_10000623 3300025923 Bacteria 23667
285 Ga0207681_10045410 3300025923 Bacteria 2950
286 Ga0207694_10043651 3300025924 Bacteria 3460
287 Ga0207650_10000014 3300025925 Bacteria 398063
288 Ga0207650_10033348 3300025925 Bacteria 3729
289 Ga0207650_10040914 3300025925 Bacteria 3394
290 Ga0207650_10059306 3300025925 Bacteria 2852
291 Ga0207650_10072630 3300025925 Bacteria 2589
292 Ga0207644_10002262 3300025931 Bacteria 12493
293 Ga0207644_10003564 3300025931 Bacteria 10072
294 Ga0207644_10086851 3300025931 Bacteria 2323
295 Ga0207690_10000436 3300025932 Bacteria 27136
296 Ga0207690_10042444 3300025932 Bacteria 2987
297 Ga0207706_10000789 3300025933 Bacteria 32761
298 Ga0207709_10000021 3300025935 Bacteria 386722
299 Ga0207709_10000061 3300025935 Bacteria 199097
300 Ga0207709_10000626 3300025935 Bacteria 28978
301 Ga0207704_10008126 3300025938 Bacteria 4997
302 Ga0207711_10000097 3300025941 Bacteria 92721
303 Ga0207711_10020583 3300025941 Bacteria 5505
304 Ga0207711_10037444 3300025941 Bacteria 4120
305 Ga0207711_10080391 3300025941 Bacteria 2847
306 Ga0207689_10144977 3300025942 Bacteria 1956
307 Ga0207667_10232775 3300025949 Bacteria 1886
308 Ga0207712_10014945 3300025961 Bacteria 5000
309 Ga0207712_10178118 3300025961 Bacteria 1667
310 Ga0207668_10000013 3300025972 Bacteria 167989
311 Ga0207668_10000356 3300025972 Bacteria 29433
312 Ga0207668_10005502 3300025972 Bacteria 7465
313 Ga0207668_10009386 3300025972 Bacteria 5861
314 Ga0207668_10040403 3300025972 Bacteria 3147
315 Ga0207658_10000496 3300025986 Bacteria 36165
316 Ga0207658_10003812 3300025986 Bacteria 10615
317 Ga0207658_10030294 3300025986 Bacteria 3830
318 Ga0207658_10034905 3300025986 Bacteria 3598
319 Ga0207658_10185934 3300025986 Bacteria 1723
320 Ga0207703_10000051 3300026035 Bacteria 145390
321 Ga0207703_10000622 3300026035 Bacteria 35788
322 Ga0207639_10001991 3300026041 Bacteria 13753
323 Ga0207639_10061479 3300026041 Bacteria 2901
324 Ga0207641_10000003 3300026088 Bacteria 496984
325 Ga0207641_10001098 3300026088 Bacteria 27186
326 Ga0207641_10022295 3300026088 Bacteria 5212
327 Ga0207641_10158708 3300026088 Bacteria 2054
328 Ga0207676_10000223 3300026095 Bacteria 48952
329 Ga0207676_10004623 3300026095 Bacteria 9747
330 Ga0209281_1000016 3300027111 Bacteria 588107
331 Ga0209281_1000091 3300027111 Bacteria 242588
332 Ga0209281_1002831 3300027111 Bacteria 6358
333 Ga0209389_1000036 3300027296 Bacteria 126146
334 Ga0209371_1001083 3300027312 Bacteria 20355
335 Ga0209981_1001883 3300027378 Bacteria 2672
336 Ga0209999_1000276 3300027543 Bacteria 7584
337 Ga0209983_1012221 3300027665 Bacteria 1762
338 Ga0209813_10024973 3300027866 Bacteria 1714
339 Ga0207428_10008602 3300027907 Bacteria 9216
340 Ga0207428_10024521 3300027907 Bacteria 5065
341 Ga0268266_10000003 3300028379 Bacteria 1701703
342 Ga0268266_10001589 3300028379 Bacteria 26538
343 Ga0268266_10002499 3300028379 Bacteria 19615
344 Ga0268266_10007274 3300028379 Bacteria 10011
345 Ga0268266_10086601 3300028379 Bacteria 2739
346 Ga0268266_10227331 3300028379 Bacteria 1717
347 Ga0268265_10001601 3300028380 Bacteria 18701
348 Ga0268265_10017945 3300028380 Bacteria 4895
349 Ga0268265_10027501 3300028380 Bacteria 4060
350 Ga0268264_10000032 3300028381 Bacteria 408337
351 Ga0268264_10000091 3300028381 Bacteria 233338
352 Ga0268264_10025097 3300028381 Bacteria 4870
353 Ga0268264_10062574 3300028381 Bacteria 3125
354 Ga0307517_10000813 3300028786 Bacteria 53669
355 Ga0307517_10042446 3300028786 Bacteria 4877
356 Ga0307515_10016578 3300028794 Bacteria 13481
357 Ga0307515_10045304 3300028794 Bacteria 6763
358 Ga0307515_10091223 3300028794 Eukaryota 3810
359 Ga0307515_10237139 3300028794 Bacteria 1603
360 Ga0265338_10019460 3300028800 Bacteria 7200
361 Ga0265338_10071089 3300028800 Bacteria 2980
362 Ga0268256_1000912 3300030500 Bacteria 20394
363 Ga0307511_10004234 3300030521 Bacteria 14645
364 Ga0307511_10006554 3300030521 Bacteria 11724
365 Ga0316177_1188425 3300030731 Bacteria 4905
366 Ga0314311_1083059 3300030733 Bacteria 3972
367 Ga0316179_1077856 3300030734 Bacteria 4847
368 Ga0316178_1088395 3300030735 Bacteria 18494
369 Ga0316183_1020455 3300030742 Bacteria 3407
370 Ga0265327_10000279 3300031251 Bacteria 100885
371 Ga0265327_10001583 3300031251 Bacteria 27733
372 Ga0265327_10010720 3300031251 Bacteria 6402
373 Ga0307513_10000100 3300031456 Bacteria 125183
374 Ga0307513_10001018 3300031456 Bacteria 40592
375 Ga0307513_10010930 3300031456 Bacteria 11331
376 Ga0307408_100000392 3300031548 Bacteria 39845
377 Ga0307408_100000577 3300031548 Bacteria 31560
378 Ga0307408_100001053 3300031548 Bacteria 21203
379 Ga0307408_100024490 3300031548 Bacteria 4123
380 Ga0307508_10060650 3300031616 Eukaryota 3344
381 Ga0265314_10037617 3300031711 Bacteria 3505
382 Ga0316576_10000732 3300031727 Bacteria 16270
383 Ga0316576_10072253 3300031727 Bacteria 2546
384 Ga0307516_10000035 3300031730 Bacteria 152658
385 Ga0307516_10088059 3300031730 Eukaryota 2938
386 Ga0307405_10000068 3300031731 Bacteria 47793
387 Ga0307405_10000093 3300031731 Bacteria 38072
388 Ga0307405_10000145 3300031731 Bacteria 27341
389 Ga0316577_10104768 3300031733 Bacteria 1587
390 Ga0307406_10099489 3300031901 Bacteria 1977
391 Ga0307407_10000001 3300031903 Bacteria 570048
392 Ga0307407_10051910 3300031903 Bacteria 2352
393 Ga0307412_10000111 3300031911 Bacteria 64380
394 Ga0307412_10000174 3300031911 Bacteria 45787
395 Ga0307412_10000276 3300031911 Bacteria 32692
396 Ga0307412_10001934 3300031911 Bacteria 11451
397 Ga0307409_100008503 3300031995 Bacteria 6235
398 Ga0307409_100036835 3300031995 Bacteria 3600
399 Ga0307416_100000008 3300032002 Bacteria 401343
400 Ga0307416_100153283 3300032002 Bacteria 2117
401 Ga0307414_10000545 3300032004 Bacteria 19649
402 Ga0307414_10001843 3300032004 Bacteria 10962
403 Ga0307414_10007790 3300032004 Bacteria 6039
404 Ga0307414_10010561 3300032004 Bacteria 5367
405 Ga0307414_10128683 3300032004 Bacteria 1961
406 Ga0307414_10171651 3300032004 Bacteria 1734
407 Ga0307414_10175544 3300032004 Bacteria 1718
408 Ga0307411_10000213 3300032005 Bacteria 18720
409 Ga0307411_10049124 3300032005 Bacteria 2739
410 Ga0307411_10053341 3300032005 Bacteria 2648
411 Ga0307411_10076046 3300032005 Bacteria 2294
412 Ga0307411_10124112 3300032005 Bacteria 1874
413 Ga0307510_10000511 3300033180 Bacteria 38517
414 Ga0307510_10009689 3300033180 Bacteria 11466
415 Ga0373936_0001691 3300035113 Bacteria 8091
416 Ga0373931_0047063 3300035691 Bacteria 2282
417 Ga0373927_0001662 3300035695 Bacteria 16633
418 Ga0373925_0000135 3300037068 Bacteria 78245
419 Ga0373925_0195136 3300037068 Bacteria 1608
420 Ga0395899_0000190 3300037312 Bacteria 90356
421 Ga0395900_0000002 3300037418 Bacteria 671103
422 Ga0395900_0016355 3300037418 Bacteria 7561
423 Ga0395900_0075889 3300037418 Bacteria 3455
424 Ga0395898_0007454 3300037466 Bacteria 11614
425 Ga0395905_0000022 3300037471 Bacteria 321527
426 Ga0395905_0114519 3300037471 Bacteria 2533
427 Ga0395905_0215346 3300037471 Bacteria 1799
428 Ga0436364_0480205 3300037853 Bacteria 1816
429 Ga0436364_1502320 3300037853 Bacteria 3488
430 Ga0395901_0000013 3300038443 Bacteria 375733
431 Ga0395901_0000818 3300038443 Bacteria 34480
432 Ga0400489_72461 3300039093 Bacteria 14955
433 Ga0436365_0142198 3300039437 Bacteria 6142
434 Ga0436365_1887405 3300039437 Bacteria 5238
435 Ga0439438_000038 3300041405 Bacteria 66849
436 Ga0439438_000124 3300041405 Bacteria 34621
437 Ga0439438_000135 3300041405 Bacteria 33398
438 Ga0439438_000164 3300041405 Bacteria 30315
439 Ga0439438_000187 3300041405 Bacteria 27807
440 Ga0439438_000193 3300041405 Bacteria 27601
441 Ga0439438_000435 3300041405 Bacteria 18989
442 Ga0439438_000590 3300041405 Bacteria 16435
443 Ga0439438_000845 3300041405 Bacteria 13679
444 Ga0439447_000072 3300041407 Bacteria 35889
445 Ga0439447_000756 3300041407 Bacteria 11964
446 Ga0439447_002193 3300041407 Bacteria 7156
447 Ga0439447_005949 3300041407 Bacteria 4004
448 Ga0439447_006114 3300041407 Bacteria 3935
449 Ga0439461_0007173 3300041410 Bacteria 1965
450 Ga0439466_0000252 3300041411 Bacteria 21095
451 Ga0439466_0000286 3300041411 Bacteria 19701
452 Ga0439466_0000307 3300041411 Bacteria 18939
453 Ga0439466_0000743 3300041411 Bacteria 12349
454 Ga0439466_0000755 3300041411 Bacteria 12230
455 Ga0439466_0002964 3300041411 Bacteria 6630
456 Ga0439466_0003416 3300041411 Bacteria 6159
457 Ga0439466_0004150 3300041411 Bacteria 5594
458 Ga0439431_0000017 3300041997 Bacteria 26613
459 Ga0439437_000770 3300042000 Bacteria 3264
460 Ga0439432_000225 3300042006 Bacteria 20312
461 Ga0439432_000445 3300042006 Bacteria 15343
462 Ga0439432_001399 3300042006 Bacteria 9088
463 Ga0439432_001442 3300042006 Bacteria 8927
464 Ga0439432_009625 3300042006 Bacteria 3367
465 Ga0439451_000168 3300042009 Bacteria 12269
466 Ga0439451_000489 3300042009 Bacteria 7647
467 Ga0439452_000203 3300042010 Bacteria 43038
468 Ga0439452_000223 3300042010 Bacteria 40174
469 Ga0439452_000807 3300042010 Bacteria 14730
470 Ga0439452_000948 3300042010 Bacteria 13028
471 Ga0439452_001571 3300042010 Bacteria 9102
472 Ga0439452_001857 3300042010 Bacteria 8162
473 Ga0439452_005119 3300042010 Bacteria 4268
474 Ga0439456_000151 3300042013 Bacteria 20588
475 Ga0439456_002313 3300042013 Bacteria 3836
476 Ga0439463_000021 3300042016 Bacteria 33563
477 Ga0439463_000587 3300042016 Bacteria 10132
478 Ga0450911_000015 3300042115 Bacteria 109635
479 Ga0450911_000047 3300042115 Bacteria 52286
480 Ga0450911_000099 3300042115 Bacteria 34952
481 Ga0450911_001198 3300042115 Bacteria 6321
482 Ga0450911_002247 3300042115 Bacteria 3889
483 Ga0450919_000040 3300042121 Bacteria 10739
484 Ga0450919_000424 3300042121 Bacteria 5221
485 Ga0450920_000070 3300042122 Bacteria 13219
486 Ga0450922_000706 3300042124 Bacteria 3460
487 Ga0450890_000059 3300042127 Bacteria 21519
488 Ga0450900_001145 3300042136 Bacteria 2478
489 Ga0450900_002198 3300042136 Bacteria 2036
490 Ga0450902_000397 3300042137 Bacteria 5306
491 Ga0450902_002110 3300042137 Bacteria 2794
492 Ga0450903_001300 3300042138 Bacteria 4669
493 Ga0450903_002313 3300042138 Bacteria 3399
494 Ga0450904_000463 3300042139 Bacteria 8038
495 Ga0450904_001129 3300042139 Bacteria 4065
496 Ga0450904_001319 3300042139 Bacteria 3626
497 Ga0450907_000052 3300042146 Bacteria 48960
498 Ga0450907_001268 3300042146 Bacteria 5646
499 Ga0450910_003554 3300042147 Bacteria 2071
500 Ga0439446_0004360 3300042156 Bacteria 3585
501 Ga0439446_0009644 3300042156 Bacteria 2588
502 Ga0439446_0015692 3300042156 Bacteria 2102
503 Ga0450909_000317 3300042185 Bacteria 6003
504 Ga0439434_0000007 3300042435 Bacteria 53582
505 Ga0439459_0001726 3300042438 Bacteria 3267
506 Ga0439464_0000752 3300042439 Bacteria 7027
507 Ga0439460_0001597 3300042461 Bacteria 5364
508 Ga0439460_0003567 3300042461 Bacteria 3760
509 Ga0450916_002837 3300042530 Bacteria 1870
510 Ga0450893_0002447 3300042532 Bacteria 2894
511 Ga0450901_000107 3300042533 Bacteria 9070
512 Ga0450901_000206 3300042533 Bacteria 7004
513 Ga0439440_0000124 3300042993 Bacteria 10784
514 Ga0495617_000124 3300046452 Bacteria 50836
515 Ga0495617_000195 3300046452 Bacteria 38179
516 Ga0495617_008099 3300046452 Bacteria 3631
517 Ga0495617_012204 3300046452 Bacteria 2926
518 Ga0495617_015826 3300046452 Bacteria 2552
519 Ga0495617_016694 3300046452 Bacteria 2482
520 Ga0495627_000115 3300046453 Bacteria 99960
521 Ga0495627_000264 3300046453 Bacteria 53754
522 Ga0495627_000819 3300046453 Bacteria 22665
523 Ga0495627_000959 3300046453 Bacteria 19773
524 Ga0495627_001215 3300046453 Bacteria 16137
525 Ga0495627_001340 3300046453 Bacteria 14890
526 Ga0495627_023595 3300046453 Bacteria 2013
527 Ga0495627_024215 3300046453 Bacteria 1981
528 Ga0495603_0001230 3300046455 Bacteria 14938
529 Ga0495590_0000164 3300046457 Bacteria 39780
530 Ga0495590_0000245 3300046457 Bacteria 29532
531 Ga0495590_0000277 3300046457 Bacteria 27644
532 Ga0495590_0001187 3300046457 Bacteria 11395
533 Ga0495591_000061 3300046458 Bacteria 126594
534 Ga0495591_000145 3300046458 Bacteria 75506
535 Ga0495591_000193 3300046458 Bacteria 62184
536 Ga0495591_000308 3300046458 Bacteria 44417
537 Ga0495591_000320 3300046458 Bacteria 43508
538 Ga0495591_000378 3300046458 Bacteria 37922
539 Ga0495591_000416 3300046458 Bacteria 35344
540 Ga0495591_000492 3300046458 Bacteria 31278
541 Ga0495591_001463 3300046458 Bacteria 14616
542 Ga0495591_001496 3300046458 Bacteria 14424
543 Ga0495591_001759 3300046458 Bacteria 12874
544 Ga0495591_005196 3300046458 Bacteria 6096
545 Ga0495591_009354 3300046458 Bacteria 3904
546 Ga0495591_012747 3300046458 Bacteria 3112
547 Ga0495591_018420 3300046458 Bacteria 2369
548 Ga0495629_0014320 3300046459 Bacteria 5707
549 Ga0495638_0000439 3300046460 Bacteria 50194
550 Ga0495638_0000691 3300046460 Bacteria 36584
551 Ga0495638_0000855 3300046460 Bacteria 31732
552 Ga0495638_0000888 3300046460 Bacteria 30663
553 Ga0495638_0001080 3300046460 Bacteria 26579
554 Ga0495638_0001845 3300046460 Bacteria 18343
555 Ga0495638_0003267 3300046460 Bacteria 12794
556 Ga0495638_0003596 3300046460 Bacteria 12134
557 Ga0495638_0003906 3300046460 Bacteria 11530
558 Ga0495638_0025657 3300046460 Bacteria 3827
559 Ga0495638_0026560 3300046460 Bacteria 3751
560 Ga0495638_0104063 3300046460 Bacteria 1693
561 Ga0495653_0000469 3300046463 Bacteria 31224
562 Ga0495653_0005088 3300046463 Bacteria 10668
563 Ga0495653_0005152 3300046463 Bacteria 10617
564 Ga0495653_0081855 3300046463 Bacteria 2384
565 Ga0495650_0000046 3300046471 Bacteria 342987
566 Ga0495650_0000660 3300046471 Bacteria 45141
567 Ga0495650_0000925 3300046471 Bacteria 34422
568 Ga0495650_0000973 3300046471 Bacteria 32770
569 Ga0495650_0001175 3300046471 Bacteria 27832
570 Ga0495650_0001399 3300046471 Bacteria 23608
571 Ga0495650_0002044 3300046471 Bacteria 17617
572 Ga0495650_0003695 3300046471 Bacteria 10957
573 Ga0495650_0008614 3300046471 Bacteria 5917
574 Ga0495650_0009427 3300046471 Bacteria 5550
575 Ga0495650_0013097 3300046471 Bacteria 4411
576 Ga0495650_0045103 3300046471 Bacteria 1858
577 Ga0495650_0056989 3300046471 Bacteria 1583
578 Ga0495605_0000079 3300046474 Bacteria 126756
579 Ga0495605_0000216 3300046474 Bacteria 71077
580 Ga0495605_0000289 3300046474 Bacteria 55572
581 Ga0495605_0000371 3300046474 Bacteria 42507
582 Ga0495605_0000396 3300046474 Bacteria 40204
583 Ga0495605_0000513 3300046474 Bacteria 33142
584 Ga0495605_0000713 3300046474 Bacteria 24544
585 Ga0495605_0000947 3300046474 Bacteria 19783
586 Ga0495605_0001356 3300046474 Bacteria 16176
587 Ga0495605_0002382 3300046474 Bacteria 11668
588 Ga0495605_0004530 3300046474 Bacteria 8137
589 Ga0495605_0007446 3300046474 Bacteria 6212
590 Ga0495605_0013610 3300046474 Bacteria 4477
591 Ga0495605_0028433 3300046474 Bacteria 2885
592 Ga0495605_0037758 3300046474 Bacteria 2427
593 Ga0495639_0000023 3300046475 Bacteria 70927
594 Ga0495639_0038462 3300046475 Bacteria 2149
595 Ga0495584_0000266 3300046491 Bacteria 37081
596 Ga0495584_0000545 3300046491 Bacteria 25529
597 Ga0495584_0000649 3300046491 Bacteria 23190
598 Ga0495584_0000897 3300046491 Bacteria 19082
599 Ga0495584_0000927 3300046491 Bacteria 18574
600 Ga0495584_0002684 3300046491 Bacteria 10008
601 Ga0495584_0003012 3300046491 Bacteria 9341
602 Ga0495584_0007021 3300046491 Bacteria 5881
603 Ga0495584_0007324 3300046491 Bacteria 5753
604 Ga0495584_0007886 3300046491 Bacteria 5537
605 Ga0495585_0000378 3300046492 Bacteria 42672
606 Ga0495585_0000527 3300046492 Bacteria 36115
607 Ga0495585_0000960 3300046492 Bacteria 24197
608 Ga0495585_0002142 3300046492 Bacteria 14401
609 Ga0495585_0006399 3300046492 Bacteria 7313
610 Ga0495585_0006739 3300046492 Bacteria 7087
611 Ga0495585_0011527 3300046492 Bacteria 5231
612 Ga0495585_0011975 3300046492 Bacteria 5119
613 Ga0495585_0024080 3300046492 Bacteria 3492
614 Ga0495594_0002415 3300046499 Bacteria 9727
615 Ga0495594_0009411 3300046499 Bacteria 5046
616 Ga0495596_0001041 3300046500 Bacteria 16467
617 Ga0495596_0002933 3300046500 Bacteria 8848
618 Ga0495596_0005845 3300046500 Bacteria 5756
619 Ga0495607_0000205 3300046501 Bacteria 62835
620 Ga0495607_0000257 3300046501 Bacteria 57042
621 Ga0495607_0000261 3300046501 Bacteria 56378
622 Ga0495607_0000387 3300046501 Bacteria 45024
623 Ga0495607_0000418 3300046501 Bacteria 43301
624 Ga0495607_0000500 3300046501 Bacteria 39193
625 Ga0495607_0000971 3300046501 Bacteria 26549
626 Ga0495607_0001646 3300046501 Bacteria 19369
627 Ga0495607_0001931 3300046501 Bacteria 17498
628 Ga0495607_0012366 3300046501 Bacteria 5640
629 Ga0495607_0014215 3300046501 Bacteria 5191
630 Ga0495607_0015164 3300046501 Bacteria 5003
631 Ga0495607_0018021 3300046501 Bacteria 4514
632 Ga0495607_0019562 3300046501 Bacteria 4298
633 Ga0495607_0029876 3300046501 Bacteria 3353
634 Ga0495607_0045064 3300046501 Bacteria 2596
635 Ga0495607_0045944 3300046501 Bacteria 2566
636 Ga0495583_0000025 3300046506 Bacteria 263775
637 Ga0495583_0000362 3300046506 Bacteria 71060
638 Ga0495583_0001149 3300046506 Bacteria 28807
639 Ga0495583_0001157 3300046506 Bacteria 28727
640 Ga0495583_0001337 3300046506 Bacteria 25529
641 Ga0495583_0001967 3300046506 Bacteria 18861
642 Ga0495583_0002347 3300046506 Bacteria 16392
643 Ga0495583_0003316 3300046506 Bacteria 12475
644 Ga0495583_0004139 3300046506 Bacteria 10621
645 Ga0495583_0012584 3300046506 Bacteria 4777
646 Ga0495606_0000139 3300046507 Bacteria 124493
647 Ga0495606_0000183 3300046507 Bacteria 110912
648 Ga0495606_0000370 3300046507 Bacteria 76903
649 Ga0495606_0000502 3300046507 Bacteria 63679
650 Ga0495606_0000998 3300046507 Bacteria 41251
651 Ga0495606_0001377 3300046507 Bacteria 32881
652 Ga0495606_0001519 3300046507 Bacteria 30741
653 Ga0495606_0001914 3300046507 Bacteria 25891
654 Ga0495606_0009725 3300046507 Bacteria 8090
655 Ga0495606_0016288 3300046507 Bacteria 5676
656 Ga0495606_0019137 3300046507 Bacteria 5105
657 Ga0495606_0026813 3300046507 Bacteria 4098
658 Ga0495606_0032929 3300046507 Bacteria 3583
659 Ga0495606_0049009 3300046507 Bacteria 2773
660 Ga0495610_0000039 3300046512 Bacteria 166799
661 Ga0495610_0000651 3300046512 Bacteria 33926
662 Ga0495610_0000853 3300046512 Bacteria 28430
663 Ga0495610_0001032 3300046512 Bacteria 25585
664 Ga0495610_0001081 3300046512 Bacteria 24944
665 Ga0495610_0001825 3300046512 Bacteria 18509
666 Ga0495610_0001923 3300046512 Bacteria 17920
667 Ga0495610_0002405 3300046512 Bacteria 15759
668 Ga0495610_0002515 3300046512 Bacteria 15310
669 Ga0495610_0002636 3300046512 Bacteria 14838
670 Ga0495610_0004985 3300046512 Bacteria 9617
671 Ga0495610_0005870 3300046512 Bacteria 8618
672 Ga0495610_0008944 3300046512 Bacteria 6406
673 Ga0495610_0011516 3300046512 Bacteria 5402
674 Ga0495610_0012313 3300046512 Bacteria 5158
675 Ga0495610_0027297 3300046512 Bacteria 3036
676 Ga0495610_0035251 3300046512 Bacteria 2571
677 Ga0495616_0000369 3300046513 Bacteria 35160
678 Ga0495616_0000710 3300046513 Bacteria 24702
679 Ga0495616_0000804 3300046513 Bacteria 22964
680 Ga0495616_0001884 3300046513 Bacteria 14169
681 Ga0495616_0001915 3300046513 Bacteria 14004
682 Ga0495616_0004468 3300046513 Bacteria 8805
683 Ga0495616_0011526 3300046513 Bacteria 5059
684 Ga0495616_0017627 3300046513 Bacteria 3935
685 Ga0495616_0020047 3300046513 Bacteria 3643
686 Ga0495620_0000044 3300046515 Bacteria 110431
687 Ga0495620_0000309 3300046515 Bacteria 34860
688 Ga0495620_0000339 3300046515 Bacteria 32584
689 Ga0495620_0000697 3300046515 Bacteria 20776
690 Ga0495620_0001785 3300046515 Bacteria 12649
691 Ga0495620_0002152 3300046515 Bacteria 11450
692 Ga0495620_0004815 3300046515 Bacteria 7586
693 Ga0495620_0004891 3300046515 Bacteria 7522
694 Ga0495620_0010382 3300046515 Bacteria 4914
695 Ga0495620_0020372 3300046515 Bacteria 3239
696 Ga0495620_0034212 3300046515 Bacteria 2298
697 Ga0495630_0051144 3300046517 Bacteria 3092
698 Ga0495631_0000056 3300046518 Bacteria 69858
699 Ga0495631_0000194 3300046518 Bacteria 41639
700 Ga0495631_0001167 3300046518 Bacteria 16242
701 Ga0495631_0006327 3300046518 Bacteria 6126
702 Ga0495631_0024274 3300046518 Bacteria 2799
703 Ga0495631_0030843 3300046518 Bacteria 2430
704 Ga0495632_0000232 3300046519 Bacteria 55806
705 Ga0495632_0000326 3300046519 Bacteria 45910
706 Ga0495632_0000454 3300046519 Bacteria 39007
707 Ga0495632_0000687 3300046519 Bacteria 30881
708 Ga0495632_0000706 3300046519 Bacteria 30404
709 Ga0495632_0001261 3300046519 Bacteria 21462
710 Ga0495632_0002296 3300046519 Bacteria 14732
711 Ga0495632_0002424 3300046519 Bacteria 14197
712 Ga0495632_0002965 3300046519 Bacteria 12436
713 Ga0495632_0007602 3300046519 Bacteria 6780
714 Ga0495632_0010030 3300046519 Bacteria 5646
715 Ga0495632_0011019 3300046519 Bacteria 5300
716 Ga0495632_0013447 3300046519 Bacteria 4670
717 Ga0495637_0000066 3300046520 Bacteria 89139
718 Ga0495637_0000157 3300046520 Bacteria 52481
719 Ga0495637_0000182 3300046520 Bacteria 48881
720 Ga0495637_0000299 3300046520 Bacteria 38328
721 Ga0495637_0000321 3300046520 Bacteria 37240
722 Ga0495637_0000352 3300046520 Bacteria 35099
723 Ga0495637_0000636 3300046520 Bacteria 24606
724 Ga0495637_0001138 3300046520 Bacteria 16284
725 Ga0495637_0001715 3300046520 Bacteria 12612
726 Ga0495637_0001767 3300046520 Bacteria 12380
727 Ga0495637_0001839 3300046520 Bacteria 12132
728 Ga0495637_0002376 3300046520 Bacteria 10432
729 Ga0495637_0003988 3300046520 Bacteria 7708
730 Ga0495637_0004625 3300046520 Bacteria 7108
731 Ga0495637_0004913 3300046520 Bacteria 6884
732 Ga0495637_0004997 3300046520 Bacteria 6820
733 Ga0495637_0017538 3300046520 Bacteria 3333
734 Ga0495637_0021481 3300046520 Bacteria 2958
735 Ga0495643_0000511 3300046522 Bacteria 48399
736 Ga0495643_0001141 3300046522 Bacteria 26050
737 Ga0495643_0001412 3300046522 Bacteria 22267
738 Ga0495643_0001456 3300046522 Bacteria 21736
739 Ga0495643_0002071 3300046522 Bacteria 16605
740 Ga0495643_0003868 3300046522 Bacteria 10775
741 Ga0495643_0004320 3300046522 Bacteria 9998
742 Ga0495643_0005627 3300046522 Bacteria 8405
743 Ga0495643_0027578 3300046522 Bacteria 3190
744 Ga0495643_0030835 3300046522 Bacteria 2989
745 Ga0495643_0035143 3300046522 Bacteria 2760
746 Ga0495643_0036129 3300046522 Bacteria 2716
747 Ga0495643_0101086 3300046522 Bacteria 1477
748 Ga0495644_0000162 3300046523 Bacteria 31648
749 Ga0495644_0001352 3300046523 Bacteria 10019
750 Ga0495644_0006755 3300046523 Bacteria 4442
751 Ga0495644_0046355 3300046523 Bacteria 1634
752 Ga0495648_0000458 3300046524 Bacteria 44202
753 Ga0495648_0000579 3300046524 Bacteria 39158
754 Ga0495648_0000861 3300046524 Bacteria 31965
755 Ga0495648_0001229 3300046524 Bacteria 25613
756 Ga0495648_0001234 3300046524 Bacteria 25570
757 Ga0495648_0001592 3300046524 Bacteria 22118
758 Ga0495648_0001787 3300046524 Bacteria 20689
759 Ga0495648_0002076 3300046524 Bacteria 18967
760 Ga0495648_0002912 3300046524 Bacteria 15378
761 Ga0495648_0007972 3300046524 Bacteria 8401
762 Ga0495648_0008412 3300046524 Bacteria 8123
763 Ga0495648_0030491 3300046524 Bacteria 3564
764 Ga0495648_0033109 3300046524 Bacteria 3380
765 Ga0495648_0065775 3300046524 Bacteria 2129
766 Ga0495666_0000115 3300046526 Bacteria 33493
767 Ga0495666_0000747 3300046526 Bacteria 14962
768 Ga0495666_0054986 3300046526 Bacteria 1908
769 Ga0495642_0000099 3300046528 Bacteria 48774
770 Ga0495642_0000113 3300046528 Bacteria 45816
771 Ga0495642_0000475 3300046528 Bacteria 20778
772 Ga0495642_0005554 3300046528 Bacteria 4847
773 Ga0495654_0000023 3300046530 Bacteria 243798
774 Ga0495654_0000317 3300046530 Bacteria 42247
775 Ga0495654_0000372 3300046530 Bacteria 38835
776 Ga0495654_0000634 3300046530 Bacteria 27724
777 Ga0495654_0000812 3300046530 Bacteria 23872
778 Ga0495654_0001289 3300046530 Bacteria 17584
779 Ga0495654_0006529 3300046530 Bacteria 6612
780 Ga0495654_0010162 3300046530 Bacteria 5130
781 Ga0495654_0019537 3300046530 Bacteria 3543
782 Ga0495654_0029529 3300046530 Bacteria 2795
783 Ga0495587_0000633 3300046536 Bacteria 23672
784 Ga0495609_0000098 3300046538 Bacteria 103106
785 Ga0495609_0000146 3300046538 Bacteria 73679
786 Ga0495609_0000284 3300046538 Bacteria 46858
787 Ga0495609_0000586 3300046538 Bacteria 28579
788 Ga0495609_0001382 3300046538 Bacteria 16307
789 Ga0495609_0001745 3300046538 Bacteria 13992
790 Ga0495609_0002905 3300046538 Bacteria 10215
791 Ga0495609_0005167 3300046538 Bacteria 6948
792 Ga0495609_0013617 3300046538 Bacteria 3839
793 Ga0495609_0015575 3300046538 Bacteria 3557
794 Ga0495621_0002949 3300046539 Bacteria 4638
795 Ga0495597_0000370 3300046542 Bacteria 39500
796 Ga0495597_0000463 3300046542 Bacteria 34575
797 Ga0495597_0000835 3300046542 Bacteria 24216
798 Ga0495597_0001344 3300046542 Bacteria 17848
799 Ga0495597_0001523 3300046542 Bacteria 16483
800 Ga0495597_0004039 3300046542 Bacteria 8221
801 Ga0495597_0006719 3300046542 Bacteria 5922
802 Ga0495597_0010873 3300046542 Bacteria 4428
803 Ga0495597_0061872 3300046542 Bacteria 1629
804 Ga0495622_0000135 3300046557 Bacteria 63001
805 Ga0495622_0000509 3300046557 Bacteria 24092
806 Ga0495622_0000510 3300046557 Bacteria 24004
807 Ga0495622_0000663 3300046557 Bacteria 19486
808 Ga0495622_0003901 3300046557 Bacteria 6966
809 Ga0495622_0007183 3300046557 Bacteria 5175
810 Ga0495622_0010014 3300046557 Bacteria 4385
811 Ga0495633_0000201 3300046558 Bacteria 76414
812 Ga0495633_0000604 3300046558 Bacteria 34384
813 Ga0495633_0022257 3300046558 Bacteria 3158
814 Ga0495668_0000124 3300046616 Bacteria 114685
815 Ga0495668_0000839 3300046616 Bacteria 34821
816 Ga0495668_0001586 3300046616 Bacteria 21432
817 Ga0495668_0005704 3300046616 Bacteria 8335
818 Ga0495668_0010627 3300046616 Bacteria 5562
819 Ga0495668_0012984 3300046616 Bacteria 4930
820 Ga0495668_0025133 3300046616 Bacteria 3386
821 Ga0495668_0033179 3300046616 Bacteria 2901
822 Ga0495668_0051410 3300046616 Bacteria 2281
823 Ga0495668_0080853 3300046616 Bacteria 1783
824 Ga0495634_0000515 3300046642 Bacteria 37813
825 Ga0495634_0053184 3300046642 Bacteria 2713
826 Ga0495611_0000098 3300046648 Bacteria 60447
827 Ga0495611_0001294 3300046648 Bacteria 12767
828 Ga0495611_0003777 3300046648 Bacteria 6613
829 Ga0495611_0009730 3300046648 Bacteria 4064
830 Ga0495625_0000113 3300046660 Bacteria 124185
831 Ga0495625_0000233 3300046660 Bacteria 86941
832 Ga0495625_0001741 3300046660 Bacteria 25172
833 Ga0495625_0001802 3300046660 Bacteria 24616
834 Ga0495625_0003561 3300046660 Bacteria 15359
835 Ga0495625_0004643 3300046660 Bacteria 12900
836 Ga0495625_0005991 3300046660 Bacteria 10923
837 Ga0495625_0013267 3300046660 Bacteria 6628
838 Ga0495625_0019585 3300046660 Bacteria 5243
839 Ga0495625_0024470 3300046660 Bacteria 4594
840 Ga0495625_0030260 3300046660 Bacteria 4041
841 Ga0495625_0034269 3300046660 Bacteria 3748
842 Ga0495625_0057929 3300046660 Bacteria 2753
843 Ga0495625_0130615 3300046660 Bacteria 1701
844 Ga0495635_0000201 3300046663 Bacteria 37681
845 Ga0495659_0000090 3300046664 Bacteria 40033
846 Ga0495659_0000748 3300046664 Bacteria 11655
847 Ga0495661_0000112 3300046665 Bacteria 96840
848 Ga0495661_0000241 3300046665 Bacteria 63218
849 Ga0495661_0000664 3300046665 Bacteria 34477
850 Ga0495661_0012834 3300046665 Bacteria 5649
851 Ga0495661_0017385 3300046665 Bacteria 4750
852 Ga0495661_0022550 3300046665 Bacteria 4096
853 Ga0495661_0062805 3300046665 Bacteria 2198
854 Ga0495661_0066026 3300046665 Bacteria 2130
855 Ga0495588_0009616 3300046674 Bacteria 4474
856 Ga0495623_0000934 3300046679 Bacteria 19705
857 Ga0495646_0020411 3300046680 Bacteria 4191
858 Ga0495669_0000006 3300046684 Bacteria 190838
859 Ga0495669_0000059 3300046684 Bacteria 76021
860 Ga0495669_0011267 3300046684 Bacteria 3794
861 Ga0495613_0001426 3300046689 Bacteria 18226
862 Ga0495613_0001679 3300046689 Bacteria 16853
863 Ga0495624_0000569 3300046690 Bacteria 28994
864 Ga0495670_0000097 3300046691 Bacteria 37989
865 Ga0495670_0000648 3300046691 Bacteria 16588
866 Ga0495670_0057893 3300046691 Bacteria 1946
867 Ga0495670_0061605 3300046691 Bacteria 1886
868 Ga0495671_0000236 3300046692 Bacteria 47535
869 Ga0495671_0000258 3300046692 Bacteria 44869
870 Ga0495671_0000608 3300046692 Bacteria 26319
871 Ga0495671_0000638 3300046692 Bacteria 25506
872 Ga0495671_0000772 3300046692 Bacteria 22993
873 Ga0495671_0001109 3300046692 Bacteria 18613
874 Ga0495671_0003855 3300046692 Bacteria 9115
875 Ga0495671_0005369 3300046692 Bacteria 7516
876 Ga0495671_0015478 3300046692 Bacteria 4086
877 Ga0495671_0016496 3300046692 Bacteria 3943
878 Ga0495671_0016846 3300046692 Bacteria 3895
879 Ga0495671_0025424 3300046692 Bacteria 3077
880 Ga0495671_0038887 3300046692 Bacteria 2403
881 Ga0495649_0000323 3300046694 Bacteria 41599
882 Ga0495649_0000520 3300046694 Bacteria 32804
883 Ga0495649_0000681 3300046694 Bacteria 27689
884 Ga0495649_0000855 3300046694 Bacteria 24486
885 Ga0495649_0000907 3300046694 Bacteria 23469
886 Ga0495649_0003025 3300046694 Bacteria 11538
887 Ga0495649_0003884 3300046694 Bacteria 9885
888 Ga0495649_0004684 3300046694 Bacteria 8880
889 Ga0495649_0009149 3300046694 Bacteria 5905
890 Ga0495649_0017849 3300046694 Bacteria 4000
891 Ga0495649_0024300 3300046694 Bacteria 3379
892 Ga0495649_0025253 3300046694 Bacteria 3309
893 Ga0495649_0094356 3300046694 Bacteria 1592
894 Ga0495589_0000181 3300046794 Bacteria 55674
895 Ga0495589_0000229 3300046794 Bacteria 47221
896 Ga0495589_0000264 3300046794 Bacteria 42879
897 Ga0495589_0001225 3300046794 Bacteria 15211
898 Ga0495589_0001632 3300046794 Bacteria 12857
899 Ga0495589_0006544 3300046794 Bacteria 6142
900 Ga0495589_0013513 3300046794 Bacteria 4211
901 Ga0495589_0043896 3300046794 Bacteria 2224
902 Ga0495589_0067430 3300046794 Bacteria 1751
903 Ga0495589_0082973 3300046794 Bacteria 1558
904 Ga0495600_0005745 3300046809 Bacteria 7495
905 Ga0495660_0000087 3300046810 Bacteria 98971
906 Ga0495660_0000503 3300046810 Bacteria 32308
907 Ga0495660_0000759 3300046810 Bacteria 24375
908 Ga0495660_0000900 3300046810 Bacteria 21994
909 Ga0495660_0001220 3300046810 Bacteria 17955
910 Ga0495660_0001832 3300046810 Bacteria 13952
911 Ga0495660_0002315 3300046810 Bacteria 12216
912 Ga0495660_0002520 3300046810 Bacteria 11679
913 Ga0495660_0003376 3300046810 Bacteria 9895
914 Ga0495660_0003897 3300046810 Bacteria 9116
915 Ga0495660_0011847 3300046810 Bacteria 5057
916 Ga0495660_0015031 3300046810 Bacteria 4473
917 Ga0495660_0030887 3300046810 Bacteria 3015
918 Ga0495660_0043171 3300046810 Bacteria 2488
919 Ga0495581_0000509 3300047315 Bacteria 19922
920 Ga0495604_0004138 3300047317 Bacteria 11520
921 Ga0495636_0003161 3300047318 Bacteria 6383
922 Ga0495672_0000552 3300047320 Bacteria 42541
923 Ga0495672_0001272 3300047320 Bacteria 25235
924 Ga0495672_0001805 3300047320 Bacteria 20516
925 Ga0495672_0002163 3300047320 Bacteria 18334
926 Ga0495672_0002310 3300047320 Bacteria 17687
927 Ga0495672_0002618 3300047320 Bacteria 16278
928 Ga0495672_0004053 3300047320 Bacteria 12239
929 Ga0495672_0006591 3300047320 Bacteria 8941
930 Ga0495672_0009050 3300047320 Bacteria 7260
931 Ga0495672_0013526 3300047320 Bacteria 5627
932 Ga0495672_0013537 3300047320 Bacteria 5624
933 Ga0495672_0019684 3300047320 Bacteria 4447
934 Ga0495672_0020591 3300047320 Bacteria 4317
935 Ga0495672_0024592 3300047320 Bacteria 3875
936 Ga0495672_0035373 3300047320 Bacteria 3076
937 Ga0495672_0040093 3300047320 Bacteria 2842
938 Ga0495672_0054430 3300047320 Bacteria 2339
939 Ga0495672_0078094 3300047320 Bacteria 1853
940 Ga0495672_0113042 3300047320 Bacteria 1455
941 Ga0495676_0000032 3300047321 Bacteria 131215
942 Ga0495676_0000762 3300047321 Bacteria 26867
943 Ga0495676_0002433 3300047321 Bacteria 16535
944 Ga0495680_0001279 3300047322 Bacteria 27450
945 Ga0495680_0005791 3300047322 Bacteria 11565
946 Ga0495680_0006398 3300047322 Bacteria 10956
947 Ga0495683_0000141 3300047323 Bacteria 70994
948 Ga0495683_0000274 3300047323 Bacteria 45119
949 Ga0495683_0000295 3300047323 Bacteria 43033
950 Ga0495683_0004422 3300047323 Bacteria 7980
951 Ga0495683_0004906 3300047323 Bacteria 7489
952 Ga0495683_0009122 3300047323 Bacteria 5285
953 Ga0495683_0010658 3300047323 Bacteria 4851
954 Ga0495687_010230 3300047443 Bacteria 5157
955 Ga0495677_0001107 3300047445 Bacteria 10767
956 Ga0495679_000116 3300047446 Bacteria 69977
957 Ga0495679_000387 3300047446 Bacteria 33710
958 Ga0495679_000772 3300047446 Bacteria 20343
959 Ga0495679_001632 3300047446 Bacteria 12494
960 Ga0495679_003626 3300047446 Bacteria 7378
961 Ga0495679_008579 3300047446 Bacteria 4143
962 Ga0495679_015305 3300047446 Bacteria 2810
963 Ga0495673_0000102 3300047469 Bacteria 173343
964 Ga0495673_0000253 3300047469 Bacteria 74730
965 Ga0495673_0000286 3300047469 Bacteria 68088
966 Ga0495673_0000634 3300047469 Bacteria 34564
967 Ga0495673_0000728 3300047469 Bacteria 31503
968 Ga0495673_0000736 3300047469 Bacteria 31230
969 Ga0495673_0000868 3300047469 Bacteria 28013
970 Ga0495673_0000959 3300047469 Bacteria 26102
971 Ga0495673_0001148 3300047469 Bacteria 22568
972 Ga0495673_0001178 3300047469 Bacteria 22086
973 Ga0495673_0001370 3300047469 Bacteria 19679
974 Ga0495673_0001494 3300047469 Bacteria 18490
975 Ga0495673_0001786 3300047469 Bacteria 16334
976 Ga0495673_0002848 3300047469 Bacteria 11770
977 Ga0495673_0003423 3300047469 Bacteria 10464
978 Ga0495673_0009737 3300047469 Bacteria 5289
979 Ga0495673_0011074 3300047469 Bacteria 4873
980 Ga0495673_0014816 3300047469 Bacteria 4040
981 Ga0495673_0019350 3300047469 Bacteria 3412
982 Ga0495673_0021667 3300047469 Bacteria 3167
983 Ga0495673_0029742 3300047469 Bacteria 2574
984 Ga0495673_0030769 3300047469 Bacteria 2518
985 Ga0495673_0041505 3300047469 Bacteria 2071
986 Ga0495681_0000168 3300047470 Bacteria 54934
987 Ga0495681_0000238 3300047470 Bacteria 45615
988 Ga0495681_0000320 3300047470 Bacteria 38212
989 Ga0495681_0000335 3300047470 Bacteria 37129
990 Ga0495681_0000531 3300047470 Bacteria 29173
991 Ga0495681_0000873 3300047470 Bacteria 23253
992 Ga0495681_0000996 3300047470 Bacteria 21681
993 Ga0495681_0001895 3300047470 Bacteria 15349
994 Ga0495681_0003398 3300047470 Bacteria 11085
995 Ga0495681_0005975 3300047470 Bacteria 8070
996 Ga0495681_0009366 3300047470 Bacteria 6042
997 Ga0495681_0010377 3300047470 Bacteria 5638
998 Ga0495681_0011952 3300047470 Bacteria 5129
999 Ga0495681_0018862 3300047470 Bacteria 3785
1000 Ga0495681_0019511 3300047470 Bacteria 3700
1001 Ga0495684_0003637 3300047471 Bacteria 12011
1002 Ga0495686_0000025 3300047472 Bacteria 388098
1003 Ga0495686_0001012 3300047472 Bacteria 34088
1004 Ga0495686_0001232 3300047472 Bacteria 29230
1005 Ga0495686_0001602 3300047472 Bacteria 23903
1006 Ga0495686_0001767 3300047472 Bacteria 22109
1007 Ga0495686_0004310 3300047472 Bacteria 11770
1008 Ga0495686_0031411 3300047472 Bacteria 3443
1009 Ga0495686_0045637 3300047472 Bacteria 2772
1010 Ga0495593_0005511 3300047673 Bacteria 7470
1011 Ga0495593_0005792 3300047673 Bacteria 7286
1012 Ga0495602_0000508 3300048088 Bacteria 36202
1013 Ga0495626_0000024 3300048091 Bacteria 214179
1014 Ga0495626_0000365 3300048091 Bacteria 47488
1015 Ga0495626_0000396 3300048091 Bacteria 44925
1016 Ga0495626_0000401 3300048091 Bacteria 44320
1017 Ga0495626_0000431 3300048091 Bacteria 42891
1018 Ga0495626_0000488 3300048091 Bacteria 40010
1019 Ga0495626_0001600 3300048091 Bacteria 17650
1020 Ga0495626_0002157 3300048091 Bacteria 14187
1021 Ga0495626_0002326 3300048091 Bacteria 13418
1022 Ga0495626_0002621 3300048091 Bacteria 12237
1023 Ga0495626_0005181 3300048091 Bacteria 7725
1024 Ga0495626_0011745 3300048091 Bacteria 4618
1025 Ga0495626_0039323 3300048091 Bacteria 2239
1026 Ga0496101_0119531 3300048904 Bacteria 1991
1027 Ga0496101_0176850 3300048904 Bacteria 1642
1028 Ga0496102_0000304 3300048905 Bacteria 62749
1029 Ga0496102_0075311 3300048905 Bacteria 3103
1030 Ga0496103_0000544 3300048906 Bacteria 30291
1031 Ga0496106_0012070 3300048909 Bacteria 6375
1032 Ga0496106_0089566 3300048909 Bacteria 2373
1033 Ga0496107_0000028 3300048910 Bacteria 105641
1034 Ga0496110_0011514 3300048913 Bacteria 7243
1035 Ga0496110_0064832 3300048913 Bacteria 3229
1036 Ga0496110_0219174 3300048913 Bacteria 1730
1037 Ga0496110_0243314 3300048913 Bacteria 1637
1038 Ga0496112_0150153 3300048915 Bacteria 2297
1039 Ga0496114_0016603 3300048917 Bacteria 5935
1040 Ga0496115_0002713 3300048918 Bacteria 12720
1041 Ga0496115_0012802 3300048918 Bacteria 6324
1042 Ga0496115_0064426 3300048918 Bacteria 2958
1043 Ga0496116_0000761 3300048919 Bacteria 40895
1044 Ga0496116_0000831 3300048919 Bacteria 39048
1045 Ga0496116_0001051 3300048919 Bacteria 33568
1046 Ga0496116_0001351 3300048919 Bacteria 27849
1047 Ga0496116_0001617 3300048919 Bacteria 24774
1048 Ga0496116_0010403 3300048919 Bacteria 7800
1049 Ga0496116_0041442 3300048919 Bacteria 3159
1050 Ga0496117_0001424 3300048920 Bacteria 34641
1051 Ga0496117_0001501 3300048920 Bacteria 33410
1052 Ga0496117_0001636 3300048920 Bacteria 31572
1053 Ga0496117_0002508 3300048920 Bacteria 23020
1054 Ga0496117_0002876 3300048920 Bacteria 20903
1055 Ga0496117_0004599 3300048920 Bacteria 15075
1056 Ga0496117_0007138 3300048920 Bacteria 11036
1057 Ga0496117_0036410 3300048920 Bacteria 3682
1058 Ga0496117_0074945 3300048920 Bacteria 2250
1059 Ga0496118_0001223 3300048921 Bacteria 39530
1060 Ga0496118_0001495 3300048921 Bacteria 34900
1061 Ga0496118_0003095 3300048921 Bacteria 21336
1062 Ga0496118_0007783 3300048921 Bacteria 11251
1063 Ga0496118_0008106 3300048921 Bacteria 10946
1064 Ga0496118_0074808 3300048921 Bacteria 2419
1065 Ga0496118_0074862 3300048921 Bacteria 2418
1066 Ga0496119_0028389 3300048922 Bacteria 3818
1067 Ga0496119_0034498 3300048922 Bacteria 3331
1068 Ga0496121_0000874 3300048924 Bacteria 54498
1069 Ga0496121_0001884 3300048924 Bacteria 33652
1070 Ga0496121_0003790 3300048924 Bacteria 21093
1071 Ga0496121_0004233 3300048924 Bacteria 19531
1072 Ga0496121_0014277 3300048924 Bacteria 8445
1073 Ga0496121_0017418 3300048924 Bacteria 7342
1074 Ga0496121_0025093 3300048924 Bacteria 5673
1075 Ga0496121_0045788 3300048924 Bacteria 3755
1076 Ga0496122_0000880 3300048925 Bacteria 56253
1077 Ga0496122_0000991 3300048925 Bacteria 50603
1078 Ga0496122_0001433 3300048925 Bacteria 38586
1079 Ga0496122_0004216 3300048925 Bacteria 18071
1080 Ga0496122_0013139 3300048925 Bacteria 8140
1081 Ga0496122_0023095 3300048925 Bacteria 5499
1082 Ga0496122_0036140 3300048925 Bacteria 4002
1083 Ga0496123_0000494 3300048926 Bacteria 68290
1084 Ga0496123_0001506 3300048926 Bacteria 32273
1085 Ga0496123_0002273 3300048926 Bacteria 24181
1086 Ga0496123_0007259 3300048926 Bacteria 10516
1087 Ga0496123_0013460 3300048926 Bacteria 6862
1088 Ga0496123_0016089 3300048926 Bacteria 6095
1089 Ga0496123_0016409 3300048926 Bacteria 6017
1090 Ga0496123_0055439 3300048926 Bacteria 2601
1091 Ga0496124_0000279 3300048927 Bacteria 97488
1092 Ga0496124_0001410 3300048927 Bacteria 35845
1093 Ga0496124_0001880 3300048927 Bacteria 28906
1094 Ga0496124_0003491 3300048927 Bacteria 19148
1095 Ga0496124_0004155 3300048927 Bacteria 17089
1096 Ga0496124_0006034 3300048927 Bacteria 13348
1097 Ga0496124_0045190 3300048927 Bacteria 3776
1098 Ga0496124_0072111 3300048927 Bacteria 2861
1099 Ga0496124_0104316 3300048927 Bacteria 2292
1100 Ga0496125_0001198 3300048928 Bacteria 39047
1101 Ga0496125_0004988 3300048928 Bacteria 15001
1102 Ga0496125_0008052 3300048928 Bacteria 11123
1103 Ga0496125_0009247 3300048928 Bacteria 10176
1104 Ga0496125_0025339 3300048928 Bacteria 5434
1105 Ga0496125_0026179 3300048928 Bacteria 5323
1106 Ga0496125_0037404 3300048928 Bacteria 4221
1107 Ga0496125_0074872 3300048928 Bacteria 2623
1108 Ga0496126_0040048 3300048929 Bacteria 4345
1109 Ga0495678_000054 3300049459 Bacteria 153487
1110 Ga0495678_000078 3300049459 Bacteria 123666
1111 Ga0495678_000533 3300049459 Bacteria 36896
1112 Ga0495678_001006 3300049459 Bacteria 24181
1113 Ga0495678_001105 3300049459 Bacteria 22628
1114 Ga0495678_001300 3300049459 Bacteria 20161
1115 Ga0495678_001330 3300049459 Bacteria 19810
1116 Ga0495678_002116 3300049459 Bacteria 14099
1117 Ga0495678_021380 3300049459 Bacteria 2850
1118 Ga0495678_042018 3300049459 Bacteria 1825
1119 Ga0495682_0000073 3300049460 Bacteria 92060
1120 Ga0495682_0000547 3300049460 Bacteria 25943
1121 Ga0495682_0002257 3300049460 Bacteria 9258
1122 Ga0501034_0000136 3300049571 Bacteria 136835
1123 Ga0501034_0043199 3300049571 Bacteria 4563
1124 Ga0501037_0032680 3300049573 Bacteria 3843
1125 Ga0501043_0009645 3300049579 Bacteria 7568
1126 Ga0501047_0009895 3300049581 Bacteria 9013
1127 Ga0501047_0103518 3300049581 Bacteria 2727
1128 Ga0501067_0000401 3300049583 Bacteria 23635
1129 Ga0501068_0000152 3300049584 Bacteria 31915
1130 Ga0501073_0000007 3300049589 Bacteria 227229
1131 Ga0501075_0072875 3300049591 Bacteria 2597
1132 Ga0501077_0000063 3300049593 Bacteria 53959
1133 Ga0501238_002488 3300049671 Bacteria 2209
1134 Ga0501240_000522 3300049673 Bacteria 3171
1135 Ga0501247_000710 3300049677 Bacteria 2829
1136 Ga0501080_0003554 3300049742 Bacteria 13729
1137 Ga0501241_000051 3300049758 Bacteria 31350
1138 Ga0501269_000494 3300049766 Bacteria 8171
1139 Ga0501035_0026544 3300049822 Bacteria 5298
1140 Ga0501044_0002824 3300049823 Bacteria 19773
1141 Ga0501226_000009 3300049853 Bacteria 194138
1142 nmdc:mga00v17_7244_c1 3300050491 Bacteria 5911
1143 nmdc:mga0yw44_115444_c1 3300050492 Bacteria 1724
1144 nmdc:mga0k408_20130_c2 3300050493 Bacteria 2456
1145 nmdc:mga05p37_81598_c1 3300050507 Bacteria 3983
1146 nmdc:mga09592_1385_c1 3300050508 Bacteria 19400
1147 nmdc:mga08x19_70304_c1 3300050514 Bacteria 2280
1148 nmdc:mga0sz30_10932_c1 3300050516 Bacteria 3491
1149 nmdc:mga0sz30_13514_c1 3300050516 Bacteria 3198
1150 Ga0500635_0000297 3300053080 Bacteria 17607
1151 Ga0500635_0000384 3300053080 Bacteria 13633
1152 Ga0500578_0000159 3300053086 Bacteria 79246
1153 Ga0500643_003722 3300053087 Bacteria 7169
1154 Ga0500643_012390 3300053087 Bacteria 3054
1155 Ga0500643_013970 3300053087 Bacteria 2809
1156 Ga0500644_0000322 3300053088 Bacteria 24894
1157 Ga0500644_0006526 3300053088 Bacteria 2995
1158 Ga0500583_0016822 3300053092 Bacteria 2930
1159 Ga0500651_0002506 3300053093 Bacteria 9733
1160 Ga0500651_0073333 3300053093 Bacteria 2128
1161 Ga0500641_0002892 3300053096 Bacteria 6089
1162 Ga0500641_0013891 3300053096 Bacteria 2963
1163 Ga0500554_004129 3300053102 Bacteria 3048
1164 Ga0500555_004667 3300053103 Bacteria 3891
1165 Ga0500556_0000692 3300053104 Bacteria 20705
1166 Ga0500556_0002142 3300053104 Bacteria 6700
1167 Ga0500562_001055 3300053108 Bacteria 6772
1168 Ga0500562_005861 3300053108 Bacteria 3093
1169 Ga0500562_009205 3300053108 Bacteria 2496
1170 Ga0500562_021430 3300053108 Bacteria 1682
1171 Ga0500569_000447 3300053109 Bacteria 6732
1172 Ga0500572_000204 3300053111 Bacteria 20963
1173 Ga0500572_000705 3300053111 Bacteria 10835
1174 Ga0500594_0000108 3300053118 Bacteria 24161
1175 Ga0500595_024072 3300053119 Bacteria 2129
1176 Ga0500608_000121 3300053122 Bacteria 32563
1177 Ga0500608_000797 3300053122 Bacteria 11486
1178 Ga0500608_007058 3300053122 Bacteria 4618
1179 Ga0500614_001258 3300053123 Bacteria 6130
1180 Ga0500618_002453 3300053125 Bacteria 6978
1181 Ga0500659_0002695 3300053135 Bacteria 10615
1182 Ga0500559_0000004 3300053136 Bacteria 241551
1183 Ga0500559_0000271 3300053136 Bacteria 40434
1184 Ga0500559_0011738 3300053136 Bacteria 3735
1185 Ga0500564_000247 3300053138 Bacteria 15124
1186 Ga0500573_0006880 3300053140 Bacteria 6173
1187 Ga0500577_0015640 3300053142 Bacteria 2375
1188 Ga0500590_006966 3300053148 Bacteria 5545
1189 Ga0500616_0006903 3300053153 Bacteria 7325
1190 Ga0500616_0055040 3300053153 Bacteria 2082
1191 Ga0500619_004796 3300053154 Bacteria 2944
1192 Ga0500622_0003788 3300053156 Bacteria 9861
1193 Ga0500622_0042544 3300053156 Bacteria 2359
1194 Ga0500622_0046361 3300053156 Bacteria 2247
1195 Ga0500637_0007620 3300053178 Bacteria 5425
1196 Ga0500645_001637 3300053730 Bacteria 11043
1197 Ga0500645_001850 3300053730 Bacteria 10135
1198 Ga0500645_008465 3300053730 Bacteria 3512
1199 Ga0500645_011543 3300053730 Bacteria 2881
1200 Ga0500609_001510 3300053731 Bacteria 3406
1201 Ga0500596_002429 3300053735 Bacteria 3673
1202 Ga0501082_0169437 3300060353 Bacteria 1898

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300006846 Ga0075430_100057373 Ga0075430_1000573732 377
2 3300049591 Ga0501075_0072875 Ga0501075_0072875_807_2231 412
3 3300037068 Ga0373925_0195136 Ga0373925_0195136_232_1533 422
4 3300028794 Ga0307515_10091223 Ga0307515_100912231 423
5 3300031616 Ga0307508_10060650 Ga0307508_100606503 423
6 3300031730 Ga0307516_10088059 Ga0307516_100880592 423
7 3300049677 Ga0501247_000710 Ga0501247_000710_1480_2760 423
8 3300031727 Ga0316576_10000732 Ga0316576_100007329 428
9 3300031727 Ga0316576_10072253 Ga0316576_100722531 428
10 3300046520 Ga0495637_0001767 Ga0495637_0001767_11047_12369 431
11 3300048904 Ga0496101_0119531 Ga0496101_0119531_22_1320 432
12 3300038443 Ga0395901_0000818 Ga0395901_0000818_17225_18631 434
13 3300009147 Ga0114129_10083587 Ga0114129_100835874 435
14 3300050507 nmdc:mga05p37_81598_c1 nmdc:mga05p37_81598_c1_1156_2532 435
15 3300032004 Ga0307414_10007790 Ga0307414_100077903 438
16 3300046536 Ga0495587_0000633 Ga0495587_0000633_22335_23657 440
17 3300047469 Ga0495673_0041505 Ga0495673_0041505_738_2060 440
18 3300035691 Ga0373931_0047063 Ga0373931_0047063_560_1894 441
19 3300006178 Ga0075367_10019130 Ga0075367_100191302 442
20 3300042136 Ga0450900_002198 Ga0450900_002198_692_2020 442
21 3300009011 Ga0105251_10002253 Ga0105251_100022532 444
22 3300046460 Ga0495638_0000855 Ga0495638_0000855_17028_18428 444
23 3300046491 Ga0495584_0007021 Ga0495584_0007021_3603_5003 444
24 3300046501 Ga0495607_0001646 Ga0495607_0001646_8885_10285 444
25 3300046517 Ga0495630_0051144 Ga0495630_0051144_630_2030 444
26 3300046519 Ga0495632_0010030 Ga0495632_0010030_148_1548 444
27 3300046523 Ga0495644_0000162 Ga0495644_0000162_16950_18350 444
28 3300046530 Ga0495654_0019537 Ga0495654_0019537_2094_3494 444
29 3300046542 Ga0495597_0006719 Ga0495597_0006719_3874_5274 444
30 3300046692 Ga0495671_0000236 Ga0495671_0000236_2385_3785 444
31 3300046694 Ga0495649_0000907 Ga0495649_0000907_13011_14411 444
32 3300046810 Ga0495660_0003376 Ga0495660_0003376_3829_5229 444
33 3300047322 Ga0495680_0006398 Ga0495680_0006398_4656_6056 444
34 3300047323 Ga0495683_0004906 Ga0495683_0004906_4109_5509 444
35 3300047469 Ga0495673_0001370 Ga0495673_0001370_9089_10489 444
36 3300047673 Ga0495593_0005792 Ga0495593_0005792_3199_4599 444
37 3300048927 Ga0496124_0001410 Ga0496124_0001410_13279_14679 444
38 3300006844 Ga0075428_100072504 Ga0075428_1000725042 445
39 3300006880 Ga0075429_100001471 Ga0075429_1000014713 445
40 3300042139 Ga0450904_000463 Ga0450904_000463_4517_6001 445
41 3300050508 nmdc:mga09592_1385_c1 nmdc:mga09592_1385_c1_1600_3024 445
42 3300002773 JGI25152J39213_1000007 JGI25152J39213_10000071 447
43 3300002774 JGI25150J39212_1000013 JGI25150J39212_100001326 447
44 3300003187 JGI25151J46595_10000004 JGI25151J46595_10000004144 447
45 3300003215 JGI25153J46596_10000004 JGI25153J46596_10000004144 447
46 3300003781 Ga0055536_1000071 Ga0055536_100007143 447
47 3300005288 Ga0065714_10013340 Ga0065714_100133402 447
48 3300009545 Ga0105237_10000399 Ga0105237_1000039919 447
49 3300013104 Ga0157370_10003977 Ga0157370_100039775 447
50 3300013105 Ga0157369_10000053 Ga0157369_1000005325 447
51 3300014497 Ga0182008_10000124 Ga0182008_1000012435 447
52 3300014497 Ga0182008_10000221 Ga0182008_100002218 447
53 3300015261 Ga0182006_1000294 Ga0182006_100029423 447
54 3300015261 Ga0182006_1000575 Ga0182006_100057518 447
55 3300015262 Ga0182007_10000005 Ga0182007_10000005390 447
56 3300015682 Ga0183373_1007 Ga0183373_100766 447
57 3300017792 Ga0163161_10000354 Ga0163161_1000035414 447
58 3300017792 Ga0163161_10000423 Ga0163161_100004238 447
59 3300017792 Ga0163161_10002969 Ga0163161_1000296911 447
60 3300025245 Ga0207425_1000008 Ga0207425_1000008290 447
61 3300025258 Ga0209129_1000042 Ga0209129_100004225 447
62 3300025292 Ga0209676_1000039 Ga0209676_100003940 447
63 3300025294 Ga0209025_1000020 Ga0209025_1000020290 447
64 3300025297 Ga0209758_1000022 Ga0209758_1000022290 447
65 3300025298 Ga0209050_1000033 Ga0209050_1000033409 447
66 3300025914 Ga0207671_10001451 Ga0207671_1000145112 447
67 3300028794 Ga0307515_10016578 Ga0307515_100165785 447
68 3300031731 Ga0307405_10000068 Ga0307405_100000687 447
69 3300031903 Ga0307407_10000001 Ga0307407_1000000180 447
70 3300031995 Ga0307409_100036835 Ga0307409_1000368352 447
71 3300032002 Ga0307416_100000008 Ga0307416_100000008309 447
72 3300032004 Ga0307414_10000545 Ga0307414_100005453 447
73 3300032004 Ga0307414_10001843 Ga0307414_100018438 447
74 3300042137 Ga0450902_002110 Ga0450902_002110_464_1864 447
75 3300046453 Ga0495627_024215 Ga0495627_024215_182_1615 447
76 3300046460 Ga0495638_0104063 Ga0495638_0104063_98_1498 447
77 3300046501 Ga0495607_0001931 Ga0495607_0001931_9289_10689 447
78 3300046507 Ga0495606_0032929 Ga0495606_0032929_1763_3169 447
79 3300046512 Ga0495610_0000039 Ga0495610_0000039_12080_13486 447
80 3300046512 Ga0495610_0000651 Ga0495610_0000651_17072_18505 447
81 3300046522 Ga0495643_0004320 Ga0495643_0004320_3453_4853 447
82 3300046542 Ga0495597_0010873 Ga0495597_0010873_1885_3285 447
83 3300046694 Ga0495649_0003025 Ga0495649_0003025_6198_7598 447
84 3300047320 Ga0495672_0002618 Ga0495672_0002618_7772_9172 447
85 3300048925 Ga0496122_0000991 Ga0496122_0000991_19059_20492 447
86 3300048926 Ga0496123_0016089 Ga0496123_0016089_3239_4672 447
87 3300048928 Ga0496125_0074872 Ga0496125_0074872_53_1486 447
88 3300003781 Ga0055536_1000171 Ga0055536_100017126 448
89 3300003791 Ga0055530_10000501 Ga0055530_1000050115 448
90 3300003792 Ga0055540_1000172 Ga0055540_100017233 448
91 3300003794 Ga0055531_10000540 Ga0055531_100005403 448
92 3300005353 Ga0070669_100000251 Ga0070669_10000025112 448
93 3300009011 Ga0105251_10036865 Ga0105251_100368653 448
94 3300009011 Ga0105251_10042713 Ga0105251_100427131 448
95 3300013100 Ga0157373_10010052 Ga0157373_100100523 448
96 3300013104 Ga0157370_10007656 Ga0157370_100076567 448
97 3300025291 Ga0209675_1001895 Ga0209675_10018955 448
98 3300025292 Ga0209676_1000015 Ga0209676_1000015159 448
99 3300025298 Ga0209050_1000030 Ga0209050_1000030279 448
100 3300025303 Ga0209051_1000012 Ga0209051_1000012520 448
101 3300025304 Ga0209257_1000143 Ga0209257_100014377 448
102 3300025728 Ga0207655_1001282 Ga0207655_100128220 448
103 3300025923 Ga0207681_10000623 Ga0207681_100006239 448
104 3300027907 Ga0207428_10008602 Ga0207428_100086024 448
105 3300041405 Ga0439438_000038 Ga0439438_000038_45627_47027 448
106 3300041411 Ga0439466_0002964 Ga0439466_0002964_4639_6039 448
107 3300042115 Ga0450911_001198 Ga0450911_001198_2131_3531 448
108 3300042121 Ga0450919_000424 Ga0450919_000424_3408_4808 448
109 3300042122 Ga0450920_000070 Ga0450920_000070_10763_12163 448
110 3300042124 Ga0450922_000706 Ga0450922_000706_1603_3003 448
111 3300042147 Ga0450910_003554 Ga0450910_003554_15_1415 448
112 3300046524 Ga0495648_0002076 Ga0495648_0002076_15941_17341 448
113 3300005289 Ga0065704_10000533 Ga0065704_100005335 449
114 3300013100 Ga0157373_10000532 Ga0157373_100005329 449
115 3300013102 Ga0157371_10002564 Ga0157371_100025645 449
116 3300013102 Ga0157371_10007217 Ga0157371_100072171 449
117 3300013104 Ga0157370_10005172 Ga0157370_100051727 449
118 3300014497 Ga0182008_10000021 Ga0182008_1000002151 449
119 3300014497 Ga0182008_10001981 Ga0182008_1000198110 449
120 3300015261 Ga0182006_1005380 Ga0182006_10053802 449
121 3300031911 Ga0307412_10000111 Ga0307412_1000011132 449
122 3300032005 Ga0307411_10053341 Ga0307411_100533412 449
123 3300042115 Ga0450911_000099 Ga0450911_000099_21124_22524 449
124 3300046491 Ga0495584_0002684 Ga0495584_0002684_6009_7409 449
125 3300046492 Ga0495585_0000527 Ga0495585_0000527_21548_22948 449
126 3300046512 Ga0495610_0011516 Ga0495610_0011516_1613_3013 449
127 3300046520 Ga0495637_0004913 Ga0495637_0004913_4268_5668 449
128 3300047470 Ga0495681_0010377 Ga0495681_0010377_737_2137 449
129 3300047472 Ga0495686_0001012 Ga0495686_0001012_9303_10703 449
130 3300053093 Ga0500651_0002506 Ga0500651_0002506_8089_9495 449
131 3300006058 Ga0075432_10017049 Ga0075432_100170491 450
132 3300009148 Ga0105243_10155666 Ga0105243_101556661 450
133 3300013104 Ga0157370_10042481 Ga0157370_100424813 450
134 3300025298 Ga0209050_1001230 Ga0209050_10012308 450
135 3300025304 Ga0209257_1005627 Ga0209257_10056277 450
136 3300025735 Ga0207713_1005034 Ga0207713_10050346 450
137 3300027907 Ga0207428_10024521 Ga0207428_100245214 450
138 3300042010 Ga0439452_000948 Ga0439452_000948_6149_7549 450
139 3300042138 Ga0450903_001300 Ga0450903_001300_910_2310 450
140 3300042461 Ga0439460_0001597 Ga0439460_0001597_3388_4788 450
141 3300046460 Ga0495638_0000691 Ga0495638_0000691_12881_14281 450
142 3300046692 Ga0495671_0005369 Ga0495671_0005369_2690_4090 450
143 3300048091 Ga0495626_0000431 Ga0495626_0000431_22922_24322 450
144 3300048927 Ga0496124_0045190 Ga0496124_0045190_1159_2559 450
145 3300005288 Ga0065714_10002902 Ga0065714_100029027 451
146 3300006058 Ga0075432_10006759 Ga0075432_100067594 451
147 3300009036 Ga0105244_10046058 Ga0105244_100460581 451
148 3300027378 Ga0209981_1001883 Ga0209981_10018833 451
149 3300027543 Ga0209999_1000276 Ga0209999_10002764 451
150 3300027665 Ga0209983_1012221 Ga0209983_10122211 451
151 3300039093 Ga0400489_72461 Ga0400489_72461_2943_4319 451
152 3300041405 Ga0439438_000435 Ga0439438_000435_7433_8833 451
153 3300041407 Ga0439447_006114 Ga0439447_006114_1411_2811 451
154 3300041411 Ga0439466_0000286 Ga0439466_0000286_1696_3096 451
155 3300046452 Ga0495617_008099 Ga0495617_008099_2131_3531 451
156 3300046452 Ga0495617_016694 Ga0495617_016694_324_1724 451
157 3300046453 Ga0495627_000819 Ga0495627_000819_11284_12684 451
158 3300046457 Ga0495590_0001187 Ga0495590_0001187_9309_10709 451
159 3300046458 Ga0495591_000320 Ga0495591_000320_13272_14672 451
160 3300046460 Ga0495638_0003267 Ga0495638_0003267_375_1775 451
161 3300046471 Ga0495650_0002044 Ga0495650_0002044_2923_4323 451
162 3300046474 Ga0495605_0013610 Ga0495605_0013610_2893_4293 451
163 3300046492 Ga0495585_0006399 Ga0495585_0006399_5521_6921 451
164 3300046500 Ga0495596_0001041 Ga0495596_0001041_1805_3205 451
165 3300046507 Ga0495606_0026813 Ga0495606_0026813_2646_4046 451
166 3300046513 Ga0495616_0020047 Ga0495616_0020047_1416_2816 451
167 3300046515 Ga0495620_0002152 Ga0495620_0002152_6567_7967 451
168 3300046519 Ga0495632_0001261 Ga0495632_0001261_13282_14682 451
169 3300046519 Ga0495632_0013447 Ga0495632_0013447_3107_4507 451
170 3300046520 Ga0495637_0021481 Ga0495637_0021481_15_1415 451
171 3300046522 Ga0495643_0030835 Ga0495643_0030835_81_1481 451
172 3300046524 Ga0495648_0008412 Ga0495648_0008412_5657_7057 451
173 3300046542 Ga0495597_0061872 Ga0495597_0061872_53_1453 451
174 3300046616 Ga0495668_0001586 Ga0495668_0001586_1815_3215 451
175 3300046665 Ga0495661_0017385 Ga0495661_0017385_3021_4421 451
176 3300046691 Ga0495670_0000648 Ga0495670_0000648_5472_6872 451
177 3300046692 Ga0495671_0003855 Ga0495671_0003855_3364_4764 451
178 3300046794 Ga0495589_0001225 Ga0495589_0001225_712_2112 451
179 3300046794 Ga0495589_0006544 Ga0495589_0006544_262_1662 451
180 3300046810 Ga0495660_0015031 Ga0495660_0015031_181_1581 451
181 3300047320 Ga0495672_0009050 Ga0495672_0009050_1742_3142 451
182 3300047323 Ga0495683_0010658 Ga0495683_0010658_1368_2768 451
183 3300047469 Ga0495673_0011074 Ga0495673_0011074_3289_4689 451
184 3300047469 Ga0495673_0030769 Ga0495673_0030769_15_1415 451
185 3300047470 Ga0495681_0000531 Ga0495681_0000531_8662_10062 451
186 3300047470 Ga0495681_0000873 Ga0495681_0000873_11256_12656 451
187 3300047472 Ga0495686_0031411 Ga0495686_0031411_977_2377 451
188 3300048091 Ga0495626_0000365 Ga0495626_0000365_32808_34208 451
189 3300048920 Ga0496117_0001501 Ga0496117_0001501_20577_21977 451
190 3300048920 Ga0496117_0002508 Ga0496117_0002508_17046_18446 451
191 3300048921 Ga0496118_0001495 Ga0496118_0001495_12894_14294 451
192 3300048925 Ga0496122_0023095 Ga0496122_0023095_3312_4712 451
193 3300048926 Ga0496123_0001506 Ga0496123_0001506_11557_12957 451
194 3300050514 nmdc:mga08x19_70304_c1 nmdc:mga08x19_70304_c1_590_1990 451
195 3300005288 Ga0065714_10080610 Ga0065714_100806102 452
196 3300005548 Ga0070665_100001733 Ga0070665_10000173324 452
197 3300009036 Ga0105244_10024038 Ga0105244_100240384 452
198 3300009176 Ga0105242_10093478 Ga0105242_100934782 452
199 3300011119 Ga0105246_10012643 Ga0105246_100126434 452
200 3300013100 Ga0157373_10021214 Ga0157373_100212142 452
201 3300017792 Ga0163161_10102062 Ga0163161_101020622 452
202 3300028379 Ga0268266_10001589 Ga0268266_1000158924 452
203 3300028794 Ga0307515_10237139 Ga0307515_102371391 452
204 3300033180 Ga0307510_10000511 Ga0307510_1000051113 452
205 3300041407 Ga0439447_000756 Ga0439447_000756_8573_9973 452
206 3300046460 Ga0495638_0025657 Ga0495638_0025657_976_2376 452
207 3300046471 Ga0495650_0001399 Ga0495650_0001399_8931_10331 452
208 3300046491 Ga0495584_0003012 Ga0495584_0003012_7606_9006 452
209 3300046501 Ga0495607_0019562 Ga0495607_0019562_2592_3992 452
210 3300046506 Ga0495583_0001337 Ga0495583_0001337_12619_14019 452
211 3300046512 Ga0495610_0002515 Ga0495610_0002515_9571_10971 452
212 3300046513 Ga0495616_0011526 Ga0495616_0011526_166_1566 452
213 3300046518 Ga0495631_0030843 Ga0495631_0030843_57_1457 452
214 3300046519 Ga0495632_0000706 Ga0495632_0000706_13305_14705 452
215 3300046520 Ga0495637_0000352 Ga0495637_0000352_13319_14719 452
216 3300046528 Ga0495642_0000113 Ga0495642_0000113_23428_24828 452
217 3300046664 Ga0495659_0000748 Ga0495659_0000748_1984_3384 452
218 3300046684 Ga0495669_0011267 Ga0495669_0011267_2052_3452 452
219 3300046794 Ga0495589_0043896 Ga0495589_0043896_482_1882 452
220 3300047320 Ga0495672_0078094 Ga0495672_0078094_55_1455 452
221 3300047445 Ga0495677_0001107 Ga0495677_0001107_8130_9530 452
222 3300047446 Ga0495679_008579 Ga0495679_008579_104_1504 452
223 3300047469 Ga0495673_0000634 Ga0495673_0000634_19756_21156 452
224 3300047469 Ga0495673_0000868 Ga0495673_0000868_8188_9588 452
225 3300048091 Ga0495626_0011745 Ga0495626_0011745_2902_4302 452
226 3300048913 Ga0496110_0219174 Ga0496110_0219174_102_1502 452
227 3300005288 Ga0065714_10005804 Ga0065714_100058043 453
228 3300046452 Ga0495617_012204 Ga0495617_012204_996_2396 453
229 3300046453 Ga0495627_023595 Ga0495627_023595_531_1931 453
230 3300046460 Ga0495638_0001845 Ga0495638_0001845_10180_11580 453
231 3300046471 Ga0495650_0013097 Ga0495650_0013097_1934_3334 453
232 3300046474 Ga0495605_0004530 Ga0495605_0004530_2506_3906 453
233 3300046474 Ga0495605_0028433 Ga0495605_0028433_1033_2433 453
234 3300046501 Ga0495607_0014215 Ga0495607_0014215_1739_3139 453
235 3300046506 Ga0495583_0002347 Ga0495583_0002347_1772_3172 453
236 3300046507 Ga0495606_0001519 Ga0495606_0001519_16225_17625 453
237 3300046512 Ga0495610_0001825 Ga0495610_0001825_11004_12404 453
238 3300046513 Ga0495616_0004468 Ga0495616_0004468_3715_5115 453
239 3300046515 Ga0495620_0020372 Ga0495620_0020372_1466_2866 453
240 3300046519 Ga0495632_0011019 Ga0495632_0011019_471_1871 453
241 3300046520 Ga0495637_0017538 Ga0495637_0017538_1565_2965 453
242 3300046530 Ga0495654_0000634 Ga0495654_0000634_5475_6875 453
243 3300046530 Ga0495654_0001289 Ga0495654_0001289_9273_10673 453
244 3300046538 Ga0495609_0001382 Ga0495609_0001382_7703_9103 453
245 3300046660 Ga0495625_0024470 Ga0495625_0024470_2795_4195 453
246 3300046665 Ga0495661_0062805 Ga0495661_0062805_768_2168 453
247 3300046794 Ga0495589_0082973 Ga0495589_0082973_23_1423 453
248 3300047443 Ga0495687_010230 Ga0495687_010230_1625_3025 453
249 3300047446 Ga0495679_001632 Ga0495679_001632_8117_9517 453
250 3300047469 Ga0495673_0000728 Ga0495673_0000728_17005_18405 453
251 3300047469 Ga0495673_0009737 Ga0495673_0009737_14_1414 453
252 3300047470 Ga0495681_0005975 Ga0495681_0005975_5122_6522 453
253 3300048091 Ga0495626_0000396 Ga0495626_0000396_13215_14615 453
254 3300049459 Ga0495678_001300 Ga0495678_001300_6768_8168 453
255 3300005355 Ga0070671_100003368 Ga0070671_1000033687 454
256 3300006914 Ga0075436_100121368 Ga0075436_1001213681 454
257 3300025931 Ga0207644_10002262 Ga0207644_100022627 454
258 3300025986 Ga0207658_10030294 Ga0207658_100302942 454
259 3300041405 Ga0439438_000187 Ga0439438_000187_237_1637 454
260 3300041411 Ga0439466_0000755 Ga0439466_0000755_5462_6862 454
261 3300042009 Ga0439451_000168 Ga0439451_000168_8688_10088 454
262 3300042115 Ga0450911_002247 Ga0450911_002247_779_2179 454
263 3300042121 Ga0450919_000040 Ga0450919_000040_5311_6711 454
264 3300042127 Ga0450890_000059 Ga0450890_000059_7473_8873 454
265 3300042146 Ga0450907_001268 Ga0450907_001268_1333_2733 454
266 3300042156 Ga0439446_0015692 Ga0439446_0015692_156_1556 454
267 3300046474 Ga0495605_0037758 Ga0495605_0037758_923_2323 454
268 3300046501 Ga0495607_0000971 Ga0495607_0000971_18418_19818 454
269 3300046501 Ga0495607_0015164 Ga0495607_0015164_3289_4689 454
270 3300046520 Ga0495637_0000321 Ga0495637_0000321_22560_23960 454
271 3300046660 Ga0495625_0003561 Ga0495625_0003561_12910_14310 454
272 3300047469 Ga0495673_0019350 Ga0495673_0019350_317_1717 454
273 3300047470 Ga0495681_0011952 Ga0495681_0011952_1821_3221 454
274 3300009011 Ga0105251_10000563 Ga0105251_1000056325 455
275 3300009036 Ga0105244_10003548 Ga0105244_100035482 455
276 3300009092 Ga0105250_10000247 Ga0105250_1000024719 455
277 3300014497 Ga0182008_10000618 Ga0182008_1000061824 455
278 3300015261 Ga0182006_1000314 Ga0182006_100031423 455
279 3300025230 Ga0209563_100264 Ga0209563_1002644 455
280 3300025711 Ga0207696_1001047 Ga0207696_10010475 455
281 3300025735 Ga0207713_1001134 Ga0207713_100113414 455
282 3300030734 Ga0316179_1077856 Ga0316179_10778562 455
283 3300030735 Ga0316178_1088395 Ga0316178_10883958 455
284 3300031730 Ga0307516_10000035 Ga0307516_1000003548 455
285 3300031995 Ga0307409_100008503 Ga0307409_1000085034 455
286 3300032005 Ga0307411_10000213 Ga0307411_1000021311 455
287 3300041405 Ga0439438_000124 Ga0439438_000124_15712_17112 455
288 3300041405 Ga0439438_000193 Ga0439438_000193_11852_13252 455
289 3300041405 Ga0439438_000590 Ga0439438_000590_14363_15763 455
290 3300041411 Ga0439466_0003416 Ga0439466_0003416_2640_4124 455
291 3300042006 Ga0439432_001399 Ga0439432_001399_1644_3044 455
292 3300042006 Ga0439432_009625 Ga0439432_009625_1000_2400 455
293 3300042010 Ga0439452_000203 Ga0439452_000203_30076_31476 455
294 3300042010 Ga0439452_001857 Ga0439452_001857_1712_3112 455
295 3300042013 Ga0439456_002313 Ga0439456_002313_303_1787 455
296 3300042115 Ga0450911_000047 Ga0450911_000047_45842_47242 455
297 3300042136 Ga0450900_001145 Ga0450900_001145_552_2036 455
298 3300046458 Ga0495591_001463 Ga0495591_001463_1370_2770 455
299 3300046471 Ga0495650_0003695 Ga0495650_0003695_3207_4607 455
300 3300046507 Ga0495606_0001377 Ga0495606_0001377_10896_12296 455
301 3300046513 Ga0495616_0000804 Ga0495616_0000804_9188_10588 455
302 3300046522 Ga0495643_0101086 Ga0495643_0101086_19_1419 455
303 3300046524 Ga0495648_0007972 Ga0495648_0007972_6581_7981 455
304 3300046542 Ga0495597_0000463 Ga0495597_0000463_12465_13865 455
305 3300046557 Ga0495622_0000509 Ga0495622_0000509_12462_13862 455
306 3300046665 Ga0495661_0066026 Ga0495661_0066026_232_1632 455
307 3300046810 Ga0495660_0002315 Ga0495660_0002315_9188_10588 455
308 3300047469 Ga0495673_0003423 Ga0495673_0003423_3335_4735 455
309 3300048091 Ga0495626_0002621 Ga0495626_0002621_1629_3029 455
310 3300048919 Ga0496116_0001051 Ga0496116_0001051_11534_12934 455
311 3300049459 Ga0495678_001105 Ga0495678_001105_9256_10656 455
312 3300049673 Ga0501240_000522 Ga0501240_000522_66_1466 455
313 3300009553 Ga0105249_10006749 Ga0105249_100067492 456
314 3300046519 Ga0495632_0002965 Ga0495632_0002965_9535_10935 456
315 3300046642 Ga0495634_0053184 Ga0495634_0053184_566_1966 456
316 3300046660 Ga0495625_0005991 Ga0495625_0005991_4319_5689 456
317 3300046680 Ga0495646_0020411 Ga0495646_0020411_643_2043 456
318 3300046689 Ga0495613_0001426 Ga0495613_0001426_11140_12540 456
319 3300046690 Ga0495624_0000569 Ga0495624_0000569_27410_28810 456
320 3300046809 Ga0495600_0005745 Ga0495600_0005745_5877_7277 456
321 3300047320 Ga0495672_0001272 Ga0495672_0001272_68_1468 456
322 3300047321 Ga0495676_0002433 Ga0495676_0002433_2790_4190 456
323 3300047471 Ga0495684_0003637 Ga0495684_0003637_8589_9989 456
324 3300047673 Ga0495593_0005511 Ga0495593_0005511_1354_2754 456
325 3300048088 Ga0495602_0000508 Ga0495602_0000508_22625_24025 456
326 3300049571 Ga0501034_0043199 Ga0501034_0043199_170_1576 456
327 iso_pu_bacteria 2842298080 2842303938 456
328 3300013307 Ga0157372_10000601 Ga0157372_100006019 457
329 3300025711 Ga0207696_1000180 Ga0207696_100018026 457
330 3300025711 Ga0207696_1000184 Ga0207696_100018453 457
331 3300025735 Ga0207713_1014187 Ga0207713_10141872 457
332 3300025933 Ga0207706_10000789 Ga0207706_1000078910 457
333 3300041405 Ga0439438_000845 Ga0439438_000845_9267_10667 457
334 3300042010 Ga0439452_000223 Ga0439452_000223_24121_25521 457
335 3300046523 Ga0495644_0001352 Ga0495644_0001352_4379_5779 457
336 3300048919 Ga0496116_0001617 Ga0496116_0001617_11636_13036 457
337 3300048927 Ga0496124_0072111 Ga0496124_0072111_1236_2636 457
338 3300006051 Ga0075364_10104013 Ga0075364_101040131 458
339 3300006177 Ga0075362_10050359 Ga0075362_100503592 458
340 3300047470 Ga0495681_0000335 Ga0495681_0000335_18125_19525 458
341 3300050516 nmdc:mga0sz30_13514_c1 nmdc:mga0sz30_13514_c1_98_1498 458
342 iso_pu_bacteria 2524023209 2524463228 458
343 iso_pu_bacteria 2599185353 2600200025 458
344 iso_pu_bacteria 2600254943 2600400782 458
345 iso_pu_bacteria 2738543023 2739302789 458
346 iso_pu_bacteria 2744054657 2745165867 458
347 iso_pu_bacteria 2816332336 2817619170 458
348 iso_pu_bacteria 2841859092 2841863036 458
349 iso_pu_bacteria 2842515876 2842519447 458
350 iso_pu_bacteria 2852627209 2852629573 458
351 iso_pu_bacteria 2881644220 2881647766 458
352 iso_pu_bacteria 2919186247 2919191147 458
353 iso_pu_bacteria 2933011516 2933016652 458
354 iso_pu_bacteria 2939664404 2939669426 458
355 iso_pu_bacteria 2964375228 2964378925 458
356 3300006844 Ga0075428_100253453 Ga0075428_1002534532 459
357 3300007788 Ga0099795_10000428 Ga0099795_100004283 459
358 3300013297 Ga0157378_10147270 Ga0157378_101472703 459
359 iso_pu_bacteria 2511231221 2512034375 459
360 iso_pu_bacteria 2721755487 2722726481 459
361 iso_pu_bacteria 2738541273 2738701120 459
362 iso_pu_bacteria 2738541283 2738758401 459
363 iso_pu_bacteria 2738541302 2738854700 459
364 iso_pu_bacteria 2739367651 2739587228 459
365 iso_pu_bacteria 2739367656 2739617536 459
366 iso_pu_bacteria 2739367663 2739647986 459
367 iso_pu_bacteria 2775506987 2776616389 459
368 iso_pu_bacteria 2842722452 2842726699 459
369 iso_pu_bacteria 2842909656 2842911541 459
370 iso_pu_bacteria 2849281842 2849286286 459
371 iso_pu_bacteria 2857627736 2857629978 459
372 iso_pu_bacteria 2896317667 2896319394 459
373 iso_pu_bacteria 2898713307 2898713399 459
374 iso_pu_bacteria 2902048731 2902052636 459
375 iso_pu_bacteria 2904445276 2904449587 459
376 iso_pu_bacteria 2904780799 2904783654 459
377 iso_pu_bacteria 2919177583 2919182205 459
378 iso_pu_bacteria 2945997725 2946002984 459
379 iso_pu_bacteria 2954016120 2954019861 459
380 iso_pu_bacteria 8055588893 8055591801 459
381 3300005466 Ga0070685_10003229 Ga0070685_100032292 460
382 3300010159 Ga0099796_10001771 Ga0099796_100017712 460
383 3300025250 Ga0209026_1001901 Ga0209026_10019011 460
384 3300047320 Ga0495672_0113042 Ga0495672_0113042_60_1442 460
385 3300047472 Ga0495686_0045637 Ga0495686_0045637_1056_2444 460
386 iso_pu_bacteria 2924710171 2924715041 460
387 iso_pu_bacteria 2977898635 2977902692 460
388 3300031548 Ga0307408_100024490 Ga0307408_1000244902 461
389 3300031733 Ga0316577_10104768 Ga0316577_101047682 461
390 3300031901 Ga0307406_10099489 Ga0307406_100994892 461
391 3300031903 Ga0307407_10051910 Ga0307407_100519102 461
392 3300032005 Ga0307411_10049124 Ga0307411_100491242 461
393 iso_pu_bacteria 2643221614 2644087834 461
394 iso_pu_bacteria 2643221661 2644345438 461
395 iso_pu_bacteria 2643221666 2644367190 461
396 3300005288 Ga0065714_10064634 Ga0065714_1006463417 462
397 3300046474 Ga0495605_0007446 Ga0495605_0007446_924_2312 462
398 iso_pu_bacteria 2510917020 2511121334 462
399 iso_pu_bacteria 2511231004 2511253582 462
400 iso_pu_bacteria 2511231006 2511266515 462
401 iso_pu_bacteria 2511231007 2511269839 462
402 iso_pu_bacteria 2511231008 2511275809 462
403 iso_pu_bacteria 2511231010 2511289760 462
404 iso_pu_bacteria 2511231011 2511293353 462
405 iso_pu_bacteria 2511231012 2511298981 462
406 iso_pu_bacteria 2511231014 2511315419 462
407 iso_pu_bacteria 2511231015 2511320406 462
408 iso_pu_bacteria 2511231016 2511325187 462
409 iso_pu_bacteria 2511231017 2511332173 462
410 iso_pu_bacteria 2511231018 2511337615 462
411 iso_pu_bacteria 2511231019 2511345436 462
412 iso_pu_bacteria 2511231020 2511347949 462
413 iso_pu_bacteria 2511231021 2511359099 462
414 iso_pu_bacteria 2511231022 2511364367 462
415 iso_pu_bacteria 2511231023 2511367486 462
416 iso_pu_bacteria 2511231024 2511374231 462
417 iso_pu_bacteria 2511231031 2511412524 462
418 iso_pu_bacteria 2511231156 2511827880 462
419 iso_pu_bacteria 2512047018 2512325372 462
420 iso_pu_bacteria 2554235132 2554817851 462
421 iso_pu_bacteria 2554235231 2555246497 462
422 iso_pu_bacteria 2582580891 2583795469 462
423 iso_pu_bacteria 2582581279 2585148132 462
424 iso_pu_bacteria 2582581280 2585152667 462
425 iso_pu_bacteria 2582581293 2585198870 462
426 iso_pu_bacteria 2585428106 2587916981 462
427 iso_pu_bacteria 2597489887 2597861147 462
428 iso_pu_bacteria 2599185185 2599487270 462
429 iso_pu_bacteria 2599185188 2599503708 462
430 iso_pu_bacteria 2599185212 2599612709 462
431 iso_pu_bacteria 2599185248 2599767910 462
432 iso_pu_bacteria 2599185257 2599804383 462
433 iso_pu_bacteria 2599185289 2599887786 462
434 iso_pu_bacteria 2599185291 2599899523 462
435 iso_pu_bacteria 2599185300 2599933143 462
436 iso_pu_bacteria 2599185302 2599942107 462
437 iso_pu_bacteria 2599185304 2599955088 462
438 iso_pu_bacteria 2599185305 2599962173 462
439 iso_pu_bacteria 2599185306 2599966313 462
440 iso_pu_bacteria 2599185307 2599975075 462
441 iso_pu_bacteria 2599185308 2599977162 462
442 iso_pu_bacteria 2599185309 2599984519 462
443 iso_pu_bacteria 2599185310 2599990801 462
444 iso_pu_bacteria 2599185311 2599995053 462
445 iso_pu_bacteria 2599185312 2600000723 462
446 iso_pu_bacteria 2599185313 2600007135 462
447 iso_pu_bacteria 2599185314 2600011405 462
448 iso_pu_bacteria 2599185315 2600019545 462
449 iso_pu_bacteria 2599185316 2600024963 462
450 iso_pu_bacteria 2599185317 2600029410 462
451 iso_pu_bacteria 2599185318 2600038857 462
452 iso_pu_bacteria 2599185320 2600049682 462
453 iso_pu_bacteria 2599185321 2600054055 462
454 iso_pu_bacteria 2599185322 2600059777 462
455 iso_pu_bacteria 2599185323 2600065457 462
456 iso_pu_bacteria 2599185324 2600072089 462
457 iso_pu_bacteria 2599185325 2600079090 462
458 iso_pu_bacteria 2600254930 2600358906 462
459 iso_pu_bacteria 2600254931 2600363269 462
460 iso_pu_bacteria 2600254954 2600443342 462
461 iso_pu_bacteria 2600255283 2601627647 462
462 iso_pu_bacteria 2600255318 2601798294 462
463 iso_pu_bacteria 2600255389 2602009194 462
464 iso_pu_bacteria 2603880185 2606077188 462
465 iso_pu_bacteria 2603880199 2606129566 462
466 iso_pu_bacteria 2606217733 2608380831 462
467 iso_pu_bacteria 2623620443 2624483672 462
468 iso_pu_bacteria 2623620446 2624495253 462
469 iso_pu_bacteria 2643221545 2643748995 462
470 iso_pu_bacteria 2643221552 2643780762 462
471 iso_pu_bacteria 2643221565 2643843252 462
472 iso_pu_bacteria 2643221583 2643924648 462
473 iso_pu_bacteria 2643221584 2643930247 462
474 iso_pu_bacteria 2643221589 2643956094 462
475 iso_pu_bacteria 2643221598 2644001771 462
476 iso_pu_bacteria 2643221602 2644020216 462
477 iso_pu_bacteria 2643221633 2644184225 462
478 iso_pu_bacteria 2643221640 2644223815 462
479 iso_pu_bacteria 2643221642 2644236099 462
480 iso_pu_bacteria 2643221650 2644282971 462
481 iso_pu_bacteria 2643221691 2644509246 462
482 iso_pu_bacteria 2651869719 2652545600 462
483 iso_pu_bacteria 2667528170 2671092027 462
484 iso_pu_bacteria 2667528176 2671129409 462
485 iso_pu_bacteria 2671180172 2671771391 462
486 iso_pu_bacteria 2675903515 2678266394 462
487 iso_pu_bacteria 2713897148 2715749575 462
488 iso_pu_bacteria 2713897149 2715754583 462
489 iso_pu_bacteria 2718217725 2718636866 462
490 iso_pu_bacteria 2738543004 2739201011 462
491 iso_pu_bacteria 2738543015 2739260623 462
492 iso_pu_bacteria 2738543020 2739285229 462
493 iso_pu_bacteria 2738543021 2739290543 462
494 iso_pu_bacteria 2738543025 2739312236 462
495 iso_pu_bacteria 2740892503 2743740686 462
496 iso_pu_bacteria 2744054620 2745007624 462
497 iso_pu_bacteria 2765235841 2765586773 462
498 iso_pu_bacteria 2773857670 2774118096 462
499 iso_pu_bacteria 2773857673 2774136451 462
500 iso_pu_bacteria 2784132063 2784261552 462
501 iso_pu_bacteria 2784132072 2784316864 462
502 iso_pu_bacteria 2791355048 2792461786 462
503 iso_pu_bacteria 2791355520 2794599021 462
504 iso_pu_bacteria 2806310737 2807410969 462
505 iso_pu_bacteria 2806310745 2807459310 462
506 iso_pu_bacteria 2808606377 2808928186 462
507 iso_pu_bacteria 2808606379 2808940637 462
508 iso_pu_bacteria 2808606381 2808950632 462
509 iso_pu_bacteria 2808606382 2808961608 462
510 iso_pu_bacteria 2808606445 2809217477 462
511 iso_pu_bacteria 2818991435 2819537598 462
512 iso_pu_bacteria 2818991454 2819647374 462
513 iso_pu_bacteria 2818991456 2819655393 462
514 iso_pu_bacteria 2823421272 2823424948 462
515 iso_pu_bacteria 2825651385 2825654821 462
516 iso_pu_bacteria 2842805378 2842807053 462
517 iso_pu_bacteria 2842832357 2842833714 462
518 iso_pu_bacteria 2842843487 2842845947 462
519 iso_pu_bacteria 2842854478 2842855873 462
520 iso_pu_bacteria 2843744320 2843745852 462
521 iso_pu_bacteria 2849560528 2849562235 462
522 iso_pu_bacteria 2849573788 2849577156 462
523 iso_pu_bacteria 2851153111 2851156904 462
524 iso_pu_bacteria 2852657418 2852660073 462
525 iso_pu_bacteria 2857504554 2857508144 462
526 iso_pu_bacteria 2860339153 2860341980 462
527 iso_pu_bacteria 2878029506 2878029677 462
528 iso_pu_bacteria 2880230671 2880236257 462
529 iso_pu_bacteria 2884960567 2884963380 462
530 iso_pu_bacteria 2898329390 2898331166 462
531 iso_pu_bacteria 2904518522 2904518693 462
532 iso_pu_bacteria 2904550169 2904553371 462
533 iso_pu_bacteria 2912963787 2912969089 462
534 iso_pu_bacteria 2913036834 2913042801 462
535 iso_pu_bacteria 2919063839 2919068119 462
536 iso_pu_bacteria 2919385768 2919388936 462
537 iso_pu_bacteria 2919456309 2919457835 462
538 iso_pu_bacteria 2919481497 2919487219 462
539 iso_pu_bacteria 2919487758 2919487866 462
540 iso_pu_bacteria 2919501602 2919501677 462
541 iso_pu_bacteria 2919697872 2919702469 462
542 iso_pu_bacteria 2923153595 2923159782 462
543 iso_pu_bacteria 2923586266 2923589218 462
544 iso_pu_bacteria 2926063275 2926063350 462
545 iso_pu_bacteria 2928531327 2928534704 462
546 iso_pu_bacteria 2929144301 2929150170 462
547 iso_pu_bacteria 2931369376 2931372415 462
548 iso_pu_bacteria 2931396565 2931398377 462
549 iso_pu_bacteria 2939636861 2939640587 462
550 iso_pu_bacteria 2939651529 2939654351 462
551 iso_pu_bacteria 2945928738 2945933595 462
552 iso_pu_bacteria 2969304461 2969310478 462
553 iso_pu_bacteria 2974289157 2974293824 462
554 iso_pu_bacteria 2984286254 2984286332 462
555 iso_pu_bacteria 2998139840 2998140003 462
556 iso_pu_bacteria 3007395558 3007399118 462
557 iso_pu_bacteria 3007419365 3007419541 462
558 iso_pu_bacteria 3007511990 3007517433 462
559 iso_pu_bacteria 3007614139 3007619337 462
560 iso_pu_bacteria 3007619802 3007622626 462
561 iso_pu_bacteria 3007718800 3007723132 462
562 iso_pu_bacteria 3007803356 3007809311 462
563 iso_pu_bacteria 3007861166 3007864840 462
564 iso_pu_bacteria 3007866637 3007871814 462
565 iso_pu_bacteria 8011350971 8011352363 462
566 iso_pu_bacteria 8015687852 8015693876 462
567 iso_pu_bacteria 8019775933 8019779691 462
568 iso_pu_bacteria 8029995093 8029995250 462
569 iso_pu_bacteria 8034962539 8034962934 462
570 iso_pu_bacteria 8052494512 8052494656 462
571 iso_pu_bacteria 8054929484 8054929701 462
572 iso_pu_bacteria 8055770955 8055777138 462
573 iso_pu_bacteria 8055878733 8055881687 462
574 iso_pu_bacteria 8056115690 8056116353 462
575 iso_pu_bacteria 8056120720 8056125878 462
576 iso_pu_bacteria 8056125926 8056126031 462
577 iso_pu_bacteria 8056137416 8056142999 462
578 iso_pu_bacteria 8056143049 8056143202 462
579 iso_pu_bacteria 8056155041 8056160003 462
580 iso_pu_bacteria 8056166840 8056171048 462
581 iso_pu_bacteria 8056172158 8056177171 462
582 iso_pu_bacteria 8056177738 8056182256 462
583 iso_pu_bacteria 8056569372 8056570732 462
584 3300005288 Ga0065714_10002191 Ga0065714_1000219173 463
585 3300005614 Ga0068856_100021439 Ga0068856_1000214395 463
586 3300009148 Ga0105243_10000018 Ga0105243_1000001874 463
587 3300013100 Ga0157373_10000120 Ga0157373_1000012030 463
588 3300013102 Ga0157371_10000027 Ga0157371_10000027122 463
589 3300013102 Ga0157371_10017512 Ga0157371_100175122 463
590 3300013105 Ga0157369_10008306 Ga0157369_100083067 463
591 3300013306 Ga0163162_10000911 Ga0163162_100009119 463
592 3300013308 Ga0157375_10247366 Ga0157375_102473662 463
593 3300015261 Ga0182006_1000126 Ga0182006_100012617 463
594 3300015261 Ga0182006_1002381 Ga0182006_10023816 463
595 3300015262 Ga0182007_10002566 Ga0182007_100025664 463
596 3300017792 Ga0163161_10000383 Ga0163161_1000038320 463
597 3300017792 Ga0163161_10076367 Ga0163161_100763672 463
598 3300025935 Ga0207709_10000021 Ga0207709_10000021120 463
599 3300032004 Ga0307414_10010561 Ga0307414_100105613 463
600 3300046538 Ga0495609_0005167 Ga0495609_0005167_4853_6259 463
601 3300048919 Ga0496116_0001351 Ga0496116_0001351_4455_5861 463
602 3300048920 Ga0496117_0004599 Ga0496117_0004599_5116_6522 463
603 3300048925 Ga0496122_0013139 Ga0496122_0013139_1892_3298 463
604 3300048928 Ga0496125_0037404 Ga0496125_0037404_300_1706 463
605 iso_pu_bacteria 2585427687 2586209193 463
606 iso_pu_bacteria 2738541284 2738764027 463
607 iso_pu_bacteria 2818991437 2819547684 463
608 3300010375 Ga0105239_10000300 Ga0105239_1000030041 464
609 3300013308 Ga0157375_10253832 Ga0157375_102538321 464
610 3300025949 Ga0207667_10232775 Ga0207667_102327752 464
611 3300041410 Ga0439461_0007173 Ga0439461_0007173_207_1601 464
612 3300047472 Ga0495686_0000025 Ga0495686_0000025_79590_80990 464
613 3300049573 Ga0501037_0032680 Ga0501037_0032680_1212_2627 464
614 3300049579 Ga0501043_0009645 Ga0501043_0009645_5913_7328 464
615 3300049581 Ga0501047_0009895 Ga0501047_0009895_1231_2646 464
616 3300049583 Ga0501067_0000401 Ga0501067_0000401_16443_17858 464
617 3300049584 Ga0501068_0000152 Ga0501068_0000152_24627_26042 464
618 3300049589 Ga0501073_0000007 Ga0501073_0000007_150497_151912 464
619 3300049593 Ga0501077_0000063 Ga0501077_0000063_27936_29351 464
620 3300049742 Ga0501080_0003554 Ga0501080_0003554_8733_10148 464
621 3300049823 Ga0501044_0002824 Ga0501044_0002824_16978_18393 464
622 3300060353 Ga0501082_0169437 Ga0501082_0169437_380_1795 464
623 iso_pu_bacteria 2874168670 2874173030 464
624 3300005262 Ga0065165_1000294 Ga0065165_100029467 465
625 3300005331 Ga0070670_100000004 Ga0070670_100000004368 465
626 3300005334 Ga0068869_100082425 Ga0068869_1000824252 465
627 3300005335 Ga0070666_10060244 Ga0070666_100602442 465
628 3300005336 Ga0070680_100042257 Ga0070680_1000422574 465
629 3300005336 Ga0070680_100054793 Ga0070680_1000547933 465
630 3300005338 Ga0068868_100074562 Ga0068868_1000745624 465
631 3300005339 Ga0070660_100044788 Ga0070660_1000447883 465
632 3300005347 Ga0070668_100000684 Ga0070668_10000068423 465
633 3300005347 Ga0070668_100000986 Ga0070668_1000009865 465
634 3300005347 Ga0070668_100017483 Ga0070668_1000174834 465
635 3300005347 Ga0070668_100062078 Ga0070668_1000620783 465
636 3300005353 Ga0070669_100005805 Ga0070669_1000058054 465
637 3300005355 Ga0070671_100003524 Ga0070671_1000035249 465
638 3300005355 Ga0070671_100061950 Ga0070671_1000619503 465
639 3300005366 Ga0070659_100001101 Ga0070659_10000110110 465
640 3300005366 Ga0070659_100162359 Ga0070659_1001623592 465
641 3300005367 Ga0070667_100000115 Ga0070667_100000115105 465
642 3300005367 Ga0070667_100001604 Ga0070667_1000016042 465
643 3300005367 Ga0070667_100007198 Ga0070667_1000071982 465
644 3300005530 Ga0070679_100062480 Ga0070679_1000624803 465
645 3300005548 Ga0070665_100000157 Ga0070665_10000015723 465
646 3300005548 Ga0070665_100000347 Ga0070665_10000034737 465
647 3300005548 Ga0070665_100000395 Ga0070665_1000003952 465
648 3300005548 Ga0070665_100006210 Ga0070665_1000062104 465
649 3300005563 Ga0068855_100031312 Ga0068855_1000313124 465
650 3300005617 Ga0068859_100028999 Ga0068859_1000289994 465
651 3300005617 Ga0068859_100104780 Ga0068859_1001047803 465
652 3300005618 Ga0068864_100000175 Ga0068864_1000001753 465
653 3300005618 Ga0068864_100000522 Ga0068864_10000052233 465
654 3300005841 Ga0068863_100000076 Ga0068863_100000076111 465
655 3300005841 Ga0068863_100000308 Ga0068863_10000030840 465
656 3300005841 Ga0068863_100002055 Ga0068863_10000205514 465
657 3300005841 Ga0068863_100075960 Ga0068863_1000759604 465
658 3300005841 Ga0068863_100095238 Ga0068863_1000952383 465
659 3300005841 Ga0068863_100110566 Ga0068863_1001105664 465
660 3300005842 Ga0068858_100000079 Ga0068858_1000000793 465
661 3300005842 Ga0068858_100003236 Ga0068858_10000323614 465
662 3300005842 Ga0068858_100010456 Ga0068858_1000104562 465
663 3300005843 Ga0068860_100000212 Ga0068860_1000002127 465
664 3300005843 Ga0068860_100000299 Ga0068860_1000002999 465
665 3300005843 Ga0068860_100022987 Ga0068860_1000229874 465
666 3300005843 Ga0068860_100048075 Ga0068860_1000480752 465
667 3300005844 Ga0068862_100000285 Ga0068862_10000028541 465
668 3300005844 Ga0068862_100007856 Ga0068862_1000078564 465
669 3300005844 Ga0068862_100054100 Ga0068862_1000541004 465
670 3300006042 Ga0075368_10012668 Ga0075368_100126683 465
671 3300006931 Ga0097620_100029000 Ga0097620_1000290004 465
672 3300006931 Ga0097620_100104782 Ga0097620_1001047823 465
673 3300009093 Ga0105240_10003928 Ga0105240_1000392823 465
674 3300009093 Ga0105240_10067731 Ga0105240_100677312 465
675 3300009177 Ga0105248_10019301 Ga0105248_100193012 465
676 3300009177 Ga0105248_10048390 Ga0105248_100483904 465
677 3300009177 Ga0105248_10123729 Ga0105248_101237294 465
678 3300009177 Ga0105248_10148476 Ga0105248_101484762 465
679 3300009553 Ga0105249_10000396 Ga0105249_100003966 465
680 3300010375 Ga0105239_10213075 Ga0105239_102130751 465
681 3300013104 Ga0157370_10018935 Ga0157370_100189355 465
682 3300013296 Ga0157374_10316738 Ga0157374_103167381 465
683 3300013306 Ga0163162_10059327 Ga0163162_100593272 465
684 3300013306 Ga0163162_10202188 Ga0163162_102021882 465
685 3300014325 Ga0163163_10085926 Ga0163163_100859264 465
686 3300014968 Ga0157379_10068488 Ga0157379_100684883 465
687 3300015684 Ga0183365_10001 Ga0183365_10001690 465
688 3300021384 Ga0213876_10008012 Ga0213876_100080126 465
689 3300025297 Ga0209758_1003600 Ga0209758_100360010 465
690 3300025298 Ga0209050_1000053 Ga0209050_1000053278 465
691 3300025304 Ga0209257_1000316 Ga0209257_100031680 465
692 3300025909 Ga0207705_10000635 Ga0207705_100006355 465
693 3300025912 Ga0207707_10211178 Ga0207707_102111782 465
694 3300025913 Ga0207695_10001594 Ga0207695_1000159416 465
695 3300025913 Ga0207695_10003219 Ga0207695_100032197 465
696 3300025913 Ga0207695_10037489 Ga0207695_100374895 465
697 3300025913 Ga0207695_10064349 Ga0207695_100643495 465
698 3300025917 Ga0207660_10008125 Ga0207660_100081255 465
699 3300025919 Ga0207657_10014297 Ga0207657_100142974 465
700 3300025921 Ga0207652_10005251 Ga0207652_100052518 465
701 3300025923 Ga0207681_10045410 Ga0207681_100454102 465
702 3300025924 Ga0207694_10043651 Ga0207694_100436514 465
703 3300025925 Ga0207650_10000014 Ga0207650_1000001422 465
704 3300025925 Ga0207650_10033348 Ga0207650_100333483 465
705 3300025925 Ga0207650_10040914 Ga0207650_100409142 465
706 3300025925 Ga0207650_10059306 Ga0207650_100593063 465
707 3300025925 Ga0207650_10072630 Ga0207650_100726303 465
708 3300025931 Ga0207644_10003564 Ga0207644_100035645 465
709 3300025931 Ga0207644_10086851 Ga0207644_100868512 465
710 3300025932 Ga0207690_10000436 Ga0207690_1000043624 465
711 3300025932 Ga0207690_10042444 Ga0207690_100424442 465
712 3300025938 Ga0207704_10008126 Ga0207704_100081267 465
713 3300025941 Ga0207711_10000097 Ga0207711_1000009738 465
714 3300025941 Ga0207711_10020583 Ga0207711_100205833 465
715 3300025941 Ga0207711_10037444 Ga0207711_100374445 465
716 3300025941 Ga0207711_10080391 Ga0207711_100803912 465
717 3300025942 Ga0207689_10144977 Ga0207689_101449772 465
718 3300025961 Ga0207712_10014945 Ga0207712_100149456 465
719 3300025961 Ga0207712_10178118 Ga0207712_101781182 465
720 3300025972 Ga0207668_10000013 Ga0207668_10000013122 465
721 3300025972 Ga0207668_10000356 Ga0207668_100003566 465
722 3300025972 Ga0207668_10005502 Ga0207668_100055027 465
723 3300025972 Ga0207668_10009386 Ga0207668_100093863 465
724 3300025972 Ga0207668_10040403 Ga0207668_100404032 465
725 3300025986 Ga0207658_10000496 Ga0207658_1000049614 465
726 3300025986 Ga0207658_10003812 Ga0207658_100038122 465
727 3300025986 Ga0207658_10034905 Ga0207658_100349052 465
728 3300025986 Ga0207658_10185934 Ga0207658_101859342 465
729 3300026035 Ga0207703_10000051 Ga0207703_10000051112 465
730 3300026035 Ga0207703_10000622 Ga0207703_100006223 465
731 3300026041 Ga0207639_10061479 Ga0207639_100614793 465
732 3300026088 Ga0207641_10000003 Ga0207641_10000003121 465
733 3300026088 Ga0207641_10001098 Ga0207641_1000109811 465
734 3300026088 Ga0207641_10022295 Ga0207641_100222952 465
735 3300026088 Ga0207641_10158708 Ga0207641_101587081 465
736 3300026095 Ga0207676_10000223 Ga0207676_1000022350 465
737 3300026095 Ga0207676_10004623 Ga0207676_100046239 465
738 3300027866 Ga0209813_10024973 Ga0209813_100249732 465
739 3300028379 Ga0268266_10000003 Ga0268266_100000031606 465
740 3300028379 Ga0268266_10002499 Ga0268266_100024999 465
741 3300028379 Ga0268266_10007274 Ga0268266_100072743 465
742 3300028379 Ga0268266_10086601 Ga0268266_100866012 465
743 3300028380 Ga0268265_10001601 Ga0268265_100016017 465
744 3300028380 Ga0268265_10017945 Ga0268265_100179452 465
745 3300028380 Ga0268265_10027501 Ga0268265_100275013 465
746 3300028381 Ga0268264_10000032 Ga0268264_1000003247 465
747 3300028381 Ga0268264_10000091 Ga0268264_10000091101 465
748 3300028381 Ga0268264_10025097 Ga0268264_100250976 465
749 3300028381 Ga0268264_10062574 Ga0268264_100625742 465
750 3300028786 Ga0307517_10000813 Ga0307517_1000081338 465
751 3300028786 Ga0307517_10042446 Ga0307517_100424463 465
752 3300030521 Ga0307511_10006554 Ga0307511_100065546 465
753 3300031251 Ga0265327_10000279 Ga0265327_1000027945 465
754 3300031251 Ga0265327_10001583 Ga0265327_1000158319 465
755 3300031251 Ga0265327_10010720 Ga0265327_100107206 465
756 3300031456 Ga0307513_10000100 Ga0307513_1000010077 465
757 3300031456 Ga0307513_10001018 Ga0307513_1000101831 465
758 3300031456 Ga0307513_10010930 Ga0307513_100109307 465
759 3300031711 Ga0265314_10037617 Ga0265314_100376174 465
760 3300032004 Ga0307414_10175544 Ga0307414_101755442 465
761 3300032005 Ga0307411_10076046 Ga0307411_100760462 465
762 3300033180 Ga0307510_10009689 Ga0307510_100096896 465
763 3300035113 Ga0373936_0001691 Ga0373936_0001691_3781_5190 465
764 3300035695 Ga0373927_0001662 Ga0373927_0001662_413_1831 465
765 3300037068 Ga0373925_0000135 Ga0373925_0000135_69830_71248 465
766 3300037312 Ga0395899_0000190 Ga0395899_0000190_82427_83845 465
767 3300037418 Ga0395900_0000002 Ga0395900_0000002_467635_469053 465
768 3300037418 Ga0395900_0016355 Ga0395900_0016355_703_2106 465
769 3300037466 Ga0395898_0007454 Ga0395898_0007454_3819_5237 465
770 3300037471 Ga0395905_0000022 Ga0395905_0000022_85562_86971 465
771 3300037471 Ga0395905_0114519 Ga0395905_0114519_178_1596 465
772 3300037471 Ga0395905_0215346 Ga0395905_0215346_146_1561 465
773 3300037853 Ga0436364_0480205 Ga0436364_0480205_170_1567 465
774 3300037853 Ga0436364_1502320 Ga0436364_1502320_1879_3288 465
775 3300038443 Ga0395901_0000013 Ga0395901_0000013_234732_236150 465
776 3300039437 Ga0436365_0142198 Ga0436365_0142198_212_1618 465
777 3300039437 Ga0436365_1887405 Ga0436365_1887405_3647_5044 465
778 3300046459 Ga0495629_0014320 Ga0495629_0014320_2053_3459 465
779 3300046471 Ga0495650_0056989 Ga0495650_0056989_131_1543 465
780 3300046507 Ga0495606_0000183 Ga0495606_0000183_42297_43694 465
781 3300046512 Ga0495610_0035251 Ga0495610_0035251_861_2267 465
782 3300046522 Ga0495643_0003868 Ga0495643_0003868_3173_4579 465
783 3300046528 Ga0495642_0005554 Ga0495642_0005554_2297_3709 465
784 3300046539 Ga0495621_0002949 Ga0495621_0002949_198_1595 465
785 3300046542 Ga0495597_0001344 Ga0495597_0001344_7357_8763 465
786 3300046557 Ga0495622_0000663 Ga0495622_0000663_16157_17563 465
787 3300046616 Ga0495668_0033179 Ga0495668_0033179_202_1608 465
788 3300046660 Ga0495625_0019585 Ga0495625_0019585_1170_2582 465
789 3300046684 Ga0495669_0000006 Ga0495669_0000006_156293_157690 465
790 3300046689 Ga0495613_0001679 Ga0495613_0001679_8823_10220 465
791 3300047320 Ga0495672_0054430 Ga0495672_0054430_338_1747 465
792 3300048905 Ga0496102_0075311 Ga0496102_0075311_93_1499 465
793 3300048909 Ga0496106_0089566 Ga0496106_0089566_871_2277 465
794 3300048915 Ga0496112_0150153 Ga0496112_0150153_438_1850 465
795 3300048918 Ga0496115_0002713 Ga0496115_0002713_4827_6236 465
796 3300048918 Ga0496115_0064426 Ga0496115_0064426_1190_2599 465
797 3300048920 Ga0496117_0074945 Ga0496117_0074945_510_1916 465
798 3300048921 Ga0496118_0007783 Ga0496118_0007783_3075_4481 465
799 3300048922 Ga0496119_0028389 Ga0496119_0028389_2362_3768 465
800 3300048924 Ga0496121_0000874 Ga0496121_0000874_48413_49819 465
801 3300049581 Ga0501047_0103518 Ga0501047_0103518_388_1794 465
802 3300049822 Ga0501035_0026544 Ga0501035_0026544_1628_3034 465
803 3300050491 nmdc:mga00v17_7244_c1 nmdc:mga00v17_7244_c1_3533_4939 465
804 3300050492 nmdc:mga0yw44_115444_c1 nmdc:mga0yw44_115444_c1_278_1696 465
805 3300050493 nmdc:mga0k408_20130_c2 nmdc:mga0k408_20130_c2_137_1543 465
806 3300053080 Ga0500635_0000297 Ga0500635_0000297_1043_2449 465
807 3300053080 Ga0500635_0000384 Ga0500635_0000384_9563_10972 465
808 3300053087 Ga0500643_003722 Ga0500643_003722_4877_6274 465
809 3300053087 Ga0500643_013970 Ga0500643_013970_1295_2701 465
810 3300053092 Ga0500583_0016822 Ga0500583_0016822_524_1930 465
811 3300053103 Ga0500555_004667 Ga0500555_004667_920_2326 465
812 3300053108 Ga0500562_009205 Ga0500562_009205_879_2288 465
813 3300053108 Ga0500562_021430 Ga0500562_021430_184_1584 465
814 3300053109 Ga0500569_000447 Ga0500569_000447_238_1644 465
815 3300053111 Ga0500572_000705 Ga0500572_000705_573_1973 465
816 3300053119 Ga0500595_024072 Ga0500595_024072_642_2048 465
817 3300053122 Ga0500608_000121 Ga0500608_000121_1005_2411 465
818 3300053122 Ga0500608_007058 Ga0500608_007058_2298_3704 465
819 3300053123 Ga0500614_001258 Ga0500614_001258_3066_4472 465
820 3300053136 Ga0500559_0000004 Ga0500559_0000004_37595_38992 465
821 3300053148 Ga0500590_006966 Ga0500590_006966_997_2403 465
822 3300053154 Ga0500619_004796 Ga0500619_004796_526_1932 465
823 3300053156 Ga0500622_0046361 Ga0500622_0046361_20_1420 465
824 3300053178 Ga0500637_0007620 Ga0500637_0007620_2972_4378 465
825 3300053730 Ga0500645_008465 Ga0500645_008465_1667_3085 465
826 3300053735 Ga0500596_002429 Ga0500596_002429_1117_2523 465
827 2124908027 MRS2a_Contig_81 MRS2a_00665090 466
828 3300003771 Ga0055526_1023555 Ga0055526_10235551 466
829 3300003773 Ga0055537_1000985 Ga0055537_10009856 466
830 3300003781 Ga0055536_1000055 Ga0055536_100005536 466
831 3300003781 Ga0055536_1000257 Ga0055536_100025723 466
832 3300003790 Ga0055528_1004889 Ga0055528_10048893 466
833 3300003791 Ga0055530_10000068 Ga0055530_1000006845 466
834 3300003791 Ga0055530_10000077 Ga0055530_1000007744 466
835 3300003792 Ga0055540_1000106 Ga0055540_100010632 466
836 3300003792 Ga0055540_1000410 Ga0055540_100041026 466
837 3300005288 Ga0065714_10000447 Ga0065714_100004474 466
838 3300005288 Ga0065714_10002560 Ga0065714_100025601 466
839 3300005288 Ga0065714_10005642 Ga0065714_100056427 466
840 3300005288 Ga0065714_10065178 Ga0065714_100651784 466
841 3300005289 Ga0065704_10000458 Ga0065704_1000045815 466
842 3300005289 Ga0065704_10002205 Ga0065704_100022052 466
843 3300005289 Ga0065704_10070235 Ga0065704_1007023524 466
844 3300006058 Ga0075432_10000027 Ga0075432_1000002722 466
845 3300006944 Ga0099823_1000078 Ga0099823_100007833 466
846 3300006944 Ga0099823_1007403 Ga0099823_10074032 466
847 3300006946 Ga0079104_1000189 Ga0079104_100018942 466
848 3300006946 Ga0079104_1000262 Ga0079104_100026253 466
849 3300006946 Ga0079104_1004139 Ga0079104_10041393 466
850 3300009011 Ga0105251_10000804 Ga0105251_100008049 466
851 3300009036 Ga0105244_10001174 Ga0105244_1000117413 466
852 3300009036 Ga0105244_10001715 Ga0105244_1000171512 466
853 3300009036 Ga0105244_10002614 Ga0105244_100026143 466
854 3300009036 Ga0105244_10009928 Ga0105244_100099285 466
855 3300009036 Ga0105244_10029508 Ga0105244_100295082 466
856 3300009036 Ga0105244_10085814 Ga0105244_100858141 466
857 3300009092 Ga0105250_10008837 Ga0105250_100088372 466
858 3300009092 Ga0105250_10031362 Ga0105250_100313622 466
859 3300009148 Ga0105243_10000342 Ga0105243_1000034234 466
860 3300009148 Ga0105243_10001040 Ga0105243_1000104014 466
861 3300009148 Ga0105243_10001458 Ga0105243_100014585 466
862 3300011119 Ga0105246_10000129 Ga0105246_1000012927 466
863 3300013100 Ga0157373_10000293 Ga0157373_1000029314 466
864 3300013100 Ga0157373_10009920 Ga0157373_100099204 466
865 3300013102 Ga0157371_10000432 Ga0157371_1000043224 466
866 3300013104 Ga0157370_10002182 Ga0157370_1000218213 466
867 3300013104 Ga0157370_10012632 Ga0157370_100126323 466
868 3300013104 Ga0157370_10032962 Ga0157370_100329622 466
869 3300013104 Ga0157370_10053571 Ga0157370_100535712 466
870 3300013104 Ga0157370_10139796 Ga0157370_101397962 466
871 3300013105 Ga0157369_10000523 Ga0157369_1000052323 466
872 3300013306 Ga0163162_10000706 Ga0163162_1000070618 466
873 3300014497 Ga0182008_10002959 Ga0182008_100029597 466
874 3300014497 Ga0182008_10012276 Ga0182008_100122762 466
875 3300015261 Ga0182006_1001146 Ga0182006_10011464 466
876 3300015261 Ga0182006_1006053 Ga0182006_10060534 466
877 3300015261 Ga0182006_1016356 Ga0182006_10163562 466
878 3300015262 Ga0182007_10000178 Ga0182007_1000017814 466
879 3300015262 Ga0182007_10001957 Ga0182007_100019572 466
880 3300015265 Ga0182005_1000274 Ga0182005_100027427 466
881 3300015265 Ga0182005_1000939 Ga0182005_10009394 466
882 3300017792 Ga0163161_10000250 Ga0163161_1000025032 466
883 3300017792 Ga0163161_10001625 Ga0163161_100016256 466
884 3300017792 Ga0163161_10018558 Ga0163161_100185583 466
885 3300025263 Ga0209565_1000271 Ga0209565_100027130 466
886 3300025273 Ga0209673_1001417 Ga0209673_100141710 466
887 3300025291 Ga0209675_1004874 Ga0209675_10048743 466
888 3300025292 Ga0209676_1000262 Ga0209676_100026243 466
889 3300025292 Ga0209676_1000271 Ga0209676_100027163 466
890 3300025292 Ga0209676_1000278 Ga0209676_100027818 466
891 3300025292 Ga0209676_1000394 Ga0209676_100039413 466
892 3300025292 Ga0209676_1000765 Ga0209676_100076534 466
893 3300025295 Ga0209564_1001539 Ga0209564_100153918 466
894 3300025295 Ga0209564_1031906 Ga0209564_10319061 466
895 3300025297 Ga0209758_1006335 Ga0209758_10063357 466
896 3300025297 Ga0209758_1006627 Ga0209758_10066273 466
897 3300025298 Ga0209050_1000061 Ga0209050_1000061236 466
898 3300025298 Ga0209050_1000241 Ga0209050_100024172 466
899 3300025303 Ga0209051_1000203 Ga0209051_100020361 466
900 3300025303 Ga0209051_1000222 Ga0209051_100022245 466
901 3300025303 Ga0209051_1000983 Ga0209051_100098311 466
902 3300025304 Ga0209257_1000036 Ga0209257_1000036115 466
903 3300025304 Ga0209257_1000725 Ga0209257_100072524 466
904 3300025711 Ga0207696_1000055 Ga0207696_100005595 466
905 3300025711 Ga0207696_1001175 Ga0207696_10011755 466
906 3300025728 Ga0207655_1000116 Ga0207655_1000116125 466
907 3300025728 Ga0207655_1000663 Ga0207655_10006638 466
908 3300025728 Ga0207655_1000757 Ga0207655_10007575 466
909 3300025728 Ga0207655_1003150 Ga0207655_10031504 466
910 3300025728 Ga0207655_1003167 Ga0207655_10031674 466
911 3300025728 Ga0207655_1004158 Ga0207655_10041589 466
912 3300025728 Ga0207655_1004449 Ga0207655_10044492 466
913 3300025728 Ga0207655_1006715 Ga0207655_10067152 466
914 3300025728 Ga0207655_1028168 Ga0207655_10281683 466
915 3300025735 Ga0207713_1000188 Ga0207713_100018850 466
916 3300025735 Ga0207713_1000588 Ga0207713_100058813 466
917 3300025735 Ga0207713_1000717 Ga0207713_10007179 466
918 3300025735 Ga0207713_1001114 Ga0207713_100111411 466
919 3300025735 Ga0207713_1004218 Ga0207713_10042184 466
920 3300025735 Ga0207713_1010633 Ga0207713_10106332 466
921 3300025735 Ga0207713_1013351 Ga0207713_10133513 466
922 3300025935 Ga0207709_10000061 Ga0207709_1000006123 466
923 3300025935 Ga0207709_10000626 Ga0207709_1000062613 466
924 3300026041 Ga0207639_10001991 Ga0207639_100019914 466
925 3300027111 Ga0209281_1000016 Ga0209281_1000016520 466
926 3300027111 Ga0209281_1000091 Ga0209281_100009142 466
927 3300027111 Ga0209281_1002831 Ga0209281_10028314 466
928 3300027296 Ga0209389_1000036 Ga0209389_100003684 466
929 3300027312 Ga0209371_1001083 Ga0209371_100108318 466
930 3300028379 Ga0268266_10227331 Ga0268266_102273311 466
931 3300028794 Ga0307515_10045304 Ga0307515_100453046 466
932 3300028800 Ga0265338_10019460 Ga0265338_100194603 466
933 3300028800 Ga0265338_10071089 Ga0265338_100710891 466
934 3300030500 Ga0268256_1000912 Ga0268256_10009123 466
935 3300030521 Ga0307511_10004234 Ga0307511_100042346 466
936 3300030731 Ga0316177_1188425 Ga0316177_11884252 466
937 3300030733 Ga0314311_1083059 Ga0314311_10830592 466
938 3300030742 Ga0316183_1020455 Ga0316183_10204552 466
939 3300031548 Ga0307408_100000392 Ga0307408_10000039217 466
940 3300031548 Ga0307408_100000577 Ga0307408_10000057718 466
941 3300031548 Ga0307408_100001053 Ga0307408_10000105318 466
942 3300031731 Ga0307405_10000093 Ga0307405_1000009327 466
943 3300031731 Ga0307405_10000145 Ga0307405_1000014513 466
944 3300031911 Ga0307412_10000174 Ga0307412_1000017423 466
945 3300031911 Ga0307412_10000276 Ga0307412_1000027626 466
946 3300031911 Ga0307412_10001934 Ga0307412_100019343 466
947 3300032002 Ga0307416_100153283 Ga0307416_1001532832 466
948 3300032004 Ga0307414_10128683 Ga0307414_101286831 466
949 3300032004 Ga0307414_10171651 Ga0307414_101716512 466
950 3300032005 Ga0307411_10124112 Ga0307411_101241121 466
951 3300037418 Ga0395900_0075889 Ga0395900_0075889_786_2204 466
952 3300041405 Ga0439438_000135 Ga0439438_000135_10517_11917 466
953 3300041405 Ga0439438_000164 Ga0439438_000164_17244_18644 466
954 3300041407 Ga0439447_000072 Ga0439447_000072_22692_24092 466
955 3300041407 Ga0439447_002193 Ga0439447_002193_376_1776 466
956 3300041407 Ga0439447_005949 Ga0439447_005949_79_1479 466
957 3300041411 Ga0439466_0000252 Ga0439466_0000252_8709_10109 466
958 3300041411 Ga0439466_0000307 Ga0439466_0000307_6722_8122 466
959 3300041411 Ga0439466_0000743 Ga0439466_0000743_6872_8272 466
960 3300041411 Ga0439466_0004150 Ga0439466_0004150_1512_2912 466
961 3300041997 Ga0439431_0000017 Ga0439431_0000017_3732_5132 466
962 3300042000 Ga0439437_000770 Ga0439437_000770_169_1569 466
963 3300042006 Ga0439432_000225 Ga0439432_000225_15104_16504 466
964 3300042006 Ga0439432_000445 Ga0439432_000445_5535_6935 466
965 3300042006 Ga0439432_001442 Ga0439432_001442_4943_6343 466
966 3300042009 Ga0439451_000489 Ga0439451_000489_1155_2555 466
967 3300042010 Ga0439452_000807 Ga0439452_000807_2522_3922 466
968 3300042010 Ga0439452_001571 Ga0439452_001571_3298_4698 466
969 3300042010 Ga0439452_005119 Ga0439452_005119_1380_2780 466
970 3300042013 Ga0439456_000151 Ga0439456_000151_12884_14284 466
971 3300042016 Ga0439463_000021 Ga0439463_000021_490_2067 466
972 3300042016 Ga0439463_000587 Ga0439463_000587_1051_2451 466
973 3300042115 Ga0450911_000015 Ga0450911_000015_166_1566 466
974 3300042137 Ga0450902_000397 Ga0450902_000397_3259_4659 466
975 3300042138 Ga0450903_002313 Ga0450903_002313_350_1858 466
976 3300042139 Ga0450904_001129 Ga0450904_001129_1265_2665 466
977 3300042139 Ga0450904_001319 Ga0450904_001319_2070_3470 466
978 3300042146 Ga0450907_000052 Ga0450907_000052_29172_30572 466
979 3300042156 Ga0439446_0004360 Ga0439446_0004360_1187_2587 466
980 3300042156 Ga0439446_0009644 Ga0439446_0009644_778_2178 466
981 3300042185 Ga0450909_000317 Ga0450909_000317_217_1617 466
982 3300042435 Ga0439434_0000007 Ga0439434_0000007_29141_30541 466
983 3300042438 Ga0439459_0001726 Ga0439459_0001726_1735_3135 466
984 3300042439 Ga0439464_0000752 Ga0439464_0000752_3811_5211 466
985 3300042461 Ga0439460_0003567 Ga0439460_0003567_1282_2790 466
986 3300042530 Ga0450916_002837 Ga0450916_002837_11_1411 466
987 3300042532 Ga0450893_0002447 Ga0450893_0002447_1358_2758 466
988 3300042533 Ga0450901_000107 Ga0450901_000107_1025_2425 466
989 3300042533 Ga0450901_000206 Ga0450901_000206_5511_6911 466
990 3300042993 Ga0439440_0000124 Ga0439440_0000124_7575_9083 466
991 3300046452 Ga0495617_000124 Ga0495617_000124_35411_36811 466
992 3300046452 Ga0495617_000195 Ga0495617_000195_18650_20050 466
993 3300046452 Ga0495617_015826 Ga0495617_015826_180_1580 466
994 3300046453 Ga0495627_000115 Ga0495627_000115_2012_3412 466
995 3300046453 Ga0495627_000264 Ga0495627_000264_23956_25356 466
996 3300046453 Ga0495627_000959 Ga0495627_000959_11706_13106 466
997 3300046453 Ga0495627_001215 Ga0495627_001215_12431_13831 466
998 3300046453 Ga0495627_001340 Ga0495627_001340_7835_9235 466
999 3300046455 Ga0495603_0001230 Ga0495603_0001230_8584_9984 466
1000 3300046457 Ga0495590_0000164 Ga0495590_0000164_13299_14699 466
1001 3300046457 Ga0495590_0000245 Ga0495590_0000245_7849_9249 466
1002 3300046457 Ga0495590_0000277 Ga0495590_0000277_12945_14345 466
1003 3300046458 Ga0495591_000061 Ga0495591_000061_15912_17312 466
1004 3300046458 Ga0495591_000145 Ga0495591_000145_48091_49491 466
1005 3300046458 Ga0495591_000193 Ga0495591_000193_36930_38330 466
1006 3300046458 Ga0495591_000308 Ga0495591_000308_23897_25297 466
1007 3300046458 Ga0495591_000378 Ga0495591_000378_12484_13884 466
1008 3300046458 Ga0495591_000416 Ga0495591_000416_11902_13302 466
1009 3300046458 Ga0495591_000492 Ga0495591_000492_4403_5803 466
1010 3300046458 Ga0495591_001496 Ga0495591_001496_11522_12922 466
1011 3300046458 Ga0495591_001759 Ga0495591_001759_11027_12427 466
1012 3300046458 Ga0495591_005196 Ga0495591_005196_216_1616 466
1013 3300046458 Ga0495591_009354 Ga0495591_009354_2437_3837 466
1014 3300046458 Ga0495591_012747 Ga0495591_012747_189_1589 466
1015 3300046458 Ga0495591_018420 Ga0495591_018420_601_2001 466
1016 3300046460 Ga0495638_0000439 Ga0495638_0000439_38038_39438 466
1017 3300046460 Ga0495638_0000888 Ga0495638_0000888_2779_4179 466
1018 3300046460 Ga0495638_0001080 Ga0495638_0001080_11724_13124 466
1019 3300046460 Ga0495638_0003596 Ga0495638_0003596_2940_4340 466
1020 3300046460 Ga0495638_0003906 Ga0495638_0003906_8822_10222 466
1021 3300046460 Ga0495638_0026560 Ga0495638_0026560_440_1840 466
1022 3300046463 Ga0495653_0000469 Ga0495653_0000469_24616_26016 466
1023 3300046463 Ga0495653_0005088 Ga0495653_0005088_4831_6231 466
1024 3300046463 Ga0495653_0005152 Ga0495653_0005152_7772_9172 466
1025 3300046463 Ga0495653_0081855 Ga0495653_0081855_948_2348 466
1026 3300046471 Ga0495650_0000046 Ga0495650_0000046_179090_180490 466
1027 3300046471 Ga0495650_0000660 Ga0495650_0000660_21871_23271 466
1028 3300046471 Ga0495650_0000925 Ga0495650_0000925_7477_8877 466
1029 3300046471 Ga0495650_0000973 Ga0495650_0000973_22223_23623 466
1030 3300046471 Ga0495650_0001175 Ga0495650_0001175_13467_14867 466
1031 3300046471 Ga0495650_0008614 Ga0495650_0008614_1837_3237 466
1032 3300046471 Ga0495650_0009427 Ga0495650_0009427_2501_3901 466
1033 3300046471 Ga0495650_0045103 Ga0495650_0045103_190_1590 466
1034 3300046474 Ga0495605_0000079 Ga0495605_0000079_92041_93441 466
1035 3300046474 Ga0495605_0000216 Ga0495605_0000216_37565_38965 466
1036 3300046474 Ga0495605_0000289 Ga0495605_0000289_17758_19158 466
1037 3300046474 Ga0495605_0000371 Ga0495605_0000371_16461_17861 466
1038 3300046474 Ga0495605_0000396 Ga0495605_0000396_23679_25079 466
1039 3300046474 Ga0495605_0000513 Ga0495605_0000513_9623_11023 466
1040 3300046474 Ga0495605_0000713 Ga0495605_0000713_10880_12280 466
1041 3300046474 Ga0495605_0000947 Ga0495605_0000947_11559_12959 466
1042 3300046474 Ga0495605_0001356 Ga0495605_0001356_9697_11097 466
1043 3300046474 Ga0495605_0002382 Ga0495605_0002382_3459_4859 466
1044 3300046475 Ga0495639_0000023 Ga0495639_0000023_44228_45628 466
1045 3300046475 Ga0495639_0038462 Ga0495639_0038462_48_1448 466
1046 3300046491 Ga0495584_0000266 Ga0495584_0000266_17151_18551 466
1047 3300046491 Ga0495584_0000545 Ga0495584_0000545_20102_21502 466
1048 3300046491 Ga0495584_0000649 Ga0495584_0000649_5803_7203 466
1049 3300046491 Ga0495584_0000897 Ga0495584_0000897_15043_16443 466
1050 3300046491 Ga0495584_0000927 Ga0495584_0000927_6329_7729 466
1051 3300046491 Ga0495584_0007324 Ga0495584_0007324_1129_2529 466
1052 3300046491 Ga0495584_0007886 Ga0495584_0007886_2780_4180 466
1053 3300046492 Ga0495585_0000378 Ga0495585_0000378_28697_30097 466
1054 3300046492 Ga0495585_0000960 Ga0495585_0000960_11657_13057 466
1055 3300046492 Ga0495585_0002142 Ga0495585_0002142_12884_14284 466
1056 3300046492 Ga0495585_0006739 Ga0495585_0006739_4326_5726 466
1057 3300046492 Ga0495585_0011527 Ga0495585_0011527_1166_2566 466
1058 3300046492 Ga0495585_0011975 Ga0495585_0011975_157_1557 466
1059 3300046492 Ga0495585_0024080 Ga0495585_0024080_1027_2427 466
1060 3300046499 Ga0495594_0002415 Ga0495594_0002415_4256_5656 466
1061 3300046499 Ga0495594_0009411 Ga0495594_0009411_733_2133 466
1062 3300046500 Ga0495596_0002933 Ga0495596_0002933_2557_3957 466
1063 3300046500 Ga0495596_0005845 Ga0495596_0005845_2592_3992 466
1064 3300046501 Ga0495607_0000205 Ga0495607_0000205_29759_31159 466
1065 3300046501 Ga0495607_0000257 Ga0495607_0000257_51616_53016 466
1066 3300046501 Ga0495607_0000261 Ga0495607_0000261_23894_25294 466
1067 3300046501 Ga0495607_0000387 Ga0495607_0000387_20983_22383 466
1068 3300046501 Ga0495607_0000418 Ga0495607_0000418_22648_24048 466
1069 3300046501 Ga0495607_0000500 Ga0495607_0000500_21942_23342 466
1070 3300046501 Ga0495607_0012366 Ga0495607_0012366_1990_3390 466
1071 3300046501 Ga0495607_0018021 Ga0495607_0018021_848_2248 466
1072 3300046501 Ga0495607_0029876 Ga0495607_0029876_1122_2522 466
1073 3300046501 Ga0495607_0045064 Ga0495607_0045064_867_2267 466
1074 3300046501 Ga0495607_0045944 Ga0495607_0045944_1098_2498 466
1075 3300046506 Ga0495583_0000025 Ga0495583_0000025_62518_63918 466
1076 3300046506 Ga0495583_0000362 Ga0495583_0000362_20795_22195 466
1077 3300046506 Ga0495583_0001149 Ga0495583_0001149_1230_2630 466
1078 3300046506 Ga0495583_0001157 Ga0495583_0001157_23793_25193 466
1079 3300046506 Ga0495583_0001967 Ga0495583_0001967_1566_2966 466
1080 3300046506 Ga0495583_0003316 Ga0495583_0003316_1433_2833 466
1081 3300046506 Ga0495583_0004139 Ga0495583_0004139_6561_7961 466
1082 3300046506 Ga0495583_0012584 Ga0495583_0012584_2006_3406 466
1083 3300046507 Ga0495606_0000139 Ga0495606_0000139_84180_85580 466
1084 3300046507 Ga0495606_0000370 Ga0495606_0000370_50880_52280 466
1085 3300046507 Ga0495606_0000502 Ga0495606_0000502_47155_48555 466
1086 3300046507 Ga0495606_0000998 Ga0495606_0000998_24125_25525 466
1087 3300046507 Ga0495606_0001914 Ga0495606_0001914_13622_15022 466
1088 3300046507 Ga0495606_0009725 Ga0495606_0009725_4822_6222 466
1089 3300046507 Ga0495606_0016288 Ga0495606_0016288_2714_4114 466
1090 3300046507 Ga0495606_0019137 Ga0495606_0019137_513_1913 466
1091 3300046507 Ga0495606_0049009 Ga0495606_0049009_60_1460 466
1092 3300046512 Ga0495610_0000853 Ga0495610_0000853_9121_10521 466
1093 3300046512 Ga0495610_0001032 Ga0495610_0001032_3509_4909 466
1094 3300046512 Ga0495610_0001081 Ga0495610_0001081_7815_9215 466
1095 3300046512 Ga0495610_0001923 Ga0495610_0001923_3591_4991 466
1096 3300046512 Ga0495610_0002405 Ga0495610_0002405_4865_6280 466
1097 3300046512 Ga0495610_0002636 Ga0495610_0002636_5291_6691 466
1098 3300046512 Ga0495610_0004985 Ga0495610_0004985_4985_6385 466
1099 3300046512 Ga0495610_0005870 Ga0495610_0005870_4795_6195 466
1100 3300046512 Ga0495610_0008944 Ga0495610_0008944_416_1816 466
1101 3300046512 Ga0495610_0012313 Ga0495610_0012313_2549_3949 466
1102 3300046512 Ga0495610_0027297 Ga0495610_0027297_1385_2785 466
1103 3300046513 Ga0495616_0000369 Ga0495616_0000369_22051_23451 466
1104 3300046513 Ga0495616_0000710 Ga0495616_0000710_1348_2748 466
1105 3300046513 Ga0495616_0001884 Ga0495616_0001884_3000_4400 466
1106 3300046513 Ga0495616_0001915 Ga0495616_0001915_76_1476 466
1107 3300046513 Ga0495616_0017627 Ga0495616_0017627_1907_3307 466
1108 3300046515 Ga0495620_0000044 Ga0495620_0000044_96765_98165 466
1109 3300046515 Ga0495620_0000309 Ga0495620_0000309_20979_22379 466
1110 3300046515 Ga0495620_0000339 Ga0495620_0000339_26909_28309 466
1111 3300046515 Ga0495620_0000697 Ga0495620_0000697_17754_19154 466
1112 3300046515 Ga0495620_0001785 Ga0495620_0001785_6839_8239 466
1113 3300046515 Ga0495620_0004815 Ga0495620_0004815_3278_4678 466
1114 3300046515 Ga0495620_0004891 Ga0495620_0004891_5954_7354 466
1115 3300046515 Ga0495620_0010382 Ga0495620_0010382_1640_3040 466
1116 3300046515 Ga0495620_0034212 Ga0495620_0034212_392_1792 466
1117 3300046518 Ga0495631_0000056 Ga0495631_0000056_30065_31465 466
1118 3300046518 Ga0495631_0000194 Ga0495631_0000194_14670_16070 466
1119 3300046518 Ga0495631_0001167 Ga0495631_0001167_2660_4060 466
1120 3300046518 Ga0495631_0006327 Ga0495631_0006327_1368_2768 466
1121 3300046518 Ga0495631_0024274 Ga0495631_0024274_770_2170 466
1122 3300046519 Ga0495632_0000232 Ga0495632_0000232_9973_11373 466
1123 3300046519 Ga0495632_0000326 Ga0495632_0000326_24134_25534 466
1124 3300046519 Ga0495632_0000454 Ga0495632_0000454_12831_14231 466
1125 3300046519 Ga0495632_0000687 Ga0495632_0000687_28238_29638 466
1126 3300046519 Ga0495632_0002296 Ga0495632_0002296_796_2196 466
1127 3300046519 Ga0495632_0002424 Ga0495632_0002424_12121_13521 466
1128 3300046519 Ga0495632_0007602 Ga0495632_0007602_14_1414 466
1129 3300046520 Ga0495637_0000066 Ga0495637_0000066_25598_26998 466
1130 3300046520 Ga0495637_0000157 Ga0495637_0000157_34938_36338 466
1131 3300046520 Ga0495637_0000182 Ga0495637_0000182_21472_22872 466
1132 3300046520 Ga0495637_0000299 Ga0495637_0000299_23967_25367 466
1133 3300046520 Ga0495637_0000636 Ga0495637_0000636_10872_12272 466
1134 3300046520 Ga0495637_0001138 Ga0495637_0001138_12142_13542 466
1135 3300046520 Ga0495637_0001715 Ga0495637_0001715_201_1601 466
1136 3300046520 Ga0495637_0001839 Ga0495637_0001839_471_1871 466
1137 3300046520 Ga0495637_0002376 Ga0495637_0002376_2849_4249 466
1138 3300046520 Ga0495637_0003988 Ga0495637_0003988_2470_3870 466
1139 3300046520 Ga0495637_0004625 Ga0495637_0004625_1345_2745 466
1140 3300046520 Ga0495637_0004997 Ga0495637_0004997_1725_3125 466
1141 3300046522 Ga0495643_0000511 Ga0495643_0000511_8548_9987 466
1142 3300046522 Ga0495643_0001141 Ga0495643_0001141_17362_18762 466
1143 3300046522 Ga0495643_0001412 Ga0495643_0001412_8351_9751 466
1144 3300046522 Ga0495643_0001456 Ga0495643_0001456_17657_19057 466
1145 3300046522 Ga0495643_0002071 Ga0495643_0002071_545_1945 466
1146 3300046522 Ga0495643_0005627 Ga0495643_0005627_2959_4359 466
1147 3300046522 Ga0495643_0027578 Ga0495643_0027578_391_1791 466
1148 3300046522 Ga0495643_0035143 Ga0495643_0035143_1038_2438 466
1149 3300046522 Ga0495643_0036129 Ga0495643_0036129_179_1579 466
1150 3300046523 Ga0495644_0006755 Ga0495644_0006755_1192_2592 466
1151 3300046523 Ga0495644_0046355 Ga0495644_0046355_177_1577 466
1152 3300046524 Ga0495648_0000458 Ga0495648_0000458_23890_25290 466
1153 3300046524 Ga0495648_0000579 Ga0495648_0000579_24512_25912 466
1154 3300046524 Ga0495648_0000861 Ga0495648_0000861_8906_10306 466
1155 3300046524 Ga0495648_0001229 Ga0495648_0001229_11004_12404 466
1156 3300046524 Ga0495648_0001234 Ga0495648_0001234_22601_24001 466
1157 3300046524 Ga0495648_0001592 Ga0495648_0001592_10762_12162 466
1158 3300046524 Ga0495648_0001787 Ga0495648_0001787_9571_10971 466
1159 3300046524 Ga0495648_0002912 Ga0495648_0002912_2470_3870 466
1160 3300046524 Ga0495648_0030491 Ga0495648_0030491_1919_3319 466
1161 3300046524 Ga0495648_0033109 Ga0495648_0033109_21_1421 466
1162 3300046524 Ga0495648_0065775 Ga0495648_0065775_351_1751 466
1163 3300046526 Ga0495666_0000115 Ga0495666_0000115_20980_22380 466
1164 3300046526 Ga0495666_0000747 Ga0495666_0000747_2338_3738 466
1165 3300046526 Ga0495666_0054986 Ga0495666_0054986_13_1413 466
1166 3300046528 Ga0495642_0000099 Ga0495642_0000099_20350_21750 466
1167 3300046528 Ga0495642_0000475 Ga0495642_0000475_7200_8600 466
1168 3300046530 Ga0495654_0000023 Ga0495654_0000023_201099_202499 466
1169 3300046530 Ga0495654_0000317 Ga0495654_0000317_14053_15453 466
1170 3300046530 Ga0495654_0000372 Ga0495654_0000372_11866_13266 466
1171 3300046530 Ga0495654_0000812 Ga0495654_0000812_13455_14855 466
1172 3300046530 Ga0495654_0006529 Ga0495654_0006529_3948_5348 466
1173 3300046530 Ga0495654_0010162 Ga0495654_0010162_1334_2734 466
1174 3300046530 Ga0495654_0029529 Ga0495654_0029529_894_2294 466
1175 3300046538 Ga0495609_0000098 Ga0495609_0000098_7452_8852 466
1176 3300046538 Ga0495609_0000146 Ga0495609_0000146_24783_26183 466
1177 3300046538 Ga0495609_0000284 Ga0495609_0000284_20793_22193 466
1178 3300046538 Ga0495609_0000586 Ga0495609_0000586_27049_28449 466
1179 3300046538 Ga0495609_0001745 Ga0495609_0001745_82_1482 466
1180 3300046538 Ga0495609_0002905 Ga0495609_0002905_4789_6189 466
1181 3300046538 Ga0495609_0013617 Ga0495609_0013617_590_1990 466
1182 3300046538 Ga0495609_0015575 Ga0495609_0015575_2135_3535 466
1183 3300046542 Ga0495597_0000370 Ga0495597_0000370_22252_23652 466
1184 3300046542 Ga0495597_0000835 Ga0495597_0000835_10050_11450 466
1185 3300046542 Ga0495597_0001523 Ga0495597_0001523_2628_4028 466
1186 3300046542 Ga0495597_0004039 Ga0495597_0004039_6605_8005 466
1187 3300046557 Ga0495622_0000135 Ga0495622_0000135_17366_18766 466
1188 3300046557 Ga0495622_0000510 Ga0495622_0000510_6460_7860 466
1189 3300046557 Ga0495622_0003901 Ga0495622_0003901_1004_2404 466
1190 3300046557 Ga0495622_0007183 Ga0495622_0007183_1765_3165 466
1191 3300046557 Ga0495622_0010014 Ga0495622_0010014_2878_4278 466
1192 3300046558 Ga0495633_0000201 Ga0495633_0000201_54316_55716 466
1193 3300046558 Ga0495633_0000604 Ga0495633_0000604_20683_22083 466
1194 3300046558 Ga0495633_0022257 Ga0495633_0022257_489_1889 466
1195 3300046616 Ga0495668_0000124 Ga0495668_0000124_64519_65919 466
1196 3300046616 Ga0495668_0000839 Ga0495668_0000839_20657_22057 466
1197 3300046616 Ga0495668_0005704 Ga0495668_0005704_2321_3721 466
1198 3300046616 Ga0495668_0010627 Ga0495668_0010627_1076_2476 466
1199 3300046616 Ga0495668_0012984 Ga0495668_0012984_1091_2491 466
1200 3300046616 Ga0495668_0025133 Ga0495668_0025133_269_1669 466
1201 3300046616 Ga0495668_0051410 Ga0495668_0051410_530_1930 466
1202 3300046616 Ga0495668_0080853 Ga0495668_0080853_84_1484 466
1203 3300046642 Ga0495634_0000515 Ga0495634_0000515_12724_14124 466
1204 3300046648 Ga0495611_0000098 Ga0495611_0000098_30631_32031 466
1205 3300046648 Ga0495611_0001294 Ga0495611_0001294_6248_7648 466
1206 3300046648 Ga0495611_0003777 Ga0495611_0003777_4671_6071 466
1207 3300046648 Ga0495611_0009730 Ga0495611_0009730_2291_3691 466
1208 3300046660 Ga0495625_0000113 Ga0495625_0000113_98054_99454 466
1209 3300046660 Ga0495625_0000233 Ga0495625_0000233_47293_48693 466
1210 3300046660 Ga0495625_0001741 Ga0495625_0001741_12124_13524 466
1211 3300046660 Ga0495625_0001802 Ga0495625_0001802_11478_12878 466
1212 3300046660 Ga0495625_0004643 Ga0495625_0004643_8521_9921 466
1213 3300046660 Ga0495625_0013267 Ga0495625_0013267_4214_5614 466
1214 3300046660 Ga0495625_0030260 Ga0495625_0030260_1745_3145 466
1215 3300046660 Ga0495625_0034269 Ga0495625_0034269_1088_2488 466
1216 3300046660 Ga0495625_0057929 Ga0495625_0057929_1133_2533 466
1217 3300046660 Ga0495625_0130615 Ga0495625_0130615_118_1518 466
1218 3300046663 Ga0495635_0000201 Ga0495635_0000201_12486_13886 466
1219 3300046664 Ga0495659_0000090 Ga0495659_0000090_25298_26698 466
1220 3300046665 Ga0495661_0000112 Ga0495661_0000112_25602_27002 466
1221 3300046665 Ga0495661_0000241 Ga0495661_0000241_33402_34802 466
1222 3300046665 Ga0495661_0000664 Ga0495661_0000664_7838_9238 466
1223 3300046665 Ga0495661_0012834 Ga0495661_0012834_2731_4131 466
1224 3300046665 Ga0495661_0022550 Ga0495661_0022550_2328_3728 466
1225 3300046674 Ga0495588_0009616 Ga0495588_0009616_2301_3701 466
1226 3300046679 Ga0495623_0000934 Ga0495623_0000934_1063_2463 466
1227 3300046684 Ga0495669_0000059 Ga0495669_0000059_23531_24931 466
1228 3300046691 Ga0495670_0000097 Ga0495670_0000097_12700_14100 466
1229 3300046691 Ga0495670_0057893 Ga0495670_0057893_508_1908 466
1230 3300046691 Ga0495670_0061605 Ga0495670_0061605_271_1671 466
1231 3300046692 Ga0495671_0000258 Ga0495671_0000258_24677_26077 466
1232 3300046692 Ga0495671_0000608 Ga0495671_0000608_14753_16153 466
1233 3300046692 Ga0495671_0000638 Ga0495671_0000638_4278_5678 466
1234 3300046692 Ga0495671_0000772 Ga0495671_0000772_12016_13455 466
1235 3300046692 Ga0495671_0001109 Ga0495671_0001109_11291_12691 466
1236 3300046692 Ga0495671_0015478 Ga0495671_0015478_1056_2456 466
1237 3300046692 Ga0495671_0016496 Ga0495671_0016496_1008_2408 466
1238 3300046692 Ga0495671_0016846 Ga0495671_0016846_1850_3250 466
1239 3300046692 Ga0495671_0025424 Ga0495671_0025424_1104_2504 466
1240 3300046692 Ga0495671_0038887 Ga0495671_0038887_718_2118 466
1241 3300046694 Ga0495649_0000323 Ga0495649_0000323_27955_29355 466
1242 3300046694 Ga0495649_0000520 Ga0495649_0000520_3137_4537 466
1243 3300046694 Ga0495649_0000681 Ga0495649_0000681_12817_14217 466
1244 3300046694 Ga0495649_0000855 Ga0495649_0000855_11756_13156 466
1245 3300046694 Ga0495649_0003884 Ga0495649_0003884_2164_3564 466
1246 3300046694 Ga0495649_0004684 Ga0495649_0004684_3938_5338 466
1247 3300046694 Ga0495649_0009149 Ga0495649_0009149_1780_3219 466
1248 3300046694 Ga0495649_0017849 Ga0495649_0017849_2084_3484 466
1249 3300046694 Ga0495649_0024300 Ga0495649_0024300_776_2176 466
1250 3300046694 Ga0495649_0025253 Ga0495649_0025253_1823_3223 466
1251 3300046694 Ga0495649_0094356 Ga0495649_0094356_106_1506 466
1252 3300046794 Ga0495589_0000181 Ga0495589_0000181_27153_28553 466
1253 3300046794 Ga0495589_0000229 Ga0495589_0000229_22144_23544 466
1254 3300046794 Ga0495589_0000264 Ga0495589_0000264_18494_19894 466
1255 3300046794 Ga0495589_0001632 Ga0495589_0001632_7839_9239 466
1256 3300046794 Ga0495589_0013513 Ga0495589_0013513_2538_3938 466
1257 3300046794 Ga0495589_0067430 Ga0495589_0067430_325_1725 466
1258 3300046810 Ga0495660_0000087 Ga0495660_0000087_40581_41981 466
1259 3300046810 Ga0495660_0000503 Ga0495660_0000503_20619_22019 466
1260 3300046810 Ga0495660_0000759 Ga0495660_0000759_11744_13144 466
1261 3300046810 Ga0495660_0000900 Ga0495660_0000900_17544_18944 466
1262 3300046810 Ga0495660_0001220 Ga0495660_0001220_11811_13211 466
1263 3300046810 Ga0495660_0001832 Ga0495660_0001832_7811_9211 466
1264 3300046810 Ga0495660_0002520 Ga0495660_0002520_1257_2657 466
1265 3300046810 Ga0495660_0003897 Ga0495660_0003897_6519_7919 466
1266 3300046810 Ga0495660_0011847 Ga0495660_0011847_1578_2978 466
1267 3300046810 Ga0495660_0030887 Ga0495660_0030887_266_1666 466
1268 3300046810 Ga0495660_0043171 Ga0495660_0043171_628_2028 466
1269 3300047315 Ga0495581_0000509 Ga0495581_0000509_8902_10302 466
1270 3300047317 Ga0495604_0004138 Ga0495604_0004138_7122_8522 466
1271 3300047318 Ga0495636_0003161 Ga0495636_0003161_158_1558 466
1272 3300047320 Ga0495672_0000552 Ga0495672_0000552_22866_24266 466
1273 3300047320 Ga0495672_0001805 Ga0495672_0001805_15090_16490 466
1274 3300047320 Ga0495672_0002163 Ga0495672_0002163_1344_2744 466
1275 3300047320 Ga0495672_0002310 Ga0495672_0002310_274_1674 466
1276 3300047320 Ga0495672_0004053 Ga0495672_0004053_9556_10956 466
1277 3300047320 Ga0495672_0006591 Ga0495672_0006591_2128_3528 466
1278 3300047320 Ga0495672_0013526 Ga0495672_0013526_3550_4950 466
1279 3300047320 Ga0495672_0013537 Ga0495672_0013537_4012_5412 466
1280 3300047320 Ga0495672_0019684 Ga0495672_0019684_466_1866 466
1281 3300047320 Ga0495672_0020591 Ga0495672_0020591_295_1827 466
1282 3300047320 Ga0495672_0024592 Ga0495672_0024592_1372_2772 466
1283 3300047320 Ga0495672_0035373 Ga0495672_0035373_635_2035 466
1284 3300047320 Ga0495672_0040093 Ga0495672_0040093_695_2146 466
1285 3300047321 Ga0495676_0000032 Ga0495676_0000032_25688_27088 466
1286 3300047321 Ga0495676_0000762 Ga0495676_0000762_13582_14982 466
1287 3300047322 Ga0495680_0001279 Ga0495680_0001279_22292_23692 466
1288 3300047322 Ga0495680_0005791 Ga0495680_0005791_6357_7757 466
1289 3300047323 Ga0495683_0000141 Ga0495683_0000141_20712_22112 466
1290 3300047323 Ga0495683_0000274 Ga0495683_0000274_18574_19974 466
1291 3300047323 Ga0495683_0000295 Ga0495683_0000295_14224_15624 466
1292 3300047323 Ga0495683_0004422 Ga0495683_0004422_974_2374 466
1293 3300047323 Ga0495683_0009122 Ga0495683_0009122_277_1677 466
1294 3300047446 Ga0495679_000116 Ga0495679_000116_24782_26182 466
1295 3300047446 Ga0495679_000387 Ga0495679_000387_6030_7430 466
1296 3300047446 Ga0495679_000772 Ga0495679_000772_7214_8614 466
1297 3300047446 Ga0495679_003626 Ga0495679_003626_3012_4412 466
1298 3300047446 Ga0495679_015305 Ga0495679_015305_1312_2712 466
1299 3300047469 Ga0495673_0000102 Ga0495673_0000102_132362_133762 466
1300 3300047469 Ga0495673_0000253 Ga0495673_0000253_49954_51354 466
1301 3300047469 Ga0495673_0000286 Ga0495673_0000286_38329_39729 466
1302 3300047469 Ga0495673_0000736 Ga0495673_0000736_18434_19834 466
1303 3300047469 Ga0495673_0000959 Ga0495673_0000959_14016_15416 466
1304 3300047469 Ga0495673_0001148 Ga0495673_0001148_19576_20976 466
1305 3300047469 Ga0495673_0001178 Ga0495673_0001178_18168_19568 466
1306 3300047469 Ga0495673_0001494 Ga0495673_0001494_6970_8370 466
1307 3300047469 Ga0495673_0001786 Ga0495673_0001786_3250_4650 466
1308 3300047469 Ga0495673_0002848 Ga0495673_0002848_3043_4443 466
1309 3300047469 Ga0495673_0014816 Ga0495673_0014816_1788_3188 466
1310 3300047469 Ga0495673_0021667 Ga0495673_0021667_974_2374 466
1311 3300047469 Ga0495673_0029742 Ga0495673_0029742_469_1869 466
1312 3300047470 Ga0495681_0000168 Ga0495681_0000168_22502_23902 466
1313 3300047470 Ga0495681_0000238 Ga0495681_0000238_22563_23963 466
1314 3300047470 Ga0495681_0000320 Ga0495681_0000320_22652_24052 466
1315 3300047470 Ga0495681_0000996 Ga0495681_0000996_8335_9735 466
1316 3300047470 Ga0495681_0001895 Ga0495681_0001895_1694_3094 466
1317 3300047470 Ga0495681_0003398 Ga0495681_0003398_2755_4155 466
1318 3300047470 Ga0495681_0009366 Ga0495681_0009366_544_1944 466
1319 3300047470 Ga0495681_0018862 Ga0495681_0018862_763_2163 466
1320 3300047470 Ga0495681_0019511 Ga0495681_0019511_1852_3252 466
1321 3300047472 Ga0495686_0001232 Ga0495686_0001232_20107_21507 466
1322 3300047472 Ga0495686_0001602 Ga0495686_0001602_10806_12206 466
1323 3300047472 Ga0495686_0001767 Ga0495686_0001767_8343_9743 466
1324 3300047472 Ga0495686_0004310 Ga0495686_0004310_7950_9350 466
1325 3300048091 Ga0495626_0000024 Ga0495626_0000024_24737_26137 466
1326 3300048091 Ga0495626_0000401 Ga0495626_0000401_12554_13954 466
1327 3300048091 Ga0495626_0000488 Ga0495626_0000488_13318_14718 466
1328 3300048091 Ga0495626_0001600 Ga0495626_0001600_6761_8161 466
1329 3300048091 Ga0495626_0002157 Ga0495626_0002157_11164_12564 466
1330 3300048091 Ga0495626_0002326 Ga0495626_0002326_10629_12029 466
1331 3300048091 Ga0495626_0005181 Ga0495626_0005181_4787_6187 466
1332 3300048091 Ga0495626_0039323 Ga0495626_0039323_808_2208 466
1333 3300048904 Ga0496101_0176850 Ga0496101_0176850_33_1433 466
1334 3300048905 Ga0496102_0000304 Ga0496102_0000304_27425_28825 466
1335 3300048906 Ga0496103_0000544 Ga0496103_0000544_23649_25049 466
1336 3300048909 Ga0496106_0012070 Ga0496106_0012070_4556_5956 466
1337 3300048910 Ga0496107_0000028 Ga0496107_0000028_57509_58909 466
1338 3300048913 Ga0496110_0011514 Ga0496110_0011514_2454_3854 466
1339 3300048913 Ga0496110_0064832 Ga0496110_0064832_1468_2868 466
1340 3300048913 Ga0496110_0243314 Ga0496110_0243314_50_1450 466
1341 3300048917 Ga0496114_0016603 Ga0496114_0016603_2276_3676 466
1342 3300048918 Ga0496115_0012802 Ga0496115_0012802_3331_4731 466
1343 3300048919 Ga0496116_0000761 Ga0496116_0000761_27559_28959 466
1344 3300048919 Ga0496116_0000831 Ga0496116_0000831_25304_26704 466
1345 3300048919 Ga0496116_0010403 Ga0496116_0010403_2427_3827 466
1346 3300048919 Ga0496116_0041442 Ga0496116_0041442_1051_2451 466
1347 3300048920 Ga0496117_0001424 Ga0496117_0001424_23805_25205 466
1348 3300048920 Ga0496117_0001636 Ga0496117_0001636_13304_14704 466
1349 3300048920 Ga0496117_0002876 Ga0496117_0002876_14740_16140 466
1350 3300048920 Ga0496117_0007138 Ga0496117_0007138_1468_2868 466
1351 3300048920 Ga0496117_0036410 Ga0496117_0036410_74_1474 466
1352 3300048921 Ga0496118_0001223 Ga0496118_0001223_13968_15368 466
1353 3300048921 Ga0496118_0003095 Ga0496118_0003095_5305_6705 466
1354 3300048921 Ga0496118_0008106 Ga0496118_0008106_8094_9494 466
1355 3300048921 Ga0496118_0074808 Ga0496118_0074808_662_2062 466
1356 3300048921 Ga0496118_0074862 Ga0496118_0074862_947_2347 466
1357 3300048922 Ga0496119_0034498 Ga0496119_0034498_1034_2434 466
1358 3300048924 Ga0496121_0001884 Ga0496121_0001884_11652_13052 466
1359 3300048924 Ga0496121_0003790 Ga0496121_0003790_3193_4593 466
1360 3300048924 Ga0496121_0004233 Ga0496121_0004233_13811_15211 466
1361 3300048924 Ga0496121_0014277 Ga0496121_0014277_2191_3591 466
1362 3300048924 Ga0496121_0017418 Ga0496121_0017418_1412_2812 466
1363 3300048924 Ga0496121_0025093 Ga0496121_0025093_3329_4729 466
1364 3300048924 Ga0496121_0045788 Ga0496121_0045788_369_1769 466
1365 3300048925 Ga0496122_0000880 Ga0496122_0000880_23195_24595 466
1366 3300048925 Ga0496122_0001433 Ga0496122_0001433_25315_26715 466
1367 3300048925 Ga0496122_0004216 Ga0496122_0004216_97_1497 466
1368 3300048925 Ga0496122_0036140 Ga0496122_0036140_1135_2535 466
1369 3300048926 Ga0496123_0000494 Ga0496123_0000494_35238_36638 466
1370 3300048926 Ga0496123_0002273 Ga0496123_0002273_97_1497 466
1371 3300048926 Ga0496123_0007259 Ga0496123_0007259_217_1617 466
1372 3300048926 Ga0496123_0013460 Ga0496123_0013460_2576_3976 466
1373 3300048926 Ga0496123_0016409 Ga0496123_0016409_3487_4887 466
1374 3300048926 Ga0496123_0055439 Ga0496123_0055439_118_1518 466
1375 3300048927 Ga0496124_0000279 Ga0496124_0000279_27413_28813 466
1376 3300048927 Ga0496124_0001880 Ga0496124_0001880_10207_11607 466
1377 3300048927 Ga0496124_0003491 Ga0496124_0003491_16135_17535 466
1378 3300048927 Ga0496124_0004155 Ga0496124_0004155_7958_9358 466
1379 3300048927 Ga0496124_0006034 Ga0496124_0006034_1535_2935 466
1380 3300048927 Ga0496124_0104316 Ga0496124_0104316_629_2029 466
1381 3300048928 Ga0496125_0001198 Ga0496125_0001198_12253_13653 466
1382 3300048928 Ga0496125_0004988 Ga0496125_0004988_3893_5293 466
1383 3300048928 Ga0496125_0008052 Ga0496125_0008052_8250_9650 466
1384 3300048928 Ga0496125_0009247 Ga0496125_0009247_7092_8492 466
1385 3300048928 Ga0496125_0025339 Ga0496125_0025339_3990_5390 466
1386 3300048928 Ga0496125_0026179 Ga0496125_0026179_211_1611 466
1387 3300048929 Ga0496126_0040048 Ga0496126_0040048_996_2396 466
1388 3300049459 Ga0495678_000054 Ga0495678_000054_97415_98815 466
1389 3300049459 Ga0495678_000078 Ga0495678_000078_26010_27410 466
1390 3300049459 Ga0495678_000533 Ga0495678_000533_12711_14111 466
1391 3300049459 Ga0495678_001006 Ga0495678_001006_11066_12466 466
1392 3300049459 Ga0495678_001330 Ga0495678_001330_6742_8142 466
1393 3300049459 Ga0495678_002116 Ga0495678_002116_1886_3286 466
1394 3300049459 Ga0495678_021380 Ga0495678_021380_585_1985 466
1395 3300049459 Ga0495678_042018 Ga0495678_042018_364_1764 466
1396 3300049460 Ga0495682_0000073 Ga0495682_0000073_43349_44749 466
1397 3300049460 Ga0495682_0000547 Ga0495682_0000547_5153_6553 466
1398 3300049460 Ga0495682_0002257 Ga0495682_0002257_5176_6576 466
1399 3300049571 Ga0501034_0000136 Ga0501034_0000136_58719_60119 466
1400 3300049671 Ga0501238_002488 Ga0501238_002488_655_2055 466
1401 3300049758 Ga0501241_000051 Ga0501241_000051_12521_13921 466
1402 3300049766 Ga0501269_000494 Ga0501269_000494_3000_4445 466
1403 3300049853 Ga0501226_000009 Ga0501226_000009_192405_193805 466
1404 3300050516 nmdc:mga0sz30_10932_c1 nmdc:mga0sz30_10932_c1_1851_3251 466
1405 3300053086 Ga0500578_0000159 Ga0500578_0000159_44315_45715 466
1406 3300053087 Ga0500643_012390 Ga0500643_012390_974_2377 466
1407 3300053088 Ga0500644_0000322 Ga0500644_0000322_14121_15521 466
1408 3300053088 Ga0500644_0006526 Ga0500644_0006526_749_2149 466
1409 3300053093 Ga0500651_0073333 Ga0500651_0073333_241_1641 466
1410 3300053096 Ga0500641_0002892 Ga0500641_0002892_3737_5137 466
1411 3300053096 Ga0500641_0013891 Ga0500641_0013891_899_2302 466
1412 3300053102 Ga0500554_004129 Ga0500554_004129_475_1875 466
1413 3300053104 Ga0500556_0000692 Ga0500556_0000692_2770_4170 466
1414 3300053104 Ga0500556_0002142 Ga0500556_0002142_4356_5759 466
1415 3300053108 Ga0500562_001055 Ga0500562_001055_4356_5756 466
1416 3300053108 Ga0500562_005861 Ga0500562_005861_723_2126 466
1417 3300053111 Ga0500572_000204 Ga0500572_000204_12419_13819 466
1418 3300053118 Ga0500594_0000108 Ga0500594_0000108_7486_8886 466
1419 3300053122 Ga0500608_000797 Ga0500608_000797_6811_8211 466
1420 3300053125 Ga0500618_002453 Ga0500618_002453_4400_5800 466
1421 3300053135 Ga0500659_0002695 Ga0500659_0002695_8825_10225 466
1422 3300053136 Ga0500559_0000271 Ga0500559_0000271_37958_39358 466
1423 3300053136 Ga0500559_0011738 Ga0500559_0011738_139_1539 466
1424 3300053138 Ga0500564_000247 Ga0500564_000247_6486_7886 466
1425 3300053140 Ga0500573_0006880 Ga0500573_0006880_991_2391 466
1426 3300053142 Ga0500577_0015640 Ga0500577_0015640_727_2127 466
1427 3300053153 Ga0500616_0006903 Ga0500616_0006903_5852_7252 466
1428 3300053153 Ga0500616_0055040 Ga0500616_0055040_425_1825 466
1429 3300053156 Ga0500622_0003788 Ga0500622_0003788_990_2390 466
1430 3300053156 Ga0500622_0042544 Ga0500622_0042544_98_1498 466
1431 3300053730 Ga0500645_001637 Ga0500645_001637_7424_8824 466
1432 3300053730 Ga0500645_001850 Ga0500645_001850_792_2195 466
1433 3300053730 Ga0500645_011543 Ga0500645_011543_567_1970 466
1434 3300053731 Ga0500609_001510 Ga0500609_001510_1539_2939 466

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF02852

Pyr_redox_dim

Pyridine nucleotide-disulphide oxidoreductase, dimerisation domain

406

515

0.99

PF00070

Pyr_redox

Pyridine nucleotide-disulphide oxidoreductase

235

314

0.95

PF07992

Pyr_redox_2

Pyridine nucleotide-disulphide oxidoreductase

63

387

0.95

PF12831

FAD_oxidored

FAD dependent oxidoreductase

64

205

0.77

Structural Annotation

Top 5 Hits

ID Description Score Start End
6i4z-assembly3.cif.gz_E crystal structure of the disease-causing p453l mutant of the human dihydrolipoamide dehydrogenase 0.9873 2 463
5j5z-assembly1.cif.gz_B crystal structure of the d444v disease-causing mutant of the human dihydrolipoamide dehydrogenase 0.9872 4 463
7zyt-assembly1.cif.gz_B crystal structure of the i318t pathogenic variant of the human dihydrolipoamide dehydrogenase 0.9864 4 463
6i4s-assembly1.cif.gz_A crystal structure of the disease-causing r447g mutant of the human dihydrolipoamide dehydrogenase 0.9862 1 463
5j5z-assembly1.cif.gz_A crystal structure of the d444v disease-causing mutant of the human dihydrolipoamide dehydrogenase 0.9861 1 463
ID Description Score Start End Superfamily
af_A0A1D6LYX0_29_117_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9821 152 232 3.50.50.60
1dxlB03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9708 344 463 3.30.390.30
1ebdA03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9656 344 453 3.30.390.30
af_Q8I5A0_386_506_3.30.390.30 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9631 337 456 3.30.390.30
6bz0A03 Alpha Beta;2-Layer Sandwich;Enolase-like; domain 1;FAD/NAD-linked reductase, C-terminal dimerisation domain 0.9612 344 463 3.30.390.30
ID Description Score Start End GO Terms
AF-A0A2R7KM37-F1-model_v4 deleted 0.9967 1 350
AF-V9X121-F1-model_v4 deleted 0.9959 1 463
AF-A0A2L1IE78-F1-model_v4 deleted 0.9957 1 463
AF-S2EZ55-F1-model_v4 Dihydrolipoyl dehydrogenase (EC 1.8.1.4) 0.995 1 463 GO:0004148
GO:0005737
GO:0006090
GO:0006103
GO:0050660
AF-V9X121-F1-model_v4 deleted 0.9938 1 463

Feature Viewer

pLDDT pTM Quality
95.83 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map