F493906

General Info

Members Datasets Scaffolds Average Seq Length
1431 424 2862 195

Family's Representative Sequence

Representative Sequence 3300006058|Ga0075432_10103970|Ga0075432_101039702
Length 224
Sequence MTDHIYAHDHPESESRRDGGFTLWFTGLSGAGKTTIAHLVGPELDRRGHVVEYLDGDTVRTHLSKGLGFSKEDRDTNIERIGWVASRLTRQGGAVIAAAISPYEETRRKARGMVEEWGPFVEVFIKASVQECANRDVKGLYEKAFKGEIKGFTGVDDPYEAPEHPELVLDTLQETPQESLQRVLTTLMRLGYVESDEPMIEGDRLHSGMTDLRVHQSGHVVEEG

Samples

Sample ID Description Type Environment
1 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
2 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
3 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
4 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
5 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
7 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
8 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
9 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
10 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
11 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
12 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
13 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
14 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
15 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
16 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
17 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
18 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
19 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
20 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
21 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
22 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
23 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
24 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
25 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
26 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
27 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
28 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
29 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
30 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
31 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
32 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
33 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
37 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
38 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
39 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
40 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
41 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
42 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
43 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
44 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
45 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
46 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
47 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
48 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
49 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
50 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
51 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
52 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
66 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
67 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
68 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
69 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
70 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
71 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
72 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
73 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
74 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
75 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
76 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
77 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
78 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
79 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
80 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
81 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
86 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
87 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300012491 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 Metagenome Rhizosphere
114 3300012506 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 Metagenome Rhizosphere
115 3300012515 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 Metagenome Rhizosphere
116 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
117 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
118 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
119 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
120 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
121 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
122 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
123 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
124 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
125 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
126 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
127 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
128 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
129 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
130 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
131 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
137 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
138 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
201 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
202 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
205 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
206 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
207 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
208 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
209 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
210 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
211 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
212 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
213 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
214 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
215 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
216 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
217 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
218 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
219 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
220 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
221 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
222 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
223 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
224 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
225 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
226 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
227 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
228 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
229 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
230 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
231 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
232 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
233 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
234 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
235 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
236 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
237 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
238 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
239 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
240 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
241 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
242 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
243 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
244 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
245 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
246 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
247 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
248 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
249 3300038996 Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 Metagenome Rhizosphere
250 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
251 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
252 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
253 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
254 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
255 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
256 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
257 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
258 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
259 3300041507 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG Metagenome Unclassified
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
262 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
263 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
264 3300042013 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 Metagenome Rhizosphere
265 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
266 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
267 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
268 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
269 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
270 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
271 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
272 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
273 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
274 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
275 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
276 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
277 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
278 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
279 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
280 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
281 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
282 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
283 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
284 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
285 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
286 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
289 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
290 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
291 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
292 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
293 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
294 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
295 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
296 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
297 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
298 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
299 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
300 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
301 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
302 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
303 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
304 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
305 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
306 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
307 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
308 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
309 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
310 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
311 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
318 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
322 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
323 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
324 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
325 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
326 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
327 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
328 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
329 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
330 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
331 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
332 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
333 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
334 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
335 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
336 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
337 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
340 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
341 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
342 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
343 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
344 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
345 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
346 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
347 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
348 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
349 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
350 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
351 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
352 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
353 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
354 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
355 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
356 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
357 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
358 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
359 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
360 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
361 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
362 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
363 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
364 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
365 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
366 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
367 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
368 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
369 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
370 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
371 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
372 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
373 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
374 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
375 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
376 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
377 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
378 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
379 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
380 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
381 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
382 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
385 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
386 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
387 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
388 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
390 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
391 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
392 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
393 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
394 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
395 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
396 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
397 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
398 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
399 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
400 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
401 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
405 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
406 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
407 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
408 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
409 3300059477 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
410 3300059490 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
411 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
412 3300059504 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
413 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059506 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300059513 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
417 3300059630 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
418 3300059642 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
419 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
420 3300059658 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
421 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
422 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
423 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
424 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.97
Metatranscriptomes 2.03
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.49
Nodule 0
Rhizoplane 10.2
Rhizosphere 88.61
Stem 0
Stem Tuber 0
Unclassified 0.63

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075432_10103970 3300006058 Bacteria 1052
2 JGI25407J50210_10000289 3300003373 Bacteria 9091
3 JGI25407J50210_10027312 3300003373 Unclassified 1480
4 JGI25407J50210_10028471 3300003373 Bacteria 1449
5 JGI25404J52841_10032556 3300003659 Bacteria 1111
6 Ga0058861_10029875 3300004800 Bacteria 1215
7 Ga0058862_10090311 3300004803 Bacteria 1263
8 Ga0070676_10495253 3300005328 Bacteria 867
9 Ga0070683_100004118 3300005329 Bacteria 11912
10 Ga0070683_100228630 3300005329 Bacteria 1768
11 Ga0070683_100321082 3300005329 Bacteria 1474
12 Ga0070683_100815698 3300005329 Bacteria 895
13 Ga0070683_100845570 3300005329 Bacteria 878
14 Ga0070690_100010006 3300005330 Bacteria 5506
15 Ga0070690_100057669 3300005330 Bacteria 2492
16 Ga0070690_100066426 3300005330 Bacteria 2335
17 Ga0070690_100098630 3300005330 Bacteria 1934
18 Ga0070690_100599665 3300005330 Bacteria 836
19 Ga0070677_10196758 3300005333 Bacteria 970
20 Ga0068869_100181565 3300005334 Bacteria 1650
21 Ga0070666_10139940 3300005335 Bacteria 1686
22 Ga0070680_100129751 3300005336 Bacteria 2108
23 Ga0070680_100175039 3300005336 Bacteria 1807
24 Ga0070680_100241775 3300005336 Bacteria 1526
25 Ga0070682_100003401 3300005337 Bacteria 8826
26 Ga0070682_100061412 3300005337 Bacteria 2378
27 Ga0070682_100075888 3300005337 Bacteria 2163
28 Ga0070682_100093195 3300005337 Bacteria 1975
29 Ga0070682_100102291 3300005337 Bacteria 1893
30 Ga0070682_100226330 3300005337 Bacteria 1334
31 Ga0068868_100021916 3300005338 Bacteria 4817
32 Ga0068868_100037957 3300005338 Bacteria 3737
33 Ga0068868_100174154 3300005338 Bacteria 1783
34 Ga0068868_100188551 3300005338 Bacteria 1714
35 Ga0068868_100202619 3300005338 Bacteria 1655
36 Ga0068868_100267025 3300005338 Bacteria 1445
37 Ga0068868_100299064 3300005338 Bacteria 1366
38 Ga0070660_100048578 3300005339 Bacteria 3259
39 Ga0070660_100076546 3300005339 Bacteria 2621
40 Ga0070660_100222384 3300005339 Bacteria 1535
41 Ga0070660_100303730 3300005339 Bacteria 1309
42 Ga0070689_100230410 3300005340 Bacteria 1523
43 Ga0070689_100511471 3300005340 Bacteria 1030
44 Ga0070691_10115831 3300005341 Bacteria 1345
45 Ga0070691_10237937 3300005341 Bacteria 972
46 Ga0070687_100256665 3300005343 Bacteria 1089
47 Ga0070661_100047206 3300005344 Bacteria 3151
48 Ga0070661_100156791 3300005344 Bacteria 1723
49 Ga0070661_100750842 3300005344 Bacteria 798
50 Ga0070692_10011629 3300005345 Bacteria 4045
51 Ga0070692_10023120 3300005345 Bacteria 3043
52 Ga0070692_10091206 3300005345 Bacteria 1656
53 Ga0070692_10094951 3300005345 Bacteria 1626
54 Ga0070668_100397029 3300005347 Bacteria 1177
55 Ga0070668_100536419 3300005347 Bacteria 1017
56 Ga0070675_100598247 3300005354 Bacteria 1000
57 Ga0070675_100652037 3300005354 Bacteria 957
58 Ga0070671_100386025 3300005355 Bacteria 1197
59 Ga0070671_100399393 3300005355 Bacteria 1176
60 Ga0070671_100420565 3300005355 Bacteria 1144
61 Ga0070674_100032414 3300005356 Bacteria 3469
62 Ga0070674_100047960 3300005356 Bacteria 2930
63 Ga0070673_100017707 3300005364 Bacteria 5074
64 Ga0070673_100422218 3300005364 Bacteria 1196
65 Ga0070673_100981156 3300005364 Bacteria 786
66 Ga0070688_100011538 3300005365 Bacteria 4912
67 Ga0070688_100017530 3300005365 Bacteria 4112
68 Ga0070659_100019301 3300005366 Bacteria 5163
69 Ga0070659_100039597 3300005366 Bacteria 3680
70 Ga0070659_100993267 3300005366 Bacteria 736
71 Ga0070667_100136251 3300005367 Bacteria 2147
72 Ga0070703_10004087 3300005406 Bacteria 4118
73 Ga0070703_10065633 3300005406 Bacteria 1199
74 Ga0070709_10052309 3300005434 Bacteria 2566
75 Ga0070709_10064398 3300005434 Bacteria 2344
76 Ga0070709_10078786 3300005434 Bacteria 2145
77 Ga0070709_10092424 3300005434 Bacteria 1998
78 Ga0070709_10115735 3300005434 Bacteria 1809
79 Ga0070709_10232910 3300005434 Bacteria 1319
80 Ga0070714_100029263 3300005435 Bacteria 4579
81 Ga0070714_100139279 3300005435 Bacteria 2176
82 Ga0070714_100243510 3300005435 Bacteria 1660
83 Ga0070714_100266845 3300005435 Bacteria 1586
84 Ga0070714_100651726 3300005435 Bacteria 1014
85 Ga0070714_100700231 3300005435 Bacteria 977
86 Ga0070713_100236114 3300005436 Bacteria 1663
87 Ga0070713_100268378 3300005436 Bacteria 1562
88 Ga0070713_100713933 3300005436 Bacteria 958
89 Ga0070713_101158964 3300005436 Bacteria 748
90 Ga0070710_10012552 3300005437 Bacteria 4211
91 Ga0070710_10018013 3300005437 Bacteria 3626
92 Ga0070710_10053838 3300005437 Bacteria 2268
93 Ga0070710_10057552 3300005437 Bacteria 2203
94 Ga0070701_10019176 3300005438 Bacteria 3228
95 Ga0070701_10021876 3300005438 Bacteria 3059
96 Ga0070701_10110441 3300005438 Bacteria 1535
97 Ga0070711_100006010 3300005439 Bacteria 7289
98 Ga0070711_100011069 3300005439 Bacteria 5597
99 Ga0070711_100022300 3300005439 Bacteria 4102
100 Ga0070711_100079563 3300005439 Bacteria 2331
101 Ga0070711_100088935 3300005439 Bacteria 2220
102 Ga0070705_100029179 3300005440 Bacteria 3030
103 Ga0070705_100058677 3300005440 Bacteria 2275
104 Ga0070705_100069264 3300005440 Bacteria 2126
105 Ga0070705_100071793 3300005440 Bacteria 2095
106 Ga0070705_100103111 3300005440 Bacteria 1806
107 Ga0070705_100164062 3300005440 Bacteria 1488
108 Ga0070705_100193676 3300005440 Bacteria 1388
109 Ga0070705_100341472 3300005440 Bacteria 1088
110 Ga0070705_100494127 3300005440 Bacteria 927
111 Ga0070700_100001006 3300005441 Bacteria 13924
112 Ga0070700_100013938 3300005441 Bacteria 4528
113 Ga0070700_100161099 3300005441 Bacteria 1544
114 Ga0070700_100499135 3300005441 Bacteria 936
115 Ga0070694_100014357 3300005444 Bacteria 4957
116 Ga0070708_100183070 3300005445 Bacteria 1958
117 Ga0070708_100237361 3300005445 Bacteria 1711
118 Ga0070708_100614526 3300005445 Bacteria 1025
119 Ga0070708_101215099 3300005445 Bacteria 705
120 Ga0070663_100075414 3300005455 Bacteria 2465
121 Ga0070663_100099828 3300005455 Bacteria 2164
122 Ga0070663_100271835 3300005455 Bacteria 1348
123 Ga0070678_100000610 3300005456 Bacteria 17560
124 Ga0070678_100017028 3300005456 Bacteria 4666
125 Ga0070678_100027163 3300005456 Bacteria 3883
126 Ga0070662_100072757 3300005457 Bacteria 2539
127 Ga0070662_100289734 3300005457 Bacteria 1327
128 Ga0070681_10234884 3300005458 Bacteria 1747
129 Ga0068867_100131224 3300005459 Bacteria 1947
130 Ga0068867_100729652 3300005459 Bacteria 877
131 Ga0070685_10220746 3300005466 Bacteria 1242
132 Ga0070685_10266871 3300005466 Bacteria 1141
133 Ga0070706_100009648 3300005467 Bacteria 8973
134 Ga0070706_100034451 3300005467 Bacteria 4677
135 Ga0070706_100584668 3300005467 Bacteria 1038
136 Ga0070706_100846756 3300005467 Bacteria 846
137 Ga0070707_100000909 3300005468 Bacteria 29346
138 Ga0070707_100143993 3300005468 Bacteria 2320
139 Ga0070707_100150790 3300005468 Bacteria 2264
140 Ga0070707_100153621 3300005468 Bacteria 2241
141 Ga0070707_100356827 3300005468 Bacteria 1420
142 Ga0070698_100021420 3300005471 Bacteria 6770
143 Ga0070698_100023816 3300005471 Bacteria 6394
144 Ga0070698_100062351 3300005471 Bacteria 3761
145 Ga0070698_100405578 3300005471 Bacteria 1297
146 Ga0070699_100395579 3300005518 Bacteria 1249
147 Ga0070699_100999875 3300005518 Bacteria 767
148 Ga0070679_100163736 3300005530 Bacteria 2198
149 Ga0070679_100397346 3300005530 Bacteria 1324
150 Ga0070679_100529019 3300005530 Bacteria 1123
151 Ga0070679_100905438 3300005530 Bacteria 826
152 Ga0070684_100054574 3300005535 Bacteria 3481
153 Ga0070684_100055287 3300005535 Bacteria 3459
154 Ga0070684_100064453 3300005535 Bacteria 3214
155 Ga0070684_100077735 3300005535 Bacteria 2931
156 Ga0070684_100114560 3300005535 Bacteria 2420
157 Ga0070684_100248766 3300005535 Bacteria 1625
158 Ga0070684_100400352 3300005535 Bacteria 1265
159 Ga0070697_100070019 3300005536 Bacteria 2874
160 Ga0070697_100196635 3300005536 Bacteria 1713
161 Ga0070697_100507760 3300005536 Bacteria 1055
162 Ga0068853_100020589 3300005539 Bacteria 5486
163 Ga0068853_100024733 3300005539 Bacteria 5038
164 Ga0068853_100232309 3300005539 Bacteria 1688
165 Ga0070672_100207923 3300005543 Bacteria 1638
166 Ga0070672_100403028 3300005543 Bacteria 1173
167 Ga0070686_100002710 3300005544 Bacteria 9745
168 Ga0070686_100011818 3300005544 Bacteria 4960
169 Ga0070686_100025908 3300005544 Bacteria 3532
170 Ga0070686_100086275 3300005544 Bacteria 2089
171 Ga0070686_100376457 3300005544 Bacteria 1074
172 Ga0070695_100113818 3300005545 Bacteria 1840
173 Ga0070695_100164599 3300005545 Bacteria 1560
174 Ga0070695_100328724 3300005545 Bacteria 1139
175 Ga0070695_100580327 3300005545 Bacteria 878
176 Ga0070695_100761001 3300005545 Bacteria 773
177 Ga0070696_100027632 3300005546 Bacteria 3867
178 Ga0070696_100036287 3300005546 Bacteria 3398
179 Ga0070696_100041305 3300005546 Unclassified 3186
180 Ga0070696_100050548 3300005546 Bacteria 2890
181 Ga0070696_100161589 3300005546 Bacteria 1650
182 Ga0070696_100335126 3300005546 Bacteria 1168
183 Ga0070693_100002170 3300005547 Bacteria 8997
184 Ga0070693_100017228 3300005547 Bacteria 3753
185 Ga0070693_100039988 3300005547 Bacteria 2630
186 Ga0070693_100068241 3300005547 Bacteria 2087
187 Ga0070693_100079873 3300005547 Bacteria 1947
188 Ga0070665_100076549 3300005548 Bacteria 3352
189 Ga0070665_100094538 3300005548 Bacteria 2994
190 Ga0070665_100310706 3300005548 Bacteria 1580
191 Ga0070704_100077761 3300005549 Bacteria 2432
192 Ga0070704_100130360 3300005549 Bacteria 1948
193 Ga0070704_100138685 3300005549 Bacteria 1895
194 Ga0070704_100149955 3300005549 Bacteria 1832
195 Ga0070704_100150812 3300005549 Bacteria 1827
196 Ga0070704_100381507 3300005549 Bacteria 1198
197 Ga0070704_100639094 3300005549 Bacteria 938
198 Ga0068855_100162744 3300005563 Bacteria 2531
199 Ga0068855_100167180 3300005563 Bacteria 2492
200 Ga0068855_100302025 3300005563 Bacteria 1773
201 Ga0068855_100383089 3300005563 Bacteria 1544
202 Ga0068855_100613884 3300005563 Bacteria 1171
203 Ga0070664_100009330 3300005564 Bacteria 7959
204 Ga0070664_100134553 3300005564 Bacteria 2172
205 Ga0070664_100139981 3300005564 Unclassified 2130
206 Ga0070664_100468238 3300005564 Bacteria 1158
207 Ga0068857_100000231 3300005577 Bacteria 37351
208 Ga0068857_100061360 3300005577 Bacteria 3340
209 Ga0068857_100126729 3300005577 Bacteria 2301
210 Ga0068857_100415569 3300005577 Bacteria 1253
211 Ga0068854_100094485 3300005578 Bacteria 2230
212 Ga0068854_100111557 3300005578 Bacteria 2063
213 Ga0068854_100374562 3300005578 Bacteria 1171
214 Ga0068854_101017107 3300005578 Bacteria 734
215 Ga0068856_100030396 3300005614 Bacteria 5280
216 Ga0068856_100345021 3300005614 Bacteria 1507
217 Ga0068856_100792277 3300005614 Bacteria 967
218 Ga0068856_100838262 3300005614 Bacteria 939
219 Ga0070702_100003035 3300005615 Bacteria 7429
220 Ga0070702_100005902 3300005615 Bacteria 5748
221 Ga0070702_100009254 3300005615 Bacteria 4814
222 Ga0070702_100025412 3300005615 Bacteria 3173
223 Ga0070702_100027013 3300005615 Bacteria 3092
224 Ga0068852_100085204 3300005616 Bacteria 2814
225 Ga0068852_100180393 3300005616 Bacteria 1985
226 Ga0068859_100042244 3300005617 Bacteria 4580
227 Ga0068859_100428745 3300005617 Bacteria 1419
228 Ga0068859_100607142 3300005617 Bacteria 1187
229 Ga0068864_100016821 3300005618 Bacteria 6094
230 Ga0068864_100158826 3300005618 Bacteria 2054
231 Ga0068864_100269875 3300005618 Bacteria 1585
232 Ga0068866_10141004 3300005718 Bacteria 1383
233 Ga0068866_10197508 3300005718 Bacteria 1200
234 Ga0068861_100012914 3300005719 Bacteria 5831
235 Ga0068851_10036779 3300005834 Bacteria 2452
236 Ga0068863_100458226 3300005841 Bacteria 1252
237 Ga0068858_100207967 3300005842 Bacteria 1851
238 Ga0068858_100273057 3300005842 Bacteria 1609
239 Ga0081455_10007749 3300005937 Bacteria 11259
240 Ga0081455_10018478 3300005937 Bacteria 6639
241 Ga0081455_10038340 3300005937 Bacteria 4244
242 Ga0081455_10043239 3300005937 Bacteria 3944
243 Ga0081455_10045940 3300005937 Bacteria 3795
244 Ga0081455_10071215 3300005937 Bacteria 2883
245 Ga0081455_10079908 3300005937 Bacteria 2683
246 Ga0081538_10000052 3300005981 Bacteria 109642
247 Ga0081538_10000352 3300005981 Bacteria 52528
248 Ga0081538_10000571 3300005981 Bacteria 40853
249 Ga0081538_10000677 3300005981 Bacteria 37447
250 Ga0081538_10000872 3300005981 Bacteria 32589
251 Ga0081538_10010401 3300005981 Bacteria 7627
252 Ga0081538_10016094 3300005981 Bacteria 5751
253 Ga0081540_1001965 3300005983 Bacteria 17152
254 Ga0081540_1005187 3300005983 Bacteria 9756
255 Ga0081540_1005276 3300005983 Bacteria 9669
256 Ga0081540_1094445 3300005983 Bacteria 1306
257 Ga0081539_10008181 3300005985 Bacteria 9217
258 Ga0070717_10024233 3300006028 Bacteria 4816
259 Ga0070717_10030782 3300006028 Bacteria 4313
260 Ga0070717_10033346 3300006028 Bacteria 4154
261 Ga0070717_10053163 3300006028 Bacteria 3338
262 Ga0070717_10057003 3300006028 Bacteria 3229
263 Ga0070717_10224651 3300006028 Bacteria 1651
264 Ga0075365_10007709 3300006038 Bacteria 6056
265 Ga0075364_10060833 3300006051 Bacteria 2476
266 Ga0075364_10524429 3300006051 Bacteria 810
267 Ga0070715_10008610 3300006163 Bacteria 3562
268 Ga0070716_100016672 3300006173 Bacteria 3796
269 Ga0070716_100044575 3300006173 Bacteria 2485
270 Ga0070716_100078960 3300006173 Bacteria 1958
271 Ga0070716_100210883 3300006173 Bacteria 1298
272 Ga0070716_100418183 3300006173 Bacteria 969
273 Ga0070712_100011230 3300006175 Bacteria 5670
274 Ga0070712_100019238 3300006175 Bacteria 4450
275 Ga0070712_100025261 3300006175 Bacteria 3947
276 Ga0070712_100043248 3300006175 Bacteria 3100
277 Ga0070712_100301765 3300006175 Bacteria 1296
278 Ga0070712_100343570 3300006175 Bacteria 1219
279 Ga0070712_100452367 3300006175 Bacteria 1069
280 Ga0070712_100686410 3300006175 Bacteria 872
281 Ga0075362_10005562 3300006177 Bacteria 4626
282 Ga0075427_10005503 3300006194 Bacteria 1806
283 Ga0097621_100016805 3300006237 Bacteria 5544
284 Ga0097621_100060448 3300006237 Bacteria 3106
285 Ga0097621_100169932 3300006237 Bacteria 1879
286 Ga0097621_100389025 3300006237 Bacteria 1247
287 Ga0097621_100767054 3300006237 Bacteria 892
288 Ga0068871_100049456 3300006358 Bacteria 3398
289 Ga0068871_100142390 3300006358 Bacteria 2039
290 Ga0068871_100178685 3300006358 Bacteria 1823
291 Ga0068871_100366591 3300006358 Bacteria 1277
292 Ga0068871_100519765 3300006358 Bacteria 1075
293 Ga0075428_100055600 3300006844 Bacteria 4336
294 Ga0075428_100081370 3300006844 Bacteria 3534
295 Ga0075428_100174650 3300006844 Bacteria 2327
296 Ga0075428_100195786 3300006844 Bacteria 2186
297 Ga0075430_100007921 3300006846 Bacteria 8984
298 Ga0075430_100040628 3300006846 Bacteria 3937
299 Ga0075430_100107397 3300006846 Bacteria 2328
300 Ga0075430_100213120 3300006846 Bacteria 1602
301 Ga0075431_100121088 3300006847 Bacteria 2700
302 Ga0075431_100133721 3300006847 Bacteria 2557
303 Ga0075431_100162214 3300006847 Bacteria 2298
304 Ga0075431_100190267 3300006847 Bacteria 2103
305 Ga0075431_100213321 3300006847 Bacteria 1971
306 Ga0075431_100604168 3300006847 Bacteria 1081
307 Ga0075431_100615776 3300006847 Bacteria 1068
308 Ga0075433_10042647 3300006852 Bacteria 3938
309 Ga0075433_10119917 3300006852 Bacteria 2335
310 Ga0075433_10252161 3300006852 Bacteria 1566
311 Ga0075433_10266278 3300006852 Bacteria 1519
312 Ga0075433_10529117 3300006852 Bacteria 1037
313 Ga0075433_10561541 3300006852 Bacteria 1003
314 Ga0075434_100001520 3300006871 Bacteria 19621
315 Ga0075434_100004815 3300006871 Bacteria 12224
316 Ga0075434_100060849 3300006871 Bacteria 3757
317 Ga0075434_100319272 3300006871 Bacteria 1574
318 Ga0075434_100860845 3300006871 Bacteria 922
319 Ga0075429_100039216 3300006880 Bacteria 4123
320 Ga0075429_100123719 3300006880 Bacteria 2261
321 Ga0075429_100168007 3300006880 Bacteria 1921
322 Ga0075429_100174612 3300006880 Bacteria 1882
323 Ga0075429_100209528 3300006880 Bacteria 1708
324 Ga0075429_100232359 3300006880 Bacteria 1615
325 Ga0075429_100472247 3300006880 Bacteria 1099
326 Ga0075429_100475554 3300006880 Bacteria 1095
327 Ga0068865_100002992 3300006881 Bacteria 10087
328 Ga0068865_100049398 3300006881 Bacteria 2899
329 Ga0068865_100119851 3300006881 Bacteria 1954
330 Ga0068865_100203346 3300006881 Bacteria 1539
331 Ga0075436_100003579 3300006914 Bacteria 10644
332 Ga0075436_100020046 3300006914 Bacteria 4589
333 Ga0075436_100103621 3300006914 Bacteria 1983
334 Ga0075436_100108287 3300006914 Bacteria 1938
335 Ga0075436_100214311 3300006914 Bacteria 1366
336 Ga0075436_100518128 3300006914 Bacteria 873
337 Ga0075436_100593351 3300006914 Bacteria 816
338 Ga0097620_100042244 3300006931 Bacteria 4580
339 Ga0097620_100428760 3300006931 Bacteria 1419
340 Ga0097620_100607196 3300006931 Bacteria 1187
341 Ga0075435_100001635 3300007076 Bacteria 14520
342 Ga0075435_100011437 3300007076 Bacteria 6530
343 Ga0075435_100047701 3300007076 Bacteria 3440
344 Ga0075435_100175508 3300007076 Bacteria 1809
345 Ga0075435_101058504 3300007076 Bacteria 709
346 Ga0105240_10081108 3300009093 Bacteria 3988
347 Ga0111539_10001013 3300009094 Bacteria 36808
348 Ga0111539_10038452 3300009094 Bacteria 5771
349 Ga0111539_10040525 3300009094 Bacteria 5606
350 Ga0111539_10154510 3300009094 Bacteria 2685
351 Ga0111539_10167824 3300009094 Bacteria 2565
352 Ga0111539_10211542 3300009094 Bacteria 2259
353 Ga0111539_10275484 3300009094 Bacteria 1958
354 Ga0111539_10291091 3300009094 Bacteria 1900
355 Ga0111539_11512254 3300009094 Bacteria 779
356 Ga0105245_10014783 3300009098 Bacteria 6799
357 Ga0105245_10033360 3300009098 Bacteria 4563
358 Ga0105245_10073050 3300009098 Bacteria 3118
359 Ga0105245_10130472 3300009098 Bacteria 2357
360 Ga0105245_10290337 3300009098 Bacteria 1602
361 Ga0105245_10493588 3300009098 Bacteria 1239
362 Ga0105245_10609213 3300009098 Bacteria 1119
363 Ga0105245_10795035 3300009098 Bacteria 984
364 Ga0105245_11064121 3300009098 Bacteria 855
365 Ga0105247_10239044 3300009101 Bacteria 1237
366 Ga0105247_10290602 3300009101 Bacteria 1130
367 Ga0114129_10016536 3300009147 Bacteria 10504
368 Ga0114129_10070385 3300009147 Bacteria 4878
369 Ga0114129_10099939 3300009147 Bacteria 4014
370 Ga0114129_10164011 3300009147 Bacteria 3034
371 Ga0114129_10246248 3300009147 Bacteria 2401
372 Ga0114129_10292963 3300009147 Bacteria 2171
373 Ga0114129_10295527 3300009147 Bacteria 2160
374 Ga0114129_10701493 3300009147 Bacteria 1301
375 Ga0114129_10860170 3300009147 Bacteria 1152
376 Ga0114129_11057041 3300009147 Bacteria 1019
377 Ga0105243_10028290 3300009148 Bacteria 4302
378 Ga0105243_10128232 3300009148 Bacteria 2149
379 Ga0105243_10282530 3300009148 Bacteria 1496
380 Ga0105243_10389800 3300009148 Bacteria 1291
381 Ga0105243_10625517 3300009148 Bacteria 1040
382 Ga0105241_10010007 3300009174 Bacteria 6964
383 Ga0105241_10110098 3300009174 Bacteria 2203
384 Ga0105241_10681524 3300009174 Bacteria 936
385 Ga0105242_10006691 3300009176 Bacteria 8897
386 Ga0105242_10032138 3300009176 Bacteria 4195
387 Ga0105242_10082511 3300009176 Bacteria 2690
388 Ga0105242_10112166 3300009176 Bacteria 2326
389 Ga0105242_10270518 3300009176 Bacteria 1539
390 Ga0105242_10430223 3300009176 Bacteria 1239
391 Ga0105242_10468123 3300009176 Bacteria 1192
392 Ga0105248_10019066 3300009177 Bacteria 7585
393 Ga0105248_10023316 3300009177 Bacteria 6874
394 Ga0105248_10175023 3300009177 Bacteria 2419
395 Ga0105248_10186556 3300009177 Bacteria 2337
396 Ga0105248_10194549 3300009177 Bacteria 2285
397 Ga0105248_10324417 3300009177 Bacteria 1734
398 Ga0105237_10000037 3300009545 Bacteria 190855
399 Ga0105237_10198868 3300009545 Bacteria 2004
400 Ga0105237_10360923 3300009545 Bacteria 1457
401 Ga0105238_10060284 3300009551 Bacteria 3800
402 Ga0105238_10065350 3300009551 Bacteria 3639
403 Ga0105238_10879468 3300009551 Bacteria 914
404 Ga0105238_11214748 3300009551 Bacteria 778
405 Ga0105238_11232831 3300009551 Bacteria 773
406 Ga0105249_10002735 3300009553 Bacteria 15254
407 Ga0105249_10024846 3300009553 Bacteria 5388
408 Ga0105249_10120216 3300009553 Bacteria 2495
409 Ga0105239_10105487 3300010375 Bacteria 3121
410 Ga0105239_10125646 3300010375 Bacteria 2850
411 Ga0105239_10405532 3300010375 Bacteria 1543
412 Ga0105239_10641417 3300010375 Bacteria 1213
413 Ga0105239_10726013 3300010375 Bacteria 1137
414 Ga0105239_10854570 3300010375 Bacteria 1044
415 Ga0105239_11081622 3300010375 Bacteria 923
416 Ga0105239_11557599 3300010375 Bacteria 764
417 Ga0105239_11970590 3300010375 Bacteria 678
418 Ga0105246_10058244 3300011119 Bacteria 2676
419 Ga0105246_10060099 3300011119 Bacteria 2639
420 Ga0105246_10124321 3300011119 Bacteria 1917
421 Ga0105246_10225135 3300011119 Bacteria 1473
422 Ga0105246_10614809 3300011119 Bacteria 941
423 Ga0105246_11060820 3300011119 Bacteria 737
424 Ga0157329_1005250 3300012491 Bacteria 870
425 Ga0157324_1001728 3300012506 Bacteria 1249
426 Ga0157338_1005275 3300012515 Bacteria 1153
427 Ga0157371_10086198 3300013102 Bacteria 2224
428 Ga0157371_10117202 3300013102 Bacteria 1893
429 Ga0157370_10077618 3300013104 Bacteria 3129
430 Ga0157369_10249147 3300013105 Bacteria 1854
431 Ga0157369_10607263 3300013105 Bacteria 1129
432 Ga0157374_10028012 3300013296 Bacteria 5088
433 Ga0157374_10768295 3300013296 Bacteria 979
434 Ga0157378_10036713 3300013297 Bacteria 4336
435 Ga0157378_10041614 3300013297 Bacteria 4076
436 Ga0157378_10216987 3300013297 Bacteria 1817
437 Ga0163162_10003800 3300013306 Bacteria 14483
438 Ga0163162_10036629 3300013306 Bacteria 4892
439 Ga0163162_11080968 3300013306 Bacteria 908
440 Ga0157372_10053020 3300013307 Bacteria 4519
441 Ga0157372_10103103 3300013307 Bacteria 3259
442 Ga0157372_10126423 3300013307 Bacteria 2939
443 Ga0157372_11301457 3300013307 Bacteria 839
444 Ga0157375_10013777 3300013308 Bacteria 7207
445 Ga0157375_10017172 3300013308 Bacteria 6524
446 Ga0157375_10148833 3300013308 Bacteria 2475
447 Ga0157375_10255824 3300013308 Bacteria 1912
448 Ga0157375_10345738 3300013308 Bacteria 1653
449 Ga0157375_10473337 3300013308 Bacteria 1418
450 Ga0157375_11106246 3300013308 Bacteria 928
451 Ga0163163_10361960 3300014325 Bacteria 1507
452 Ga0163163_10362136 3300014325 Bacteria 1507
453 Ga0163163_10745436 3300014325 Bacteria 1043
454 Ga0157380_10118872 3300014326 Bacteria 2235
455 Ga0157380_10524468 3300014326 Bacteria 1156
456 Ga0157380_11676883 3300014326 Bacteria 693
457 Ga0182008_10050308 3300014497 Bacteria 2068
458 Ga0182008_10098766 3300014497 Bacteria 1442
459 Ga0182008_10341260 3300014497 Bacteria 792
460 Ga0157377_10077893 3300014745 Bacteria 1931
461 Ga0157379_10005505 3300014968 Bacteria 10878
462 Ga0157379_10177545 3300014968 Bacteria 1923
463 Ga0157376_10028247 3300014969 Bacteria 4457
464 Ga0157376_10030023 3300014969 Bacteria 4335
465 Ga0157376_10042207 3300014969 Bacteria 3738
466 Ga0157376_10204820 3300014969 Bacteria 1818
467 Ga0157376_10278463 3300014969 Bacteria 1574
468 Ga0157376_10373795 3300014969 Bacteria 1371
469 Ga0157376_10394674 3300014969 Bacteria 1336
470 Ga0157376_10588298 3300014969 Bacteria 1106
471 Ga0163161_10134413 3300017792 Bacteria 1868
472 Ga0163161_10421163 3300017792 Bacteria 1074
473 Ga0197907_10383702 3300020069 Bacteria 1016
474 Ga0206349_1095632 3300020075 Bacteria 1163
475 Ga0206352_11166851 3300020078 Bacteria 1593
476 Ga0206352_11331296 3300020078 Bacteria 820
477 Ga0206350_10398217 3300020080 Bacteria 2084
478 Ga0206353_10240172 3300020082 Bacteria 2592
479 Ga0206353_11538467 3300020082 Bacteria 1061
480 Ga0154015_1367111 3300020610 Bacteria 927
481 Ga0154015_1674205 3300020610 Bacteria 887
482 Ga0224712_10095369 3300022467 Bacteria 1253
483 Ga0207697_10217368 3300025315 Bacteria 843
484 Ga0207653_10002891 3300025885 Bacteria 5453
485 Ga0207653_10051426 3300025885 Bacteria 1372
486 Ga0207692_10011411 3300025898 Bacteria 3781
487 Ga0207692_10027075 3300025898 Bacteria 2696
488 Ga0207692_10042751 3300025898 Bacteria 2251
489 Ga0207692_10073518 3300025898 Bacteria 1809
490 Ga0207642_10036559 3300025899 Bacteria 2108
491 Ga0207642_10118706 3300025899 Bacteria 1360
492 Ga0207642_10128113 3300025899 Bacteria 1320
493 Ga0207688_10086026 3300025901 Bacteria 1801
494 Ga0207688_10299292 3300025901 Bacteria 983
495 Ga0207688_10532727 3300025901 Bacteria 737
496 Ga0207680_10063955 3300025903 Bacteria 2253
497 Ga0207680_10090958 3300025903 Bacteria 1941
498 Ga0207680_10230648 3300025903 Bacteria 1272
499 Ga0207647_10206881 3300025904 Bacteria 1134
500 Ga0207685_10116466 3300025905 Bacteria 1166
501 Ga0207685_10121481 3300025905 Bacteria 1147
502 Ga0207699_10019694 3300025906 Bacteria 3603
503 Ga0207699_10069186 3300025906 Bacteria 2151
504 Ga0207699_10115957 3300025906 Bacteria 1724
505 Ga0207699_10399974 3300025906 Bacteria 978
506 Ga0207699_10410041 3300025906 Bacteria 966
507 Ga0207699_10541533 3300025906 Bacteria 844
508 Ga0207643_10023603 3300025908 Bacteria 3392
509 Ga0207684_10044722 3300025910 Bacteria 3756
510 Ga0207684_10051590 3300025910 Bacteria 3490
511 Ga0207684_10066722 3300025910 Bacteria 3056
512 Ga0207684_10305365 3300025910 Bacteria 1372
513 Ga0207684_10414771 3300025910 Bacteria 1157
514 Ga0207684_10595554 3300025910 Bacteria 944
515 Ga0207684_10687374 3300025910 Bacteria 870
516 Ga0207654_10070170 3300025911 Bacteria 2079
517 Ga0207654_10134876 3300025911 Bacteria 1567
518 Ga0207654_10253167 3300025911 Bacteria 1181
519 Ga0207695_10018087 3300025913 Bacteria 8158
520 Ga0207695_10249325 3300025913 Bacteria 1675
521 Ga0207671_10000294 3300025914 Bacteria 73436
522 Ga0207671_10071951 3300025914 Bacteria 2580
523 Ga0207671_10436602 3300025914 Bacteria 1042
524 Ga0207671_10651189 3300025914 Bacteria 839
525 Ga0207693_10001397 3300025915 Bacteria 21388
526 Ga0207693_10003063 3300025915 Bacteria 14421
527 Ga0207693_10003807 3300025915 Bacteria 12843
528 Ga0207693_10008745 3300025915 Bacteria 8279
529 Ga0207693_10023761 3300025915 Bacteria 4865
530 Ga0207693_10054740 3300025915 Bacteria 3129
531 Ga0207693_10055933 3300025915 Bacteria 3094
532 Ga0207693_10099182 3300025915 Bacteria 2284
533 Ga0207693_10191014 3300025915 Bacteria 1611
534 Ga0207693_11025677 3300025915 Bacteria 629
535 Ga0207663_10001774 3300025916 Bacteria 10175
536 Ga0207663_10163764 3300025916 Bacteria 1573
537 Ga0207663_10265920 3300025916 Bacteria 1268
538 Ga0207660_10260486 3300025917 Bacteria 1371
539 Ga0207660_10315060 3300025917 Bacteria 1248
540 Ga0207660_10323323 3300025917 Bacteria 1232
541 Ga0207662_10019540 3300025918 Bacteria 3857
542 Ga0207662_10202051 3300025918 Bacteria 1287
543 Ga0207657_10070813 3300025919 Bacteria 2954
544 Ga0207657_10133883 3300025919 Bacteria 2030
545 Ga0207657_10183034 3300025919 Bacteria 1693
546 Ga0207657_10192028 3300025919 Bacteria 1647
547 Ga0207657_10465912 3300025919 Bacteria 991
548 Ga0207649_10206656 3300025920 Bacteria 1390
549 Ga0207652_10043178 3300025921 Bacteria 3839
550 Ga0207652_10111916 3300025921 Bacteria 2422
551 Ga0207652_10143918 3300025921 Bacteria 2133
552 Ga0207652_10419886 3300025921 Bacteria 1206
553 Ga0207646_10005164 3300025922 Bacteria 13824
554 Ga0207646_10044170 3300025922 Bacteria 4000
555 Ga0207646_10052287 3300025922 Bacteria 3655
556 Ga0207646_10273619 3300025922 Bacteria 1526
557 Ga0207646_10674166 3300025922 Bacteria 926
558 Ga0207681_10284991 3300025923 Bacteria 1302
559 Ga0207694_10066700 3300025924 Bacteria 2808
560 Ga0207694_10125502 3300025924 Bacteria 2053
561 Ga0207694_10186832 3300025924 Bacteria 1682
562 Ga0207694_10657706 3300025924 Bacteria 883
563 Ga0207650_10295125 3300025925 Bacteria 1323
564 Ga0207659_10166119 3300025926 Bacteria 1737
565 Ga0207687_10042335 3300025927 Bacteria 3132
566 Ga0207687_10147799 3300025927 Bacteria 1790
567 Ga0207687_10247919 3300025927 Bacteria 1414
568 Ga0207687_10399666 3300025927 Bacteria 1130
569 Ga0207687_10507496 3300025927 Bacteria 1007
570 Ga0207687_10618189 3300025927 Bacteria 914
571 Ga0207700_10010491 3300025928 Bacteria 5850
572 Ga0207700_10211510 3300025928 Bacteria 1640
573 Ga0207700_10245311 3300025928 Bacteria 1528
574 Ga0207700_10440340 3300025928 Bacteria 1147
575 Ga0207700_10587271 3300025928 Bacteria 991
576 Ga0207700_10588511 3300025928 Bacteria 990
577 Ga0207664_10013306 3300025929 Bacteria 5902
578 Ga0207664_10019531 3300025929 Bacteria 5010
579 Ga0207664_10079641 3300025929 Bacteria 2660
580 Ga0207664_10235202 3300025929 Bacteria 1594
581 Ga0207664_10242574 3300025929 Bacteria 1570
582 Ga0207664_11005468 3300025929 Bacteria 747
583 Ga0207644_10360916 3300025931 Bacteria 1182
584 Ga0207690_10008253 3300025932 Bacteria 6177
585 Ga0207690_10084296 3300025932 Bacteria 2227
586 Ga0207706_10028228 3300025933 Bacteria 5013
587 Ga0207706_10034557 3300025933 Bacteria 4497
588 Ga0207706_10048594 3300025933 Bacteria 3752
589 Ga0207706_10116452 3300025933 Bacteria 2350
590 Ga0207706_10436149 3300025933 Bacteria 1134
591 Ga0207706_10577836 3300025933 Bacteria 966
592 Ga0207686_10005329 3300025934 Bacteria 6897
593 Ga0207686_10066513 3300025934 Bacteria 2302
594 Ga0207686_10205083 3300025934 Bacteria 1414
595 Ga0207709_10002679 3300025935 Bacteria 11036
596 Ga0207709_10170735 3300025935 Bacteria 1526
597 Ga0207709_10614810 3300025935 Bacteria 862
598 Ga0207670_10040585 3300025936 Bacteria 3055
599 Ga0207670_10077932 3300025936 Bacteria 2310
600 Ga0207670_10285495 3300025936 Bacteria 1288
601 Ga0207669_10021397 3300025937 Bacteria 3414
602 Ga0207669_10028967 3300025937 Bacteria 3055
603 Ga0207704_10030321 3300025938 Bacteria 3031
604 Ga0207704_10083355 3300025938 Bacteria 2074
605 Ga0207704_10189246 3300025938 Bacteria 1495
606 Ga0207704_10507870 3300025938 Bacteria 973
607 Ga0207665_10041272 3300025939 Bacteria 3080
608 Ga0207665_10044745 3300025939 Bacteria 2962
609 Ga0207665_10074809 3300025939 Bacteria 2319
610 Ga0207665_10280429 3300025939 Bacteria 1240
611 Ga0207665_10435802 3300025939 Bacteria 1003
612 Ga0207691_10181406 3300025940 Bacteria 1839
613 Ga0207691_10328797 3300025940 Bacteria 1310
614 Ga0207711_10038983 3300025941 Bacteria 4040
615 Ga0207711_10198432 3300025941 Bacteria 1830
616 Ga0207711_10219976 3300025941 Bacteria 1736
617 Ga0207711_10269175 3300025941 Bacteria 1567
618 Ga0207711_10475954 3300025941 Bacteria 1163
619 Ga0207689_10210416 3300025942 Bacteria 1607
620 Ga0207661_10014009 3300025944 Bacteria 5865
621 Ga0207661_10258888 3300025944 Bacteria 1549
622 Ga0207661_10345457 3300025944 Bacteria 1341
623 Ga0207661_10512847 3300025944 Bacteria 1096
624 Ga0207661_10851454 3300025944 Bacteria 839
625 Ga0207679_10107458 3300025945 Bacteria 2196
626 Ga0207679_10128420 3300025945 Bacteria 2030
627 Ga0207679_10277166 3300025945 Bacteria 1437
628 Ga0207679_10288320 3300025945 Bacteria 1410
629 Ga0207679_10689409 3300025945 Bacteria 926
630 Ga0207679_10723765 3300025945 Bacteria 904
631 Ga0207667_10276763 3300025949 Bacteria 1715
632 Ga0207667_10367086 3300025949 Bacteria 1467
633 Ga0207667_10499945 3300025949 Bacteria 1233
634 Ga0207651_10300858 3300025960 Bacteria 1334
635 Ga0207651_10626270 3300025960 Bacteria 943
636 Ga0207712_10114484 3300025961 Bacteria 2029
637 Ga0207712_10196606 3300025961 Bacteria 1596
638 Ga0207668_10141878 3300025972 Bacteria 1849
639 Ga0207668_10360304 3300025972 Bacteria 1218
640 Ga0207668_10447354 3300025972 Bacteria 1102
641 Ga0207640_10075676 3300025981 Bacteria 2282
642 Ga0207658_10379372 3300025986 Bacteria 1238
643 Ga0207677_10094900 3300026023 Bacteria 2179
644 Ga0207677_10174720 3300026023 Bacteria 1684
645 Ga0207677_10184915 3300026023 Bacteria 1642
646 Ga0207677_11002667 3300026023 Bacteria 757
647 Ga0207677_11245487 3300026023 Bacteria 682
648 Ga0207703_10020015 3300026035 Bacteria 5229
649 Ga0207703_10032602 3300026035 Bacteria 4123
650 Ga0207703_10147853 3300026035 Bacteria 2045
651 Ga0207703_10341370 3300026035 Bacteria 1376
652 Ga0207639_10015571 3300026041 Bacteria 5366
653 Ga0207639_10392838 3300026041 Bacteria 1248
654 Ga0207678_10161912 3300026067 Bacteria 1911
655 Ga0207678_10194575 3300026067 Bacteria 1733
656 Ga0207678_10244121 3300026067 Bacteria 1538
657 Ga0207708_10000318 3300026075 Bacteria 38045
658 Ga0207708_10001272 3300026075 Bacteria 18966
659 Ga0207708_10023900 3300026075 Bacteria 4622
660 Ga0207708_10384606 3300026075 Bacteria 1158
661 Ga0207708_10513376 3300026075 Bacteria 1006
662 Ga0207702_10011169 3300026078 Bacteria 7490
663 Ga0207702_10035064 3300026078 Bacteria 4195
664 Ga0207702_10068952 3300026078 Bacteria 3039
665 Ga0207702_10219670 3300026078 Bacteria 1771
666 Ga0207702_11184294 3300026078 Bacteria 758
667 Ga0207702_11260744 3300026078 Bacteria 733
668 Ga0207641_11141700 3300026088 Bacteria 778
669 Ga0207648_10003992 3300026089 Bacteria 15308
670 Ga0207648_10020641 3300026089 Bacteria 5931
671 Ga0207648_10198847 3300026089 Bacteria 1778
672 Ga0207648_10313251 3300026089 Bacteria 1409
673 Ga0207676_10038667 3300026095 Bacteria 3644
674 Ga0207676_10074588 3300026095 Bacteria 2734
675 Ga0207674_10000602 3300026116 Bacteria 47280
676 Ga0207674_10001034 3300026116 Bacteria 36274
677 Ga0207674_10009302 3300026116 Bacteria 11254
678 Ga0207674_10082086 3300026116 Bacteria 3225
679 Ga0207675_100003964 3300026118 Bacteria 14368
680 Ga0207675_100011807 3300026118 Bacteria 8164
681 Ga0207675_100041266 3300026118 Bacteria 4309
682 Ga0207675_100062109 3300026118 Bacteria 3488
683 Ga0207675_100162269 3300026118 Bacteria 2132
684 Ga0207683_10000215 3300026121 Bacteria 50395
685 Ga0207683_10002095 3300026121 Bacteria 17570
686 Ga0207683_10004391 3300026121 Bacteria 12189
687 Ga0207683_10050021 3300026121 Bacteria 3660
688 Ga0207683_10367466 3300026121 Bacteria 1321
689 Ga0207698_10126200 3300026142 Bacteria 2177
690 Ga0207698_10324086 3300026142 Bacteria 1444
691 Ga0209966_1002356 3300027695 Bacteria 3146
692 Ga0207428_10005092 3300027907 Bacteria 12341
693 Ga0207428_10007271 3300027907 Bacteria 10124
694 Ga0207428_10026245 3300027907 Bacteria 4864
695 Ga0207428_10118965 3300027907 Bacteria 2027
696 Ga0207428_10120950 3300027907 Bacteria 2008
697 Ga0207428_10261940 3300027907 Bacteria 1288
698 Ga0268266_10159422 3300028379 Bacteria 2040
699 Ga0268266_10229934 3300028379 Bacteria 1708
700 Ga0268266_10809673 3300028379 Bacteria 905
701 Ga0268264_10026733 3300028381 Bacteria 4715
702 Ga0268264_10462830 3300028381 Bacteria 1231
703 Ga0265319_1036944 3300028563 Bacteria 1667
704 Ga0265320_10018694 3300031240 Bacteria 3808
705 Ga0307408_100583404 3300031548 Bacteria 991
706 Ga0265314_10189034 3300031711 Bacteria 1227
707 Ga0307413_10034557 3300031824 Bacteria 2890
708 Ga0307413_11168665 3300031824 Bacteria 668
709 Ga0307410_10028304 3300031852 Bacteria 3553
710 Ga0307410_10159319 3300031852 Bacteria 1689
711 Ga0307410_10543305 3300031852 Bacteria 962
712 Ga0307410_11145263 3300031852 Bacteria 676
713 Ga0307406_10099792 3300031901 Bacteria 1975
714 Ga0307406_10125445 3300031901 Bacteria 1793
715 Ga0307406_10140451 3300031901 Bacteria 1709
716 Ga0307409_100033311 3300031995 Bacteria 3748
717 Ga0307416_100014462 3300032002 Bacteria 5413
718 Ga0307416_100014964 3300032002 Bacteria 5339
719 Ga0307416_100075190 3300032002 Bacteria 2826
720 Ga0307416_100089581 3300032002 Bacteria 2635
721 Ga0307416_100166563 3300032002 Bacteria 2045
722 Ga0307416_100177782 3300032002 Bacteria 1991
723 Ga0307416_100323901 3300032002 Bacteria 1545
724 Ga0307414_10274653 3300032004 Bacteria 1413
725 Ga0307411_10198678 3300032005 Bacteria 1538
726 Ga0307415_100000283 3300032126 Bacteria 21941
727 Ga0307415_100588117 3300032126 Bacteria 988
728 Ga0373948_0000987 3300034817 Bacteria 3818
729 Ga0373950_0006398 3300034818 Bacteria 1794
730 Ga0373958_0002079 3300034819 Bacteria 2768
731 Ga0373959_0008553 3300034820 Bacteria 1745
732 Ga0373938_0007321 3300034957 Bacteria 1938
733 Ga0373928_0006086 3300035084 Bacteria 2314
734 Ga0373929_0001505 3300035085 Bacteria 4433
735 Ga0373929_0037208 3300035085 Bacteria 1066
736 Ga0373940_0003105 3300035088 Bacteria 3341
737 Ga0373949_0001447 3300035090 Bacteria 6785
738 Ga0373949_0014141 3300035090 Bacteria 1776
739 Ga0373949_0094059 3300035090 Bacteria 814
740 Ga0373951_0005316 3300035091 Bacteria 2997
741 Ga0373952_0001824 3300035092 Bacteria 3869
742 Ga0373952_0036549 3300035092 Bacteria 1116
743 Ga0373952_0060070 3300035092 Bacteria 927
744 Ga0373932_0000884 3300035112 Bacteria 8780
745 Ga0373932_0079177 3300035112 Bacteria 1035
746 Ga0373932_0188049 3300035112 Bacteria 728
747 Ga0373939_0003770 3300035114 Bacteria 3573
748 Ga0373941_0007609 3300035115 Bacteria 2656
749 Ga0373941_0039119 3300035115 Bacteria 1456
750 Ga0373941_0208125 3300035115 Bacteria 747
751 Ga0373945_0008033 3300035116 Bacteria 3427
752 Ga0373960_0000300 3300035121 Bacteria 9439
753 Ga0373960_0005826 3300035121 Bacteria 2866
754 Ga0373960_0306280 3300035121 Bacteria 592
755 Ga0373943_0090566 3300035170 Bacteria 1584
756 Ga0373943_0127907 3300035170 Bacteria 1357
757 Ga0373943_0139802 3300035170 Bacteria 1303
758 Ga0373942_0004007 3300035207 Bacteria 3438
759 Ga0373942_0037813 3300035207 Bacteria 1306
760 Ga0373942_0163541 3300035207 Bacteria 721
761 Ga0373961_0002740 3300035241 Bacteria 4503
762 Ga0373961_0074772 3300035241 Bacteria 1055
763 Ga0373961_0104910 3300035241 Bacteria 919
764 Ga0373961_0108015 3300035241 Bacteria 909
765 Ga0373962_0000470 3300035242 Bacteria 8917
766 Ga0373962_0010348 3300035242 Bacteria 2324
767 Ga0316574_0077842 3300035398 Bacteria 2102
768 Ga0373931_0005860 3300035691 Bacteria 5716
769 Ga0373931_0014422 3300035691 Bacteria 3863
770 Ga0373931_0587323 3300035691 Bacteria 727
771 Ga0373935_0079542 3300035692 Bacteria 2128
772 Ga0373935_0363106 3300035692 Bacteria 1034
773 Ga0373927_0124105 3300035695 Bacteria 1686
774 Ga0373933_0199870 3300035724 Bacteria 1279
775 Ga0373947_0038718 3300035725 Bacteria 2834
776 Ga0373947_0179136 3300035725 Bacteria 1379
777 Ga0373937_0311652 3300036401 Bacteria 1488
778 Ga0373937_0381837 3300036401 Bacteria 1336
779 Ga0373925_0041238 3300037068 Bacteria 3421
780 Ga0373925_0069444 3300037068 Bacteria 2662
781 Ga0373925_0401233 3300037068 Bacteria 1118
782 Ga0395899_0004381 3300037312 Bacteria 11006
783 Ga0395899_0006296 3300037312 Bacteria 9185
784 Ga0395899_0009034 3300037312 Bacteria 7660
785 Ga0395899_0009701 3300037312 Bacteria 7388
786 Ga0395899_0009738 3300037312 Bacteria 7376
787 Ga0395899_0018693 3300037312 Bacteria 5267
788 Ga0395899_0090114 3300037312 Bacteria 2224
789 Ga0395899_0100492 3300037312 Bacteria 2089
790 Ga0395899_0103355 3300037312 Bacteria 2055
791 Ga0395899_0109350 3300037312 Bacteria 1989
792 Ga0395899_0121975 3300037312 Bacteria 1866
793 Ga0395899_0141765 3300037312 Bacteria 1709
794 Ga0395900_0002094 3300037418 Bacteria 22368
795 Ga0395900_0002557 3300037418 Bacteria 19948
796 Ga0395900_0005285 3300037418 Bacteria 13535
797 Ga0395900_0006119 3300037418 Bacteria 12549
798 Ga0395900_0009995 3300037418 Bacteria 9711
799 Ga0395900_0032874 3300037418 Bacteria 5336
800 Ga0395900_0036840 3300037418 Bacteria 5041
801 Ga0395900_0054562 3300037418 Bacteria 4114
802 Ga0395900_0055402 3300037418 Bacteria 4083
803 Ga0395900_0070114 3300037418 Bacteria 3603
804 Ga0395900_0087955 3300037418 Bacteria 3193
805 Ga0395900_0099679 3300037418 Bacteria 2984
806 Ga0395900_0106579 3300037418 Bacteria 2879
807 Ga0395900_0108196 3300037418 Bacteria 2856
808 Ga0395900_0117837 3300037418 Bacteria 2725
809 Ga0395900_0172039 3300037418 Bacteria 2204
810 Ga0395900_0186796 3300037418 Bacteria 2103
811 Ga0395900_0206385 3300037418 Bacteria 1986
812 Ga0395900_0283018 3300037418 Bacteria 1649
813 Ga0395900_0287832 3300037418 Bacteria 1633
814 Ga0395900_0591291 3300037418 Bacteria 1051
815 Ga0395900_0642403 3300037418 Bacteria 998
816 Ga0395900_0644498 3300037418 Bacteria 996
817 Ga0395900_1266685 3300037418 Bacteria 652
818 Ga0395898_0002920 3300037466 Bacteria 19456
819 Ga0395898_0005446 3300037466 Bacteria 13753
820 Ga0395898_0007665 3300037466 Bacteria 11462
821 Ga0395898_0008336 3300037466 Bacteria 10957
822 Ga0395898_0014060 3300037466 Bacteria 8225
823 Ga0395898_0016773 3300037466 Bacteria 7483
824 Ga0395898_0023607 3300037466 Bacteria 6212
825 Ga0395898_0025755 3300037466 Bacteria 5924
826 Ga0395898_0028354 3300037466 Bacteria 5611
827 Ga0395898_0031904 3300037466 Bacteria 5260
828 Ga0395898_0067017 3300037466 Bacteria 3477
829 Ga0395898_0175848 3300037466 Bacteria 2046
830 Ga0395898_0186093 3300037466 Bacteria 1984
831 Ga0395898_0209053 3300037466 Bacteria 1862
832 Ga0395898_0227878 3300037466 Bacteria 1777
833 Ga0395898_0360951 3300037466 Bacteria 1385
834 Ga0395898_0370198 3300037466 Bacteria 1366
835 Ga0395898_0370779 3300037466 Bacteria 1365
836 Ga0395898_0424408 3300037466 Bacteria 1267
837 Ga0395898_0455951 3300037466 Bacteria 1217
838 Ga0395898_0672639 3300037466 Bacteria 977
839 Ga0395905_0000615 3300037471 Bacteria 47752
840 Ga0395905_0001573 3300037471 Bacteria 27258
841 Ga0395905_0004096 3300037471 Bacteria 15274
842 Ga0395905_0006308 3300037471 Bacteria 11958
843 Ga0395905_0006717 3300037471 Bacteria 11518
844 Ga0395905_0013697 3300037471 Bacteria 7765
845 Ga0395905_0021395 3300037471 Bacteria 6117
846 Ga0395905_0043580 3300037471 Bacteria 4209
847 Ga0395905_0053744 3300037471 Bacteria 3769
848 Ga0395905_0067743 3300037471 Bacteria 3343
849 Ga0395905_0091745 3300037471 Bacteria 2848
850 Ga0395905_0116819 3300037471 Bacteria 2507
851 Ga0395905_0146366 3300037471 Bacteria 2222
852 Ga0395905_0161816 3300037471 Bacteria 2103
853 Ga0395905_0215907 3300037471 Bacteria 1796
854 Ga0395905_0650318 3300037471 Bacteria 956
855 Ga0395905_0755800 3300037471 Bacteria 875
856 Ga0395905_0883556 3300037471 Unclassified 797
857 Ga0395905_0958680 3300037471 Bacteria 758
858 Ga0395901_0001769 3300038443 Bacteria 22292
859 Ga0395901_0003610 3300038443 Bacteria 15604
860 Ga0395901_0004266 3300038443 Bacteria 14419
861 Ga0395901_0005433 3300038443 Bacteria 12895
862 Ga0395901_0007585 3300038443 Bacteria 10960
863 Ga0395901_0016950 3300038443 Bacteria 7425
864 Ga0395901_0026811 3300038443 Bacteria 5917
865 Ga0395901_0032519 3300038443 Bacteria 5381
866 Ga0395901_0041499 3300038443 Bacteria 4769
867 Ga0395901_0043878 3300038443 Bacteria 4637
868 Ga0395901_0044425 3300038443 Bacteria 4608
869 Ga0395901_0053962 3300038443 Bacteria 4177
870 Ga0395901_0070288 3300038443 Bacteria 3647
871 Ga0395901_0074676 3300038443 Bacteria 3537
872 Ga0395901_0077102 3300038443 Bacteria 3479
873 Ga0395901_0109540 3300038443 Bacteria 2899
874 Ga0395901_0111707 3300038443 Bacteria 2870
875 Ga0395901_0115402 3300038443 Bacteria 2821
876 Ga0395901_0144427 3300038443 Bacteria 2501
877 Ga0395901_0148589 3300038443 Bacteria 2462
878 Ga0395901_0160209 3300038443 Bacteria 2363
879 Ga0395901_0198258 3300038443 Bacteria 2104
880 Ga0395901_0240051 3300038443 Bacteria 1890
881 Ga0395901_0257393 3300038443 Bacteria 1817
882 Ga0395901_0322862 3300038443 Bacteria 1597
883 Ga0395901_0344006 3300038443 Bacteria 1540
884 Ga0395901_0347435 3300038443 Bacteria 1531
885 Ga0395901_0518269 3300038443 Bacteria 1212
886 Ga0395901_0537790 3300038443 Bacteria 1185
887 Ga0395901_0549247 3300038443 Bacteria 1171
888 Ga0395901_0906463 3300038443 Bacteria 863
889 Ga0395901_1279485 3300038443 Bacteria 696
890 Ga0242420_037274 3300038996 Bacteria 920
891 Ga0439466_0141176 3300041411 Bacteria 739
892 Ga0451797_1467611 3300041453 Bacteria 1567
893 Ga0451802_1691267 3300041460 Bacteria 2981
894 Ga0451807_0097819 3300041486 Bacteria 1011
895 Ga0451807_1241121 3300041486 Bacteria 1002
896 Ga0451835_0553222 3300041492 Bacteria 892
897 Ga0451837_1655606 3300041494 Bacteria 767
898 Ga0451841_0721472 3300041498 Bacteria 642
899 Ga0451845_0409218 3300041501 Bacteria 3231
900 Ga0451845_0836332 3300041501 Bacteria 665
901 Ga0451847_0806778 3300041503 Bacteria 921
902 Ga0451851_0166059 3300041507 Bacteria 1317
903 Ga0451853_0059875 3300041512 Bacteria 1259
904 Ga0451853_1772707 3300041512 Bacteria 742
905 Ga0451853_1946777 3300041512 Bacteria 770
906 Ga0439450_017884 3300042008 Bacteria 1483
907 Ga0439451_001152 3300042009 Bacteria 5186
908 Ga0439454_007894 3300042011 Bacteria 1346
909 Ga0439456_035532 3300042013 Bacteria 1074
910 Ga0439463_053845 3300042016 Bacteria 1027
911 Ga0439458_0060804 3300042157 Bacteria 943
912 Ga0439435_0014525 3300042436 Bacteria 1947
913 Ga0439459_0131606 3300042438 Bacteria 639
914 Ga0450918_031663 3300042531 Bacteria 935
915 Ga0439440_0057277 3300042993 Bacteria 987
916 Ga0439440_0058500 3300042993 Bacteria 979
917 Ga0466969_0008738 3300044656 Bacteria 5369
918 Ga0466966_0044626 3300044684 Bacteria 2837
919 Ga0466961_0002904 3300044693 Bacteria 10634
920 Ga0466961_0212730 3300044693 Bacteria 1193
921 Ga0466963_0004919 3300044694 Bacteria 7791
922 Ga0466964_0007241 3300044706 Bacteria 4147
923 Ga0466964_0009363 3300044706 Bacteria 3687
924 Ga0466971_0002968 3300044719 Bacteria 7201
925 Ga0466968_0041210 3300044735 Bacteria 1948
926 Ga0466957_0001419 3300044842 Bacteria 12506
927 Ga0466957_0104398 3300044842 Bacteria 1790
928 Ga0466960_0041957 3300044901 Bacteria 2170
929 Ga0466960_0060342 3300044901 Bacteria 1858
930 Ga0466960_0065705 3300044901 Bacteria 1792
931 Ga0466959_0017850 3300045049 Bacteria 5204
932 Ga0466959_0107958 3300045049 Bacteria 1989
933 Ga0451576_0031312 3300045051 Bacteria 5674
934 Ga0451576_0085404 3300045051 Bacteria 3283
935 Ga0451576_0602839 3300045051 Bacteria 1154
936 Ga0466958_0024666 3300045836 Bacteria 3538
937 Ga0466967_0008294 3300045976 Bacteria 7594
938 Ga0466967_0050785 3300045976 Bacteria 3632
939 Ga0466967_0065595 3300045976 Bacteria 3232
940 Ga0466967_0069917 3300045976 Bacteria 3139
941 Ga0466967_0105251 3300045976 Bacteria 2584
942 Ga0495603_0001254 3300046455 Bacteria 14805
943 Ga0495603_0003282 3300046455 Bacteria 9635
944 Ga0495603_0023879 3300046455 Bacteria 3699
945 Ga0495590_0024229 3300046457 Bacteria 2139
946 Ga0495641_0109720 3300046461 Bacteria 1231
947 Ga0495641_0196017 3300046461 Bacteria 905
948 Ga0495651_0100866 3300046462 Bacteria 2150
949 Ga0495651_0439136 3300046462 Bacteria 845
950 Ga0495653_0384614 3300046463 Bacteria 895
951 Ga0495580_0012092 3300046472 Bacteria 6643
952 Ga0495580_0139618 3300046472 Bacteria 1680
953 Ga0495580_0287843 3300046472 Bacteria 1120
954 Ga0495582_0013109 3300046473 Bacteria 4564
955 Ga0495582_0029479 3300046473 Bacteria 3013
956 Ga0495582_0041400 3300046473 Bacteria 2538
957 Ga0495582_0110975 3300046473 Bacteria 1540
958 Ga0495582_0166991 3300046473 Bacteria 1252
959 Ga0495605_0061978 3300046474 Bacteria 1788
960 Ga0495605_0105608 3300046474 Bacteria 1290
961 Ga0495605_0226410 3300046474 Bacteria 807
962 Ga0495639_0076679 3300046475 Bacteria 1551
963 Ga0495639_0130695 3300046475 Bacteria 1202
964 Ga0495639_0191375 3300046475 Bacteria 999
965 Ga0495662_0101690 3300046476 Bacteria 1406
966 Ga0495662_0136006 3300046476 Bacteria 1209
967 Ga0495584_0039360 3300046491 Bacteria 2388
968 Ga0495584_0055836 3300046491 Bacteria 1987
969 Ga0495584_0119056 3300046491 Bacteria 1337
970 Ga0495584_0245294 3300046491 Bacteria 911
971 Ga0495584_0265287 3300046491 Bacteria 873
972 Ga0495584_0372423 3300046491 Bacteria 725
973 Ga0495584_0374782 3300046491 Bacteria 723
974 Ga0495585_0111025 3300046492 Bacteria 1458
975 Ga0495594_0001015 3300046499 Bacteria 14642
976 Ga0495594_0081585 3300046499 Bacteria 1806
977 Ga0495594_0139143 3300046499 Bacteria 1376
978 Ga0495596_0006468 3300046500 Bacteria 5386
979 Ga0495596_0020797 3300046500 Bacteria 2684
980 Ga0495596_0109322 3300046500 Bacteria 1073
981 Ga0495596_0121433 3300046500 Bacteria 1014
982 Ga0495596_0155298 3300046500 Bacteria 889
983 Ga0495607_0075484 3300046501 Bacteria 1868
984 Ga0495607_0200402 3300046501 Bacteria 988
985 Ga0495583_0065757 3300046506 Bacteria 1606
986 Ga0495608_0129760 3300046511 Bacteria 1614
987 Ga0495608_0332954 3300046511 Bacteria 936
988 Ga0495618_0066311 3300046514 Bacteria 2295
989 Ga0495628_0365518 3300046516 Bacteria 1059
990 Ga0495631_0016892 3300046518 Bacteria 3465
991 Ga0495631_0075870 3300046518 Bacteria 1451
992 Ga0495632_0095490 3300046519 Bacteria 1405
993 Ga0495643_0126590 3300046522 Bacteria 1286
994 Ga0495643_0341351 3300046522 Bacteria 673
995 Ga0495663_0078791 3300046525 Bacteria 1058
996 Ga0495642_0040091 3300046528 Bacteria 1901
997 Ga0495642_0104273 3300046528 Bacteria 1209
998 Ga0495642_0124226 3300046528 Bacteria 1108
999 Ga0495652_0146936 3300046529 Bacteria 1847
1000 Ga0495652_0276861 3300046529 Bacteria 1230
1001 Ga0495652_0458653 3300046529 Bacteria 891
1002 Ga0495654_0128817 3300046530 Bacteria 1138
1003 Ga0495640_0428603 3300046533 Bacteria 810
1004 Ga0495609_0054642 3300046538 Bacteria 1773
1005 Ga0495609_0082046 3300046538 Bacteria 1409
1006 Ga0495609_0088536 3300046538 Bacteria 1348
1007 Ga0495609_0090278 3300046538 Bacteria 1332
1008 Ga0495667_0088977 3300046559 Bacteria 2002
1009 Ga0495656_0024249 3300046615 Bacteria 2394
1010 Ga0495656_0072547 3300046615 Bacteria 1533
1011 Ga0495656_0085206 3300046615 Bacteria 1435
1012 Ga0495656_0132548 3300046615 Bacteria 1187
1013 Ga0495656_0133226 3300046615 Bacteria 1185
1014 Ga0495656_0220716 3300046615 Bacteria 948
1015 Ga0495656_0435519 3300046615 Bacteria 689
1016 Ga0495668_0073557 3300046616 Bacteria 1877
1017 Ga0495668_0105446 3300046616 Bacteria 1542
1018 Ga0495668_0268413 3300046616 Bacteria 934
1019 Ga0495634_0196208 3300046642 Bacteria 1256
1020 Ga0495611_0137121 3300046648 Bacteria 1142
1021 Ga0495635_0074043 3300046663 Bacteria 2333
1022 Ga0495659_0011728 3300046664 Bacteria 2826
1023 Ga0495661_0264446 3300046665 Bacteria 873
1024 Ga0495588_0000696 3300046674 Bacteria 15520
1025 Ga0495588_0126094 3300046674 Bacteria 1350
1026 Ga0495588_0171507 3300046674 Unclassified 1147
1027 Ga0495588_0185277 3300046674 Bacteria 1100
1028 Ga0495588_0410337 3300046674 Bacteria 711
1029 Ga0495623_0221074 3300046679 Bacteria 1079
1030 Ga0495646_0165256 3300046680 Bacteria 1223
1031 Ga0495646_0200524 3300046680 Bacteria 1087
1032 Ga0495647_0022377 3300046681 Bacteria 2283
1033 Ga0495647_0145540 3300046681 Bacteria 1013
1034 Ga0495658_0027545 3300046683 Bacteria 3059
1035 Ga0495658_0065955 3300046683 Bacteria 2090
1036 Ga0495658_0103135 3300046683 Bacteria 1705
1037 Ga0495669_0077715 3300046684 Bacteria 1520
1038 Ga0495613_0059074 3300046689 Bacteria 2812
1039 Ga0495613_0449472 3300046689 Bacteria 873
1040 Ga0495624_0188782 3300046690 Bacteria 1254
1041 Ga0495670_0064403 3300046691 Bacteria 1847
1042 Ga0495670_0209509 3300046691 Bacteria 1034
1043 Ga0495670_0267663 3300046691 Bacteria 913
1044 Ga0495671_0096092 3300046692 Bacteria 1450
1045 Ga0495589_0007188 3300046794 Bacteria 5832
1046 Ga0495589_0217316 3300046794 Bacteria 899
1047 Ga0495589_0258599 3300046794 Bacteria 812
1048 Ga0495600_0105092 3300046809 Bacteria 1840
1049 Ga0495581_0003961 3300047315 Bacteria 8531
1050 Ga0495581_0005721 3300047315 Bacteria 7209
1051 Ga0495581_0350081 3300047315 Bacteria 862
1052 Ga0495604_0057660 3300047317 Bacteria 2986
1053 Ga0495636_0023358 3300047318 Bacteria 2503
1054 Ga0495636_0089618 3300047318 Bacteria 1334
1055 Ga0495674_0029754 3300047319 Bacteria 4969
1056 Ga0495674_0041452 3300047319 Bacteria 4112
1057 Ga0495674_0698396 3300047319 Bacteria 796
1058 Ga0495676_0000879 3300047321 Bacteria 25087
1059 Ga0495676_0064108 3300047321 Bacteria 2860
1060 Ga0495676_0111355 3300047321 Bacteria 2008
1061 Ga0495676_0182105 3300047321 Bacteria 1472
1062 Ga0495676_0500821 3300047321 Bacteria 797
1063 Ga0495683_0053927 3300047323 Bacteria 2005
1064 Ga0495683_0208760 3300047323 Bacteria 877
1065 Ga0495675_0102645 3300047444 Bacteria 1789
1066 Ga0495677_0038650 3300047445 Bacteria 1744
1067 Ga0495677_0042134 3300047445 Bacteria 1672
1068 Ga0495677_0107510 3300047445 Bacteria 1059
1069 Ga0495679_046866 3300047446 Bacteria 1314
1070 Ga0495685_022123 3300047447 Bacteria 2188
1071 Ga0495685_105429 3300047447 Bacteria 930
1072 Ga0495684_0041444 3300047471 Bacteria 3529
1073 Ga0495684_0104319 3300047471 Bacteria 2142
1074 Ga0495626_0040809 3300048091 Bacteria 2190
1075 Ga0496100_0009888 3300048903 Bacteria 5375
1076 Ga0496100_0016648 3300048903 Bacteria 4322
1077 Ga0496100_0037077 3300048903 Bacteria 3079
1078 Ga0496100_0161319 3300048903 Bacteria 1607
1079 Ga0496100_0193023 3300048903 Bacteria 1480
1080 Ga0496100_0336058 3300048903 Bacteria 1138
1081 Ga0496100_0439557 3300048903 Bacteria 999
1082 Ga0496100_0585981 3300048903 Bacteria 865
1083 Ga0496101_0027209 3300048904 Bacteria 3981
1084 Ga0496101_0033793 3300048904 Bacteria 3609
1085 Ga0496101_0133993 3300048904 Bacteria 1883
1086 Ga0496101_0154747 3300048904 Bacteria 1755
1087 Ga0496101_0194943 3300048904 Bacteria 1564
1088 Ga0496101_0295644 3300048904 Bacteria 1267
1089 Ga0496101_0449761 3300048904 Bacteria 1016
1090 Ga0496101_0518280 3300048904 Bacteria 942
1091 Ga0496101_0807692 3300048904 Bacteria 740
1092 Ga0496102_0007258 3300048905 Bacteria 9459
1093 Ga0496102_0066625 3300048905 Bacteria 3300
1094 Ga0496102_0076345 3300048905 Bacteria 3082
1095 Ga0496102_0111461 3300048905 Bacteria 2551
1096 Ga0496102_0178625 3300048905 Bacteria 1999
1097 Ga0496102_0220104 3300048905 Bacteria 1789
1098 Ga0496102_0222257 3300048905 Bacteria 1780
1099 Ga0496102_0636828 3300048905 Bacteria 989
1100 Ga0496102_1092784 3300048905 Bacteria 717
1101 Ga0496103_0007528 3300048906 Bacteria 6491
1102 Ga0496103_0015734 3300048906 Bacteria 4509
1103 Ga0496103_0021459 3300048906 Bacteria 3885
1104 Ga0496103_0040061 3300048906 Bacteria 2879
1105 Ga0496103_0079096 3300048906 Bacteria 2066
1106 Ga0496103_0337717 3300048906 Bacteria 969
1107 Ga0496104_0000568 3300048907 Bacteria 31543
1108 Ga0496104_0010563 3300048907 Bacteria 8246
1109 Ga0496104_0043904 3300048907 Bacteria 4199
1110 Ga0496104_0059519 3300048907 Bacteria 3616
1111 Ga0496104_0137477 3300048907 Bacteria 2347
1112 Ga0496104_0226148 3300048907 Bacteria 1783
1113 Ga0496104_0399615 3300048907 Bacteria 1286
1114 Ga0496104_0819904 3300048907 Bacteria 836
1115 Ga0496105_0000457 3300048908 Bacteria 26876
1116 Ga0496105_0002396 3300048908 Bacteria 13566
1117 Ga0496105_0004767 3300048908 Bacteria 10237
1118 Ga0496105_0005072 3300048908 Bacteria 9976
1119 Ga0496105_0006996 3300048908 Bacteria 8689
1120 Ga0496105_0007239 3300048908 Bacteria 8570
1121 Ga0496105_0022270 3300048908 Bacteria 5131
1122 Ga0496105_0108306 3300048908 Bacteria 2294
1123 Ga0496105_0239933 3300048908 Bacteria 1471
1124 Ga0496105_0621179 3300048908 Bacteria 837
1125 Ga0496106_0003674 3300048909 Bacteria 11434
1126 Ga0496106_0012382 3300048909 Bacteria 6297
1127 Ga0496106_0072295 3300048909 Bacteria 2637
1128 Ga0496106_0085511 3300048909 Bacteria 2428
1129 Ga0496106_0116674 3300048909 Bacteria 2083
1130 Ga0496106_0167030 3300048909 Bacteria 1742
1131 Ga0496106_0622079 3300048909 Bacteria 864
1132 Ga0496107_0004641 3300048910 Bacteria 9318
1133 Ga0496107_0043346 3300048910 Bacteria 3232
1134 Ga0496107_0046988 3300048910 Bacteria 3107
1135 Ga0496107_0182871 3300048910 Bacteria 1556
1136 Ga0496107_0231764 3300048910 Bacteria 1374
1137 Ga0496107_0258061 3300048910 Bacteria 1297
1138 Ga0496107_0882661 3300048910 Bacteria 652
1139 Ga0496108_0002627 3300048911 Bacteria 14398
1140 Ga0496108_0006684 3300048911 Bacteria 9338
1141 Ga0496108_0024613 3300048911 Bacteria 4957
1142 Ga0496108_0026971 3300048911 Bacteria 4740
1143 Ga0496108_0030460 3300048911 Bacteria 4472
1144 Ga0496108_0122697 3300048911 Bacteria 2229
1145 Ga0496108_0207247 3300048911 Bacteria 1701
1146 Ga0496108_0319801 3300048911 Bacteria 1353
1147 Ga0496108_0346431 3300048911 Bacteria 1296
1148 Ga0496108_0388697 3300048911 Bacteria 1218
1149 Ga0496109_0002827 3300048912 Bacteria 14545
1150 Ga0496109_0007630 3300048912 Bacteria 9173
1151 Ga0496109_0008726 3300048912 Bacteria 8630
1152 Ga0496109_0008994 3300048912 Bacteria 8504
1153 Ga0496109_0014010 3300048912 Bacteria 6970
1154 Ga0496109_0015471 3300048912 Bacteria 6649
1155 Ga0496109_0059306 3300048912 Bacteria 3496
1156 Ga0496109_0102525 3300048912 Bacteria 2655
1157 Ga0496109_0102667 3300048912 Bacteria 2654
1158 Ga0496109_0105412 3300048912 Bacteria 2618
1159 Ga0496109_0139385 3300048912 Bacteria 2267
1160 Ga0496109_0272041 3300048912 Bacteria 1596
1161 Ga0496109_0335251 3300048912 Bacteria 1428
1162 Ga0496109_0463888 3300048912 Bacteria 1196
1163 Ga0496109_0709289 3300048912 Bacteria 943
1164 Ga0496110_0000054 3300048913 Bacteria 57987
1165 Ga0496110_0000980 3300048913 Bacteria 20040
1166 Ga0496110_0019346 3300048913 Bacteria 5728
1167 Ga0496110_0020491 3300048913 Bacteria 5584
1168 Ga0496110_0073489 3300048913 Bacteria 3034
1169 Ga0496110_0216320 3300048913 Bacteria 1742
1170 Ga0496111_0000156 3300048914 Bacteria 30445
1171 Ga0496111_0000243 3300048914 Bacteria 26096
1172 Ga0496111_0013181 3300048914 Bacteria 5621
1173 Ga0496111_0020816 3300048914 Bacteria 4573
1174 Ga0496111_0039385 3300048914 Bacteria 3388
1175 Ga0496111_0082287 3300048914 Bacteria 2351
1176 Ga0496111_0134640 3300048914 Bacteria 1830
1177 Ga0496112_0000300 3300048915 Bacteria 31936
1178 Ga0496112_0025114 3300048915 Bacteria 5717
1179 Ga0496112_0035423 3300048915 Bacteria 4862
1180 Ga0496112_0040341 3300048915 Bacteria 4564
1181 Ga0496112_0051694 3300048915 Bacteria 4031
1182 Ga0496112_0053844 3300048915 Bacteria 3952
1183 Ga0496112_0058787 3300048915 Bacteria 3787
1184 Ga0496112_0113776 3300048915 Bacteria 2676
1185 Ga0496112_0136060 3300048915 Bacteria 2427
1186 Ga0496112_0587901 3300048915 Bacteria 1046
1187 Ga0496112_0762430 3300048915 Bacteria 893
1188 Ga0496113_0000275 3300048916 Bacteria 24381
1189 Ga0496113_0041747 3300048916 Bacteria 3387
1190 Ga0496113_0063608 3300048916 Bacteria 2788
1191 Ga0496113_0089816 3300048916 Bacteria 2365
1192 Ga0496114_0005825 3300048917 Bacteria 9676
1193 Ga0496114_0008296 3300048917 Bacteria 8231
1194 Ga0496114_0011918 3300048917 Bacteria 6957
1195 Ga0496114_0028280 3300048917 Bacteria 4599
1196 Ga0496114_0031921 3300048917 Bacteria 4333
1197 Ga0496114_0034894 3300048917 Bacteria 4153
1198 Ga0496114_0068918 3300048917 Bacteria 2970
1199 Ga0496114_0082235 3300048917 Bacteria 2722
1200 Ga0496114_0154982 3300048917 Bacteria 1989
1201 Ga0496114_0221721 3300048917 Bacteria 1660
1202 Ga0496114_0390771 3300048917 Bacteria 1232
1203 Ga0496114_0438688 3300048917 Bacteria 1156
1204 Ga0496114_0495874 3300048917 Bacteria 1080
1205 Ga0496114_0512216 3300048917 Bacteria 1061
1206 Ga0496114_0843231 3300048917 Bacteria 796
1207 Ga0496115_0008732 3300048918 Bacteria 7511
1208 Ga0496115_0021128 3300048918 Bacteria 5024
1209 Ga0496115_0033634 3300048918 Bacteria 4048
1210 Ga0496115_0038218 3300048918 Bacteria 3808
1211 Ga0496115_0092162 3300048918 Bacteria 2477
1212 Ga0496115_0099710 3300048918 Bacteria 2380
1213 Ga0496115_0116868 3300048918 Bacteria 2194
1214 Ga0496115_0135960 3300048918 Bacteria 2027
1215 Ga0496115_0225347 3300048918 Bacteria 1546
1216 Ga0496115_0637962 3300048918 Bacteria 843
1217 Ga0501031_0137555 3300049568 Bacteria 1596
1218 Ga0501033_0011314 3300049570 Bacteria 6831
1219 Ga0501033_0153639 3300049570 Bacteria 1659
1220 Ga0501034_0709802 3300049571 Bacteria 904
1221 Ga0501036_0064525 3300049572 Bacteria 3099
1222 Ga0501036_0099881 3300049572 Bacteria 2454
1223 Ga0501036_0192735 3300049572 Bacteria 1715
1224 Ga0501036_0243293 3300049572 Bacteria 1509
1225 Ga0501036_0643714 3300049572 Bacteria 878
1226 Ga0501037_0135447 3300049573 Bacteria 1764
1227 Ga0501037_0156962 3300049573 Bacteria 1623
1228 Ga0501037_0191287 3300049573 Bacteria 1449
1229 Ga0501037_0465709 3300049573 Bacteria 861
1230 Ga0501038_0002835 3300049574 Bacteria 16133
1231 Ga0501039_0002978 3300049575 Bacteria 12671
1232 Ga0501039_0034693 3300049575 Bacteria 3892
1233 Ga0501039_0297314 3300049575 Bacteria 1269
1234 Ga0501039_0458766 3300049575 Bacteria 1001
1235 Ga0501040_0003917 3300049576 Bacteria 9661
1236 Ga0501040_0056074 3300049576 Bacteria 2703
1237 Ga0501040_0160636 3300049576 Bacteria 1588
1238 Ga0501041_0007132 3300049577 Bacteria 6556
1239 Ga0501041_0013352 3300049577 Bacteria 4867
1240 Ga0501041_0109467 3300049577 Bacteria 1714
1241 Ga0501041_0155772 3300049577 Bacteria 1427
1242 Ga0501041_0242916 3300049577 Bacteria 1132
1243 Ga0501042_0034401 3300049578 Bacteria 3593
1244 Ga0501042_0160716 3300049578 Bacteria 1621
1245 Ga0501042_0349905 3300049578 Bacteria 1069
1246 Ga0501042_0372307 3300049578 Bacteria 1034
1247 Ga0501046_0170685 3300049580 Bacteria 1633
1248 Ga0501047_0056961 3300049581 Bacteria 3780
1249 Ga0501047_0113994 3300049581 Bacteria 2585
1250 Ga0501047_0489799 3300049581 Bacteria 1057
1251 Ga0501048_0002599 3300049582 Bacteria 13837
1252 Ga0501048_0019984 3300049582 Bacteria 4911
1253 Ga0501048_0030138 3300049582 Bacteria 3928
1254 Ga0501048_0258234 3300049582 Bacteria 1238
1255 Ga0501048_0466049 3300049582 Bacteria 905
1256 Ga0501067_0006992 3300049583 Bacteria 6262
1257 Ga0501067_0019921 3300049583 Bacteria 3711
1258 Ga0501067_0070099 3300049583 Bacteria 1941
1259 Ga0501067_0075307 3300049583 Bacteria 1870
1260 Ga0501067_0167565 3300049583 Bacteria 1223
1261 Ga0501067_0260032 3300049583 Bacteria 966
1262 Ga0501068_0016659 3300049584 Bacteria 4238
1263 Ga0501068_0034780 3300049584 Bacteria 3006
1264 Ga0501068_0178574 3300049584 Bacteria 1342
1265 Ga0501069_0027406 3300049585 Bacteria 3122
1266 Ga0501069_0031671 3300049585 Bacteria 2910
1267 Ga0501069_0082803 3300049585 Bacteria 1808
1268 Ga0501069_0406856 3300049585 Bacteria 806
1269 Ga0501070_0049461 3300049586 Bacteria 3491
1270 Ga0501070_0160124 3300049586 Bacteria 1856
1271 Ga0501070_0639710 3300049586 Bacteria 845
1272 Ga0501071_0002211 3300049587 Bacteria 11702
1273 Ga0501071_0049718 3300049587 Bacteria 3019
1274 Ga0501071_0066101 3300049587 Bacteria 2627
1275 Ga0501071_0103252 3300049587 Bacteria 2103
1276 Ga0501071_0116465 3300049587 Bacteria 1978
1277 Ga0501071_0497897 3300049587 Bacteria 935
1278 Ga0501072_0011137 3300049588 Bacteria 6863
1279 Ga0501072_0080055 3300049588 Bacteria 2587
1280 Ga0501072_0136297 3300049588 Bacteria 1957
1281 Ga0501072_0313160 3300049588 Bacteria 1247
1282 Ga0501072_0627938 3300049588 Bacteria 846
1283 Ga0501074_0007610 3300049590 Bacteria 7840
1284 Ga0501074_0275471 3300049590 Bacteria 1196
1285 Ga0501074_0329299 3300049590 Bacteria 1084
1286 Ga0501074_0515855 3300049590 Unclassified 847
1287 Ga0501075_0003490 3300049591 Bacteria 10513
1288 Ga0501075_0050367 3300049591 Bacteria 3131
1289 Ga0501075_0063980 3300049591 Bacteria 2774
1290 Ga0501075_0172661 3300049591 Bacteria 1650
1291 Ga0501075_0308010 3300049591 Bacteria 1207
1292 Ga0501075_0626285 3300049591 Bacteria 820
1293 Ga0501076_0006835 3300049592 Bacteria 8279
1294 Ga0501076_0045765 3300049592 Bacteria 3455
1295 Ga0501076_0129651 3300049592 Bacteria 2045
1296 Ga0501076_0360422 3300049592 Bacteria 1194
1297 Ga0501076_0815469 3300049592 Bacteria 770
1298 Ga0501077_0003797 3300049593 Bacteria 9094
1299 Ga0501077_0011455 3300049593 Bacteria 5539
1300 Ga0501077_0037016 3300049593 Bacteria 3108
1301 Ga0501077_0072119 3300049593 Bacteria 2188
1302 Ga0501077_0101464 3300049593 Bacteria 1823
1303 Ga0501077_0102055 3300049593 Bacteria 1818
1304 Ga0501077_0230285 3300049593 Bacteria 1178
1305 Ga0501077_0237985 3300049593 Bacteria 1157
1306 Ga0501079_0004409 3300049741 Bacteria 10422
1307 Ga0501079_0098607 3300049741 Bacteria 2265
1308 Ga0501079_0269982 3300049741 Bacteria 1330
1309 Ga0501080_0204349 3300049742 Bacteria 1812
1310 Ga0501080_0260291 3300049742 Bacteria 1581
1311 Ga0501080_0285866 3300049742 Bacteria 1498
1312 Ga0501080_0287419 3300049742 Bacteria 1494
1313 Ga0501080_1108018 3300049742 Bacteria 683
1314 Ga0501081_0001579 3300049743 Bacteria 14051
1315 Ga0501081_0089873 3300049743 Bacteria 2158
1316 Ga0501081_0236908 3300049743 Bacteria 1330
1317 Ga0501081_0274822 3300049743 Bacteria 1233
1318 Ga0501083_0042992 3300049744 Bacteria 3062
1319 Ga0501035_0007148 3300049822 Bacteria 10442
1320 Ga0501044_0954161 3300049823 Bacteria 731
1321 Ga0501045_0109987 3300049824 Bacteria 2043
1322 Ga0501045_0112180 3300049824 Bacteria 2021
1323 Ga0501045_0461019 3300049824 Bacteria 944
1324 nmdc:mga03683_52902_c1 3300050489 Unclassified 1698
1325 nmdc:mga00v17_442877_c1 3300050491 Unclassified 844
1326 nmdc:mga0k408_293362_c1 3300050493 Bacteria 970
1327 nmdc:mga05p37_154440_c1 3300050507 Bacteria 2806
1328 nmdc:mga05p37_229940_c1 3300050507 Bacteria 2235
1329 nmdc:mga05p37_444007_c1 3300050507 Unclassified 1504
1330 nmdc:mga05p37_467866_c1 3300050507 Bacteria 1455
1331 nmdc:mga05p37_52745_c1 3300050507 Bacteria 1832
1332 nmdc:mga05p37_815300_c1 3300050507 Bacteria 1019
1333 nmdc:mga05p37_844865_c1 3300050507 Bacteria 995
1334 nmdc:mga05p37_86206_c1 3300050507 Bacteria 3871
1335 nmdc:mga09592_20016_c1 3300050508 Bacteria 5498
1336 nmdc:mga09592_229046_c1 3300050508 Bacteria 1610
1337 nmdc:mga09592_311048_c1 3300050508 Bacteria 1365
1338 nmdc:mga09592_7064_c1 3300050508 Bacteria 9124
1339 nmdc:mga09592_82492_c1 3300050508 Bacteria 2740
1340 nmdc:mga0qj67_116856_c1 3300050509 Bacteria 2156
1341 nmdc:mga0qj67_168230_c1 3300050509 Bacteria 1780
1342 nmdc:mga0qj67_212520_c1 3300050509 Bacteria 1571
1343 nmdc:mga0qj67_464757_c1 3300050509 Bacteria 1019
1344 nmdc:mga0qj67_869199_c1 3300050509 Bacteria 712
1345 nmdc:mga06r32_108204_c1 3300050510 Bacteria 2733
1346 nmdc:mga06r32_172594_c1 3300050510 Bacteria 2146
1347 nmdc:mga06r32_343702_c1 3300050510 Bacteria 1477
1348 nmdc:mga06r32_44390_c1 3300050510 Bacteria 4233
1349 nmdc:mga06r32_512261_c1 3300050510 Bacteria 1176
1350 nmdc:mga06r32_55175_c1 3300050510 Bacteria 3811
1351 nmdc:mga06r32_719770_c1 3300050510 Bacteria 963
1352 nmdc:mga08y16_270030_c1 3300050511 Bacteria 1756
1353 nmdc:mga08y16_2814_c1 3300050511 Bacteria 17864
1354 nmdc:mga08y16_31729_c1 3300050511 Bacteria 5555
1355 nmdc:mga08y16_32986_c1 3300050511 Bacteria 5441
1356 nmdc:mga08y16_418545_c1 3300050511 Bacteria 1370
1357 nmdc:mga08y16_59413_c1 3300050511 Bacteria 3994
1358 nmdc:mga08y16_61338_c1 3300050511 Bacteria 3927
1359 nmdc:mga08y16_643010_c1 3300050511 Bacteria 1066
1360 nmdc:mga08y16_97069_c1 3300050511 Bacteria 3069
1361 nmdc:mga0n895_117193_c1 3300050512 Bacteria 2682
1362 nmdc:mga0n895_14920_c1 3300050512 Bacteria 7076
1363 nmdc:mga0n895_228035_c1 3300050512 Bacteria 1891
1364 nmdc:mga0n895_241324_c1 3300050512 Bacteria 1834
1365 nmdc:mga0n895_311848_c1 3300050512 Bacteria 1594
1366 nmdc:mga0n895_31746_c1 3300050512 Bacteria 5061
1367 nmdc:mga0n895_325684_c1 3300050512 Bacteria 1557
1368 nmdc:mga0n895_66179_c1 3300050512 Bacteria 3578
1369 nmdc:mga0rr50_119590_c1 3300050513 Bacteria 2095
1370 nmdc:mga0rr50_174028_c1 3300050513 Bacteria 1756
1371 nmdc:mga0rr50_190381_c1 3300050513 Bacteria 1681
1372 nmdc:mga0rr50_198141_c1 3300050513 Bacteria 1649
1373 nmdc:mga08x19_157336_c1 3300050514 Bacteria 1542
1374 nmdc:mga08x19_232619_c1 3300050514 Bacteria 1269
1375 nmdc:mga08x19_30892_c1 3300050514 Bacteria 3367
1376 nmdc:mga08x19_64245_c1 3300050514 Bacteria 2382
1377 nmdc:mga0a205_16661_c1 3300050515 Bacteria 6884
1378 nmdc:mga0a205_214689_c1 3300050515 Bacteria 1811
1379 nmdc:mga0a205_217420_c1 3300050515 Bacteria 1798
1380 nmdc:mga0a205_39141_c1 3300050515 Bacteria 4562
1381 nmdc:mga0a205_467391_c1 3300050515 Bacteria 1120
1382 nmdc:mga0a205_634673_c1 3300050515 Bacteria 920
1383 nmdc:mga0a205_66865_c2 3300050515 Bacteria 2338
1384 nmdc:mga0a205_949291_c1 3300050515 Bacteria 707
1385 Ga0495601_0027307 3300053077 Bacteria 3529
1386 Ga0495601_0173957 3300053077 Bacteria 1407
1387 Ga0495601_0214714 3300053077 Bacteria 1256
1388 Ga0495612_0044060 3300053078 Bacteria 1825
1389 Ga0495655_0075976 3300053083 Bacteria 950
1390 Ga0495595_0280013 3300053084 Bacteria 837
1391 Ga0495595_0313413 3300053084 Bacteria 790
1392 Ga0495595_0314879 3300053084 Bacteria 788
1393 Ga0495619_0022307 3300053085 Bacteria 4050
1394 Ga0495619_0578085 3300053085 Bacteria 769
1395 Ga0501084_0002637 3300054114 Bacteria 14452
1396 Ga0501084_0018862 3300054114 Bacteria 5743
1397 Ga0501084_0070642 3300054114 Bacteria 2923
1398 Ga0501084_0229688 3300054114 Bacteria 1566
1399 Ga0590075_131431 3300059424 Bacteria 657
1400 Ga0587084_023551 3300059477 Bacteria 941
1401 Ga0587066_046455 3300059490 Bacteria 838
1402 Ga0587077_023304 3300059493 Bacteria 1117
1403 Ga0587082_032460 3300059504 Bacteria 917
1404 Ga0587082_053888 3300059504 Bacteria 775
1405 Ga0587083_0063175 3300059505 Bacteria 840
1406 Ga0587083_0082448 3300059505 Bacteria 769
1407 Ga0587085_015779 3300059506 Bacteria 1084
1408 Ga0587085_074283 3300059506 Bacteria 671
1409 Ga0587091_050018 3300059511 Bacteria 855
1410 Ga0587094_022837 3300059513 Bacteria 921
1411 Ga0587128_027912 3300059630 Bacteria 915
1412 Ga0587069_075407 3300059642 Bacteria 648
1413 Ga0587079_069111 3300059647 Bacteria 784
1414 Ga0587119_012725 3300059658 Bacteria 987
1415 Ga0587071_024076 3300060344 Bacteria 1134
1416 Ga0587071_050534 3300060344 Bacteria 859
1417 Ga0501082_0009071 3300060353 Bacteria 8579
1418 Ga0501082_0030563 3300060353 Bacteria 4642
1419 Ga0501082_0147088 3300060353 Bacteria 2045
1420 Ga0501082_0288122 3300060353 Bacteria 1430
1421 Ga0501082_0405716 3300060353 Bacteria 1189
1422 Ga0466962_0016793 3300061719 Bacteria 3528
1423 Ga0466962_0035971 3300061719 Bacteria 2370
1424 Ga0530510_0010517 3300061734 Bacteria 6487
1425 Ga0530510_0024772 3300061734 Bacteria 4286
1426 Ga0530510_0048071 3300061734 Bacteria 3083
1427 Ga0530510_0069058 3300061734 Bacteria 2564
1428 Ga0530510_0162878 3300061734 Bacteria 1650
1429 Ga0530510_0347020 3300061734 Bacteria 1115
1430 Ga0530510_0490602 3300061734 Bacteria 931
1431 Ga0530510_0845559 3300061734 Bacteria 699
1432 Ga0075432_10103970
1433 JGI25407J50210_10000289
1434 JGI25407J50210_10027312
1435 JGI25407J50210_10028471
1436 JGI25404J52841_10032556
1437 Ga0058861_10029875
1438 Ga0058862_10090311
1439 Ga0070676_10495253
1440 Ga0070683_100004118
1441 Ga0070683_100228630
1442 Ga0070683_100321082
1443 Ga0070683_100815698
1444 Ga0070683_100845570
1445 Ga0070690_100010006
1446 Ga0070690_100057669
1447 Ga0070690_100066426
1448 Ga0070690_100098630
1449 Ga0070690_100599665
1450 Ga0070677_10196758
1451 Ga0068869_100181565
1452 Ga0070666_10139940
1453 Ga0070680_100129751
1454 Ga0070680_100175039
1455 Ga0070680_100241775
1456 Ga0070682_100003401
1457 Ga0070682_100061412
1458 Ga0070682_100075888
1459 Ga0070682_100093195
1460 Ga0070682_100102291
1461 Ga0070682_100226330
1462 Ga0068868_100021916
1463 Ga0068868_100037957
1464 Ga0068868_100174154
1465 Ga0068868_100188551
1466 Ga0068868_100202619
1467 Ga0068868_100267025
1468 Ga0068868_100299064
1469 Ga0070660_100048578
1470 Ga0070660_100076546
1471 Ga0070660_100222384
1472 Ga0070660_100303730
1473 Ga0070689_100230410
1474 Ga0070689_100511471
1475 Ga0070691_10115831
1476 Ga0070691_10237937
1477 Ga0070687_100256665
1478 Ga0070661_100047206
1479 Ga0070661_100156791
1480 Ga0070661_100750842
1481 Ga0070692_10011629
1482 Ga0070692_10023120
1483 Ga0070692_10091206
1484 Ga0070692_10094951
1485 Ga0070668_100397029
1486 Ga0070668_100536419
1487 Ga0070675_100598247
1488 Ga0070675_100652037
1489 Ga0070671_100386025
1490 Ga0070671_100399393
1491 Ga0070671_100420565
1492 Ga0070674_100032414
1493 Ga0070674_100047960
1494 Ga0070673_100017707
1495 Ga0070673_100422218
1496 Ga0070673_100981156
1497 Ga0070688_100011538
1498 Ga0070688_100017530
1499 Ga0070659_100019301
1500 Ga0070659_100039597
1501 Ga0070659_100993267
1502 Ga0070667_100136251
1503 Ga0070703_10004087
1504 Ga0070703_10065633
1505 Ga0070709_10052309
1506 Ga0070709_10064398
1507 Ga0070709_10078786
1508 Ga0070709_10092424
1509 Ga0070709_10115735
1510 Ga0070709_10232910
1511 Ga0070714_100029263
1512 Ga0070714_100139279
1513 Ga0070714_100243510
1514 Ga0070714_100266845
1515 Ga0070714_100651726
1516 Ga0070714_100700231
1517 Ga0070713_100236114
1518 Ga0070713_100268378
1519 Ga0070713_100713933
1520 Ga0070713_101158964
1521 Ga0070710_10012552
1522 Ga0070710_10018013
1523 Ga0070710_10053838
1524 Ga0070710_10057552
1525 Ga0070701_10019176
1526 Ga0070701_10021876
1527 Ga0070701_10110441
1528 Ga0070711_100006010
1529 Ga0070711_100011069
1530 Ga0070711_100022300
1531 Ga0070711_100079563
1532 Ga0070711_100088935
1533 Ga0070705_100029179
1534 Ga0070705_100058677
1535 Ga0070705_100069264
1536 Ga0070705_100071793
1537 Ga0070705_100103111
1538 Ga0070705_100164062
1539 Ga0070705_100193676
1540 Ga0070705_100341472
1541 Ga0070705_100494127
1542 Ga0070700_100001006
1543 Ga0070700_100013938
1544 Ga0070700_100161099
1545 Ga0070700_100499135
1546 Ga0070694_100014357
1547 Ga0070708_100183070
1548 Ga0070708_100237361
1549 Ga0070708_100614526
1550 Ga0070708_101215099
1551 Ga0070663_100075414
1552 Ga0070663_100099828
1553 Ga0070663_100271835
1554 Ga0070678_100000610
1555 Ga0070678_100017028
1556 Ga0070678_100027163
1557 Ga0070662_100072757
1558 Ga0070662_100289734
1559 Ga0070681_10234884
1560 Ga0068867_100131224
1561 Ga0068867_100729652
1562 Ga0070685_10220746
1563 Ga0070685_10266871
1564 Ga0070706_100009648
1565 Ga0070706_100034451
1566 Ga0070706_100584668
1567 Ga0070706_100846756
1568 Ga0070707_100000909
1569 Ga0070707_100143993
1570 Ga0070707_100150790
1571 Ga0070707_100153621
1572 Ga0070707_100356827
1573 Ga0070698_100021420
1574 Ga0070698_100023816
1575 Ga0070698_100062351
1576 Ga0070698_100405578
1577 Ga0070699_100395579
1578 Ga0070699_100999875
1579 Ga0070679_100163736
1580 Ga0070679_100397346
1581 Ga0070679_100529019
1582 Ga0070679_100905438
1583 Ga0070684_100054574
1584 Ga0070684_100055287
1585 Ga0070684_100064453
1586 Ga0070684_100077735
1587 Ga0070684_100114560
1588 Ga0070684_100248766
1589 Ga0070684_100400352
1590 Ga0070697_100070019
1591 Ga0070697_100196635
1592 Ga0070697_100507760
1593 Ga0068853_100020589
1594 Ga0068853_100024733
1595 Ga0068853_100232309
1596 Ga0070672_100207923
1597 Ga0070672_100403028
1598 Ga0070686_100002710
1599 Ga0070686_100011818
1600 Ga0070686_100025908
1601 Ga0070686_100086275
1602 Ga0070686_100376457
1603 Ga0070695_100113818
1604 Ga0070695_100164599
1605 Ga0070695_100328724
1606 Ga0070695_100580327
1607 Ga0070695_100761001
1608 Ga0070696_100027632
1609 Ga0070696_100036287
1610 Ga0070696_100041305
1611 Ga0070696_100050548
1612 Ga0070696_100161589
1613 Ga0070696_100335126
1614 Ga0070693_100002170
1615 Ga0070693_100017228
1616 Ga0070693_100039988
1617 Ga0070693_100068241
1618 Ga0070693_100079873
1619 Ga0070665_100076549
1620 Ga0070665_100094538
1621 Ga0070665_100310706
1622 Ga0070704_100077761
1623 Ga0070704_100130360
1624 Ga0070704_100138685
1625 Ga0070704_100149955
1626 Ga0070704_100150812
1627 Ga0070704_100381507
1628 Ga0070704_100639094
1629 Ga0068855_100162744
1630 Ga0068855_100167180
1631 Ga0068855_100302025
1632 Ga0068855_100383089
1633 Ga0068855_100613884
1634 Ga0070664_100009330
1635 Ga0070664_100134553
1636 Ga0070664_100139981
1637 Ga0070664_100468238
1638 Ga0068857_100000231
1639 Ga0068857_100061360
1640 Ga0068857_100126729
1641 Ga0068857_100415569
1642 Ga0068854_100094485
1643 Ga0068854_100111557
1644 Ga0068854_100374562
1645 Ga0068854_101017107
1646 Ga0068856_100030396
1647 Ga0068856_100345021
1648 Ga0068856_100792277
1649 Ga0068856_100838262
1650 Ga0070702_100003035
1651 Ga0070702_100005902
1652 Ga0070702_100009254
1653 Ga0070702_100025412
1654 Ga0070702_100027013
1655 Ga0068852_100085204
1656 Ga0068852_100180393
1657 Ga0068859_100042244
1658 Ga0068859_100428745
1659 Ga0068859_100607142
1660 Ga0068864_100016821
1661 Ga0068864_100158826
1662 Ga0068864_100269875
1663 Ga0068866_10141004
1664 Ga0068866_10197508
1665 Ga0068861_100012914
1666 Ga0068851_10036779
1667 Ga0068863_100458226
1668 Ga0068858_100207967
1669 Ga0068858_100273057
1670 Ga0081455_10007749
1671 Ga0081455_10018478
1672 Ga0081455_10038340
1673 Ga0081455_10043239
1674 Ga0081455_10045940
1675 Ga0081455_10071215
1676 Ga0081455_10079908
1677 Ga0081538_10000052
1678 Ga0081538_10000352
1679 Ga0081538_10000571
1680 Ga0081538_10000677
1681 Ga0081538_10000872
1682 Ga0081538_10010401
1683 Ga0081538_10016094
1684 Ga0081540_1001965
1685 Ga0081540_1005187
1686 Ga0081540_1005276
1687 Ga0081540_1094445
1688 Ga0081539_10008181
1689 Ga0070717_10024233
1690 Ga0070717_10030782
1691 Ga0070717_10033346
1692 Ga0070717_10053163
1693 Ga0070717_10057003
1694 Ga0070717_10224651
1695 Ga0075365_10007709
1696 Ga0075364_10060833
1697 Ga0075364_10524429
1698 Ga0070715_10008610
1699 Ga0070716_100016672
1700 Ga0070716_100044575
1701 Ga0070716_100078960
1702 Ga0070716_100210883
1703 Ga0070716_100418183
1704 Ga0070712_100011230
1705 Ga0070712_100019238
1706 Ga0070712_100025261
1707 Ga0070712_100043248
1708 Ga0070712_100301765
1709 Ga0070712_100343570
1710 Ga0070712_100452367
1711 Ga0070712_100686410
1712 Ga0075362_10005562
1713 Ga0075427_10005503
1714 Ga0097621_100016805
1715 Ga0097621_100060448
1716 Ga0097621_100169932
1717 Ga0097621_100389025
1718 Ga0097621_100767054
1719 Ga0068871_100049456
1720 Ga0068871_100142390
1721 Ga0068871_100178685
1722 Ga0068871_100366591
1723 Ga0068871_100519765
1724 Ga0075428_100055600
1725 Ga0075428_100081370
1726 Ga0075428_100174650
1727 Ga0075428_100195786
1728 Ga0075430_100007921
1729 Ga0075430_100040628
1730 Ga0075430_100107397
1731 Ga0075430_100213120
1732 Ga0075431_100121088
1733 Ga0075431_100133721
1734 Ga0075431_100162214
1735 Ga0075431_100190267
1736 Ga0075431_100213321
1737 Ga0075431_100604168
1738 Ga0075431_100615776
1739 Ga0075433_10042647
1740 Ga0075433_10119917
1741 Ga0075433_10252161
1742 Ga0075433_10266278
1743 Ga0075433_10529117
1744 Ga0075433_10561541
1745 Ga0075434_100001520
1746 Ga0075434_100004815
1747 Ga0075434_100060849
1748 Ga0075434_100319272
1749 Ga0075434_100860845
1750 Ga0075429_100039216
1751 Ga0075429_100123719
1752 Ga0075429_100168007
1753 Ga0075429_100174612
1754 Ga0075429_100209528
1755 Ga0075429_100232359
1756 Ga0075429_100472247
1757 Ga0075429_100475554
1758 Ga0068865_100002992
1759 Ga0068865_100049398
1760 Ga0068865_100119851
1761 Ga0068865_100203346
1762 Ga0075436_100003579
1763 Ga0075436_100020046
1764 Ga0075436_100103621
1765 Ga0075436_100108287
1766 Ga0075436_100214311
1767 Ga0075436_100518128
1768 Ga0075436_100593351
1769 Ga0097620_100042244
1770 Ga0097620_100428760
1771 Ga0097620_100607196
1772 Ga0075435_100001635
1773 Ga0075435_100011437
1774 Ga0075435_100047701
1775 Ga0075435_100175508
1776 Ga0075435_101058504
1777 Ga0105240_10081108
1778 Ga0111539_10001013
1779 Ga0111539_10038452
1780 Ga0111539_10040525
1781 Ga0111539_10154510
1782 Ga0111539_10167824
1783 Ga0111539_10211542
1784 Ga0111539_10275484
1785 Ga0111539_10291091
1786 Ga0111539_11512254
1787 Ga0105245_10014783
1788 Ga0105245_10033360
1789 Ga0105245_10073050
1790 Ga0105245_10130472
1791 Ga0105245_10290337
1792 Ga0105245_10493588
1793 Ga0105245_10609213
1794 Ga0105245_10795035
1795 Ga0105245_11064121
1796 Ga0105247_10239044
1797 Ga0105247_10290602
1798 Ga0114129_10016536
1799 Ga0114129_10070385
1800 Ga0114129_10099939
1801 Ga0114129_10164011
1802 Ga0114129_10246248
1803 Ga0114129_10292963
1804 Ga0114129_10295527
1805 Ga0114129_10701493
1806 Ga0114129_10860170
1807 Ga0114129_11057041
1808 Ga0105243_10028290
1809 Ga0105243_10128232
1810 Ga0105243_10282530
1811 Ga0105243_10389800
1812 Ga0105243_10625517
1813 Ga0105241_10010007
1814 Ga0105241_10110098
1815 Ga0105241_10681524
1816 Ga0105242_10006691
1817 Ga0105242_10032138
1818 Ga0105242_10082511
1819 Ga0105242_10112166
1820 Ga0105242_10270518
1821 Ga0105242_10430223
1822 Ga0105242_10468123
1823 Ga0105248_10019066
1824 Ga0105248_10023316
1825 Ga0105248_10175023
1826 Ga0105248_10186556
1827 Ga0105248_10194549
1828 Ga0105248_10324417
1829 Ga0105237_10000037
1830 Ga0105237_10198868
1831 Ga0105237_10360923
1832 Ga0105238_10060284
1833 Ga0105238_10065350
1834 Ga0105238_10879468
1835 Ga0105238_11214748
1836 Ga0105238_11232831
1837 Ga0105249_10002735
1838 Ga0105249_10024846
1839 Ga0105249_10120216
1840 Ga0105239_10105487
1841 Ga0105239_10125646
1842 Ga0105239_10405532
1843 Ga0105239_10641417
1844 Ga0105239_10726013
1845 Ga0105239_10854570
1846 Ga0105239_11081622
1847 Ga0105239_11557599
1848 Ga0105239_11970590
1849 Ga0105246_10058244
1850 Ga0105246_10060099
1851 Ga0105246_10124321
1852 Ga0105246_10225135
1853 Ga0105246_10614809
1854 Ga0105246_11060820
1855 Ga0157329_1005250
1856 Ga0157324_1001728
1857 Ga0157338_1005275
1858 Ga0157371_10086198
1859 Ga0157371_10117202
1860 Ga0157370_10077618
1861 Ga0157369_10249147
1862 Ga0157369_10607263
1863 Ga0157374_10028012
1864 Ga0157374_10768295
1865 Ga0157378_10036713
1866 Ga0157378_10041614
1867 Ga0157378_10216987
1868 Ga0163162_10003800
1869 Ga0163162_10036629
1870 Ga0163162_11080968
1871 Ga0157372_10053020
1872 Ga0157372_10103103
1873 Ga0157372_10126423
1874 Ga0157372_11301457
1875 Ga0157375_10013777
1876 Ga0157375_10017172
1877 Ga0157375_10148833
1878 Ga0157375_10255824
1879 Ga0157375_10345738
1880 Ga0157375_10473337
1881 Ga0157375_11106246
1882 Ga0163163_10361960
1883 Ga0163163_10362136
1884 Ga0163163_10745436
1885 Ga0157380_10118872
1886 Ga0157380_10524468
1887 Ga0157380_11676883
1888 Ga0182008_10050308
1889 Ga0182008_10098766
1890 Ga0182008_10341260
1891 Ga0157377_10077893
1892 Ga0157379_10005505
1893 Ga0157379_10177545
1894 Ga0157376_10028247
1895 Ga0157376_10030023
1896 Ga0157376_10042207
1897 Ga0157376_10204820
1898 Ga0157376_10278463
1899 Ga0157376_10373795
1900 Ga0157376_10394674
1901 Ga0157376_10588298
1902 Ga0163161_10134413
1903 Ga0163161_10421163
1904 Ga0197907_10383702
1905 Ga0206349_1095632
1906 Ga0206352_11166851
1907 Ga0206352_11331296
1908 Ga0206350_10398217
1909 Ga0206353_10240172
1910 Ga0206353_11538467
1911 Ga0154015_1367111
1912 Ga0154015_1674205
1913 Ga0224712_10095369
1914 Ga0207697_10217368
1915 Ga0207653_10002891
1916 Ga0207653_10051426
1917 Ga0207692_10011411
1918 Ga0207692_10027075
1919 Ga0207692_10042751
1920 Ga0207692_10073518
1921 Ga0207642_10036559
1922 Ga0207642_10118706
1923 Ga0207642_10128113
1924 Ga0207688_10086026
1925 Ga0207688_10299292
1926 Ga0207688_10532727
1927 Ga0207680_10063955
1928 Ga0207680_10090958
1929 Ga0207680_10230648
1930 Ga0207647_10206881
1931 Ga0207685_10116466
1932 Ga0207685_10121481
1933 Ga0207699_10019694
1934 Ga0207699_10069186
1935 Ga0207699_10115957
1936 Ga0207699_10399974
1937 Ga0207699_10410041
1938 Ga0207699_10541533
1939 Ga0207643_10023603
1940 Ga0207684_10044722
1941 Ga0207684_10051590
1942 Ga0207684_10066722
1943 Ga0207684_10305365
1944 Ga0207684_10414771
1945 Ga0207684_10595554
1946 Ga0207684_10687374
1947 Ga0207654_10070170
1948 Ga0207654_10134876
1949 Ga0207654_10253167
1950 Ga0207695_10018087
1951 Ga0207695_10249325
1952 Ga0207671_10000294
1953 Ga0207671_10071951
1954 Ga0207671_10436602
1955 Ga0207671_10651189
1956 Ga0207693_10001397
1957 Ga0207693_10003063
1958 Ga0207693_10003807
1959 Ga0207693_10008745
1960 Ga0207693_10023761
1961 Ga0207693_10054740
1962 Ga0207693_10055933
1963 Ga0207693_10099182
1964 Ga0207693_10191014
1965 Ga0207693_11025677
1966 Ga0207663_10001774
1967 Ga0207663_10163764
1968 Ga0207663_10265920
1969 Ga0207660_10260486
1970 Ga0207660_10315060
1971 Ga0207660_10323323
1972 Ga0207662_10019540
1973 Ga0207662_10202051
1974 Ga0207657_10070813
1975 Ga0207657_10133883
1976 Ga0207657_10183034
1977 Ga0207657_10192028
1978 Ga0207657_10465912
1979 Ga0207649_10206656
1980 Ga0207652_10043178
1981 Ga0207652_10111916
1982 Ga0207652_10143918
1983 Ga0207652_10419886
1984 Ga0207646_10005164
1985 Ga0207646_10044170
1986 Ga0207646_10052287
1987 Ga0207646_10273619
1988 Ga0207646_10674166
1989 Ga0207681_10284991
1990 Ga0207694_10066700
1991 Ga0207694_10125502
1992 Ga0207694_10186832
1993 Ga0207694_10657706
1994 Ga0207650_10295125
1995 Ga0207659_10166119
1996 Ga0207687_10042335
1997 Ga0207687_10147799
1998 Ga0207687_10247919
1999 Ga0207687_10399666
2000 Ga0207687_10507496
2001 Ga0207687_10618189
2002 Ga0207700_10010491
2003 Ga0207700_10211510
2004 Ga0207700_10245311
2005 Ga0207700_10440340
2006 Ga0207700_10587271
2007 Ga0207700_10588511
2008 Ga0207664_10013306
2009 Ga0207664_10019531
2010 Ga0207664_10079641
2011 Ga0207664_10235202
2012 Ga0207664_10242574
2013 Ga0207664_11005468
2014 Ga0207644_10360916
2015 Ga0207690_10008253
2016 Ga0207690_10084296
2017 Ga0207706_10028228
2018 Ga0207706_10034557
2019 Ga0207706_10048594
2020 Ga0207706_10116452
2021 Ga0207706_10436149
2022 Ga0207706_10577836
2023 Ga0207686_10005329
2024 Ga0207686_10066513
2025 Ga0207686_10205083
2026 Ga0207709_10002679
2027 Ga0207709_10170735
2028 Ga0207709_10614810
2029 Ga0207670_10040585
2030 Ga0207670_10077932
2031 Ga0207670_10285495
2032 Ga0207669_10021397
2033 Ga0207669_10028967
2034 Ga0207704_10030321
2035 Ga0207704_10083355
2036 Ga0207704_10189246
2037 Ga0207704_10507870
2038 Ga0207665_10041272
2039 Ga0207665_10044745
2040 Ga0207665_10074809
2041 Ga0207665_10280429
2042 Ga0207665_10435802
2043 Ga0207691_10181406
2044 Ga0207691_10328797
2045 Ga0207711_10038983
2046 Ga0207711_10198432
2047 Ga0207711_10219976
2048 Ga0207711_10269175
2049 Ga0207711_10475954
2050 Ga0207689_10210416
2051 Ga0207661_10014009
2052 Ga0207661_10258888
2053 Ga0207661_10345457
2054 Ga0207661_10512847
2055 Ga0207661_10851454
2056 Ga0207679_10107458
2057 Ga0207679_10128420
2058 Ga0207679_10277166
2059 Ga0207679_10288320
2060 Ga0207679_10689409
2061 Ga0207679_10723765
2062 Ga0207667_10276763
2063 Ga0207667_10367086
2064 Ga0207667_10499945
2065 Ga0207651_10300858
2066 Ga0207651_10626270
2067 Ga0207712_10114484
2068 Ga0207712_10196606
2069 Ga0207668_10141878
2070 Ga0207668_10360304
2071 Ga0207668_10447354
2072 Ga0207640_10075676
2073 Ga0207658_10379372
2074 Ga0207677_10094900
2075 Ga0207677_10174720
2076 Ga0207677_10184915
2077 Ga0207677_11002667
2078 Ga0207677_11245487
2079 Ga0207703_10020015
2080 Ga0207703_10032602
2081 Ga0207703_10147853
2082 Ga0207703_10341370
2083 Ga0207639_10015571
2084 Ga0207639_10392838
2085 Ga0207678_10161912
2086 Ga0207678_10194575
2087 Ga0207678_10244121
2088 Ga0207708_10000318
2089 Ga0207708_10001272
2090 Ga0207708_10023900
2091 Ga0207708_10384606
2092 Ga0207708_10513376
2093 Ga0207702_10011169
2094 Ga0207702_10035064
2095 Ga0207702_10068952
2096 Ga0207702_10219670
2097 Ga0207702_11184294
2098 Ga0207702_11260744
2099 Ga0207641_11141700
2100 Ga0207648_10003992
2101 Ga0207648_10020641
2102 Ga0207648_10198847
2103 Ga0207648_10313251
2104 Ga0207676_10038667
2105 Ga0207676_10074588
2106 Ga0207674_10000602
2107 Ga0207674_10001034
2108 Ga0207674_10009302
2109 Ga0207674_10082086
2110 Ga0207675_100003964
2111 Ga0207675_100011807
2112 Ga0207675_100041266
2113 Ga0207675_100062109
2114 Ga0207675_100162269
2115 Ga0207683_10000215
2116 Ga0207683_10002095
2117 Ga0207683_10004391
2118 Ga0207683_10050021
2119 Ga0207683_10367466
2120 Ga0207698_10126200
2121 Ga0207698_10324086
2122 Ga0209966_1002356
2123 Ga0207428_10005092
2124 Ga0207428_10007271
2125 Ga0207428_10026245
2126 Ga0207428_10118965
2127 Ga0207428_10120950
2128 Ga0207428_10261940
2129 Ga0268266_10159422
2130 Ga0268266_10229934
2131 Ga0268266_10809673
2132 Ga0268264_10026733
2133 Ga0268264_10462830
2134 Ga0265319_1036944
2135 Ga0265320_10018694
2136 Ga0307408_100583404
2137 Ga0265314_10189034
2138 Ga0307413_10034557
2139 Ga0307413_11168665
2140 Ga0307410_10028304
2141 Ga0307410_10159319
2142 Ga0307410_10543305
2143 Ga0307410_11145263
2144 Ga0307406_10099792
2145 Ga0307406_10125445
2146 Ga0307406_10140451
2147 Ga0307409_100033311
2148 Ga0307416_100014462
2149 Ga0307416_100014964
2150 Ga0307416_100075190
2151 Ga0307416_100089581
2152 Ga0307416_100166563
2153 Ga0307416_100177782
2154 Ga0307416_100323901
2155 Ga0307414_10274653
2156 Ga0307411_10198678
2157 Ga0307415_100000283
2158 Ga0307415_100588117
2159 Ga0373948_0000987
2160 Ga0373950_0006398
2161 Ga0373958_0002079
2162 Ga0373959_0008553
2163 Ga0373938_0007321
2164 Ga0373928_0006086
2165 Ga0373929_0001505
2166 Ga0373929_0037208
2167 Ga0373940_0003105
2168 Ga0373949_0001447
2169 Ga0373949_0014141
2170 Ga0373949_0094059
2171 Ga0373951_0005316
2172 Ga0373952_0001824
2173 Ga0373952_0036549
2174 Ga0373952_0060070
2175 Ga0373932_0000884
2176 Ga0373932_0079177
2177 Ga0373932_0188049
2178 Ga0373939_0003770
2179 Ga0373941_0007609
2180 Ga0373941_0039119
2181 Ga0373941_0208125
2182 Ga0373945_0008033
2183 Ga0373960_0000300
2184 Ga0373960_0005826
2185 Ga0373960_0306280
2186 Ga0373943_0090566
2187 Ga0373943_0127907
2188 Ga0373943_0139802
2189 Ga0373942_0004007
2190 Ga0373942_0037813
2191 Ga0373942_0163541
2192 Ga0373961_0002740
2193 Ga0373961_0074772
2194 Ga0373961_0104910
2195 Ga0373961_0108015
2196 Ga0373962_0000470
2197 Ga0373962_0010348
2198 Ga0316574_0077842
2199 Ga0373931_0005860
2200 Ga0373931_0014422
2201 Ga0373931_0587323
2202 Ga0373935_0079542
2203 Ga0373935_0363106
2204 Ga0373927_0124105
2205 Ga0373933_0199870
2206 Ga0373947_0038718
2207 Ga0373947_0179136
2208 Ga0373937_0311652
2209 Ga0373937_0381837
2210 Ga0373925_0041238
2211 Ga0373925_0069444
2212 Ga0373925_0401233
2213 Ga0395899_0004381
2214 Ga0395899_0006296
2215 Ga0395899_0009034
2216 Ga0395899_0009701
2217 Ga0395899_0009738
2218 Ga0395899_0018693
2219 Ga0395899_0090114
2220 Ga0395899_0100492
2221 Ga0395899_0103355
2222 Ga0395899_0109350
2223 Ga0395899_0121975
2224 Ga0395899_0141765
2225 Ga0395900_0002094
2226 Ga0395900_0002557
2227 Ga0395900_0005285
2228 Ga0395900_0006119
2229 Ga0395900_0009995
2230 Ga0395900_0032874
2231 Ga0395900_0036840
2232 Ga0395900_0054562
2233 Ga0395900_0055402
2234 Ga0395900_0070114
2235 Ga0395900_0087955
2236 Ga0395900_0099679
2237 Ga0395900_0106579
2238 Ga0395900_0108196
2239 Ga0395900_0117837
2240 Ga0395900_0172039
2241 Ga0395900_0186796
2242 Ga0395900_0206385
2243 Ga0395900_0283018
2244 Ga0395900_0287832
2245 Ga0395900_0591291
2246 Ga0395900_0642403
2247 Ga0395900_0644498
2248 Ga0395900_1266685
2249 Ga0395898_0002920
2250 Ga0395898_0005446
2251 Ga0395898_0007665
2252 Ga0395898_0008336
2253 Ga0395898_0014060
2254 Ga0395898_0016773
2255 Ga0395898_0023607
2256 Ga0395898_0025755
2257 Ga0395898_0028354
2258 Ga0395898_0031904
2259 Ga0395898_0067017
2260 Ga0395898_0175848
2261 Ga0395898_0186093
2262 Ga0395898_0209053
2263 Ga0395898_0227878
2264 Ga0395898_0360951
2265 Ga0395898_0370198
2266 Ga0395898_0370779
2267 Ga0395898_0424408
2268 Ga0395898_0455951
2269 Ga0395898_0672639
2270 Ga0395905_0000615
2271 Ga0395905_0001573
2272 Ga0395905_0004096
2273 Ga0395905_0006308
2274 Ga0395905_0006717
2275 Ga0395905_0013697
2276 Ga0395905_0021395
2277 Ga0395905_0043580
2278 Ga0395905_0053744
2279 Ga0395905_0067743
2280 Ga0395905_0091745
2281 Ga0395905_0116819
2282 Ga0395905_0146366
2283 Ga0395905_0161816
2284 Ga0395905_0215907
2285 Ga0395905_0650318
2286 Ga0395905_0755800
2287 Ga0395905_0883556
2288 Ga0395905_0958680
2289 Ga0395901_0001769
2290 Ga0395901_0003610
2291 Ga0395901_0004266
2292 Ga0395901_0005433
2293 Ga0395901_0007585
2294 Ga0395901_0016950
2295 Ga0395901_0026811
2296 Ga0395901_0032519
2297 Ga0395901_0041499
2298 Ga0395901_0043878
2299 Ga0395901_0044425
2300 Ga0395901_0053962
2301 Ga0395901_0070288
2302 Ga0395901_0074676
2303 Ga0395901_0077102
2304 Ga0395901_0109540
2305 Ga0395901_0111707
2306 Ga0395901_0115402
2307 Ga0395901_0144427
2308 Ga0395901_0148589
2309 Ga0395901_0160209
2310 Ga0395901_0198258
2311 Ga0395901_0240051
2312 Ga0395901_0257393
2313 Ga0395901_0322862
2314 Ga0395901_0344006
2315 Ga0395901_0347435
2316 Ga0395901_0518269
2317 Ga0395901_0537790
2318 Ga0395901_0549247
2319 Ga0395901_0906463
2320 Ga0395901_1279485
2321 Ga0242420_037274
2322 Ga0439466_0141176
2323 Ga0451797_1467611
2324 Ga0451802_1691267
2325 Ga0451807_0097819
2326 Ga0451807_1241121
2327 Ga0451835_0553222
2328 Ga0451837_1655606
2329 Ga0451841_0721472
2330 Ga0451845_0409218
2331 Ga0451845_0836332
2332 Ga0451847_0806778
2333 Ga0451851_0166059
2334 Ga0451853_0059875
2335 Ga0451853_1772707
2336 Ga0451853_1946777
2337 Ga0439450_017884
2338 Ga0439451_001152
2339 Ga0439454_007894
2340 Ga0439456_035532
2341 Ga0439463_053845
2342 Ga0439458_0060804
2343 Ga0439435_0014525
2344 Ga0439459_0131606
2345 Ga0450918_031663
2346 Ga0439440_0057277
2347 Ga0439440_0058500
2348 Ga0466969_0008738
2349 Ga0466966_0044626
2350 Ga0466961_0002904
2351 Ga0466961_0212730
2352 Ga0466963_0004919
2353 Ga0466964_0007241
2354 Ga0466964_0009363
2355 Ga0466971_0002968
2356 Ga0466968_0041210
2357 Ga0466957_0001419
2358 Ga0466957_0104398
2359 Ga0466960_0041957
2360 Ga0466960_0060342
2361 Ga0466960_0065705
2362 Ga0466959_0017850
2363 Ga0466959_0107958
2364 Ga0451576_0031312
2365 Ga0451576_0085404
2366 Ga0451576_0602839
2367 Ga0466958_0024666
2368 Ga0466967_0008294
2369 Ga0466967_0050785
2370 Ga0466967_0065595
2371 Ga0466967_0069917
2372 Ga0466967_0105251
2373 Ga0495603_0001254
2374 Ga0495603_0003282
2375 Ga0495603_0023879
2376 Ga0495590_0024229
2377 Ga0495641_0109720
2378 Ga0495641_0196017
2379 Ga0495651_0100866
2380 Ga0495651_0439136
2381 Ga0495653_0384614
2382 Ga0495580_0012092
2383 Ga0495580_0139618
2384 Ga0495580_0287843
2385 Ga0495582_0013109
2386 Ga0495582_0029479
2387 Ga0495582_0041400
2388 Ga0495582_0110975
2389 Ga0495582_0166991
2390 Ga0495605_0061978
2391 Ga0495605_0105608
2392 Ga0495605_0226410
2393 Ga0495639_0076679
2394 Ga0495639_0130695
2395 Ga0495639_0191375
2396 Ga0495662_0101690
2397 Ga0495662_0136006
2398 Ga0495584_0039360
2399 Ga0495584_0055836
2400 Ga0495584_0119056
2401 Ga0495584_0245294
2402 Ga0495584_0265287
2403 Ga0495584_0372423
2404 Ga0495584_0374782
2405 Ga0495585_0111025
2406 Ga0495594_0001015
2407 Ga0495594_0081585
2408 Ga0495594_0139143
2409 Ga0495596_0006468
2410 Ga0495596_0020797
2411 Ga0495596_0109322
2412 Ga0495596_0121433
2413 Ga0495596_0155298
2414 Ga0495607_0075484
2415 Ga0495607_0200402
2416 Ga0495583_0065757
2417 Ga0495608_0129760
2418 Ga0495608_0332954
2419 Ga0495618_0066311
2420 Ga0495628_0365518
2421 Ga0495631_0016892
2422 Ga0495631_0075870
2423 Ga0495632_0095490
2424 Ga0495643_0126590
2425 Ga0495643_0341351
2426 Ga0495663_0078791
2427 Ga0495642_0040091
2428 Ga0495642_0104273
2429 Ga0495642_0124226
2430 Ga0495652_0146936
2431 Ga0495652_0276861
2432 Ga0495652_0458653
2433 Ga0495654_0128817
2434 Ga0495640_0428603
2435 Ga0495609_0054642
2436 Ga0495609_0082046
2437 Ga0495609_0088536
2438 Ga0495609_0090278
2439 Ga0495667_0088977
2440 Ga0495656_0024249
2441 Ga0495656_0072547
2442 Ga0495656_0085206
2443 Ga0495656_0132548
2444 Ga0495656_0133226
2445 Ga0495656_0220716
2446 Ga0495656_0435519
2447 Ga0495668_0073557
2448 Ga0495668_0105446
2449 Ga0495668_0268413
2450 Ga0495634_0196208
2451 Ga0495611_0137121
2452 Ga0495635_0074043
2453 Ga0495659_0011728
2454 Ga0495661_0264446
2455 Ga0495588_0000696
2456 Ga0495588_0126094
2457 Ga0495588_0171507
2458 Ga0495588_0185277
2459 Ga0495588_0410337
2460 Ga0495623_0221074
2461 Ga0495646_0165256
2462 Ga0495646_0200524
2463 Ga0495647_0022377
2464 Ga0495647_0145540
2465 Ga0495658_0027545
2466 Ga0495658_0065955
2467 Ga0495658_0103135
2468 Ga0495669_0077715
2469 Ga0495613_0059074
2470 Ga0495613_0449472
2471 Ga0495624_0188782
2472 Ga0495670_0064403
2473 Ga0495670_0209509
2474 Ga0495670_0267663
2475 Ga0495671_0096092
2476 Ga0495589_0007188
2477 Ga0495589_0217316
2478 Ga0495589_0258599
2479 Ga0495600_0105092
2480 Ga0495581_0003961
2481 Ga0495581_0005721
2482 Ga0495581_0350081
2483 Ga0495604_0057660
2484 Ga0495636_0023358
2485 Ga0495636_0089618
2486 Ga0495674_0029754
2487 Ga0495674_0041452
2488 Ga0495674_0698396
2489 Ga0495676_0000879
2490 Ga0495676_0064108
2491 Ga0495676_0111355
2492 Ga0495676_0182105
2493 Ga0495676_0500821
2494 Ga0495683_0053927
2495 Ga0495683_0208760
2496 Ga0495675_0102645
2497 Ga0495677_0038650
2498 Ga0495677_0042134
2499 Ga0495677_0107510
2500 Ga0495679_046866
2501 Ga0495685_022123
2502 Ga0495685_105429
2503 Ga0495684_0041444
2504 Ga0495684_0104319
2505 Ga0495626_0040809
2506 Ga0496100_0009888
2507 Ga0496100_0016648
2508 Ga0496100_0037077
2509 Ga0496100_0161319
2510 Ga0496100_0193023
2511 Ga0496100_0336058
2512 Ga0496100_0439557
2513 Ga0496100_0585981
2514 Ga0496101_0027209
2515 Ga0496101_0033793
2516 Ga0496101_0133993
2517 Ga0496101_0154747
2518 Ga0496101_0194943
2519 Ga0496101_0295644
2520 Ga0496101_0449761
2521 Ga0496101_0518280
2522 Ga0496101_0807692
2523 Ga0496102_0007258
2524 Ga0496102_0066625
2525 Ga0496102_0076345
2526 Ga0496102_0111461
2527 Ga0496102_0178625
2528 Ga0496102_0220104
2529 Ga0496102_0222257
2530 Ga0496102_0636828
2531 Ga0496102_1092784
2532 Ga0496103_0007528
2533 Ga0496103_0015734
2534 Ga0496103_0021459
2535 Ga0496103_0040061
2536 Ga0496103_0079096
2537 Ga0496103_0337717
2538 Ga0496104_0000568
2539 Ga0496104_0010563
2540 Ga0496104_0043904
2541 Ga0496104_0059519
2542 Ga0496104_0137477
2543 Ga0496104_0226148
2544 Ga0496104_0399615
2545 Ga0496104_0819904
2546 Ga0496105_0000457
2547 Ga0496105_0002396
2548 Ga0496105_0004767
2549 Ga0496105_0005072
2550 Ga0496105_0006996
2551 Ga0496105_0007239
2552 Ga0496105_0022270
2553 Ga0496105_0108306
2554 Ga0496105_0239933
2555 Ga0496105_0621179
2556 Ga0496106_0003674
2557 Ga0496106_0012382
2558 Ga0496106_0072295
2559 Ga0496106_0085511
2560 Ga0496106_0116674
2561 Ga0496106_0167030
2562 Ga0496106_0622079
2563 Ga0496107_0004641
2564 Ga0496107_0043346
2565 Ga0496107_0046988
2566 Ga0496107_0182871
2567 Ga0496107_0231764
2568 Ga0496107_0258061
2569 Ga0496107_0882661
2570 Ga0496108_0002627
2571 Ga0496108_0006684
2572 Ga0496108_0024613
2573 Ga0496108_0026971
2574 Ga0496108_0030460
2575 Ga0496108_0122697
2576 Ga0496108_0207247
2577 Ga0496108_0319801
2578 Ga0496108_0346431
2579 Ga0496108_0388697
2580 Ga0496109_0002827
2581 Ga0496109_0007630
2582 Ga0496109_0008726
2583 Ga0496109_0008994
2584 Ga0496109_0014010
2585 Ga0496109_0015471
2586 Ga0496109_0059306
2587 Ga0496109_0102525
2588 Ga0496109_0102667
2589 Ga0496109_0105412
2590 Ga0496109_0139385
2591 Ga0496109_0272041
2592 Ga0496109_0335251
2593 Ga0496109_0463888
2594 Ga0496109_0709289
2595 Ga0496110_0000054
2596 Ga0496110_0000980
2597 Ga0496110_0019346
2598 Ga0496110_0020491
2599 Ga0496110_0073489
2600 Ga0496110_0216320
2601 Ga0496111_0000156
2602 Ga0496111_0000243
2603 Ga0496111_0013181
2604 Ga0496111_0020816
2605 Ga0496111_0039385
2606 Ga0496111_0082287
2607 Ga0496111_0134640
2608 Ga0496112_0000300
2609 Ga0496112_0025114
2610 Ga0496112_0035423
2611 Ga0496112_0040341
2612 Ga0496112_0051694
2613 Ga0496112_0053844
2614 Ga0496112_0058787
2615 Ga0496112_0113776
2616 Ga0496112_0136060
2617 Ga0496112_0587901
2618 Ga0496112_0762430
2619 Ga0496113_0000275
2620 Ga0496113_0041747
2621 Ga0496113_0063608
2622 Ga0496113_0089816
2623 Ga0496114_0005825
2624 Ga0496114_0008296
2625 Ga0496114_0011918
2626 Ga0496114_0028280
2627 Ga0496114_0031921
2628 Ga0496114_0034894
2629 Ga0496114_0068918
2630 Ga0496114_0082235
2631 Ga0496114_0154982
2632 Ga0496114_0221721
2633 Ga0496114_0390771
2634 Ga0496114_0438688
2635 Ga0496114_0495874
2636 Ga0496114_0512216
2637 Ga0496114_0843231
2638 Ga0496115_0008732
2639 Ga0496115_0021128
2640 Ga0496115_0033634
2641 Ga0496115_0038218
2642 Ga0496115_0092162
2643 Ga0496115_0099710
2644 Ga0496115_0116868
2645 Ga0496115_0135960
2646 Ga0496115_0225347
2647 Ga0496115_0637962
2648 Ga0501031_0137555
2649 Ga0501033_0011314
2650 Ga0501033_0153639
2651 Ga0501034_0709802
2652 Ga0501036_0064525
2653 Ga0501036_0099881
2654 Ga0501036_0192735
2655 Ga0501036_0243293
2656 Ga0501036_0643714
2657 Ga0501037_0135447
2658 Ga0501037_0156962
2659 Ga0501037_0191287
2660 Ga0501037_0465709
2661 Ga0501038_0002835
2662 Ga0501039_0002978
2663 Ga0501039_0034693
2664 Ga0501039_0297314
2665 Ga0501039_0458766
2666 Ga0501040_0003917
2667 Ga0501040_0056074
2668 Ga0501040_0160636
2669 Ga0501041_0007132
2670 Ga0501041_0013352
2671 Ga0501041_0109467
2672 Ga0501041_0155772
2673 Ga0501041_0242916
2674 Ga0501042_0034401
2675 Ga0501042_0160716
2676 Ga0501042_0349905
2677 Ga0501042_0372307
2678 Ga0501046_0170685
2679 Ga0501047_0056961
2680 Ga0501047_0113994
2681 Ga0501047_0489799
2682 Ga0501048_0002599
2683 Ga0501048_0019984
2684 Ga0501048_0030138
2685 Ga0501048_0258234
2686 Ga0501048_0466049
2687 Ga0501067_0006992
2688 Ga0501067_0019921
2689 Ga0501067_0070099
2690 Ga0501067_0075307
2691 Ga0501067_0167565
2692 Ga0501067_0260032
2693 Ga0501068_0016659
2694 Ga0501068_0034780
2695 Ga0501068_0178574
2696 Ga0501069_0027406
2697 Ga0501069_0031671
2698 Ga0501069_0082803
2699 Ga0501069_0406856
2700 Ga0501070_0049461
2701 Ga0501070_0160124
2702 Ga0501070_0639710
2703 Ga0501071_0002211
2704 Ga0501071_0049718
2705 Ga0501071_0066101
2706 Ga0501071_0103252
2707 Ga0501071_0116465
2708 Ga0501071_0497897
2709 Ga0501072_0011137
2710 Ga0501072_0080055
2711 Ga0501072_0136297
2712 Ga0501072_0313160
2713 Ga0501072_0627938
2714 Ga0501074_0007610
2715 Ga0501074_0275471
2716 Ga0501074_0329299
2717 Ga0501074_0515855
2718 Ga0501075_0003490
2719 Ga0501075_0050367
2720 Ga0501075_0063980
2721 Ga0501075_0172661
2722 Ga0501075_0308010
2723 Ga0501075_0626285
2724 Ga0501076_0006835
2725 Ga0501076_0045765
2726 Ga0501076_0129651
2727 Ga0501076_0360422
2728 Ga0501076_0815469
2729 Ga0501077_0003797
2730 Ga0501077_0011455
2731 Ga0501077_0037016
2732 Ga0501077_0072119
2733 Ga0501077_0101464
2734 Ga0501077_0102055
2735 Ga0501077_0230285
2736 Ga0501077_0237985
2737 Ga0501079_0004409
2738 Ga0501079_0098607
2739 Ga0501079_0269982
2740 Ga0501080_0204349
2741 Ga0501080_0260291
2742 Ga0501080_0285866
2743 Ga0501080_0287419
2744 Ga0501080_1108018
2745 Ga0501081_0001579
2746 Ga0501081_0089873
2747 Ga0501081_0236908
2748 Ga0501081_0274822
2749 Ga0501083_0042992
2750 Ga0501035_0007148
2751 Ga0501044_0954161
2752 Ga0501045_0109987
2753 Ga0501045_0112180
2754 Ga0501045_0461019
2755 nmdc:mga03683_52902_c1
2756 nmdc:mga00v17_442877_c1
2757 nmdc:mga0k408_293362_c1
2758 nmdc:mga05p37_154440_c1
2759 nmdc:mga05p37_229940_c1
2760 nmdc:mga05p37_444007_c1
2761 nmdc:mga05p37_467866_c1
2762 nmdc:mga05p37_52745_c1
2763 nmdc:mga05p37_815300_c1
2764 nmdc:mga05p37_844865_c1
2765 nmdc:mga05p37_86206_c1
2766 nmdc:mga09592_20016_c1
2767 nmdc:mga09592_229046_c1
2768 nmdc:mga09592_311048_c1
2769 nmdc:mga09592_7064_c1
2770 nmdc:mga09592_82492_c1
2771 nmdc:mga0qj67_116856_c1
2772 nmdc:mga0qj67_168230_c1
2773 nmdc:mga0qj67_212520_c1
2774 nmdc:mga0qj67_464757_c1
2775 nmdc:mga0qj67_869199_c1
2776 nmdc:mga06r32_108204_c1
2777 nmdc:mga06r32_172594_c1
2778 nmdc:mga06r32_343702_c1
2779 nmdc:mga06r32_44390_c1
2780 nmdc:mga06r32_512261_c1
2781 nmdc:mga06r32_55175_c1
2782 nmdc:mga06r32_719770_c1
2783 nmdc:mga08y16_270030_c1
2784 nmdc:mga08y16_2814_c1
2785 nmdc:mga08y16_31729_c1
2786 nmdc:mga08y16_32986_c1
2787 nmdc:mga08y16_418545_c1
2788 nmdc:mga08y16_59413_c1
2789 nmdc:mga08y16_61338_c1
2790 nmdc:mga08y16_643010_c1
2791 nmdc:mga08y16_97069_c1
2792 nmdc:mga0n895_117193_c1
2793 nmdc:mga0n895_14920_c1
2794 nmdc:mga0n895_228035_c1
2795 nmdc:mga0n895_241324_c1
2796 nmdc:mga0n895_311848_c1
2797 nmdc:mga0n895_31746_c1
2798 nmdc:mga0n895_325684_c1
2799 nmdc:mga0n895_66179_c1
2800 nmdc:mga0rr50_119590_c1
2801 nmdc:mga0rr50_174028_c1
2802 nmdc:mga0rr50_190381_c1
2803 nmdc:mga0rr50_198141_c1
2804 nmdc:mga08x19_157336_c1
2805 nmdc:mga08x19_232619_c1
2806 nmdc:mga08x19_30892_c1
2807 nmdc:mga08x19_64245_c1
2808 nmdc:mga0a205_16661_c1
2809 nmdc:mga0a205_214689_c1
2810 nmdc:mga0a205_217420_c1
2811 nmdc:mga0a205_39141_c1
2812 nmdc:mga0a205_467391_c1
2813 nmdc:mga0a205_634673_c1
2814 nmdc:mga0a205_66865_c2
2815 nmdc:mga0a205_949291_c1
2816 Ga0495601_0027307
2817 Ga0495601_0173957
2818 Ga0495601_0214714
2819 Ga0495612_0044060
2820 Ga0495655_0075976
2821 Ga0495595_0280013
2822 Ga0495595_0313413
2823 Ga0495595_0314879
2824 Ga0495619_0022307
2825 Ga0495619_0578085
2826 Ga0501084_0002637
2827 Ga0501084_0018862
2828 Ga0501084_0070642
2829 Ga0501084_0229688
2830 Ga0590075_131431
2831 Ga0587084_023551
2832 Ga0587066_046455
2833 Ga0587077_023304
2834 Ga0587082_032460
2835 Ga0587082_053888
2836 Ga0587083_0063175
2837 Ga0587083_0082448
2838 Ga0587085_015779
2839 Ga0587085_074283
2840 Ga0587091_050018
2841 Ga0587094_022837
2842 Ga0587128_027912
2843 Ga0587069_075407
2844 Ga0587079_069111
2845 Ga0587119_012725
2846 Ga0587071_024076
2847 Ga0587071_050534
2848 Ga0501082_0009071
2849 Ga0501082_0030563
2850 Ga0501082_0147088
2851 Ga0501082_0288122
2852 Ga0501082_0405716
2853 Ga0466962_0016793
2854 Ga0466962_0035971
2855 Ga0530510_0010517
2856 Ga0530510_0024772
2857 Ga0530510_0048071
2858 Ga0530510_0069058
2859 Ga0530510_0162878
2860 Ga0530510_0347020
2861 Ga0530510_0490602
2862 Ga0530510_0845559

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01583

APS_kinase

Adenylylsulphate kinase

19

170

0.99

PF13671

AAA_33

AAA domain

23

143

0.85

Structural Annotation

Top 5 Hits

ID Description Score Start End
1m8p-assembly1.cif.gz_A crystal structure of p. chrysogenum atp sulfurylase in the t-state 0.976 2 175
1i2d-assembly1.cif.gz_A crystal structure of atp sulfurylase from penicillium chrysogenum 0.9725 2 175
1m7g-assembly1.cif.gz_B crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps 0.9724 1 179
2gks-assembly1.cif.gz_A crystal structure of the bi-functional atp sulfurylase-aps kinase from aquifex aeolicus, a chemolithotrophic thermophile 0.9719 2 178
1m7g-assembly2.cif.gz_D crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps 0.9707 1 178
ID Description Score Start End Superfamily
1i2dC03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9727 2 175 3.40.50.300
2gksA03 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9719 2 178 3.40.50.300
af_A0A2R8RUC9_5_216_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9656 3 178 3.40.50.300
5cb8B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9614 2 178 3.40.50.300
af_P9WNM5_418_614_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9523 2 172 3.40.50.300
ID Description Score Start End GO Terms
AF-A0A1Q6XCS7-F1-model_v4 Adenylyl-sulfate kinase (EC 2.7.1.25) 0.984 2 147 GO:0004020
GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379
GO:0070814
AF-K2G412-F1-model_v4 Adenylylsulfate kinase domain containing protein 0.9835 2 177 GO:0004020
GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379
AF-A0A3M1B3W4-F1-model_v4 Adenylyl-sulfate kinase (EC 2.7.1.25) 0.9829 2 175 GO:0004020
GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379
GO:0070814
AF-A0A1S1RHF2-F1-model_v4 deleted 0.9826 2 178
AF-A0A1V2IDL2-F1-model_v4 Adenylyl-sulfate kinase 0.9823 2 178 GO:0004020
GO:0004781
GO:0005524
GO:0005737
GO:0010134
GO:0019379

Map