F493906
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1431 | 424 | 2862 | 195 |
Family's Representative Sequence
| Representative Sequence | 3300006058|Ga0075432_10103970|Ga0075432_101039702 |
| Length | 224 |
| Sequence | MTDHIYAHDHPESESRRDGGFTLWFTGLSGAGKTTIAHLVGPELDRRGHVVEYLDGDTVRTHLSKGLGFSKEDRDTNIERIGWVASRLTRQGGAVIAAAISPYEETRRKARGMVEEWGPFVEVFIKASVQECANRDVKGLYEKAFKGEIKGFTGVDDPYEAPEHPELVLDTLQETPQESLQRVLTTLMRLGYVESDEPMIEGDRLHSGMTDLRVHQSGHVVEEG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 2 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 3 | 3300003659 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 4 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 5 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 7 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 9 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 11 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 13 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 14 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 15 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 17 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 19 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 27 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 30 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 31 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 44 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 45 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 46 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 47 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 48 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 49 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 54 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 57 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 58 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 66 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 68 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 69 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 70 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 71 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 72 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 73 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 74 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 75 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 76 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 77 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 78 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 79 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 80 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 81 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 86 | 3300006194 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 | Metagenome | Rhizosphere |
| 87 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300012491 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.8.old.040610 | Metagenome | Rhizosphere |
| 114 | 3300012506 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.6.old.040610 | Metagenome | Rhizosphere |
| 115 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 137 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 138 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 202 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 205 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 206 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 207 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 208 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 209 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 210 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 211 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 212 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 213 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 214 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 220 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 222 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 223 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 224 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 225 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 226 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 227 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 234 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 235 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 236 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 241 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 242 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 244 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 245 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 246 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 247 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 248 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 249 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 250 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 251 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 252 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 253 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 254 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 255 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 256 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 257 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 258 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 259 | 3300041507 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_10 MetaG | Metagenome | Unclassified |
| 260 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 261 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 262 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 263 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 264 | 3300042013 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z071817_5339 | Metagenome | Rhizosphere |
| 265 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 266 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 267 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 268 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 269 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 270 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 271 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 272 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 273 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 274 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 275 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 276 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 277 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 367 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 368 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 369 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 370 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 371 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 372 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 373 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 380 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 381 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 382 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 383 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 385 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 386 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 388 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 391 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 392 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 393 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 394 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 395 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 403 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 409 | 3300059477 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 50R_CW_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 410 | 3300059490 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 7R_CD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 411 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 412 | 3300059504 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 23R_SD_T1_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 413 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059506 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 52R_CW_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300059513 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 59R_AW_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 417 | 3300059630 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 165R_SD_T3_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 418 | 3300059642 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 10R_AW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 419 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 420 | 3300059658 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 178R_AW_T3_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 421 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 422 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 423 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 424 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.97 |
| Metatranscriptomes | 2.03 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.49 |
| Nodule | 0 |
| Rhizoplane | 10.2 |
| Rhizosphere | 88.61 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0.63 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075432_10103970 | 3300006058 | Bacteria | 1052 |
| 2 | JGI25407J50210_10000289 | 3300003373 | Bacteria | 9091 |
| 3 | JGI25407J50210_10027312 | 3300003373 | Unclassified | 1480 |
| 4 | JGI25407J50210_10028471 | 3300003373 | Bacteria | 1449 |
| 5 | JGI25404J52841_10032556 | 3300003659 | Bacteria | 1111 |
| 6 | Ga0058861_10029875 | 3300004800 | Bacteria | 1215 |
| 7 | Ga0058862_10090311 | 3300004803 | Bacteria | 1263 |
| 8 | Ga0070676_10495253 | 3300005328 | Bacteria | 867 |
| 9 | Ga0070683_100004118 | 3300005329 | Bacteria | 11912 |
| 10 | Ga0070683_100228630 | 3300005329 | Bacteria | 1768 |
| 11 | Ga0070683_100321082 | 3300005329 | Bacteria | 1474 |
| 12 | Ga0070683_100815698 | 3300005329 | Bacteria | 895 |
| 13 | Ga0070683_100845570 | 3300005329 | Bacteria | 878 |
| 14 | Ga0070690_100010006 | 3300005330 | Bacteria | 5506 |
| 15 | Ga0070690_100057669 | 3300005330 | Bacteria | 2492 |
| 16 | Ga0070690_100066426 | 3300005330 | Bacteria | 2335 |
| 17 | Ga0070690_100098630 | 3300005330 | Bacteria | 1934 |
| 18 | Ga0070690_100599665 | 3300005330 | Bacteria | 836 |
| 19 | Ga0070677_10196758 | 3300005333 | Bacteria | 970 |
| 20 | Ga0068869_100181565 | 3300005334 | Bacteria | 1650 |
| 21 | Ga0070666_10139940 | 3300005335 | Bacteria | 1686 |
| 22 | Ga0070680_100129751 | 3300005336 | Bacteria | 2108 |
| 23 | Ga0070680_100175039 | 3300005336 | Bacteria | 1807 |
| 24 | Ga0070680_100241775 | 3300005336 | Bacteria | 1526 |
| 25 | Ga0070682_100003401 | 3300005337 | Bacteria | 8826 |
| 26 | Ga0070682_100061412 | 3300005337 | Bacteria | 2378 |
| 27 | Ga0070682_100075888 | 3300005337 | Bacteria | 2163 |
| 28 | Ga0070682_100093195 | 3300005337 | Bacteria | 1975 |
| 29 | Ga0070682_100102291 | 3300005337 | Bacteria | 1893 |
| 30 | Ga0070682_100226330 | 3300005337 | Bacteria | 1334 |
| 31 | Ga0068868_100021916 | 3300005338 | Bacteria | 4817 |
| 32 | Ga0068868_100037957 | 3300005338 | Bacteria | 3737 |
| 33 | Ga0068868_100174154 | 3300005338 | Bacteria | 1783 |
| 34 | Ga0068868_100188551 | 3300005338 | Bacteria | 1714 |
| 35 | Ga0068868_100202619 | 3300005338 | Bacteria | 1655 |
| 36 | Ga0068868_100267025 | 3300005338 | Bacteria | 1445 |
| 37 | Ga0068868_100299064 | 3300005338 | Bacteria | 1366 |
| 38 | Ga0070660_100048578 | 3300005339 | Bacteria | 3259 |
| 39 | Ga0070660_100076546 | 3300005339 | Bacteria | 2621 |
| 40 | Ga0070660_100222384 | 3300005339 | Bacteria | 1535 |
| 41 | Ga0070660_100303730 | 3300005339 | Bacteria | 1309 |
| 42 | Ga0070689_100230410 | 3300005340 | Bacteria | 1523 |
| 43 | Ga0070689_100511471 | 3300005340 | Bacteria | 1030 |
| 44 | Ga0070691_10115831 | 3300005341 | Bacteria | 1345 |
| 45 | Ga0070691_10237937 | 3300005341 | Bacteria | 972 |
| 46 | Ga0070687_100256665 | 3300005343 | Bacteria | 1089 |
| 47 | Ga0070661_100047206 | 3300005344 | Bacteria | 3151 |
| 48 | Ga0070661_100156791 | 3300005344 | Bacteria | 1723 |
| 49 | Ga0070661_100750842 | 3300005344 | Bacteria | 798 |
| 50 | Ga0070692_10011629 | 3300005345 | Bacteria | 4045 |
| 51 | Ga0070692_10023120 | 3300005345 | Bacteria | 3043 |
| 52 | Ga0070692_10091206 | 3300005345 | Bacteria | 1656 |
| 53 | Ga0070692_10094951 | 3300005345 | Bacteria | 1626 |
| 54 | Ga0070668_100397029 | 3300005347 | Bacteria | 1177 |
| 55 | Ga0070668_100536419 | 3300005347 | Bacteria | 1017 |
| 56 | Ga0070675_100598247 | 3300005354 | Bacteria | 1000 |
| 57 | Ga0070675_100652037 | 3300005354 | Bacteria | 957 |
| 58 | Ga0070671_100386025 | 3300005355 | Bacteria | 1197 |
| 59 | Ga0070671_100399393 | 3300005355 | Bacteria | 1176 |
| 60 | Ga0070671_100420565 | 3300005355 | Bacteria | 1144 |
| 61 | Ga0070674_100032414 | 3300005356 | Bacteria | 3469 |
| 62 | Ga0070674_100047960 | 3300005356 | Bacteria | 2930 |
| 63 | Ga0070673_100017707 | 3300005364 | Bacteria | 5074 |
| 64 | Ga0070673_100422218 | 3300005364 | Bacteria | 1196 |
| 65 | Ga0070673_100981156 | 3300005364 | Bacteria | 786 |
| 66 | Ga0070688_100011538 | 3300005365 | Bacteria | 4912 |
| 67 | Ga0070688_100017530 | 3300005365 | Bacteria | 4112 |
| 68 | Ga0070659_100019301 | 3300005366 | Bacteria | 5163 |
| 69 | Ga0070659_100039597 | 3300005366 | Bacteria | 3680 |
| 70 | Ga0070659_100993267 | 3300005366 | Bacteria | 736 |
| 71 | Ga0070667_100136251 | 3300005367 | Bacteria | 2147 |
| 72 | Ga0070703_10004087 | 3300005406 | Bacteria | 4118 |
| 73 | Ga0070703_10065633 | 3300005406 | Bacteria | 1199 |
| 74 | Ga0070709_10052309 | 3300005434 | Bacteria | 2566 |
| 75 | Ga0070709_10064398 | 3300005434 | Bacteria | 2344 |
| 76 | Ga0070709_10078786 | 3300005434 | Bacteria | 2145 |
| 77 | Ga0070709_10092424 | 3300005434 | Bacteria | 1998 |
| 78 | Ga0070709_10115735 | 3300005434 | Bacteria | 1809 |
| 79 | Ga0070709_10232910 | 3300005434 | Bacteria | 1319 |
| 80 | Ga0070714_100029263 | 3300005435 | Bacteria | 4579 |
| 81 | Ga0070714_100139279 | 3300005435 | Bacteria | 2176 |
| 82 | Ga0070714_100243510 | 3300005435 | Bacteria | 1660 |
| 83 | Ga0070714_100266845 | 3300005435 | Bacteria | 1586 |
| 84 | Ga0070714_100651726 | 3300005435 | Bacteria | 1014 |
| 85 | Ga0070714_100700231 | 3300005435 | Bacteria | 977 |
| 86 | Ga0070713_100236114 | 3300005436 | Bacteria | 1663 |
| 87 | Ga0070713_100268378 | 3300005436 | Bacteria | 1562 |
| 88 | Ga0070713_100713933 | 3300005436 | Bacteria | 958 |
| 89 | Ga0070713_101158964 | 3300005436 | Bacteria | 748 |
| 90 | Ga0070710_10012552 | 3300005437 | Bacteria | 4211 |
| 91 | Ga0070710_10018013 | 3300005437 | Bacteria | 3626 |
| 92 | Ga0070710_10053838 | 3300005437 | Bacteria | 2268 |
| 93 | Ga0070710_10057552 | 3300005437 | Bacteria | 2203 |
| 94 | Ga0070701_10019176 | 3300005438 | Bacteria | 3228 |
| 95 | Ga0070701_10021876 | 3300005438 | Bacteria | 3059 |
| 96 | Ga0070701_10110441 | 3300005438 | Bacteria | 1535 |
| 97 | Ga0070711_100006010 | 3300005439 | Bacteria | 7289 |
| 98 | Ga0070711_100011069 | 3300005439 | Bacteria | 5597 |
| 99 | Ga0070711_100022300 | 3300005439 | Bacteria | 4102 |
| 100 | Ga0070711_100079563 | 3300005439 | Bacteria | 2331 |
| 101 | Ga0070711_100088935 | 3300005439 | Bacteria | 2220 |
| 102 | Ga0070705_100029179 | 3300005440 | Bacteria | 3030 |
| 103 | Ga0070705_100058677 | 3300005440 | Bacteria | 2275 |
| 104 | Ga0070705_100069264 | 3300005440 | Bacteria | 2126 |
| 105 | Ga0070705_100071793 | 3300005440 | Bacteria | 2095 |
| 106 | Ga0070705_100103111 | 3300005440 | Bacteria | 1806 |
| 107 | Ga0070705_100164062 | 3300005440 | Bacteria | 1488 |
| 108 | Ga0070705_100193676 | 3300005440 | Bacteria | 1388 |
| 109 | Ga0070705_100341472 | 3300005440 | Bacteria | 1088 |
| 110 | Ga0070705_100494127 | 3300005440 | Bacteria | 927 |
| 111 | Ga0070700_100001006 | 3300005441 | Bacteria | 13924 |
| 112 | Ga0070700_100013938 | 3300005441 | Bacteria | 4528 |
| 113 | Ga0070700_100161099 | 3300005441 | Bacteria | 1544 |
| 114 | Ga0070700_100499135 | 3300005441 | Bacteria | 936 |
| 115 | Ga0070694_100014357 | 3300005444 | Bacteria | 4957 |
| 116 | Ga0070708_100183070 | 3300005445 | Bacteria | 1958 |
| 117 | Ga0070708_100237361 | 3300005445 | Bacteria | 1711 |
| 118 | Ga0070708_100614526 | 3300005445 | Bacteria | 1025 |
| 119 | Ga0070708_101215099 | 3300005445 | Bacteria | 705 |
| 120 | Ga0070663_100075414 | 3300005455 | Bacteria | 2465 |
| 121 | Ga0070663_100099828 | 3300005455 | Bacteria | 2164 |
| 122 | Ga0070663_100271835 | 3300005455 | Bacteria | 1348 |
| 123 | Ga0070678_100000610 | 3300005456 | Bacteria | 17560 |
| 124 | Ga0070678_100017028 | 3300005456 | Bacteria | 4666 |
| 125 | Ga0070678_100027163 | 3300005456 | Bacteria | 3883 |
| 126 | Ga0070662_100072757 | 3300005457 | Bacteria | 2539 |
| 127 | Ga0070662_100289734 | 3300005457 | Bacteria | 1327 |
| 128 | Ga0070681_10234884 | 3300005458 | Bacteria | 1747 |
| 129 | Ga0068867_100131224 | 3300005459 | Bacteria | 1947 |
| 130 | Ga0068867_100729652 | 3300005459 | Bacteria | 877 |
| 131 | Ga0070685_10220746 | 3300005466 | Bacteria | 1242 |
| 132 | Ga0070685_10266871 | 3300005466 | Bacteria | 1141 |
| 133 | Ga0070706_100009648 | 3300005467 | Bacteria | 8973 |
| 134 | Ga0070706_100034451 | 3300005467 | Bacteria | 4677 |
| 135 | Ga0070706_100584668 | 3300005467 | Bacteria | 1038 |
| 136 | Ga0070706_100846756 | 3300005467 | Bacteria | 846 |
| 137 | Ga0070707_100000909 | 3300005468 | Bacteria | 29346 |
| 138 | Ga0070707_100143993 | 3300005468 | Bacteria | 2320 |
| 139 | Ga0070707_100150790 | 3300005468 | Bacteria | 2264 |
| 140 | Ga0070707_100153621 | 3300005468 | Bacteria | 2241 |
| 141 | Ga0070707_100356827 | 3300005468 | Bacteria | 1420 |
| 142 | Ga0070698_100021420 | 3300005471 | Bacteria | 6770 |
| 143 | Ga0070698_100023816 | 3300005471 | Bacteria | 6394 |
| 144 | Ga0070698_100062351 | 3300005471 | Bacteria | 3761 |
| 145 | Ga0070698_100405578 | 3300005471 | Bacteria | 1297 |
| 146 | Ga0070699_100395579 | 3300005518 | Bacteria | 1249 |
| 147 | Ga0070699_100999875 | 3300005518 | Bacteria | 767 |
| 148 | Ga0070679_100163736 | 3300005530 | Bacteria | 2198 |
| 149 | Ga0070679_100397346 | 3300005530 | Bacteria | 1324 |
| 150 | Ga0070679_100529019 | 3300005530 | Bacteria | 1123 |
| 151 | Ga0070679_100905438 | 3300005530 | Bacteria | 826 |
| 152 | Ga0070684_100054574 | 3300005535 | Bacteria | 3481 |
| 153 | Ga0070684_100055287 | 3300005535 | Bacteria | 3459 |
| 154 | Ga0070684_100064453 | 3300005535 | Bacteria | 3214 |
| 155 | Ga0070684_100077735 | 3300005535 | Bacteria | 2931 |
| 156 | Ga0070684_100114560 | 3300005535 | Bacteria | 2420 |
| 157 | Ga0070684_100248766 | 3300005535 | Bacteria | 1625 |
| 158 | Ga0070684_100400352 | 3300005535 | Bacteria | 1265 |
| 159 | Ga0070697_100070019 | 3300005536 | Bacteria | 2874 |
| 160 | Ga0070697_100196635 | 3300005536 | Bacteria | 1713 |
| 161 | Ga0070697_100507760 | 3300005536 | Bacteria | 1055 |
| 162 | Ga0068853_100020589 | 3300005539 | Bacteria | 5486 |
| 163 | Ga0068853_100024733 | 3300005539 | Bacteria | 5038 |
| 164 | Ga0068853_100232309 | 3300005539 | Bacteria | 1688 |
| 165 | Ga0070672_100207923 | 3300005543 | Bacteria | 1638 |
| 166 | Ga0070672_100403028 | 3300005543 | Bacteria | 1173 |
| 167 | Ga0070686_100002710 | 3300005544 | Bacteria | 9745 |
| 168 | Ga0070686_100011818 | 3300005544 | Bacteria | 4960 |
| 169 | Ga0070686_100025908 | 3300005544 | Bacteria | 3532 |
| 170 | Ga0070686_100086275 | 3300005544 | Bacteria | 2089 |
| 171 | Ga0070686_100376457 | 3300005544 | Bacteria | 1074 |
| 172 | Ga0070695_100113818 | 3300005545 | Bacteria | 1840 |
| 173 | Ga0070695_100164599 | 3300005545 | Bacteria | 1560 |
| 174 | Ga0070695_100328724 | 3300005545 | Bacteria | 1139 |
| 175 | Ga0070695_100580327 | 3300005545 | Bacteria | 878 |
| 176 | Ga0070695_100761001 | 3300005545 | Bacteria | 773 |
| 177 | Ga0070696_100027632 | 3300005546 | Bacteria | 3867 |
| 178 | Ga0070696_100036287 | 3300005546 | Bacteria | 3398 |
| 179 | Ga0070696_100041305 | 3300005546 | Unclassified | 3186 |
| 180 | Ga0070696_100050548 | 3300005546 | Bacteria | 2890 |
| 181 | Ga0070696_100161589 | 3300005546 | Bacteria | 1650 |
| 182 | Ga0070696_100335126 | 3300005546 | Bacteria | 1168 |
| 183 | Ga0070693_100002170 | 3300005547 | Bacteria | 8997 |
| 184 | Ga0070693_100017228 | 3300005547 | Bacteria | 3753 |
| 185 | Ga0070693_100039988 | 3300005547 | Bacteria | 2630 |
| 186 | Ga0070693_100068241 | 3300005547 | Bacteria | 2087 |
| 187 | Ga0070693_100079873 | 3300005547 | Bacteria | 1947 |
| 188 | Ga0070665_100076549 | 3300005548 | Bacteria | 3352 |
| 189 | Ga0070665_100094538 | 3300005548 | Bacteria | 2994 |
| 190 | Ga0070665_100310706 | 3300005548 | Bacteria | 1580 |
| 191 | Ga0070704_100077761 | 3300005549 | Bacteria | 2432 |
| 192 | Ga0070704_100130360 | 3300005549 | Bacteria | 1948 |
| 193 | Ga0070704_100138685 | 3300005549 | Bacteria | 1895 |
| 194 | Ga0070704_100149955 | 3300005549 | Bacteria | 1832 |
| 195 | Ga0070704_100150812 | 3300005549 | Bacteria | 1827 |
| 196 | Ga0070704_100381507 | 3300005549 | Bacteria | 1198 |
| 197 | Ga0070704_100639094 | 3300005549 | Bacteria | 938 |
| 198 | Ga0068855_100162744 | 3300005563 | Bacteria | 2531 |
| 199 | Ga0068855_100167180 | 3300005563 | Bacteria | 2492 |
| 200 | Ga0068855_100302025 | 3300005563 | Bacteria | 1773 |
| 201 | Ga0068855_100383089 | 3300005563 | Bacteria | 1544 |
| 202 | Ga0068855_100613884 | 3300005563 | Bacteria | 1171 |
| 203 | Ga0070664_100009330 | 3300005564 | Bacteria | 7959 |
| 204 | Ga0070664_100134553 | 3300005564 | Bacteria | 2172 |
| 205 | Ga0070664_100139981 | 3300005564 | Unclassified | 2130 |
| 206 | Ga0070664_100468238 | 3300005564 | Bacteria | 1158 |
| 207 | Ga0068857_100000231 | 3300005577 | Bacteria | 37351 |
| 208 | Ga0068857_100061360 | 3300005577 | Bacteria | 3340 |
| 209 | Ga0068857_100126729 | 3300005577 | Bacteria | 2301 |
| 210 | Ga0068857_100415569 | 3300005577 | Bacteria | 1253 |
| 211 | Ga0068854_100094485 | 3300005578 | Bacteria | 2230 |
| 212 | Ga0068854_100111557 | 3300005578 | Bacteria | 2063 |
| 213 | Ga0068854_100374562 | 3300005578 | Bacteria | 1171 |
| 214 | Ga0068854_101017107 | 3300005578 | Bacteria | 734 |
| 215 | Ga0068856_100030396 | 3300005614 | Bacteria | 5280 |
| 216 | Ga0068856_100345021 | 3300005614 | Bacteria | 1507 |
| 217 | Ga0068856_100792277 | 3300005614 | Bacteria | 967 |
| 218 | Ga0068856_100838262 | 3300005614 | Bacteria | 939 |
| 219 | Ga0070702_100003035 | 3300005615 | Bacteria | 7429 |
| 220 | Ga0070702_100005902 | 3300005615 | Bacteria | 5748 |
| 221 | Ga0070702_100009254 | 3300005615 | Bacteria | 4814 |
| 222 | Ga0070702_100025412 | 3300005615 | Bacteria | 3173 |
| 223 | Ga0070702_100027013 | 3300005615 | Bacteria | 3092 |
| 224 | Ga0068852_100085204 | 3300005616 | Bacteria | 2814 |
| 225 | Ga0068852_100180393 | 3300005616 | Bacteria | 1985 |
| 226 | Ga0068859_100042244 | 3300005617 | Bacteria | 4580 |
| 227 | Ga0068859_100428745 | 3300005617 | Bacteria | 1419 |
| 228 | Ga0068859_100607142 | 3300005617 | Bacteria | 1187 |
| 229 | Ga0068864_100016821 | 3300005618 | Bacteria | 6094 |
| 230 | Ga0068864_100158826 | 3300005618 | Bacteria | 2054 |
| 231 | Ga0068864_100269875 | 3300005618 | Bacteria | 1585 |
| 232 | Ga0068866_10141004 | 3300005718 | Bacteria | 1383 |
| 233 | Ga0068866_10197508 | 3300005718 | Bacteria | 1200 |
| 234 | Ga0068861_100012914 | 3300005719 | Bacteria | 5831 |
| 235 | Ga0068851_10036779 | 3300005834 | Bacteria | 2452 |
| 236 | Ga0068863_100458226 | 3300005841 | Bacteria | 1252 |
| 237 | Ga0068858_100207967 | 3300005842 | Bacteria | 1851 |
| 238 | Ga0068858_100273057 | 3300005842 | Bacteria | 1609 |
| 239 | Ga0081455_10007749 | 3300005937 | Bacteria | 11259 |
| 240 | Ga0081455_10018478 | 3300005937 | Bacteria | 6639 |
| 241 | Ga0081455_10038340 | 3300005937 | Bacteria | 4244 |
| 242 | Ga0081455_10043239 | 3300005937 | Bacteria | 3944 |
| 243 | Ga0081455_10045940 | 3300005937 | Bacteria | 3795 |
| 244 | Ga0081455_10071215 | 3300005937 | Bacteria | 2883 |
| 245 | Ga0081455_10079908 | 3300005937 | Bacteria | 2683 |
| 246 | Ga0081538_10000052 | 3300005981 | Bacteria | 109642 |
| 247 | Ga0081538_10000352 | 3300005981 | Bacteria | 52528 |
| 248 | Ga0081538_10000571 | 3300005981 | Bacteria | 40853 |
| 249 | Ga0081538_10000677 | 3300005981 | Bacteria | 37447 |
| 250 | Ga0081538_10000872 | 3300005981 | Bacteria | 32589 |
| 251 | Ga0081538_10010401 | 3300005981 | Bacteria | 7627 |
| 252 | Ga0081538_10016094 | 3300005981 | Bacteria | 5751 |
| 253 | Ga0081540_1001965 | 3300005983 | Bacteria | 17152 |
| 254 | Ga0081540_1005187 | 3300005983 | Bacteria | 9756 |
| 255 | Ga0081540_1005276 | 3300005983 | Bacteria | 9669 |
| 256 | Ga0081540_1094445 | 3300005983 | Bacteria | 1306 |
| 257 | Ga0081539_10008181 | 3300005985 | Bacteria | 9217 |
| 258 | Ga0070717_10024233 | 3300006028 | Bacteria | 4816 |
| 259 | Ga0070717_10030782 | 3300006028 | Bacteria | 4313 |
| 260 | Ga0070717_10033346 | 3300006028 | Bacteria | 4154 |
| 261 | Ga0070717_10053163 | 3300006028 | Bacteria | 3338 |
| 262 | Ga0070717_10057003 | 3300006028 | Bacteria | 3229 |
| 263 | Ga0070717_10224651 | 3300006028 | Bacteria | 1651 |
| 264 | Ga0075365_10007709 | 3300006038 | Bacteria | 6056 |
| 265 | Ga0075364_10060833 | 3300006051 | Bacteria | 2476 |
| 266 | Ga0075364_10524429 | 3300006051 | Bacteria | 810 |
| 267 | Ga0070715_10008610 | 3300006163 | Bacteria | 3562 |
| 268 | Ga0070716_100016672 | 3300006173 | Bacteria | 3796 |
| 269 | Ga0070716_100044575 | 3300006173 | Bacteria | 2485 |
| 270 | Ga0070716_100078960 | 3300006173 | Bacteria | 1958 |
| 271 | Ga0070716_100210883 | 3300006173 | Bacteria | 1298 |
| 272 | Ga0070716_100418183 | 3300006173 | Bacteria | 969 |
| 273 | Ga0070712_100011230 | 3300006175 | Bacteria | 5670 |
| 274 | Ga0070712_100019238 | 3300006175 | Bacteria | 4450 |
| 275 | Ga0070712_100025261 | 3300006175 | Bacteria | 3947 |
| 276 | Ga0070712_100043248 | 3300006175 | Bacteria | 3100 |
| 277 | Ga0070712_100301765 | 3300006175 | Bacteria | 1296 |
| 278 | Ga0070712_100343570 | 3300006175 | Bacteria | 1219 |
| 279 | Ga0070712_100452367 | 3300006175 | Bacteria | 1069 |
| 280 | Ga0070712_100686410 | 3300006175 | Bacteria | 872 |
| 281 | Ga0075362_10005562 | 3300006177 | Bacteria | 4626 |
| 282 | Ga0075427_10005503 | 3300006194 | Bacteria | 1806 |
| 283 | Ga0097621_100016805 | 3300006237 | Bacteria | 5544 |
| 284 | Ga0097621_100060448 | 3300006237 | Bacteria | 3106 |
| 285 | Ga0097621_100169932 | 3300006237 | Bacteria | 1879 |
| 286 | Ga0097621_100389025 | 3300006237 | Bacteria | 1247 |
| 287 | Ga0097621_100767054 | 3300006237 | Bacteria | 892 |
| 288 | Ga0068871_100049456 | 3300006358 | Bacteria | 3398 |
| 289 | Ga0068871_100142390 | 3300006358 | Bacteria | 2039 |
| 290 | Ga0068871_100178685 | 3300006358 | Bacteria | 1823 |
| 291 | Ga0068871_100366591 | 3300006358 | Bacteria | 1277 |
| 292 | Ga0068871_100519765 | 3300006358 | Bacteria | 1075 |
| 293 | Ga0075428_100055600 | 3300006844 | Bacteria | 4336 |
| 294 | Ga0075428_100081370 | 3300006844 | Bacteria | 3534 |
| 295 | Ga0075428_100174650 | 3300006844 | Bacteria | 2327 |
| 296 | Ga0075428_100195786 | 3300006844 | Bacteria | 2186 |
| 297 | Ga0075430_100007921 | 3300006846 | Bacteria | 8984 |
| 298 | Ga0075430_100040628 | 3300006846 | Bacteria | 3937 |
| 299 | Ga0075430_100107397 | 3300006846 | Bacteria | 2328 |
| 300 | Ga0075430_100213120 | 3300006846 | Bacteria | 1602 |
| 301 | Ga0075431_100121088 | 3300006847 | Bacteria | 2700 |
| 302 | Ga0075431_100133721 | 3300006847 | Bacteria | 2557 |
| 303 | Ga0075431_100162214 | 3300006847 | Bacteria | 2298 |
| 304 | Ga0075431_100190267 | 3300006847 | Bacteria | 2103 |
| 305 | Ga0075431_100213321 | 3300006847 | Bacteria | 1971 |
| 306 | Ga0075431_100604168 | 3300006847 | Bacteria | 1081 |
| 307 | Ga0075431_100615776 | 3300006847 | Bacteria | 1068 |
| 308 | Ga0075433_10042647 | 3300006852 | Bacteria | 3938 |
| 309 | Ga0075433_10119917 | 3300006852 | Bacteria | 2335 |
| 310 | Ga0075433_10252161 | 3300006852 | Bacteria | 1566 |
| 311 | Ga0075433_10266278 | 3300006852 | Bacteria | 1519 |
| 312 | Ga0075433_10529117 | 3300006852 | Bacteria | 1037 |
| 313 | Ga0075433_10561541 | 3300006852 | Bacteria | 1003 |
| 314 | Ga0075434_100001520 | 3300006871 | Bacteria | 19621 |
| 315 | Ga0075434_100004815 | 3300006871 | Bacteria | 12224 |
| 316 | Ga0075434_100060849 | 3300006871 | Bacteria | 3757 |
| 317 | Ga0075434_100319272 | 3300006871 | Bacteria | 1574 |
| 318 | Ga0075434_100860845 | 3300006871 | Bacteria | 922 |
| 319 | Ga0075429_100039216 | 3300006880 | Bacteria | 4123 |
| 320 | Ga0075429_100123719 | 3300006880 | Bacteria | 2261 |
| 321 | Ga0075429_100168007 | 3300006880 | Bacteria | 1921 |
| 322 | Ga0075429_100174612 | 3300006880 | Bacteria | 1882 |
| 323 | Ga0075429_100209528 | 3300006880 | Bacteria | 1708 |
| 324 | Ga0075429_100232359 | 3300006880 | Bacteria | 1615 |
| 325 | Ga0075429_100472247 | 3300006880 | Bacteria | 1099 |
| 326 | Ga0075429_100475554 | 3300006880 | Bacteria | 1095 |
| 327 | Ga0068865_100002992 | 3300006881 | Bacteria | 10087 |
| 328 | Ga0068865_100049398 | 3300006881 | Bacteria | 2899 |
| 329 | Ga0068865_100119851 | 3300006881 | Bacteria | 1954 |
| 330 | Ga0068865_100203346 | 3300006881 | Bacteria | 1539 |
| 331 | Ga0075436_100003579 | 3300006914 | Bacteria | 10644 |
| 332 | Ga0075436_100020046 | 3300006914 | Bacteria | 4589 |
| 333 | Ga0075436_100103621 | 3300006914 | Bacteria | 1983 |
| 334 | Ga0075436_100108287 | 3300006914 | Bacteria | 1938 |
| 335 | Ga0075436_100214311 | 3300006914 | Bacteria | 1366 |
| 336 | Ga0075436_100518128 | 3300006914 | Bacteria | 873 |
| 337 | Ga0075436_100593351 | 3300006914 | Bacteria | 816 |
| 338 | Ga0097620_100042244 | 3300006931 | Bacteria | 4580 |
| 339 | Ga0097620_100428760 | 3300006931 | Bacteria | 1419 |
| 340 | Ga0097620_100607196 | 3300006931 | Bacteria | 1187 |
| 341 | Ga0075435_100001635 | 3300007076 | Bacteria | 14520 |
| 342 | Ga0075435_100011437 | 3300007076 | Bacteria | 6530 |
| 343 | Ga0075435_100047701 | 3300007076 | Bacteria | 3440 |
| 344 | Ga0075435_100175508 | 3300007076 | Bacteria | 1809 |
| 345 | Ga0075435_101058504 | 3300007076 | Bacteria | 709 |
| 346 | Ga0105240_10081108 | 3300009093 | Bacteria | 3988 |
| 347 | Ga0111539_10001013 | 3300009094 | Bacteria | 36808 |
| 348 | Ga0111539_10038452 | 3300009094 | Bacteria | 5771 |
| 349 | Ga0111539_10040525 | 3300009094 | Bacteria | 5606 |
| 350 | Ga0111539_10154510 | 3300009094 | Bacteria | 2685 |
| 351 | Ga0111539_10167824 | 3300009094 | Bacteria | 2565 |
| 352 | Ga0111539_10211542 | 3300009094 | Bacteria | 2259 |
| 353 | Ga0111539_10275484 | 3300009094 | Bacteria | 1958 |
| 354 | Ga0111539_10291091 | 3300009094 | Bacteria | 1900 |
| 355 | Ga0111539_11512254 | 3300009094 | Bacteria | 779 |
| 356 | Ga0105245_10014783 | 3300009098 | Bacteria | 6799 |
| 357 | Ga0105245_10033360 | 3300009098 | Bacteria | 4563 |
| 358 | Ga0105245_10073050 | 3300009098 | Bacteria | 3118 |
| 359 | Ga0105245_10130472 | 3300009098 | Bacteria | 2357 |
| 360 | Ga0105245_10290337 | 3300009098 | Bacteria | 1602 |
| 361 | Ga0105245_10493588 | 3300009098 | Bacteria | 1239 |
| 362 | Ga0105245_10609213 | 3300009098 | Bacteria | 1119 |
| 363 | Ga0105245_10795035 | 3300009098 | Bacteria | 984 |
| 364 | Ga0105245_11064121 | 3300009098 | Bacteria | 855 |
| 365 | Ga0105247_10239044 | 3300009101 | Bacteria | 1237 |
| 366 | Ga0105247_10290602 | 3300009101 | Bacteria | 1130 |
| 367 | Ga0114129_10016536 | 3300009147 | Bacteria | 10504 |
| 368 | Ga0114129_10070385 | 3300009147 | Bacteria | 4878 |
| 369 | Ga0114129_10099939 | 3300009147 | Bacteria | 4014 |
| 370 | Ga0114129_10164011 | 3300009147 | Bacteria | 3034 |
| 371 | Ga0114129_10246248 | 3300009147 | Bacteria | 2401 |
| 372 | Ga0114129_10292963 | 3300009147 | Bacteria | 2171 |
| 373 | Ga0114129_10295527 | 3300009147 | Bacteria | 2160 |
| 374 | Ga0114129_10701493 | 3300009147 | Bacteria | 1301 |
| 375 | Ga0114129_10860170 | 3300009147 | Bacteria | 1152 |
| 376 | Ga0114129_11057041 | 3300009147 | Bacteria | 1019 |
| 377 | Ga0105243_10028290 | 3300009148 | Bacteria | 4302 |
| 378 | Ga0105243_10128232 | 3300009148 | Bacteria | 2149 |
| 379 | Ga0105243_10282530 | 3300009148 | Bacteria | 1496 |
| 380 | Ga0105243_10389800 | 3300009148 | Bacteria | 1291 |
| 381 | Ga0105243_10625517 | 3300009148 | Bacteria | 1040 |
| 382 | Ga0105241_10010007 | 3300009174 | Bacteria | 6964 |
| 383 | Ga0105241_10110098 | 3300009174 | Bacteria | 2203 |
| 384 | Ga0105241_10681524 | 3300009174 | Bacteria | 936 |
| 385 | Ga0105242_10006691 | 3300009176 | Bacteria | 8897 |
| 386 | Ga0105242_10032138 | 3300009176 | Bacteria | 4195 |
| 387 | Ga0105242_10082511 | 3300009176 | Bacteria | 2690 |
| 388 | Ga0105242_10112166 | 3300009176 | Bacteria | 2326 |
| 389 | Ga0105242_10270518 | 3300009176 | Bacteria | 1539 |
| 390 | Ga0105242_10430223 | 3300009176 | Bacteria | 1239 |
| 391 | Ga0105242_10468123 | 3300009176 | Bacteria | 1192 |
| 392 | Ga0105248_10019066 | 3300009177 | Bacteria | 7585 |
| 393 | Ga0105248_10023316 | 3300009177 | Bacteria | 6874 |
| 394 | Ga0105248_10175023 | 3300009177 | Bacteria | 2419 |
| 395 | Ga0105248_10186556 | 3300009177 | Bacteria | 2337 |
| 396 | Ga0105248_10194549 | 3300009177 | Bacteria | 2285 |
| 397 | Ga0105248_10324417 | 3300009177 | Bacteria | 1734 |
| 398 | Ga0105237_10000037 | 3300009545 | Bacteria | 190855 |
| 399 | Ga0105237_10198868 | 3300009545 | Bacteria | 2004 |
| 400 | Ga0105237_10360923 | 3300009545 | Bacteria | 1457 |
| 401 | Ga0105238_10060284 | 3300009551 | Bacteria | 3800 |
| 402 | Ga0105238_10065350 | 3300009551 | Bacteria | 3639 |
| 403 | Ga0105238_10879468 | 3300009551 | Bacteria | 914 |
| 404 | Ga0105238_11214748 | 3300009551 | Bacteria | 778 |
| 405 | Ga0105238_11232831 | 3300009551 | Bacteria | 773 |
| 406 | Ga0105249_10002735 | 3300009553 | Bacteria | 15254 |
| 407 | Ga0105249_10024846 | 3300009553 | Bacteria | 5388 |
| 408 | Ga0105249_10120216 | 3300009553 | Bacteria | 2495 |
| 409 | Ga0105239_10105487 | 3300010375 | Bacteria | 3121 |
| 410 | Ga0105239_10125646 | 3300010375 | Bacteria | 2850 |
| 411 | Ga0105239_10405532 | 3300010375 | Bacteria | 1543 |
| 412 | Ga0105239_10641417 | 3300010375 | Bacteria | 1213 |
| 413 | Ga0105239_10726013 | 3300010375 | Bacteria | 1137 |
| 414 | Ga0105239_10854570 | 3300010375 | Bacteria | 1044 |
| 415 | Ga0105239_11081622 | 3300010375 | Bacteria | 923 |
| 416 | Ga0105239_11557599 | 3300010375 | Bacteria | 764 |
| 417 | Ga0105239_11970590 | 3300010375 | Bacteria | 678 |
| 418 | Ga0105246_10058244 | 3300011119 | Bacteria | 2676 |
| 419 | Ga0105246_10060099 | 3300011119 | Bacteria | 2639 |
| 420 | Ga0105246_10124321 | 3300011119 | Bacteria | 1917 |
| 421 | Ga0105246_10225135 | 3300011119 | Bacteria | 1473 |
| 422 | Ga0105246_10614809 | 3300011119 | Bacteria | 941 |
| 423 | Ga0105246_11060820 | 3300011119 | Bacteria | 737 |
| 424 | Ga0157329_1005250 | 3300012491 | Bacteria | 870 |
| 425 | Ga0157324_1001728 | 3300012506 | Bacteria | 1249 |
| 426 | Ga0157338_1005275 | 3300012515 | Bacteria | 1153 |
| 427 | Ga0157371_10086198 | 3300013102 | Bacteria | 2224 |
| 428 | Ga0157371_10117202 | 3300013102 | Bacteria | 1893 |
| 429 | Ga0157370_10077618 | 3300013104 | Bacteria | 3129 |
| 430 | Ga0157369_10249147 | 3300013105 | Bacteria | 1854 |
| 431 | Ga0157369_10607263 | 3300013105 | Bacteria | 1129 |
| 432 | Ga0157374_10028012 | 3300013296 | Bacteria | 5088 |
| 433 | Ga0157374_10768295 | 3300013296 | Bacteria | 979 |
| 434 | Ga0157378_10036713 | 3300013297 | Bacteria | 4336 |
| 435 | Ga0157378_10041614 | 3300013297 | Bacteria | 4076 |
| 436 | Ga0157378_10216987 | 3300013297 | Bacteria | 1817 |
| 437 | Ga0163162_10003800 | 3300013306 | Bacteria | 14483 |
| 438 | Ga0163162_10036629 | 3300013306 | Bacteria | 4892 |
| 439 | Ga0163162_11080968 | 3300013306 | Bacteria | 908 |
| 440 | Ga0157372_10053020 | 3300013307 | Bacteria | 4519 |
| 441 | Ga0157372_10103103 | 3300013307 | Bacteria | 3259 |
| 442 | Ga0157372_10126423 | 3300013307 | Bacteria | 2939 |
| 443 | Ga0157372_11301457 | 3300013307 | Bacteria | 839 |
| 444 | Ga0157375_10013777 | 3300013308 | Bacteria | 7207 |
| 445 | Ga0157375_10017172 | 3300013308 | Bacteria | 6524 |
| 446 | Ga0157375_10148833 | 3300013308 | Bacteria | 2475 |
| 447 | Ga0157375_10255824 | 3300013308 | Bacteria | 1912 |
| 448 | Ga0157375_10345738 | 3300013308 | Bacteria | 1653 |
| 449 | Ga0157375_10473337 | 3300013308 | Bacteria | 1418 |
| 450 | Ga0157375_11106246 | 3300013308 | Bacteria | 928 |
| 451 | Ga0163163_10361960 | 3300014325 | Bacteria | 1507 |
| 452 | Ga0163163_10362136 | 3300014325 | Bacteria | 1507 |
| 453 | Ga0163163_10745436 | 3300014325 | Bacteria | 1043 |
| 454 | Ga0157380_10118872 | 3300014326 | Bacteria | 2235 |
| 455 | Ga0157380_10524468 | 3300014326 | Bacteria | 1156 |
| 456 | Ga0157380_11676883 | 3300014326 | Bacteria | 693 |
| 457 | Ga0182008_10050308 | 3300014497 | Bacteria | 2068 |
| 458 | Ga0182008_10098766 | 3300014497 | Bacteria | 1442 |
| 459 | Ga0182008_10341260 | 3300014497 | Bacteria | 792 |
| 460 | Ga0157377_10077893 | 3300014745 | Bacteria | 1931 |
| 461 | Ga0157379_10005505 | 3300014968 | Bacteria | 10878 |
| 462 | Ga0157379_10177545 | 3300014968 | Bacteria | 1923 |
| 463 | Ga0157376_10028247 | 3300014969 | Bacteria | 4457 |
| 464 | Ga0157376_10030023 | 3300014969 | Bacteria | 4335 |
| 465 | Ga0157376_10042207 | 3300014969 | Bacteria | 3738 |
| 466 | Ga0157376_10204820 | 3300014969 | Bacteria | 1818 |
| 467 | Ga0157376_10278463 | 3300014969 | Bacteria | 1574 |
| 468 | Ga0157376_10373795 | 3300014969 | Bacteria | 1371 |
| 469 | Ga0157376_10394674 | 3300014969 | Bacteria | 1336 |
| 470 | Ga0157376_10588298 | 3300014969 | Bacteria | 1106 |
| 471 | Ga0163161_10134413 | 3300017792 | Bacteria | 1868 |
| 472 | Ga0163161_10421163 | 3300017792 | Bacteria | 1074 |
| 473 | Ga0197907_10383702 | 3300020069 | Bacteria | 1016 |
| 474 | Ga0206349_1095632 | 3300020075 | Bacteria | 1163 |
| 475 | Ga0206352_11166851 | 3300020078 | Bacteria | 1593 |
| 476 | Ga0206352_11331296 | 3300020078 | Bacteria | 820 |
| 477 | Ga0206350_10398217 | 3300020080 | Bacteria | 2084 |
| 478 | Ga0206353_10240172 | 3300020082 | Bacteria | 2592 |
| 479 | Ga0206353_11538467 | 3300020082 | Bacteria | 1061 |
| 480 | Ga0154015_1367111 | 3300020610 | Bacteria | 927 |
| 481 | Ga0154015_1674205 | 3300020610 | Bacteria | 887 |
| 482 | Ga0224712_10095369 | 3300022467 | Bacteria | 1253 |
| 483 | Ga0207697_10217368 | 3300025315 | Bacteria | 843 |
| 484 | Ga0207653_10002891 | 3300025885 | Bacteria | 5453 |
| 485 | Ga0207653_10051426 | 3300025885 | Bacteria | 1372 |
| 486 | Ga0207692_10011411 | 3300025898 | Bacteria | 3781 |
| 487 | Ga0207692_10027075 | 3300025898 | Bacteria | 2696 |
| 488 | Ga0207692_10042751 | 3300025898 | Bacteria | 2251 |
| 489 | Ga0207692_10073518 | 3300025898 | Bacteria | 1809 |
| 490 | Ga0207642_10036559 | 3300025899 | Bacteria | 2108 |
| 491 | Ga0207642_10118706 | 3300025899 | Bacteria | 1360 |
| 492 | Ga0207642_10128113 | 3300025899 | Bacteria | 1320 |
| 493 | Ga0207688_10086026 | 3300025901 | Bacteria | 1801 |
| 494 | Ga0207688_10299292 | 3300025901 | Bacteria | 983 |
| 495 | Ga0207688_10532727 | 3300025901 | Bacteria | 737 |
| 496 | Ga0207680_10063955 | 3300025903 | Bacteria | 2253 |
| 497 | Ga0207680_10090958 | 3300025903 | Bacteria | 1941 |
| 498 | Ga0207680_10230648 | 3300025903 | Bacteria | 1272 |
| 499 | Ga0207647_10206881 | 3300025904 | Bacteria | 1134 |
| 500 | Ga0207685_10116466 | 3300025905 | Bacteria | 1166 |
| 501 | Ga0207685_10121481 | 3300025905 | Bacteria | 1147 |
| 502 | Ga0207699_10019694 | 3300025906 | Bacteria | 3603 |
| 503 | Ga0207699_10069186 | 3300025906 | Bacteria | 2151 |
| 504 | Ga0207699_10115957 | 3300025906 | Bacteria | 1724 |
| 505 | Ga0207699_10399974 | 3300025906 | Bacteria | 978 |
| 506 | Ga0207699_10410041 | 3300025906 | Bacteria | 966 |
| 507 | Ga0207699_10541533 | 3300025906 | Bacteria | 844 |
| 508 | Ga0207643_10023603 | 3300025908 | Bacteria | 3392 |
| 509 | Ga0207684_10044722 | 3300025910 | Bacteria | 3756 |
| 510 | Ga0207684_10051590 | 3300025910 | Bacteria | 3490 |
| 511 | Ga0207684_10066722 | 3300025910 | Bacteria | 3056 |
| 512 | Ga0207684_10305365 | 3300025910 | Bacteria | 1372 |
| 513 | Ga0207684_10414771 | 3300025910 | Bacteria | 1157 |
| 514 | Ga0207684_10595554 | 3300025910 | Bacteria | 944 |
| 515 | Ga0207684_10687374 | 3300025910 | Bacteria | 870 |
| 516 | Ga0207654_10070170 | 3300025911 | Bacteria | 2079 |
| 517 | Ga0207654_10134876 | 3300025911 | Bacteria | 1567 |
| 518 | Ga0207654_10253167 | 3300025911 | Bacteria | 1181 |
| 519 | Ga0207695_10018087 | 3300025913 | Bacteria | 8158 |
| 520 | Ga0207695_10249325 | 3300025913 | Bacteria | 1675 |
| 521 | Ga0207671_10000294 | 3300025914 | Bacteria | 73436 |
| 522 | Ga0207671_10071951 | 3300025914 | Bacteria | 2580 |
| 523 | Ga0207671_10436602 | 3300025914 | Bacteria | 1042 |
| 524 | Ga0207671_10651189 | 3300025914 | Bacteria | 839 |
| 525 | Ga0207693_10001397 | 3300025915 | Bacteria | 21388 |
| 526 | Ga0207693_10003063 | 3300025915 | Bacteria | 14421 |
| 527 | Ga0207693_10003807 | 3300025915 | Bacteria | 12843 |
| 528 | Ga0207693_10008745 | 3300025915 | Bacteria | 8279 |
| 529 | Ga0207693_10023761 | 3300025915 | Bacteria | 4865 |
| 530 | Ga0207693_10054740 | 3300025915 | Bacteria | 3129 |
| 531 | Ga0207693_10055933 | 3300025915 | Bacteria | 3094 |
| 532 | Ga0207693_10099182 | 3300025915 | Bacteria | 2284 |
| 533 | Ga0207693_10191014 | 3300025915 | Bacteria | 1611 |
| 534 | Ga0207693_11025677 | 3300025915 | Bacteria | 629 |
| 535 | Ga0207663_10001774 | 3300025916 | Bacteria | 10175 |
| 536 | Ga0207663_10163764 | 3300025916 | Bacteria | 1573 |
| 537 | Ga0207663_10265920 | 3300025916 | Bacteria | 1268 |
| 538 | Ga0207660_10260486 | 3300025917 | Bacteria | 1371 |
| 539 | Ga0207660_10315060 | 3300025917 | Bacteria | 1248 |
| 540 | Ga0207660_10323323 | 3300025917 | Bacteria | 1232 |
| 541 | Ga0207662_10019540 | 3300025918 | Bacteria | 3857 |
| 542 | Ga0207662_10202051 | 3300025918 | Bacteria | 1287 |
| 543 | Ga0207657_10070813 | 3300025919 | Bacteria | 2954 |
| 544 | Ga0207657_10133883 | 3300025919 | Bacteria | 2030 |
| 545 | Ga0207657_10183034 | 3300025919 | Bacteria | 1693 |
| 546 | Ga0207657_10192028 | 3300025919 | Bacteria | 1647 |
| 547 | Ga0207657_10465912 | 3300025919 | Bacteria | 991 |
| 548 | Ga0207649_10206656 | 3300025920 | Bacteria | 1390 |
| 549 | Ga0207652_10043178 | 3300025921 | Bacteria | 3839 |
| 550 | Ga0207652_10111916 | 3300025921 | Bacteria | 2422 |
| 551 | Ga0207652_10143918 | 3300025921 | Bacteria | 2133 |
| 552 | Ga0207652_10419886 | 3300025921 | Bacteria | 1206 |
| 553 | Ga0207646_10005164 | 3300025922 | Bacteria | 13824 |
| 554 | Ga0207646_10044170 | 3300025922 | Bacteria | 4000 |
| 555 | Ga0207646_10052287 | 3300025922 | Bacteria | 3655 |
| 556 | Ga0207646_10273619 | 3300025922 | Bacteria | 1526 |
| 557 | Ga0207646_10674166 | 3300025922 | Bacteria | 926 |
| 558 | Ga0207681_10284991 | 3300025923 | Bacteria | 1302 |
| 559 | Ga0207694_10066700 | 3300025924 | Bacteria | 2808 |
| 560 | Ga0207694_10125502 | 3300025924 | Bacteria | 2053 |
| 561 | Ga0207694_10186832 | 3300025924 | Bacteria | 1682 |
| 562 | Ga0207694_10657706 | 3300025924 | Bacteria | 883 |
| 563 | Ga0207650_10295125 | 3300025925 | Bacteria | 1323 |
| 564 | Ga0207659_10166119 | 3300025926 | Bacteria | 1737 |
| 565 | Ga0207687_10042335 | 3300025927 | Bacteria | 3132 |
| 566 | Ga0207687_10147799 | 3300025927 | Bacteria | 1790 |
| 567 | Ga0207687_10247919 | 3300025927 | Bacteria | 1414 |
| 568 | Ga0207687_10399666 | 3300025927 | Bacteria | 1130 |
| 569 | Ga0207687_10507496 | 3300025927 | Bacteria | 1007 |
| 570 | Ga0207687_10618189 | 3300025927 | Bacteria | 914 |
| 571 | Ga0207700_10010491 | 3300025928 | Bacteria | 5850 |
| 572 | Ga0207700_10211510 | 3300025928 | Bacteria | 1640 |
| 573 | Ga0207700_10245311 | 3300025928 | Bacteria | 1528 |
| 574 | Ga0207700_10440340 | 3300025928 | Bacteria | 1147 |
| 575 | Ga0207700_10587271 | 3300025928 | Bacteria | 991 |
| 576 | Ga0207700_10588511 | 3300025928 | Bacteria | 990 |
| 577 | Ga0207664_10013306 | 3300025929 | Bacteria | 5902 |
| 578 | Ga0207664_10019531 | 3300025929 | Bacteria | 5010 |
| 579 | Ga0207664_10079641 | 3300025929 | Bacteria | 2660 |
| 580 | Ga0207664_10235202 | 3300025929 | Bacteria | 1594 |
| 581 | Ga0207664_10242574 | 3300025929 | Bacteria | 1570 |
| 582 | Ga0207664_11005468 | 3300025929 | Bacteria | 747 |
| 583 | Ga0207644_10360916 | 3300025931 | Bacteria | 1182 |
| 584 | Ga0207690_10008253 | 3300025932 | Bacteria | 6177 |
| 585 | Ga0207690_10084296 | 3300025932 | Bacteria | 2227 |
| 586 | Ga0207706_10028228 | 3300025933 | Bacteria | 5013 |
| 587 | Ga0207706_10034557 | 3300025933 | Bacteria | 4497 |
| 588 | Ga0207706_10048594 | 3300025933 | Bacteria | 3752 |
| 589 | Ga0207706_10116452 | 3300025933 | Bacteria | 2350 |
| 590 | Ga0207706_10436149 | 3300025933 | Bacteria | 1134 |
| 591 | Ga0207706_10577836 | 3300025933 | Bacteria | 966 |
| 592 | Ga0207686_10005329 | 3300025934 | Bacteria | 6897 |
| 593 | Ga0207686_10066513 | 3300025934 | Bacteria | 2302 |
| 594 | Ga0207686_10205083 | 3300025934 | Bacteria | 1414 |
| 595 | Ga0207709_10002679 | 3300025935 | Bacteria | 11036 |
| 596 | Ga0207709_10170735 | 3300025935 | Bacteria | 1526 |
| 597 | Ga0207709_10614810 | 3300025935 | Bacteria | 862 |
| 598 | Ga0207670_10040585 | 3300025936 | Bacteria | 3055 |
| 599 | Ga0207670_10077932 | 3300025936 | Bacteria | 2310 |
| 600 | Ga0207670_10285495 | 3300025936 | Bacteria | 1288 |
| 601 | Ga0207669_10021397 | 3300025937 | Bacteria | 3414 |
| 602 | Ga0207669_10028967 | 3300025937 | Bacteria | 3055 |
| 603 | Ga0207704_10030321 | 3300025938 | Bacteria | 3031 |
| 604 | Ga0207704_10083355 | 3300025938 | Bacteria | 2074 |
| 605 | Ga0207704_10189246 | 3300025938 | Bacteria | 1495 |
| 606 | Ga0207704_10507870 | 3300025938 | Bacteria | 973 |
| 607 | Ga0207665_10041272 | 3300025939 | Bacteria | 3080 |
| 608 | Ga0207665_10044745 | 3300025939 | Bacteria | 2962 |
| 609 | Ga0207665_10074809 | 3300025939 | Bacteria | 2319 |
| 610 | Ga0207665_10280429 | 3300025939 | Bacteria | 1240 |
| 611 | Ga0207665_10435802 | 3300025939 | Bacteria | 1003 |
| 612 | Ga0207691_10181406 | 3300025940 | Bacteria | 1839 |
| 613 | Ga0207691_10328797 | 3300025940 | Bacteria | 1310 |
| 614 | Ga0207711_10038983 | 3300025941 | Bacteria | 4040 |
| 615 | Ga0207711_10198432 | 3300025941 | Bacteria | 1830 |
| 616 | Ga0207711_10219976 | 3300025941 | Bacteria | 1736 |
| 617 | Ga0207711_10269175 | 3300025941 | Bacteria | 1567 |
| 618 | Ga0207711_10475954 | 3300025941 | Bacteria | 1163 |
| 619 | Ga0207689_10210416 | 3300025942 | Bacteria | 1607 |
| 620 | Ga0207661_10014009 | 3300025944 | Bacteria | 5865 |
| 621 | Ga0207661_10258888 | 3300025944 | Bacteria | 1549 |
| 622 | Ga0207661_10345457 | 3300025944 | Bacteria | 1341 |
| 623 | Ga0207661_10512847 | 3300025944 | Bacteria | 1096 |
| 624 | Ga0207661_10851454 | 3300025944 | Bacteria | 839 |
| 625 | Ga0207679_10107458 | 3300025945 | Bacteria | 2196 |
| 626 | Ga0207679_10128420 | 3300025945 | Bacteria | 2030 |
| 627 | Ga0207679_10277166 | 3300025945 | Bacteria | 1437 |
| 628 | Ga0207679_10288320 | 3300025945 | Bacteria | 1410 |
| 629 | Ga0207679_10689409 | 3300025945 | Bacteria | 926 |
| 630 | Ga0207679_10723765 | 3300025945 | Bacteria | 904 |
| 631 | Ga0207667_10276763 | 3300025949 | Bacteria | 1715 |
| 632 | Ga0207667_10367086 | 3300025949 | Bacteria | 1467 |
| 633 | Ga0207667_10499945 | 3300025949 | Bacteria | 1233 |
| 634 | Ga0207651_10300858 | 3300025960 | Bacteria | 1334 |
| 635 | Ga0207651_10626270 | 3300025960 | Bacteria | 943 |
| 636 | Ga0207712_10114484 | 3300025961 | Bacteria | 2029 |
| 637 | Ga0207712_10196606 | 3300025961 | Bacteria | 1596 |
| 638 | Ga0207668_10141878 | 3300025972 | Bacteria | 1849 |
| 639 | Ga0207668_10360304 | 3300025972 | Bacteria | 1218 |
| 640 | Ga0207668_10447354 | 3300025972 | Bacteria | 1102 |
| 641 | Ga0207640_10075676 | 3300025981 | Bacteria | 2282 |
| 642 | Ga0207658_10379372 | 3300025986 | Bacteria | 1238 |
| 643 | Ga0207677_10094900 | 3300026023 | Bacteria | 2179 |
| 644 | Ga0207677_10174720 | 3300026023 | Bacteria | 1684 |
| 645 | Ga0207677_10184915 | 3300026023 | Bacteria | 1642 |
| 646 | Ga0207677_11002667 | 3300026023 | Bacteria | 757 |
| 647 | Ga0207677_11245487 | 3300026023 | Bacteria | 682 |
| 648 | Ga0207703_10020015 | 3300026035 | Bacteria | 5229 |
| 649 | Ga0207703_10032602 | 3300026035 | Bacteria | 4123 |
| 650 | Ga0207703_10147853 | 3300026035 | Bacteria | 2045 |
| 651 | Ga0207703_10341370 | 3300026035 | Bacteria | 1376 |
| 652 | Ga0207639_10015571 | 3300026041 | Bacteria | 5366 |
| 653 | Ga0207639_10392838 | 3300026041 | Bacteria | 1248 |
| 654 | Ga0207678_10161912 | 3300026067 | Bacteria | 1911 |
| 655 | Ga0207678_10194575 | 3300026067 | Bacteria | 1733 |
| 656 | Ga0207678_10244121 | 3300026067 | Bacteria | 1538 |
| 657 | Ga0207708_10000318 | 3300026075 | Bacteria | 38045 |
| 658 | Ga0207708_10001272 | 3300026075 | Bacteria | 18966 |
| 659 | Ga0207708_10023900 | 3300026075 | Bacteria | 4622 |
| 660 | Ga0207708_10384606 | 3300026075 | Bacteria | 1158 |
| 661 | Ga0207708_10513376 | 3300026075 | Bacteria | 1006 |
| 662 | Ga0207702_10011169 | 3300026078 | Bacteria | 7490 |
| 663 | Ga0207702_10035064 | 3300026078 | Bacteria | 4195 |
| 664 | Ga0207702_10068952 | 3300026078 | Bacteria | 3039 |
| 665 | Ga0207702_10219670 | 3300026078 | Bacteria | 1771 |
| 666 | Ga0207702_11184294 | 3300026078 | Bacteria | 758 |
| 667 | Ga0207702_11260744 | 3300026078 | Bacteria | 733 |
| 668 | Ga0207641_11141700 | 3300026088 | Bacteria | 778 |
| 669 | Ga0207648_10003992 | 3300026089 | Bacteria | 15308 |
| 670 | Ga0207648_10020641 | 3300026089 | Bacteria | 5931 |
| 671 | Ga0207648_10198847 | 3300026089 | Bacteria | 1778 |
| 672 | Ga0207648_10313251 | 3300026089 | Bacteria | 1409 |
| 673 | Ga0207676_10038667 | 3300026095 | Bacteria | 3644 |
| 674 | Ga0207676_10074588 | 3300026095 | Bacteria | 2734 |
| 675 | Ga0207674_10000602 | 3300026116 | Bacteria | 47280 |
| 676 | Ga0207674_10001034 | 3300026116 | Bacteria | 36274 |
| 677 | Ga0207674_10009302 | 3300026116 | Bacteria | 11254 |
| 678 | Ga0207674_10082086 | 3300026116 | Bacteria | 3225 |
| 679 | Ga0207675_100003964 | 3300026118 | Bacteria | 14368 |
| 680 | Ga0207675_100011807 | 3300026118 | Bacteria | 8164 |
| 681 | Ga0207675_100041266 | 3300026118 | Bacteria | 4309 |
| 682 | Ga0207675_100062109 | 3300026118 | Bacteria | 3488 |
| 683 | Ga0207675_100162269 | 3300026118 | Bacteria | 2132 |
| 684 | Ga0207683_10000215 | 3300026121 | Bacteria | 50395 |
| 685 | Ga0207683_10002095 | 3300026121 | Bacteria | 17570 |
| 686 | Ga0207683_10004391 | 3300026121 | Bacteria | 12189 |
| 687 | Ga0207683_10050021 | 3300026121 | Bacteria | 3660 |
| 688 | Ga0207683_10367466 | 3300026121 | Bacteria | 1321 |
| 689 | Ga0207698_10126200 | 3300026142 | Bacteria | 2177 |
| 690 | Ga0207698_10324086 | 3300026142 | Bacteria | 1444 |
| 691 | Ga0209966_1002356 | 3300027695 | Bacteria | 3146 |
| 692 | Ga0207428_10005092 | 3300027907 | Bacteria | 12341 |
| 693 | Ga0207428_10007271 | 3300027907 | Bacteria | 10124 |
| 694 | Ga0207428_10026245 | 3300027907 | Bacteria | 4864 |
| 695 | Ga0207428_10118965 | 3300027907 | Bacteria | 2027 |
| 696 | Ga0207428_10120950 | 3300027907 | Bacteria | 2008 |
| 697 | Ga0207428_10261940 | 3300027907 | Bacteria | 1288 |
| 698 | Ga0268266_10159422 | 3300028379 | Bacteria | 2040 |
| 699 | Ga0268266_10229934 | 3300028379 | Bacteria | 1708 |
| 700 | Ga0268266_10809673 | 3300028379 | Bacteria | 905 |
| 701 | Ga0268264_10026733 | 3300028381 | Bacteria | 4715 |
| 702 | Ga0268264_10462830 | 3300028381 | Bacteria | 1231 |
| 703 | Ga0265319_1036944 | 3300028563 | Bacteria | 1667 |
| 704 | Ga0265320_10018694 | 3300031240 | Bacteria | 3808 |
| 705 | Ga0307408_100583404 | 3300031548 | Bacteria | 991 |
| 706 | Ga0265314_10189034 | 3300031711 | Bacteria | 1227 |
| 707 | Ga0307413_10034557 | 3300031824 | Bacteria | 2890 |
| 708 | Ga0307413_11168665 | 3300031824 | Bacteria | 668 |
| 709 | Ga0307410_10028304 | 3300031852 | Bacteria | 3553 |
| 710 | Ga0307410_10159319 | 3300031852 | Bacteria | 1689 |
| 711 | Ga0307410_10543305 | 3300031852 | Bacteria | 962 |
| 712 | Ga0307410_11145263 | 3300031852 | Bacteria | 676 |
| 713 | Ga0307406_10099792 | 3300031901 | Bacteria | 1975 |
| 714 | Ga0307406_10125445 | 3300031901 | Bacteria | 1793 |
| 715 | Ga0307406_10140451 | 3300031901 | Bacteria | 1709 |
| 716 | Ga0307409_100033311 | 3300031995 | Bacteria | 3748 |
| 717 | Ga0307416_100014462 | 3300032002 | Bacteria | 5413 |
| 718 | Ga0307416_100014964 | 3300032002 | Bacteria | 5339 |
| 719 | Ga0307416_100075190 | 3300032002 | Bacteria | 2826 |
| 720 | Ga0307416_100089581 | 3300032002 | Bacteria | 2635 |
| 721 | Ga0307416_100166563 | 3300032002 | Bacteria | 2045 |
| 722 | Ga0307416_100177782 | 3300032002 | Bacteria | 1991 |
| 723 | Ga0307416_100323901 | 3300032002 | Bacteria | 1545 |
| 724 | Ga0307414_10274653 | 3300032004 | Bacteria | 1413 |
| 725 | Ga0307411_10198678 | 3300032005 | Bacteria | 1538 |
| 726 | Ga0307415_100000283 | 3300032126 | Bacteria | 21941 |
| 727 | Ga0307415_100588117 | 3300032126 | Bacteria | 988 |
| 728 | Ga0373948_0000987 | 3300034817 | Bacteria | 3818 |
| 729 | Ga0373950_0006398 | 3300034818 | Bacteria | 1794 |
| 730 | Ga0373958_0002079 | 3300034819 | Bacteria | 2768 |
| 731 | Ga0373959_0008553 | 3300034820 | Bacteria | 1745 |
| 732 | Ga0373938_0007321 | 3300034957 | Bacteria | 1938 |
| 733 | Ga0373928_0006086 | 3300035084 | Bacteria | 2314 |
| 734 | Ga0373929_0001505 | 3300035085 | Bacteria | 4433 |
| 735 | Ga0373929_0037208 | 3300035085 | Bacteria | 1066 |
| 736 | Ga0373940_0003105 | 3300035088 | Bacteria | 3341 |
| 737 | Ga0373949_0001447 | 3300035090 | Bacteria | 6785 |
| 738 | Ga0373949_0014141 | 3300035090 | Bacteria | 1776 |
| 739 | Ga0373949_0094059 | 3300035090 | Bacteria | 814 |
| 740 | Ga0373951_0005316 | 3300035091 | Bacteria | 2997 |
| 741 | Ga0373952_0001824 | 3300035092 | Bacteria | 3869 |
| 742 | Ga0373952_0036549 | 3300035092 | Bacteria | 1116 |
| 743 | Ga0373952_0060070 | 3300035092 | Bacteria | 927 |
| 744 | Ga0373932_0000884 | 3300035112 | Bacteria | 8780 |
| 745 | Ga0373932_0079177 | 3300035112 | Bacteria | 1035 |
| 746 | Ga0373932_0188049 | 3300035112 | Bacteria | 728 |
| 747 | Ga0373939_0003770 | 3300035114 | Bacteria | 3573 |
| 748 | Ga0373941_0007609 | 3300035115 | Bacteria | 2656 |
| 749 | Ga0373941_0039119 | 3300035115 | Bacteria | 1456 |
| 750 | Ga0373941_0208125 | 3300035115 | Bacteria | 747 |
| 751 | Ga0373945_0008033 | 3300035116 | Bacteria | 3427 |
| 752 | Ga0373960_0000300 | 3300035121 | Bacteria | 9439 |
| 753 | Ga0373960_0005826 | 3300035121 | Bacteria | 2866 |
| 754 | Ga0373960_0306280 | 3300035121 | Bacteria | 592 |
| 755 | Ga0373943_0090566 | 3300035170 | Bacteria | 1584 |
| 756 | Ga0373943_0127907 | 3300035170 | Bacteria | 1357 |
| 757 | Ga0373943_0139802 | 3300035170 | Bacteria | 1303 |
| 758 | Ga0373942_0004007 | 3300035207 | Bacteria | 3438 |
| 759 | Ga0373942_0037813 | 3300035207 | Bacteria | 1306 |
| 760 | Ga0373942_0163541 | 3300035207 | Bacteria | 721 |
| 761 | Ga0373961_0002740 | 3300035241 | Bacteria | 4503 |
| 762 | Ga0373961_0074772 | 3300035241 | Bacteria | 1055 |
| 763 | Ga0373961_0104910 | 3300035241 | Bacteria | 919 |
| 764 | Ga0373961_0108015 | 3300035241 | Bacteria | 909 |
| 765 | Ga0373962_0000470 | 3300035242 | Bacteria | 8917 |
| 766 | Ga0373962_0010348 | 3300035242 | Bacteria | 2324 |
| 767 | Ga0316574_0077842 | 3300035398 | Bacteria | 2102 |
| 768 | Ga0373931_0005860 | 3300035691 | Bacteria | 5716 |
| 769 | Ga0373931_0014422 | 3300035691 | Bacteria | 3863 |
| 770 | Ga0373931_0587323 | 3300035691 | Bacteria | 727 |
| 771 | Ga0373935_0079542 | 3300035692 | Bacteria | 2128 |
| 772 | Ga0373935_0363106 | 3300035692 | Bacteria | 1034 |
| 773 | Ga0373927_0124105 | 3300035695 | Bacteria | 1686 |
| 774 | Ga0373933_0199870 | 3300035724 | Bacteria | 1279 |
| 775 | Ga0373947_0038718 | 3300035725 | Bacteria | 2834 |
| 776 | Ga0373947_0179136 | 3300035725 | Bacteria | 1379 |
| 777 | Ga0373937_0311652 | 3300036401 | Bacteria | 1488 |
| 778 | Ga0373937_0381837 | 3300036401 | Bacteria | 1336 |
| 779 | Ga0373925_0041238 | 3300037068 | Bacteria | 3421 |
| 780 | Ga0373925_0069444 | 3300037068 | Bacteria | 2662 |
| 781 | Ga0373925_0401233 | 3300037068 | Bacteria | 1118 |
| 782 | Ga0395899_0004381 | 3300037312 | Bacteria | 11006 |
| 783 | Ga0395899_0006296 | 3300037312 | Bacteria | 9185 |
| 784 | Ga0395899_0009034 | 3300037312 | Bacteria | 7660 |
| 785 | Ga0395899_0009701 | 3300037312 | Bacteria | 7388 |
| 786 | Ga0395899_0009738 | 3300037312 | Bacteria | 7376 |
| 787 | Ga0395899_0018693 | 3300037312 | Bacteria | 5267 |
| 788 | Ga0395899_0090114 | 3300037312 | Bacteria | 2224 |
| 789 | Ga0395899_0100492 | 3300037312 | Bacteria | 2089 |
| 790 | Ga0395899_0103355 | 3300037312 | Bacteria | 2055 |
| 791 | Ga0395899_0109350 | 3300037312 | Bacteria | 1989 |
| 792 | Ga0395899_0121975 | 3300037312 | Bacteria | 1866 |
| 793 | Ga0395899_0141765 | 3300037312 | Bacteria | 1709 |
| 794 | Ga0395900_0002094 | 3300037418 | Bacteria | 22368 |
| 795 | Ga0395900_0002557 | 3300037418 | Bacteria | 19948 |
| 796 | Ga0395900_0005285 | 3300037418 | Bacteria | 13535 |
| 797 | Ga0395900_0006119 | 3300037418 | Bacteria | 12549 |
| 798 | Ga0395900_0009995 | 3300037418 | Bacteria | 9711 |
| 799 | Ga0395900_0032874 | 3300037418 | Bacteria | 5336 |
| 800 | Ga0395900_0036840 | 3300037418 | Bacteria | 5041 |
| 801 | Ga0395900_0054562 | 3300037418 | Bacteria | 4114 |
| 802 | Ga0395900_0055402 | 3300037418 | Bacteria | 4083 |
| 803 | Ga0395900_0070114 | 3300037418 | Bacteria | 3603 |
| 804 | Ga0395900_0087955 | 3300037418 | Bacteria | 3193 |
| 805 | Ga0395900_0099679 | 3300037418 | Bacteria | 2984 |
| 806 | Ga0395900_0106579 | 3300037418 | Bacteria | 2879 |
| 807 | Ga0395900_0108196 | 3300037418 | Bacteria | 2856 |
| 808 | Ga0395900_0117837 | 3300037418 | Bacteria | 2725 |
| 809 | Ga0395900_0172039 | 3300037418 | Bacteria | 2204 |
| 810 | Ga0395900_0186796 | 3300037418 | Bacteria | 2103 |
| 811 | Ga0395900_0206385 | 3300037418 | Bacteria | 1986 |
| 812 | Ga0395900_0283018 | 3300037418 | Bacteria | 1649 |
| 813 | Ga0395900_0287832 | 3300037418 | Bacteria | 1633 |
| 814 | Ga0395900_0591291 | 3300037418 | Bacteria | 1051 |
| 815 | Ga0395900_0642403 | 3300037418 | Bacteria | 998 |
| 816 | Ga0395900_0644498 | 3300037418 | Bacteria | 996 |
| 817 | Ga0395900_1266685 | 3300037418 | Bacteria | 652 |
| 818 | Ga0395898_0002920 | 3300037466 | Bacteria | 19456 |
| 819 | Ga0395898_0005446 | 3300037466 | Bacteria | 13753 |
| 820 | Ga0395898_0007665 | 3300037466 | Bacteria | 11462 |
| 821 | Ga0395898_0008336 | 3300037466 | Bacteria | 10957 |
| 822 | Ga0395898_0014060 | 3300037466 | Bacteria | 8225 |
| 823 | Ga0395898_0016773 | 3300037466 | Bacteria | 7483 |
| 824 | Ga0395898_0023607 | 3300037466 | Bacteria | 6212 |
| 825 | Ga0395898_0025755 | 3300037466 | Bacteria | 5924 |
| 826 | Ga0395898_0028354 | 3300037466 | Bacteria | 5611 |
| 827 | Ga0395898_0031904 | 3300037466 | Bacteria | 5260 |
| 828 | Ga0395898_0067017 | 3300037466 | Bacteria | 3477 |
| 829 | Ga0395898_0175848 | 3300037466 | Bacteria | 2046 |
| 830 | Ga0395898_0186093 | 3300037466 | Bacteria | 1984 |
| 831 | Ga0395898_0209053 | 3300037466 | Bacteria | 1862 |
| 832 | Ga0395898_0227878 | 3300037466 | Bacteria | 1777 |
| 833 | Ga0395898_0360951 | 3300037466 | Bacteria | 1385 |
| 834 | Ga0395898_0370198 | 3300037466 | Bacteria | 1366 |
| 835 | Ga0395898_0370779 | 3300037466 | Bacteria | 1365 |
| 836 | Ga0395898_0424408 | 3300037466 | Bacteria | 1267 |
| 837 | Ga0395898_0455951 | 3300037466 | Bacteria | 1217 |
| 838 | Ga0395898_0672639 | 3300037466 | Bacteria | 977 |
| 839 | Ga0395905_0000615 | 3300037471 | Bacteria | 47752 |
| 840 | Ga0395905_0001573 | 3300037471 | Bacteria | 27258 |
| 841 | Ga0395905_0004096 | 3300037471 | Bacteria | 15274 |
| 842 | Ga0395905_0006308 | 3300037471 | Bacteria | 11958 |
| 843 | Ga0395905_0006717 | 3300037471 | Bacteria | 11518 |
| 844 | Ga0395905_0013697 | 3300037471 | Bacteria | 7765 |
| 845 | Ga0395905_0021395 | 3300037471 | Bacteria | 6117 |
| 846 | Ga0395905_0043580 | 3300037471 | Bacteria | 4209 |
| 847 | Ga0395905_0053744 | 3300037471 | Bacteria | 3769 |
| 848 | Ga0395905_0067743 | 3300037471 | Bacteria | 3343 |
| 849 | Ga0395905_0091745 | 3300037471 | Bacteria | 2848 |
| 850 | Ga0395905_0116819 | 3300037471 | Bacteria | 2507 |
| 851 | Ga0395905_0146366 | 3300037471 | Bacteria | 2222 |
| 852 | Ga0395905_0161816 | 3300037471 | Bacteria | 2103 |
| 853 | Ga0395905_0215907 | 3300037471 | Bacteria | 1796 |
| 854 | Ga0395905_0650318 | 3300037471 | Bacteria | 956 |
| 855 | Ga0395905_0755800 | 3300037471 | Bacteria | 875 |
| 856 | Ga0395905_0883556 | 3300037471 | Unclassified | 797 |
| 857 | Ga0395905_0958680 | 3300037471 | Bacteria | 758 |
| 858 | Ga0395901_0001769 | 3300038443 | Bacteria | 22292 |
| 859 | Ga0395901_0003610 | 3300038443 | Bacteria | 15604 |
| 860 | Ga0395901_0004266 | 3300038443 | Bacteria | 14419 |
| 861 | Ga0395901_0005433 | 3300038443 | Bacteria | 12895 |
| 862 | Ga0395901_0007585 | 3300038443 | Bacteria | 10960 |
| 863 | Ga0395901_0016950 | 3300038443 | Bacteria | 7425 |
| 864 | Ga0395901_0026811 | 3300038443 | Bacteria | 5917 |
| 865 | Ga0395901_0032519 | 3300038443 | Bacteria | 5381 |
| 866 | Ga0395901_0041499 | 3300038443 | Bacteria | 4769 |
| 867 | Ga0395901_0043878 | 3300038443 | Bacteria | 4637 |
| 868 | Ga0395901_0044425 | 3300038443 | Bacteria | 4608 |
| 869 | Ga0395901_0053962 | 3300038443 | Bacteria | 4177 |
| 870 | Ga0395901_0070288 | 3300038443 | Bacteria | 3647 |
| 871 | Ga0395901_0074676 | 3300038443 | Bacteria | 3537 |
| 872 | Ga0395901_0077102 | 3300038443 | Bacteria | 3479 |
| 873 | Ga0395901_0109540 | 3300038443 | Bacteria | 2899 |
| 874 | Ga0395901_0111707 | 3300038443 | Bacteria | 2870 |
| 875 | Ga0395901_0115402 | 3300038443 | Bacteria | 2821 |
| 876 | Ga0395901_0144427 | 3300038443 | Bacteria | 2501 |
| 877 | Ga0395901_0148589 | 3300038443 | Bacteria | 2462 |
| 878 | Ga0395901_0160209 | 3300038443 | Bacteria | 2363 |
| 879 | Ga0395901_0198258 | 3300038443 | Bacteria | 2104 |
| 880 | Ga0395901_0240051 | 3300038443 | Bacteria | 1890 |
| 881 | Ga0395901_0257393 | 3300038443 | Bacteria | 1817 |
| 882 | Ga0395901_0322862 | 3300038443 | Bacteria | 1597 |
| 883 | Ga0395901_0344006 | 3300038443 | Bacteria | 1540 |
| 884 | Ga0395901_0347435 | 3300038443 | Bacteria | 1531 |
| 885 | Ga0395901_0518269 | 3300038443 | Bacteria | 1212 |
| 886 | Ga0395901_0537790 | 3300038443 | Bacteria | 1185 |
| 887 | Ga0395901_0549247 | 3300038443 | Bacteria | 1171 |
| 888 | Ga0395901_0906463 | 3300038443 | Bacteria | 863 |
| 889 | Ga0395901_1279485 | 3300038443 | Bacteria | 696 |
| 890 | Ga0242420_037274 | 3300038996 | Bacteria | 920 |
| 891 | Ga0439466_0141176 | 3300041411 | Bacteria | 739 |
| 892 | Ga0451797_1467611 | 3300041453 | Bacteria | 1567 |
| 893 | Ga0451802_1691267 | 3300041460 | Bacteria | 2981 |
| 894 | Ga0451807_0097819 | 3300041486 | Bacteria | 1011 |
| 895 | Ga0451807_1241121 | 3300041486 | Bacteria | 1002 |
| 896 | Ga0451835_0553222 | 3300041492 | Bacteria | 892 |
| 897 | Ga0451837_1655606 | 3300041494 | Bacteria | 767 |
| 898 | Ga0451841_0721472 | 3300041498 | Bacteria | 642 |
| 899 | Ga0451845_0409218 | 3300041501 | Bacteria | 3231 |
| 900 | Ga0451845_0836332 | 3300041501 | Bacteria | 665 |
| 901 | Ga0451847_0806778 | 3300041503 | Bacteria | 921 |
| 902 | Ga0451851_0166059 | 3300041507 | Bacteria | 1317 |
| 903 | Ga0451853_0059875 | 3300041512 | Bacteria | 1259 |
| 904 | Ga0451853_1772707 | 3300041512 | Bacteria | 742 |
| 905 | Ga0451853_1946777 | 3300041512 | Bacteria | 770 |
| 906 | Ga0439450_017884 | 3300042008 | Bacteria | 1483 |
| 907 | Ga0439451_001152 | 3300042009 | Bacteria | 5186 |
| 908 | Ga0439454_007894 | 3300042011 | Bacteria | 1346 |
| 909 | Ga0439456_035532 | 3300042013 | Bacteria | 1074 |
| 910 | Ga0439463_053845 | 3300042016 | Bacteria | 1027 |
| 911 | Ga0439458_0060804 | 3300042157 | Bacteria | 943 |
| 912 | Ga0439435_0014525 | 3300042436 | Bacteria | 1947 |
| 913 | Ga0439459_0131606 | 3300042438 | Bacteria | 639 |
| 914 | Ga0450918_031663 | 3300042531 | Bacteria | 935 |
| 915 | Ga0439440_0057277 | 3300042993 | Bacteria | 987 |
| 916 | Ga0439440_0058500 | 3300042993 | Bacteria | 979 |
| 917 | Ga0466969_0008738 | 3300044656 | Bacteria | 5369 |
| 918 | Ga0466966_0044626 | 3300044684 | Bacteria | 2837 |
| 919 | Ga0466961_0002904 | 3300044693 | Bacteria | 10634 |
| 920 | Ga0466961_0212730 | 3300044693 | Bacteria | 1193 |
| 921 | Ga0466963_0004919 | 3300044694 | Bacteria | 7791 |
| 922 | Ga0466964_0007241 | 3300044706 | Bacteria | 4147 |
| 923 | Ga0466964_0009363 | 3300044706 | Bacteria | 3687 |
| 924 | Ga0466971_0002968 | 3300044719 | Bacteria | 7201 |
| 925 | Ga0466968_0041210 | 3300044735 | Bacteria | 1948 |
| 926 | Ga0466957_0001419 | 3300044842 | Bacteria | 12506 |
| 927 | Ga0466957_0104398 | 3300044842 | Bacteria | 1790 |
| 928 | Ga0466960_0041957 | 3300044901 | Bacteria | 2170 |
| 929 | Ga0466960_0060342 | 3300044901 | Bacteria | 1858 |
| 930 | Ga0466960_0065705 | 3300044901 | Bacteria | 1792 |
| 931 | Ga0466959_0017850 | 3300045049 | Bacteria | 5204 |
| 932 | Ga0466959_0107958 | 3300045049 | Bacteria | 1989 |
| 933 | Ga0451576_0031312 | 3300045051 | Bacteria | 5674 |
| 934 | Ga0451576_0085404 | 3300045051 | Bacteria | 3283 |
| 935 | Ga0451576_0602839 | 3300045051 | Bacteria | 1154 |
| 936 | Ga0466958_0024666 | 3300045836 | Bacteria | 3538 |
| 937 | Ga0466967_0008294 | 3300045976 | Bacteria | 7594 |
| 938 | Ga0466967_0050785 | 3300045976 | Bacteria | 3632 |
| 939 | Ga0466967_0065595 | 3300045976 | Bacteria | 3232 |
| 940 | Ga0466967_0069917 | 3300045976 | Bacteria | 3139 |
| 941 | Ga0466967_0105251 | 3300045976 | Bacteria | 2584 |
| 942 | Ga0495603_0001254 | 3300046455 | Bacteria | 14805 |
| 943 | Ga0495603_0003282 | 3300046455 | Bacteria | 9635 |
| 944 | Ga0495603_0023879 | 3300046455 | Bacteria | 3699 |
| 945 | Ga0495590_0024229 | 3300046457 | Bacteria | 2139 |
| 946 | Ga0495641_0109720 | 3300046461 | Bacteria | 1231 |
| 947 | Ga0495641_0196017 | 3300046461 | Bacteria | 905 |
| 948 | Ga0495651_0100866 | 3300046462 | Bacteria | 2150 |
| 949 | Ga0495651_0439136 | 3300046462 | Bacteria | 845 |
| 950 | Ga0495653_0384614 | 3300046463 | Bacteria | 895 |
| 951 | Ga0495580_0012092 | 3300046472 | Bacteria | 6643 |
| 952 | Ga0495580_0139618 | 3300046472 | Bacteria | 1680 |
| 953 | Ga0495580_0287843 | 3300046472 | Bacteria | 1120 |
| 954 | Ga0495582_0013109 | 3300046473 | Bacteria | 4564 |
| 955 | Ga0495582_0029479 | 3300046473 | Bacteria | 3013 |
| 956 | Ga0495582_0041400 | 3300046473 | Bacteria | 2538 |
| 957 | Ga0495582_0110975 | 3300046473 | Bacteria | 1540 |
| 958 | Ga0495582_0166991 | 3300046473 | Bacteria | 1252 |
| 959 | Ga0495605_0061978 | 3300046474 | Bacteria | 1788 |
| 960 | Ga0495605_0105608 | 3300046474 | Bacteria | 1290 |
| 961 | Ga0495605_0226410 | 3300046474 | Bacteria | 807 |
| 962 | Ga0495639_0076679 | 3300046475 | Bacteria | 1551 |
| 963 | Ga0495639_0130695 | 3300046475 | Bacteria | 1202 |
| 964 | Ga0495639_0191375 | 3300046475 | Bacteria | 999 |
| 965 | Ga0495662_0101690 | 3300046476 | Bacteria | 1406 |
| 966 | Ga0495662_0136006 | 3300046476 | Bacteria | 1209 |
| 967 | Ga0495584_0039360 | 3300046491 | Bacteria | 2388 |
| 968 | Ga0495584_0055836 | 3300046491 | Bacteria | 1987 |
| 969 | Ga0495584_0119056 | 3300046491 | Bacteria | 1337 |
| 970 | Ga0495584_0245294 | 3300046491 | Bacteria | 911 |
| 971 | Ga0495584_0265287 | 3300046491 | Bacteria | 873 |
| 972 | Ga0495584_0372423 | 3300046491 | Bacteria | 725 |
| 973 | Ga0495584_0374782 | 3300046491 | Bacteria | 723 |
| 974 | Ga0495585_0111025 | 3300046492 | Bacteria | 1458 |
| 975 | Ga0495594_0001015 | 3300046499 | Bacteria | 14642 |
| 976 | Ga0495594_0081585 | 3300046499 | Bacteria | 1806 |
| 977 | Ga0495594_0139143 | 3300046499 | Bacteria | 1376 |
| 978 | Ga0495596_0006468 | 3300046500 | Bacteria | 5386 |
| 979 | Ga0495596_0020797 | 3300046500 | Bacteria | 2684 |
| 980 | Ga0495596_0109322 | 3300046500 | Bacteria | 1073 |
| 981 | Ga0495596_0121433 | 3300046500 | Bacteria | 1014 |
| 982 | Ga0495596_0155298 | 3300046500 | Bacteria | 889 |
| 983 | Ga0495607_0075484 | 3300046501 | Bacteria | 1868 |
| 984 | Ga0495607_0200402 | 3300046501 | Bacteria | 988 |
| 985 | Ga0495583_0065757 | 3300046506 | Bacteria | 1606 |
| 986 | Ga0495608_0129760 | 3300046511 | Bacteria | 1614 |
| 987 | Ga0495608_0332954 | 3300046511 | Bacteria | 936 |
| 988 | Ga0495618_0066311 | 3300046514 | Bacteria | 2295 |
| 989 | Ga0495628_0365518 | 3300046516 | Bacteria | 1059 |
| 990 | Ga0495631_0016892 | 3300046518 | Bacteria | 3465 |
| 991 | Ga0495631_0075870 | 3300046518 | Bacteria | 1451 |
| 992 | Ga0495632_0095490 | 3300046519 | Bacteria | 1405 |
| 993 | Ga0495643_0126590 | 3300046522 | Bacteria | 1286 |
| 994 | Ga0495643_0341351 | 3300046522 | Bacteria | 673 |
| 995 | Ga0495663_0078791 | 3300046525 | Bacteria | 1058 |
| 996 | Ga0495642_0040091 | 3300046528 | Bacteria | 1901 |
| 997 | Ga0495642_0104273 | 3300046528 | Bacteria | 1209 |
| 998 | Ga0495642_0124226 | 3300046528 | Bacteria | 1108 |
| 999 | Ga0495652_0146936 | 3300046529 | Bacteria | 1847 |
| 1000 | Ga0495652_0276861 | 3300046529 | Bacteria | 1230 |
| 1001 | Ga0495652_0458653 | 3300046529 | Bacteria | 891 |
| 1002 | Ga0495654_0128817 | 3300046530 | Bacteria | 1138 |
| 1003 | Ga0495640_0428603 | 3300046533 | Bacteria | 810 |
| 1004 | Ga0495609_0054642 | 3300046538 | Bacteria | 1773 |
| 1005 | Ga0495609_0082046 | 3300046538 | Bacteria | 1409 |
| 1006 | Ga0495609_0088536 | 3300046538 | Bacteria | 1348 |
| 1007 | Ga0495609_0090278 | 3300046538 | Bacteria | 1332 |
| 1008 | Ga0495667_0088977 | 3300046559 | Bacteria | 2002 |
| 1009 | Ga0495656_0024249 | 3300046615 | Bacteria | 2394 |
| 1010 | Ga0495656_0072547 | 3300046615 | Bacteria | 1533 |
| 1011 | Ga0495656_0085206 | 3300046615 | Bacteria | 1435 |
| 1012 | Ga0495656_0132548 | 3300046615 | Bacteria | 1187 |
| 1013 | Ga0495656_0133226 | 3300046615 | Bacteria | 1185 |
| 1014 | Ga0495656_0220716 | 3300046615 | Bacteria | 948 |
| 1015 | Ga0495656_0435519 | 3300046615 | Bacteria | 689 |
| 1016 | Ga0495668_0073557 | 3300046616 | Bacteria | 1877 |
| 1017 | Ga0495668_0105446 | 3300046616 | Bacteria | 1542 |
| 1018 | Ga0495668_0268413 | 3300046616 | Bacteria | 934 |
| 1019 | Ga0495634_0196208 | 3300046642 | Bacteria | 1256 |
| 1020 | Ga0495611_0137121 | 3300046648 | Bacteria | 1142 |
| 1021 | Ga0495635_0074043 | 3300046663 | Bacteria | 2333 |
| 1022 | Ga0495659_0011728 | 3300046664 | Bacteria | 2826 |
| 1023 | Ga0495661_0264446 | 3300046665 | Bacteria | 873 |
| 1024 | Ga0495588_0000696 | 3300046674 | Bacteria | 15520 |
| 1025 | Ga0495588_0126094 | 3300046674 | Bacteria | 1350 |
| 1026 | Ga0495588_0171507 | 3300046674 | Unclassified | 1147 |
| 1027 | Ga0495588_0185277 | 3300046674 | Bacteria | 1100 |
| 1028 | Ga0495588_0410337 | 3300046674 | Bacteria | 711 |
| 1029 | Ga0495623_0221074 | 3300046679 | Bacteria | 1079 |
| 1030 | Ga0495646_0165256 | 3300046680 | Bacteria | 1223 |
| 1031 | Ga0495646_0200524 | 3300046680 | Bacteria | 1087 |
| 1032 | Ga0495647_0022377 | 3300046681 | Bacteria | 2283 |
| 1033 | Ga0495647_0145540 | 3300046681 | Bacteria | 1013 |
| 1034 | Ga0495658_0027545 | 3300046683 | Bacteria | 3059 |
| 1035 | Ga0495658_0065955 | 3300046683 | Bacteria | 2090 |
| 1036 | Ga0495658_0103135 | 3300046683 | Bacteria | 1705 |
| 1037 | Ga0495669_0077715 | 3300046684 | Bacteria | 1520 |
| 1038 | Ga0495613_0059074 | 3300046689 | Bacteria | 2812 |
| 1039 | Ga0495613_0449472 | 3300046689 | Bacteria | 873 |
| 1040 | Ga0495624_0188782 | 3300046690 | Bacteria | 1254 |
| 1041 | Ga0495670_0064403 | 3300046691 | Bacteria | 1847 |
| 1042 | Ga0495670_0209509 | 3300046691 | Bacteria | 1034 |
| 1043 | Ga0495670_0267663 | 3300046691 | Bacteria | 913 |
| 1044 | Ga0495671_0096092 | 3300046692 | Bacteria | 1450 |
| 1045 | Ga0495589_0007188 | 3300046794 | Bacteria | 5832 |
| 1046 | Ga0495589_0217316 | 3300046794 | Bacteria | 899 |
| 1047 | Ga0495589_0258599 | 3300046794 | Bacteria | 812 |
| 1048 | Ga0495600_0105092 | 3300046809 | Bacteria | 1840 |
| 1049 | Ga0495581_0003961 | 3300047315 | Bacteria | 8531 |
| 1050 | Ga0495581_0005721 | 3300047315 | Bacteria | 7209 |
| 1051 | Ga0495581_0350081 | 3300047315 | Bacteria | 862 |
| 1052 | Ga0495604_0057660 | 3300047317 | Bacteria | 2986 |
| 1053 | Ga0495636_0023358 | 3300047318 | Bacteria | 2503 |
| 1054 | Ga0495636_0089618 | 3300047318 | Bacteria | 1334 |
| 1055 | Ga0495674_0029754 | 3300047319 | Bacteria | 4969 |
| 1056 | Ga0495674_0041452 | 3300047319 | Bacteria | 4112 |
| 1057 | Ga0495674_0698396 | 3300047319 | Bacteria | 796 |
| 1058 | Ga0495676_0000879 | 3300047321 | Bacteria | 25087 |
| 1059 | Ga0495676_0064108 | 3300047321 | Bacteria | 2860 |
| 1060 | Ga0495676_0111355 | 3300047321 | Bacteria | 2008 |
| 1061 | Ga0495676_0182105 | 3300047321 | Bacteria | 1472 |
| 1062 | Ga0495676_0500821 | 3300047321 | Bacteria | 797 |
| 1063 | Ga0495683_0053927 | 3300047323 | Bacteria | 2005 |
| 1064 | Ga0495683_0208760 | 3300047323 | Bacteria | 877 |
| 1065 | Ga0495675_0102645 | 3300047444 | Bacteria | 1789 |
| 1066 | Ga0495677_0038650 | 3300047445 | Bacteria | 1744 |
| 1067 | Ga0495677_0042134 | 3300047445 | Bacteria | 1672 |
| 1068 | Ga0495677_0107510 | 3300047445 | Bacteria | 1059 |
| 1069 | Ga0495679_046866 | 3300047446 | Bacteria | 1314 |
| 1070 | Ga0495685_022123 | 3300047447 | Bacteria | 2188 |
| 1071 | Ga0495685_105429 | 3300047447 | Bacteria | 930 |
| 1072 | Ga0495684_0041444 | 3300047471 | Bacteria | 3529 |
| 1073 | Ga0495684_0104319 | 3300047471 | Bacteria | 2142 |
| 1074 | Ga0495626_0040809 | 3300048091 | Bacteria | 2190 |
| 1075 | Ga0496100_0009888 | 3300048903 | Bacteria | 5375 |
| 1076 | Ga0496100_0016648 | 3300048903 | Bacteria | 4322 |
| 1077 | Ga0496100_0037077 | 3300048903 | Bacteria | 3079 |
| 1078 | Ga0496100_0161319 | 3300048903 | Bacteria | 1607 |
| 1079 | Ga0496100_0193023 | 3300048903 | Bacteria | 1480 |
| 1080 | Ga0496100_0336058 | 3300048903 | Bacteria | 1138 |
| 1081 | Ga0496100_0439557 | 3300048903 | Bacteria | 999 |
| 1082 | Ga0496100_0585981 | 3300048903 | Bacteria | 865 |
| 1083 | Ga0496101_0027209 | 3300048904 | Bacteria | 3981 |
| 1084 | Ga0496101_0033793 | 3300048904 | Bacteria | 3609 |
| 1085 | Ga0496101_0133993 | 3300048904 | Bacteria | 1883 |
| 1086 | Ga0496101_0154747 | 3300048904 | Bacteria | 1755 |
| 1087 | Ga0496101_0194943 | 3300048904 | Bacteria | 1564 |
| 1088 | Ga0496101_0295644 | 3300048904 | Bacteria | 1267 |
| 1089 | Ga0496101_0449761 | 3300048904 | Bacteria | 1016 |
| 1090 | Ga0496101_0518280 | 3300048904 | Bacteria | 942 |
| 1091 | Ga0496101_0807692 | 3300048904 | Bacteria | 740 |
| 1092 | Ga0496102_0007258 | 3300048905 | Bacteria | 9459 |
| 1093 | Ga0496102_0066625 | 3300048905 | Bacteria | 3300 |
| 1094 | Ga0496102_0076345 | 3300048905 | Bacteria | 3082 |
| 1095 | Ga0496102_0111461 | 3300048905 | Bacteria | 2551 |
| 1096 | Ga0496102_0178625 | 3300048905 | Bacteria | 1999 |
| 1097 | Ga0496102_0220104 | 3300048905 | Bacteria | 1789 |
| 1098 | Ga0496102_0222257 | 3300048905 | Bacteria | 1780 |
| 1099 | Ga0496102_0636828 | 3300048905 | Bacteria | 989 |
| 1100 | Ga0496102_1092784 | 3300048905 | Bacteria | 717 |
| 1101 | Ga0496103_0007528 | 3300048906 | Bacteria | 6491 |
| 1102 | Ga0496103_0015734 | 3300048906 | Bacteria | 4509 |
| 1103 | Ga0496103_0021459 | 3300048906 | Bacteria | 3885 |
| 1104 | Ga0496103_0040061 | 3300048906 | Bacteria | 2879 |
| 1105 | Ga0496103_0079096 | 3300048906 | Bacteria | 2066 |
| 1106 | Ga0496103_0337717 | 3300048906 | Bacteria | 969 |
| 1107 | Ga0496104_0000568 | 3300048907 | Bacteria | 31543 |
| 1108 | Ga0496104_0010563 | 3300048907 | Bacteria | 8246 |
| 1109 | Ga0496104_0043904 | 3300048907 | Bacteria | 4199 |
| 1110 | Ga0496104_0059519 | 3300048907 | Bacteria | 3616 |
| 1111 | Ga0496104_0137477 | 3300048907 | Bacteria | 2347 |
| 1112 | Ga0496104_0226148 | 3300048907 | Bacteria | 1783 |
| 1113 | Ga0496104_0399615 | 3300048907 | Bacteria | 1286 |
| 1114 | Ga0496104_0819904 | 3300048907 | Bacteria | 836 |
| 1115 | Ga0496105_0000457 | 3300048908 | Bacteria | 26876 |
| 1116 | Ga0496105_0002396 | 3300048908 | Bacteria | 13566 |
| 1117 | Ga0496105_0004767 | 3300048908 | Bacteria | 10237 |
| 1118 | Ga0496105_0005072 | 3300048908 | Bacteria | 9976 |
| 1119 | Ga0496105_0006996 | 3300048908 | Bacteria | 8689 |
| 1120 | Ga0496105_0007239 | 3300048908 | Bacteria | 8570 |
| 1121 | Ga0496105_0022270 | 3300048908 | Bacteria | 5131 |
| 1122 | Ga0496105_0108306 | 3300048908 | Bacteria | 2294 |
| 1123 | Ga0496105_0239933 | 3300048908 | Bacteria | 1471 |
| 1124 | Ga0496105_0621179 | 3300048908 | Bacteria | 837 |
| 1125 | Ga0496106_0003674 | 3300048909 | Bacteria | 11434 |
| 1126 | Ga0496106_0012382 | 3300048909 | Bacteria | 6297 |
| 1127 | Ga0496106_0072295 | 3300048909 | Bacteria | 2637 |
| 1128 | Ga0496106_0085511 | 3300048909 | Bacteria | 2428 |
| 1129 | Ga0496106_0116674 | 3300048909 | Bacteria | 2083 |
| 1130 | Ga0496106_0167030 | 3300048909 | Bacteria | 1742 |
| 1131 | Ga0496106_0622079 | 3300048909 | Bacteria | 864 |
| 1132 | Ga0496107_0004641 | 3300048910 | Bacteria | 9318 |
| 1133 | Ga0496107_0043346 | 3300048910 | Bacteria | 3232 |
| 1134 | Ga0496107_0046988 | 3300048910 | Bacteria | 3107 |
| 1135 | Ga0496107_0182871 | 3300048910 | Bacteria | 1556 |
| 1136 | Ga0496107_0231764 | 3300048910 | Bacteria | 1374 |
| 1137 | Ga0496107_0258061 | 3300048910 | Bacteria | 1297 |
| 1138 | Ga0496107_0882661 | 3300048910 | Bacteria | 652 |
| 1139 | Ga0496108_0002627 | 3300048911 | Bacteria | 14398 |
| 1140 | Ga0496108_0006684 | 3300048911 | Bacteria | 9338 |
| 1141 | Ga0496108_0024613 | 3300048911 | Bacteria | 4957 |
| 1142 | Ga0496108_0026971 | 3300048911 | Bacteria | 4740 |
| 1143 | Ga0496108_0030460 | 3300048911 | Bacteria | 4472 |
| 1144 | Ga0496108_0122697 | 3300048911 | Bacteria | 2229 |
| 1145 | Ga0496108_0207247 | 3300048911 | Bacteria | 1701 |
| 1146 | Ga0496108_0319801 | 3300048911 | Bacteria | 1353 |
| 1147 | Ga0496108_0346431 | 3300048911 | Bacteria | 1296 |
| 1148 | Ga0496108_0388697 | 3300048911 | Bacteria | 1218 |
| 1149 | Ga0496109_0002827 | 3300048912 | Bacteria | 14545 |
| 1150 | Ga0496109_0007630 | 3300048912 | Bacteria | 9173 |
| 1151 | Ga0496109_0008726 | 3300048912 | Bacteria | 8630 |
| 1152 | Ga0496109_0008994 | 3300048912 | Bacteria | 8504 |
| 1153 | Ga0496109_0014010 | 3300048912 | Bacteria | 6970 |
| 1154 | Ga0496109_0015471 | 3300048912 | Bacteria | 6649 |
| 1155 | Ga0496109_0059306 | 3300048912 | Bacteria | 3496 |
| 1156 | Ga0496109_0102525 | 3300048912 | Bacteria | 2655 |
| 1157 | Ga0496109_0102667 | 3300048912 | Bacteria | 2654 |
| 1158 | Ga0496109_0105412 | 3300048912 | Bacteria | 2618 |
| 1159 | Ga0496109_0139385 | 3300048912 | Bacteria | 2267 |
| 1160 | Ga0496109_0272041 | 3300048912 | Bacteria | 1596 |
| 1161 | Ga0496109_0335251 | 3300048912 | Bacteria | 1428 |
| 1162 | Ga0496109_0463888 | 3300048912 | Bacteria | 1196 |
| 1163 | Ga0496109_0709289 | 3300048912 | Bacteria | 943 |
| 1164 | Ga0496110_0000054 | 3300048913 | Bacteria | 57987 |
| 1165 | Ga0496110_0000980 | 3300048913 | Bacteria | 20040 |
| 1166 | Ga0496110_0019346 | 3300048913 | Bacteria | 5728 |
| 1167 | Ga0496110_0020491 | 3300048913 | Bacteria | 5584 |
| 1168 | Ga0496110_0073489 | 3300048913 | Bacteria | 3034 |
| 1169 | Ga0496110_0216320 | 3300048913 | Bacteria | 1742 |
| 1170 | Ga0496111_0000156 | 3300048914 | Bacteria | 30445 |
| 1171 | Ga0496111_0000243 | 3300048914 | Bacteria | 26096 |
| 1172 | Ga0496111_0013181 | 3300048914 | Bacteria | 5621 |
| 1173 | Ga0496111_0020816 | 3300048914 | Bacteria | 4573 |
| 1174 | Ga0496111_0039385 | 3300048914 | Bacteria | 3388 |
| 1175 | Ga0496111_0082287 | 3300048914 | Bacteria | 2351 |
| 1176 | Ga0496111_0134640 | 3300048914 | Bacteria | 1830 |
| 1177 | Ga0496112_0000300 | 3300048915 | Bacteria | 31936 |
| 1178 | Ga0496112_0025114 | 3300048915 | Bacteria | 5717 |
| 1179 | Ga0496112_0035423 | 3300048915 | Bacteria | 4862 |
| 1180 | Ga0496112_0040341 | 3300048915 | Bacteria | 4564 |
| 1181 | Ga0496112_0051694 | 3300048915 | Bacteria | 4031 |
| 1182 | Ga0496112_0053844 | 3300048915 | Bacteria | 3952 |
| 1183 | Ga0496112_0058787 | 3300048915 | Bacteria | 3787 |
| 1184 | Ga0496112_0113776 | 3300048915 | Bacteria | 2676 |
| 1185 | Ga0496112_0136060 | 3300048915 | Bacteria | 2427 |
| 1186 | Ga0496112_0587901 | 3300048915 | Bacteria | 1046 |
| 1187 | Ga0496112_0762430 | 3300048915 | Bacteria | 893 |
| 1188 | Ga0496113_0000275 | 3300048916 | Bacteria | 24381 |
| 1189 | Ga0496113_0041747 | 3300048916 | Bacteria | 3387 |
| 1190 | Ga0496113_0063608 | 3300048916 | Bacteria | 2788 |
| 1191 | Ga0496113_0089816 | 3300048916 | Bacteria | 2365 |
| 1192 | Ga0496114_0005825 | 3300048917 | Bacteria | 9676 |
| 1193 | Ga0496114_0008296 | 3300048917 | Bacteria | 8231 |
| 1194 | Ga0496114_0011918 | 3300048917 | Bacteria | 6957 |
| 1195 | Ga0496114_0028280 | 3300048917 | Bacteria | 4599 |
| 1196 | Ga0496114_0031921 | 3300048917 | Bacteria | 4333 |
| 1197 | Ga0496114_0034894 | 3300048917 | Bacteria | 4153 |
| 1198 | Ga0496114_0068918 | 3300048917 | Bacteria | 2970 |
| 1199 | Ga0496114_0082235 | 3300048917 | Bacteria | 2722 |
| 1200 | Ga0496114_0154982 | 3300048917 | Bacteria | 1989 |
| 1201 | Ga0496114_0221721 | 3300048917 | Bacteria | 1660 |
| 1202 | Ga0496114_0390771 | 3300048917 | Bacteria | 1232 |
| 1203 | Ga0496114_0438688 | 3300048917 | Bacteria | 1156 |
| 1204 | Ga0496114_0495874 | 3300048917 | Bacteria | 1080 |
| 1205 | Ga0496114_0512216 | 3300048917 | Bacteria | 1061 |
| 1206 | Ga0496114_0843231 | 3300048917 | Bacteria | 796 |
| 1207 | Ga0496115_0008732 | 3300048918 | Bacteria | 7511 |
| 1208 | Ga0496115_0021128 | 3300048918 | Bacteria | 5024 |
| 1209 | Ga0496115_0033634 | 3300048918 | Bacteria | 4048 |
| 1210 | Ga0496115_0038218 | 3300048918 | Bacteria | 3808 |
| 1211 | Ga0496115_0092162 | 3300048918 | Bacteria | 2477 |
| 1212 | Ga0496115_0099710 | 3300048918 | Bacteria | 2380 |
| 1213 | Ga0496115_0116868 | 3300048918 | Bacteria | 2194 |
| 1214 | Ga0496115_0135960 | 3300048918 | Bacteria | 2027 |
| 1215 | Ga0496115_0225347 | 3300048918 | Bacteria | 1546 |
| 1216 | Ga0496115_0637962 | 3300048918 | Bacteria | 843 |
| 1217 | Ga0501031_0137555 | 3300049568 | Bacteria | 1596 |
| 1218 | Ga0501033_0011314 | 3300049570 | Bacteria | 6831 |
| 1219 | Ga0501033_0153639 | 3300049570 | Bacteria | 1659 |
| 1220 | Ga0501034_0709802 | 3300049571 | Bacteria | 904 |
| 1221 | Ga0501036_0064525 | 3300049572 | Bacteria | 3099 |
| 1222 | Ga0501036_0099881 | 3300049572 | Bacteria | 2454 |
| 1223 | Ga0501036_0192735 | 3300049572 | Bacteria | 1715 |
| 1224 | Ga0501036_0243293 | 3300049572 | Bacteria | 1509 |
| 1225 | Ga0501036_0643714 | 3300049572 | Bacteria | 878 |
| 1226 | Ga0501037_0135447 | 3300049573 | Bacteria | 1764 |
| 1227 | Ga0501037_0156962 | 3300049573 | Bacteria | 1623 |
| 1228 | Ga0501037_0191287 | 3300049573 | Bacteria | 1449 |
| 1229 | Ga0501037_0465709 | 3300049573 | Bacteria | 861 |
| 1230 | Ga0501038_0002835 | 3300049574 | Bacteria | 16133 |
| 1231 | Ga0501039_0002978 | 3300049575 | Bacteria | 12671 |
| 1232 | Ga0501039_0034693 | 3300049575 | Bacteria | 3892 |
| 1233 | Ga0501039_0297314 | 3300049575 | Bacteria | 1269 |
| 1234 | Ga0501039_0458766 | 3300049575 | Bacteria | 1001 |
| 1235 | Ga0501040_0003917 | 3300049576 | Bacteria | 9661 |
| 1236 | Ga0501040_0056074 | 3300049576 | Bacteria | 2703 |
| 1237 | Ga0501040_0160636 | 3300049576 | Bacteria | 1588 |
| 1238 | Ga0501041_0007132 | 3300049577 | Bacteria | 6556 |
| 1239 | Ga0501041_0013352 | 3300049577 | Bacteria | 4867 |
| 1240 | Ga0501041_0109467 | 3300049577 | Bacteria | 1714 |
| 1241 | Ga0501041_0155772 | 3300049577 | Bacteria | 1427 |
| 1242 | Ga0501041_0242916 | 3300049577 | Bacteria | 1132 |
| 1243 | Ga0501042_0034401 | 3300049578 | Bacteria | 3593 |
| 1244 | Ga0501042_0160716 | 3300049578 | Bacteria | 1621 |
| 1245 | Ga0501042_0349905 | 3300049578 | Bacteria | 1069 |
| 1246 | Ga0501042_0372307 | 3300049578 | Bacteria | 1034 |
| 1247 | Ga0501046_0170685 | 3300049580 | Bacteria | 1633 |
| 1248 | Ga0501047_0056961 | 3300049581 | Bacteria | 3780 |
| 1249 | Ga0501047_0113994 | 3300049581 | Bacteria | 2585 |
| 1250 | Ga0501047_0489799 | 3300049581 | Bacteria | 1057 |
| 1251 | Ga0501048_0002599 | 3300049582 | Bacteria | 13837 |
| 1252 | Ga0501048_0019984 | 3300049582 | Bacteria | 4911 |
| 1253 | Ga0501048_0030138 | 3300049582 | Bacteria | 3928 |
| 1254 | Ga0501048_0258234 | 3300049582 | Bacteria | 1238 |
| 1255 | Ga0501048_0466049 | 3300049582 | Bacteria | 905 |
| 1256 | Ga0501067_0006992 | 3300049583 | Bacteria | 6262 |
| 1257 | Ga0501067_0019921 | 3300049583 | Bacteria | 3711 |
| 1258 | Ga0501067_0070099 | 3300049583 | Bacteria | 1941 |
| 1259 | Ga0501067_0075307 | 3300049583 | Bacteria | 1870 |
| 1260 | Ga0501067_0167565 | 3300049583 | Bacteria | 1223 |
| 1261 | Ga0501067_0260032 | 3300049583 | Bacteria | 966 |
| 1262 | Ga0501068_0016659 | 3300049584 | Bacteria | 4238 |
| 1263 | Ga0501068_0034780 | 3300049584 | Bacteria | 3006 |
| 1264 | Ga0501068_0178574 | 3300049584 | Bacteria | 1342 |
| 1265 | Ga0501069_0027406 | 3300049585 | Bacteria | 3122 |
| 1266 | Ga0501069_0031671 | 3300049585 | Bacteria | 2910 |
| 1267 | Ga0501069_0082803 | 3300049585 | Bacteria | 1808 |
| 1268 | Ga0501069_0406856 | 3300049585 | Bacteria | 806 |
| 1269 | Ga0501070_0049461 | 3300049586 | Bacteria | 3491 |
| 1270 | Ga0501070_0160124 | 3300049586 | Bacteria | 1856 |
| 1271 | Ga0501070_0639710 | 3300049586 | Bacteria | 845 |
| 1272 | Ga0501071_0002211 | 3300049587 | Bacteria | 11702 |
| 1273 | Ga0501071_0049718 | 3300049587 | Bacteria | 3019 |
| 1274 | Ga0501071_0066101 | 3300049587 | Bacteria | 2627 |
| 1275 | Ga0501071_0103252 | 3300049587 | Bacteria | 2103 |
| 1276 | Ga0501071_0116465 | 3300049587 | Bacteria | 1978 |
| 1277 | Ga0501071_0497897 | 3300049587 | Bacteria | 935 |
| 1278 | Ga0501072_0011137 | 3300049588 | Bacteria | 6863 |
| 1279 | Ga0501072_0080055 | 3300049588 | Bacteria | 2587 |
| 1280 | Ga0501072_0136297 | 3300049588 | Bacteria | 1957 |
| 1281 | Ga0501072_0313160 | 3300049588 | Bacteria | 1247 |
| 1282 | Ga0501072_0627938 | 3300049588 | Bacteria | 846 |
| 1283 | Ga0501074_0007610 | 3300049590 | Bacteria | 7840 |
| 1284 | Ga0501074_0275471 | 3300049590 | Bacteria | 1196 |
| 1285 | Ga0501074_0329299 | 3300049590 | Bacteria | 1084 |
| 1286 | Ga0501074_0515855 | 3300049590 | Unclassified | 847 |
| 1287 | Ga0501075_0003490 | 3300049591 | Bacteria | 10513 |
| 1288 | Ga0501075_0050367 | 3300049591 | Bacteria | 3131 |
| 1289 | Ga0501075_0063980 | 3300049591 | Bacteria | 2774 |
| 1290 | Ga0501075_0172661 | 3300049591 | Bacteria | 1650 |
| 1291 | Ga0501075_0308010 | 3300049591 | Bacteria | 1207 |
| 1292 | Ga0501075_0626285 | 3300049591 | Bacteria | 820 |
| 1293 | Ga0501076_0006835 | 3300049592 | Bacteria | 8279 |
| 1294 | Ga0501076_0045765 | 3300049592 | Bacteria | 3455 |
| 1295 | Ga0501076_0129651 | 3300049592 | Bacteria | 2045 |
| 1296 | Ga0501076_0360422 | 3300049592 | Bacteria | 1194 |
| 1297 | Ga0501076_0815469 | 3300049592 | Bacteria | 770 |
| 1298 | Ga0501077_0003797 | 3300049593 | Bacteria | 9094 |
| 1299 | Ga0501077_0011455 | 3300049593 | Bacteria | 5539 |
| 1300 | Ga0501077_0037016 | 3300049593 | Bacteria | 3108 |
| 1301 | Ga0501077_0072119 | 3300049593 | Bacteria | 2188 |
| 1302 | Ga0501077_0101464 | 3300049593 | Bacteria | 1823 |
| 1303 | Ga0501077_0102055 | 3300049593 | Bacteria | 1818 |
| 1304 | Ga0501077_0230285 | 3300049593 | Bacteria | 1178 |
| 1305 | Ga0501077_0237985 | 3300049593 | Bacteria | 1157 |
| 1306 | Ga0501079_0004409 | 3300049741 | Bacteria | 10422 |
| 1307 | Ga0501079_0098607 | 3300049741 | Bacteria | 2265 |
| 1308 | Ga0501079_0269982 | 3300049741 | Bacteria | 1330 |
| 1309 | Ga0501080_0204349 | 3300049742 | Bacteria | 1812 |
| 1310 | Ga0501080_0260291 | 3300049742 | Bacteria | 1581 |
| 1311 | Ga0501080_0285866 | 3300049742 | Bacteria | 1498 |
| 1312 | Ga0501080_0287419 | 3300049742 | Bacteria | 1494 |
| 1313 | Ga0501080_1108018 | 3300049742 | Bacteria | 683 |
| 1314 | Ga0501081_0001579 | 3300049743 | Bacteria | 14051 |
| 1315 | Ga0501081_0089873 | 3300049743 | Bacteria | 2158 |
| 1316 | Ga0501081_0236908 | 3300049743 | Bacteria | 1330 |
| 1317 | Ga0501081_0274822 | 3300049743 | Bacteria | 1233 |
| 1318 | Ga0501083_0042992 | 3300049744 | Bacteria | 3062 |
| 1319 | Ga0501035_0007148 | 3300049822 | Bacteria | 10442 |
| 1320 | Ga0501044_0954161 | 3300049823 | Bacteria | 731 |
| 1321 | Ga0501045_0109987 | 3300049824 | Bacteria | 2043 |
| 1322 | Ga0501045_0112180 | 3300049824 | Bacteria | 2021 |
| 1323 | Ga0501045_0461019 | 3300049824 | Bacteria | 944 |
| 1324 | nmdc:mga03683_52902_c1 | 3300050489 | Unclassified | 1698 |
| 1325 | nmdc:mga00v17_442877_c1 | 3300050491 | Unclassified | 844 |
| 1326 | nmdc:mga0k408_293362_c1 | 3300050493 | Bacteria | 970 |
| 1327 | nmdc:mga05p37_154440_c1 | 3300050507 | Bacteria | 2806 |
| 1328 | nmdc:mga05p37_229940_c1 | 3300050507 | Bacteria | 2235 |
| 1329 | nmdc:mga05p37_444007_c1 | 3300050507 | Unclassified | 1504 |
| 1330 | nmdc:mga05p37_467866_c1 | 3300050507 | Bacteria | 1455 |
| 1331 | nmdc:mga05p37_52745_c1 | 3300050507 | Bacteria | 1832 |
| 1332 | nmdc:mga05p37_815300_c1 | 3300050507 | Bacteria | 1019 |
| 1333 | nmdc:mga05p37_844865_c1 | 3300050507 | Bacteria | 995 |
| 1334 | nmdc:mga05p37_86206_c1 | 3300050507 | Bacteria | 3871 |
| 1335 | nmdc:mga09592_20016_c1 | 3300050508 | Bacteria | 5498 |
| 1336 | nmdc:mga09592_229046_c1 | 3300050508 | Bacteria | 1610 |
| 1337 | nmdc:mga09592_311048_c1 | 3300050508 | Bacteria | 1365 |
| 1338 | nmdc:mga09592_7064_c1 | 3300050508 | Bacteria | 9124 |
| 1339 | nmdc:mga09592_82492_c1 | 3300050508 | Bacteria | 2740 |
| 1340 | nmdc:mga0qj67_116856_c1 | 3300050509 | Bacteria | 2156 |
| 1341 | nmdc:mga0qj67_168230_c1 | 3300050509 | Bacteria | 1780 |
| 1342 | nmdc:mga0qj67_212520_c1 | 3300050509 | Bacteria | 1571 |
| 1343 | nmdc:mga0qj67_464757_c1 | 3300050509 | Bacteria | 1019 |
| 1344 | nmdc:mga0qj67_869199_c1 | 3300050509 | Bacteria | 712 |
| 1345 | nmdc:mga06r32_108204_c1 | 3300050510 | Bacteria | 2733 |
| 1346 | nmdc:mga06r32_172594_c1 | 3300050510 | Bacteria | 2146 |
| 1347 | nmdc:mga06r32_343702_c1 | 3300050510 | Bacteria | 1477 |
| 1348 | nmdc:mga06r32_44390_c1 | 3300050510 | Bacteria | 4233 |
| 1349 | nmdc:mga06r32_512261_c1 | 3300050510 | Bacteria | 1176 |
| 1350 | nmdc:mga06r32_55175_c1 | 3300050510 | Bacteria | 3811 |
| 1351 | nmdc:mga06r32_719770_c1 | 3300050510 | Bacteria | 963 |
| 1352 | nmdc:mga08y16_270030_c1 | 3300050511 | Bacteria | 1756 |
| 1353 | nmdc:mga08y16_2814_c1 | 3300050511 | Bacteria | 17864 |
| 1354 | nmdc:mga08y16_31729_c1 | 3300050511 | Bacteria | 5555 |
| 1355 | nmdc:mga08y16_32986_c1 | 3300050511 | Bacteria | 5441 |
| 1356 | nmdc:mga08y16_418545_c1 | 3300050511 | Bacteria | 1370 |
| 1357 | nmdc:mga08y16_59413_c1 | 3300050511 | Bacteria | 3994 |
| 1358 | nmdc:mga08y16_61338_c1 | 3300050511 | Bacteria | 3927 |
| 1359 | nmdc:mga08y16_643010_c1 | 3300050511 | Bacteria | 1066 |
| 1360 | nmdc:mga08y16_97069_c1 | 3300050511 | Bacteria | 3069 |
| 1361 | nmdc:mga0n895_117193_c1 | 3300050512 | Bacteria | 2682 |
| 1362 | nmdc:mga0n895_14920_c1 | 3300050512 | Bacteria | 7076 |
| 1363 | nmdc:mga0n895_228035_c1 | 3300050512 | Bacteria | 1891 |
| 1364 | nmdc:mga0n895_241324_c1 | 3300050512 | Bacteria | 1834 |
| 1365 | nmdc:mga0n895_311848_c1 | 3300050512 | Bacteria | 1594 |
| 1366 | nmdc:mga0n895_31746_c1 | 3300050512 | Bacteria | 5061 |
| 1367 | nmdc:mga0n895_325684_c1 | 3300050512 | Bacteria | 1557 |
| 1368 | nmdc:mga0n895_66179_c1 | 3300050512 | Bacteria | 3578 |
| 1369 | nmdc:mga0rr50_119590_c1 | 3300050513 | Bacteria | 2095 |
| 1370 | nmdc:mga0rr50_174028_c1 | 3300050513 | Bacteria | 1756 |
| 1371 | nmdc:mga0rr50_190381_c1 | 3300050513 | Bacteria | 1681 |
| 1372 | nmdc:mga0rr50_198141_c1 | 3300050513 | Bacteria | 1649 |
| 1373 | nmdc:mga08x19_157336_c1 | 3300050514 | Bacteria | 1542 |
| 1374 | nmdc:mga08x19_232619_c1 | 3300050514 | Bacteria | 1269 |
| 1375 | nmdc:mga08x19_30892_c1 | 3300050514 | Bacteria | 3367 |
| 1376 | nmdc:mga08x19_64245_c1 | 3300050514 | Bacteria | 2382 |
| 1377 | nmdc:mga0a205_16661_c1 | 3300050515 | Bacteria | 6884 |
| 1378 | nmdc:mga0a205_214689_c1 | 3300050515 | Bacteria | 1811 |
| 1379 | nmdc:mga0a205_217420_c1 | 3300050515 | Bacteria | 1798 |
| 1380 | nmdc:mga0a205_39141_c1 | 3300050515 | Bacteria | 4562 |
| 1381 | nmdc:mga0a205_467391_c1 | 3300050515 | Bacteria | 1120 |
| 1382 | nmdc:mga0a205_634673_c1 | 3300050515 | Bacteria | 920 |
| 1383 | nmdc:mga0a205_66865_c2 | 3300050515 | Bacteria | 2338 |
| 1384 | nmdc:mga0a205_949291_c1 | 3300050515 | Bacteria | 707 |
| 1385 | Ga0495601_0027307 | 3300053077 | Bacteria | 3529 |
| 1386 | Ga0495601_0173957 | 3300053077 | Bacteria | 1407 |
| 1387 | Ga0495601_0214714 | 3300053077 | Bacteria | 1256 |
| 1388 | Ga0495612_0044060 | 3300053078 | Bacteria | 1825 |
| 1389 | Ga0495655_0075976 | 3300053083 | Bacteria | 950 |
| 1390 | Ga0495595_0280013 | 3300053084 | Bacteria | 837 |
| 1391 | Ga0495595_0313413 | 3300053084 | Bacteria | 790 |
| 1392 | Ga0495595_0314879 | 3300053084 | Bacteria | 788 |
| 1393 | Ga0495619_0022307 | 3300053085 | Bacteria | 4050 |
| 1394 | Ga0495619_0578085 | 3300053085 | Bacteria | 769 |
| 1395 | Ga0501084_0002637 | 3300054114 | Bacteria | 14452 |
| 1396 | Ga0501084_0018862 | 3300054114 | Bacteria | 5743 |
| 1397 | Ga0501084_0070642 | 3300054114 | Bacteria | 2923 |
| 1398 | Ga0501084_0229688 | 3300054114 | Bacteria | 1566 |
| 1399 | Ga0590075_131431 | 3300059424 | Bacteria | 657 |
| 1400 | Ga0587084_023551 | 3300059477 | Bacteria | 941 |
| 1401 | Ga0587066_046455 | 3300059490 | Bacteria | 838 |
| 1402 | Ga0587077_023304 | 3300059493 | Bacteria | 1117 |
| 1403 | Ga0587082_032460 | 3300059504 | Bacteria | 917 |
| 1404 | Ga0587082_053888 | 3300059504 | Bacteria | 775 |
| 1405 | Ga0587083_0063175 | 3300059505 | Bacteria | 840 |
| 1406 | Ga0587083_0082448 | 3300059505 | Bacteria | 769 |
| 1407 | Ga0587085_015779 | 3300059506 | Bacteria | 1084 |
| 1408 | Ga0587085_074283 | 3300059506 | Bacteria | 671 |
| 1409 | Ga0587091_050018 | 3300059511 | Bacteria | 855 |
| 1410 | Ga0587094_022837 | 3300059513 | Bacteria | 921 |
| 1411 | Ga0587128_027912 | 3300059630 | Bacteria | 915 |
| 1412 | Ga0587069_075407 | 3300059642 | Bacteria | 648 |
| 1413 | Ga0587079_069111 | 3300059647 | Bacteria | 784 |
| 1414 | Ga0587119_012725 | 3300059658 | Bacteria | 987 |
| 1415 | Ga0587071_024076 | 3300060344 | Bacteria | 1134 |
| 1416 | Ga0587071_050534 | 3300060344 | Bacteria | 859 |
| 1417 | Ga0501082_0009071 | 3300060353 | Bacteria | 8579 |
| 1418 | Ga0501082_0030563 | 3300060353 | Bacteria | 4642 |
| 1419 | Ga0501082_0147088 | 3300060353 | Bacteria | 2045 |
| 1420 | Ga0501082_0288122 | 3300060353 | Bacteria | 1430 |
| 1421 | Ga0501082_0405716 | 3300060353 | Bacteria | 1189 |
| 1422 | Ga0466962_0016793 | 3300061719 | Bacteria | 3528 |
| 1423 | Ga0466962_0035971 | 3300061719 | Bacteria | 2370 |
| 1424 | Ga0530510_0010517 | 3300061734 | Bacteria | 6487 |
| 1425 | Ga0530510_0024772 | 3300061734 | Bacteria | 4286 |
| 1426 | Ga0530510_0048071 | 3300061734 | Bacteria | 3083 |
| 1427 | Ga0530510_0069058 | 3300061734 | Bacteria | 2564 |
| 1428 | Ga0530510_0162878 | 3300061734 | Bacteria | 1650 |
| 1429 | Ga0530510_0347020 | 3300061734 | Bacteria | 1115 |
| 1430 | Ga0530510_0490602 | 3300061734 | Bacteria | 931 |
| 1431 | Ga0530510_0845559 | 3300061734 | Bacteria | 699 |
| 1432 | Ga0075432_10103970 | |||
| 1433 | JGI25407J50210_10000289 | |||
| 1434 | JGI25407J50210_10027312 | |||
| 1435 | JGI25407J50210_10028471 | |||
| 1436 | JGI25404J52841_10032556 | |||
| 1437 | Ga0058861_10029875 | |||
| 1438 | Ga0058862_10090311 | |||
| 1439 | Ga0070676_10495253 | |||
| 1440 | Ga0070683_100004118 | |||
| 1441 | Ga0070683_100228630 | |||
| 1442 | Ga0070683_100321082 | |||
| 1443 | Ga0070683_100815698 | |||
| 1444 | Ga0070683_100845570 | |||
| 1445 | Ga0070690_100010006 | |||
| 1446 | Ga0070690_100057669 | |||
| 1447 | Ga0070690_100066426 | |||
| 1448 | Ga0070690_100098630 | |||
| 1449 | Ga0070690_100599665 | |||
| 1450 | Ga0070677_10196758 | |||
| 1451 | Ga0068869_100181565 | |||
| 1452 | Ga0070666_10139940 | |||
| 1453 | Ga0070680_100129751 | |||
| 1454 | Ga0070680_100175039 | |||
| 1455 | Ga0070680_100241775 | |||
| 1456 | Ga0070682_100003401 | |||
| 1457 | Ga0070682_100061412 | |||
| 1458 | Ga0070682_100075888 | |||
| 1459 | Ga0070682_100093195 | |||
| 1460 | Ga0070682_100102291 | |||
| 1461 | Ga0070682_100226330 | |||
| 1462 | Ga0068868_100021916 | |||
| 1463 | Ga0068868_100037957 | |||
| 1464 | Ga0068868_100174154 | |||
| 1465 | Ga0068868_100188551 | |||
| 1466 | Ga0068868_100202619 | |||
| 1467 | Ga0068868_100267025 | |||
| 1468 | Ga0068868_100299064 | |||
| 1469 | Ga0070660_100048578 | |||
| 1470 | Ga0070660_100076546 | |||
| 1471 | Ga0070660_100222384 | |||
| 1472 | Ga0070660_100303730 | |||
| 1473 | Ga0070689_100230410 | |||
| 1474 | Ga0070689_100511471 | |||
| 1475 | Ga0070691_10115831 | |||
| 1476 | Ga0070691_10237937 | |||
| 1477 | Ga0070687_100256665 | |||
| 1478 | Ga0070661_100047206 | |||
| 1479 | Ga0070661_100156791 | |||
| 1480 | Ga0070661_100750842 | |||
| 1481 | Ga0070692_10011629 | |||
| 1482 | Ga0070692_10023120 | |||
| 1483 | Ga0070692_10091206 | |||
| 1484 | Ga0070692_10094951 | |||
| 1485 | Ga0070668_100397029 | |||
| 1486 | Ga0070668_100536419 | |||
| 1487 | Ga0070675_100598247 | |||
| 1488 | Ga0070675_100652037 | |||
| 1489 | Ga0070671_100386025 | |||
| 1490 | Ga0070671_100399393 | |||
| 1491 | Ga0070671_100420565 | |||
| 1492 | Ga0070674_100032414 | |||
| 1493 | Ga0070674_100047960 | |||
| 1494 | Ga0070673_100017707 | |||
| 1495 | Ga0070673_100422218 | |||
| 1496 | Ga0070673_100981156 | |||
| 1497 | Ga0070688_100011538 | |||
| 1498 | Ga0070688_100017530 | |||
| 1499 | Ga0070659_100019301 | |||
| 1500 | Ga0070659_100039597 | |||
| 1501 | Ga0070659_100993267 | |||
| 1502 | Ga0070667_100136251 | |||
| 1503 | Ga0070703_10004087 | |||
| 1504 | Ga0070703_10065633 | |||
| 1505 | Ga0070709_10052309 | |||
| 1506 | Ga0070709_10064398 | |||
| 1507 | Ga0070709_10078786 | |||
| 1508 | Ga0070709_10092424 | |||
| 1509 | Ga0070709_10115735 | |||
| 1510 | Ga0070709_10232910 | |||
| 1511 | Ga0070714_100029263 | |||
| 1512 | Ga0070714_100139279 | |||
| 1513 | Ga0070714_100243510 | |||
| 1514 | Ga0070714_100266845 | |||
| 1515 | Ga0070714_100651726 | |||
| 1516 | Ga0070714_100700231 | |||
| 1517 | Ga0070713_100236114 | |||
| 1518 | Ga0070713_100268378 | |||
| 1519 | Ga0070713_100713933 | |||
| 1520 | Ga0070713_101158964 | |||
| 1521 | Ga0070710_10012552 | |||
| 1522 | Ga0070710_10018013 | |||
| 1523 | Ga0070710_10053838 | |||
| 1524 | Ga0070710_10057552 | |||
| 1525 | Ga0070701_10019176 | |||
| 1526 | Ga0070701_10021876 | |||
| 1527 | Ga0070701_10110441 | |||
| 1528 | Ga0070711_100006010 | |||
| 1529 | Ga0070711_100011069 | |||
| 1530 | Ga0070711_100022300 | |||
| 1531 | Ga0070711_100079563 | |||
| 1532 | Ga0070711_100088935 | |||
| 1533 | Ga0070705_100029179 | |||
| 1534 | Ga0070705_100058677 | |||
| 1535 | Ga0070705_100069264 | |||
| 1536 | Ga0070705_100071793 | |||
| 1537 | Ga0070705_100103111 | |||
| 1538 | Ga0070705_100164062 | |||
| 1539 | Ga0070705_100193676 | |||
| 1540 | Ga0070705_100341472 | |||
| 1541 | Ga0070705_100494127 | |||
| 1542 | Ga0070700_100001006 | |||
| 1543 | Ga0070700_100013938 | |||
| 1544 | Ga0070700_100161099 | |||
| 1545 | Ga0070700_100499135 | |||
| 1546 | Ga0070694_100014357 | |||
| 1547 | Ga0070708_100183070 | |||
| 1548 | Ga0070708_100237361 | |||
| 1549 | Ga0070708_100614526 | |||
| 1550 | Ga0070708_101215099 | |||
| 1551 | Ga0070663_100075414 | |||
| 1552 | Ga0070663_100099828 | |||
| 1553 | Ga0070663_100271835 | |||
| 1554 | Ga0070678_100000610 | |||
| 1555 | Ga0070678_100017028 | |||
| 1556 | Ga0070678_100027163 | |||
| 1557 | Ga0070662_100072757 | |||
| 1558 | Ga0070662_100289734 | |||
| 1559 | Ga0070681_10234884 | |||
| 1560 | Ga0068867_100131224 | |||
| 1561 | Ga0068867_100729652 | |||
| 1562 | Ga0070685_10220746 | |||
| 1563 | Ga0070685_10266871 | |||
| 1564 | Ga0070706_100009648 | |||
| 1565 | Ga0070706_100034451 | |||
| 1566 | Ga0070706_100584668 | |||
| 1567 | Ga0070706_100846756 | |||
| 1568 | Ga0070707_100000909 | |||
| 1569 | Ga0070707_100143993 | |||
| 1570 | Ga0070707_100150790 | |||
| 1571 | Ga0070707_100153621 | |||
| 1572 | Ga0070707_100356827 | |||
| 1573 | Ga0070698_100021420 | |||
| 1574 | Ga0070698_100023816 | |||
| 1575 | Ga0070698_100062351 | |||
| 1576 | Ga0070698_100405578 | |||
| 1577 | Ga0070699_100395579 | |||
| 1578 | Ga0070699_100999875 | |||
| 1579 | Ga0070679_100163736 | |||
| 1580 | Ga0070679_100397346 | |||
| 1581 | Ga0070679_100529019 | |||
| 1582 | Ga0070679_100905438 | |||
| 1583 | Ga0070684_100054574 | |||
| 1584 | Ga0070684_100055287 | |||
| 1585 | Ga0070684_100064453 | |||
| 1586 | Ga0070684_100077735 | |||
| 1587 | Ga0070684_100114560 | |||
| 1588 | Ga0070684_100248766 | |||
| 1589 | Ga0070684_100400352 | |||
| 1590 | Ga0070697_100070019 | |||
| 1591 | Ga0070697_100196635 | |||
| 1592 | Ga0070697_100507760 | |||
| 1593 | Ga0068853_100020589 | |||
| 1594 | Ga0068853_100024733 | |||
| 1595 | Ga0068853_100232309 | |||
| 1596 | Ga0070672_100207923 | |||
| 1597 | Ga0070672_100403028 | |||
| 1598 | Ga0070686_100002710 | |||
| 1599 | Ga0070686_100011818 | |||
| 1600 | Ga0070686_100025908 | |||
| 1601 | Ga0070686_100086275 | |||
| 1602 | Ga0070686_100376457 | |||
| 1603 | Ga0070695_100113818 | |||
| 1604 | Ga0070695_100164599 | |||
| 1605 | Ga0070695_100328724 | |||
| 1606 | Ga0070695_100580327 | |||
| 1607 | Ga0070695_100761001 | |||
| 1608 | Ga0070696_100027632 | |||
| 1609 | Ga0070696_100036287 | |||
| 1610 | Ga0070696_100041305 | |||
| 1611 | Ga0070696_100050548 | |||
| 1612 | Ga0070696_100161589 | |||
| 1613 | Ga0070696_100335126 | |||
| 1614 | Ga0070693_100002170 | |||
| 1615 | Ga0070693_100017228 | |||
| 1616 | Ga0070693_100039988 | |||
| 1617 | Ga0070693_100068241 | |||
| 1618 | Ga0070693_100079873 | |||
| 1619 | Ga0070665_100076549 | |||
| 1620 | Ga0070665_100094538 | |||
| 1621 | Ga0070665_100310706 | |||
| 1622 | Ga0070704_100077761 | |||
| 1623 | Ga0070704_100130360 | |||
| 1624 | Ga0070704_100138685 | |||
| 1625 | Ga0070704_100149955 | |||
| 1626 | Ga0070704_100150812 | |||
| 1627 | Ga0070704_100381507 | |||
| 1628 | Ga0070704_100639094 | |||
| 1629 | Ga0068855_100162744 | |||
| 1630 | Ga0068855_100167180 | |||
| 1631 | Ga0068855_100302025 | |||
| 1632 | Ga0068855_100383089 | |||
| 1633 | Ga0068855_100613884 | |||
| 1634 | Ga0070664_100009330 | |||
| 1635 | Ga0070664_100134553 | |||
| 1636 | Ga0070664_100139981 | |||
| 1637 | Ga0070664_100468238 | |||
| 1638 | Ga0068857_100000231 | |||
| 1639 | Ga0068857_100061360 | |||
| 1640 | Ga0068857_100126729 | |||
| 1641 | Ga0068857_100415569 | |||
| 1642 | Ga0068854_100094485 | |||
| 1643 | Ga0068854_100111557 | |||
| 1644 | Ga0068854_100374562 | |||
| 1645 | Ga0068854_101017107 | |||
| 1646 | Ga0068856_100030396 | |||
| 1647 | Ga0068856_100345021 | |||
| 1648 | Ga0068856_100792277 | |||
| 1649 | Ga0068856_100838262 | |||
| 1650 | Ga0070702_100003035 | |||
| 1651 | Ga0070702_100005902 | |||
| 1652 | Ga0070702_100009254 | |||
| 1653 | Ga0070702_100025412 | |||
| 1654 | Ga0070702_100027013 | |||
| 1655 | Ga0068852_100085204 | |||
| 1656 | Ga0068852_100180393 | |||
| 1657 | Ga0068859_100042244 | |||
| 1658 | Ga0068859_100428745 | |||
| 1659 | Ga0068859_100607142 | |||
| 1660 | Ga0068864_100016821 | |||
| 1661 | Ga0068864_100158826 | |||
| 1662 | Ga0068864_100269875 | |||
| 1663 | Ga0068866_10141004 | |||
| 1664 | Ga0068866_10197508 | |||
| 1665 | Ga0068861_100012914 | |||
| 1666 | Ga0068851_10036779 | |||
| 1667 | Ga0068863_100458226 | |||
| 1668 | Ga0068858_100207967 | |||
| 1669 | Ga0068858_100273057 | |||
| 1670 | Ga0081455_10007749 | |||
| 1671 | Ga0081455_10018478 | |||
| 1672 | Ga0081455_10038340 | |||
| 1673 | Ga0081455_10043239 | |||
| 1674 | Ga0081455_10045940 | |||
| 1675 | Ga0081455_10071215 | |||
| 1676 | Ga0081455_10079908 | |||
| 1677 | Ga0081538_10000052 | |||
| 1678 | Ga0081538_10000352 | |||
| 1679 | Ga0081538_10000571 | |||
| 1680 | Ga0081538_10000677 | |||
| 1681 | Ga0081538_10000872 | |||
| 1682 | Ga0081538_10010401 | |||
| 1683 | Ga0081538_10016094 | |||
| 1684 | Ga0081540_1001965 | |||
| 1685 | Ga0081540_1005187 | |||
| 1686 | Ga0081540_1005276 | |||
| 1687 | Ga0081540_1094445 | |||
| 1688 | Ga0081539_10008181 | |||
| 1689 | Ga0070717_10024233 | |||
| 1690 | Ga0070717_10030782 | |||
| 1691 | Ga0070717_10033346 | |||
| 1692 | Ga0070717_10053163 | |||
| 1693 | Ga0070717_10057003 | |||
| 1694 | Ga0070717_10224651 | |||
| 1695 | Ga0075365_10007709 | |||
| 1696 | Ga0075364_10060833 | |||
| 1697 | Ga0075364_10524429 | |||
| 1698 | Ga0070715_10008610 | |||
| 1699 | Ga0070716_100016672 | |||
| 1700 | Ga0070716_100044575 | |||
| 1701 | Ga0070716_100078960 | |||
| 1702 | Ga0070716_100210883 | |||
| 1703 | Ga0070716_100418183 | |||
| 1704 | Ga0070712_100011230 | |||
| 1705 | Ga0070712_100019238 | |||
| 1706 | Ga0070712_100025261 | |||
| 1707 | Ga0070712_100043248 | |||
| 1708 | Ga0070712_100301765 | |||
| 1709 | Ga0070712_100343570 | |||
| 1710 | Ga0070712_100452367 | |||
| 1711 | Ga0070712_100686410 | |||
| 1712 | Ga0075362_10005562 | |||
| 1713 | Ga0075427_10005503 | |||
| 1714 | Ga0097621_100016805 | |||
| 1715 | Ga0097621_100060448 | |||
| 1716 | Ga0097621_100169932 | |||
| 1717 | Ga0097621_100389025 | |||
| 1718 | Ga0097621_100767054 | |||
| 1719 | Ga0068871_100049456 | |||
| 1720 | Ga0068871_100142390 | |||
| 1721 | Ga0068871_100178685 | |||
| 1722 | Ga0068871_100366591 | |||
| 1723 | Ga0068871_100519765 | |||
| 1724 | Ga0075428_100055600 | |||
| 1725 | Ga0075428_100081370 | |||
| 1726 | Ga0075428_100174650 | |||
| 1727 | Ga0075428_100195786 | |||
| 1728 | Ga0075430_100007921 | |||
| 1729 | Ga0075430_100040628 | |||
| 1730 | Ga0075430_100107397 | |||
| 1731 | Ga0075430_100213120 | |||
| 1732 | Ga0075431_100121088 | |||
| 1733 | Ga0075431_100133721 | |||
| 1734 | Ga0075431_100162214 | |||
| 1735 | Ga0075431_100190267 | |||
| 1736 | Ga0075431_100213321 | |||
| 1737 | Ga0075431_100604168 | |||
| 1738 | Ga0075431_100615776 | |||
| 1739 | Ga0075433_10042647 | |||
| 1740 | Ga0075433_10119917 | |||
| 1741 | Ga0075433_10252161 | |||
| 1742 | Ga0075433_10266278 | |||
| 1743 | Ga0075433_10529117 | |||
| 1744 | Ga0075433_10561541 | |||
| 1745 | Ga0075434_100001520 | |||
| 1746 | Ga0075434_100004815 | |||
| 1747 | Ga0075434_100060849 | |||
| 1748 | Ga0075434_100319272 | |||
| 1749 | Ga0075434_100860845 | |||
| 1750 | Ga0075429_100039216 | |||
| 1751 | Ga0075429_100123719 | |||
| 1752 | Ga0075429_100168007 | |||
| 1753 | Ga0075429_100174612 | |||
| 1754 | Ga0075429_100209528 | |||
| 1755 | Ga0075429_100232359 | |||
| 1756 | Ga0075429_100472247 | |||
| 1757 | Ga0075429_100475554 | |||
| 1758 | Ga0068865_100002992 | |||
| 1759 | Ga0068865_100049398 | |||
| 1760 | Ga0068865_100119851 | |||
| 1761 | Ga0068865_100203346 | |||
| 1762 | Ga0075436_100003579 | |||
| 1763 | Ga0075436_100020046 | |||
| 1764 | Ga0075436_100103621 | |||
| 1765 | Ga0075436_100108287 | |||
| 1766 | Ga0075436_100214311 | |||
| 1767 | Ga0075436_100518128 | |||
| 1768 | Ga0075436_100593351 | |||
| 1769 | Ga0097620_100042244 | |||
| 1770 | Ga0097620_100428760 | |||
| 1771 | Ga0097620_100607196 | |||
| 1772 | Ga0075435_100001635 | |||
| 1773 | Ga0075435_100011437 | |||
| 1774 | Ga0075435_100047701 | |||
| 1775 | Ga0075435_100175508 | |||
| 1776 | Ga0075435_101058504 | |||
| 1777 | Ga0105240_10081108 | |||
| 1778 | Ga0111539_10001013 | |||
| 1779 | Ga0111539_10038452 | |||
| 1780 | Ga0111539_10040525 | |||
| 1781 | Ga0111539_10154510 | |||
| 1782 | Ga0111539_10167824 | |||
| 1783 | Ga0111539_10211542 | |||
| 1784 | Ga0111539_10275484 | |||
| 1785 | Ga0111539_10291091 | |||
| 1786 | Ga0111539_11512254 | |||
| 1787 | Ga0105245_10014783 | |||
| 1788 | Ga0105245_10033360 | |||
| 1789 | Ga0105245_10073050 | |||
| 1790 | Ga0105245_10130472 | |||
| 1791 | Ga0105245_10290337 | |||
| 1792 | Ga0105245_10493588 | |||
| 1793 | Ga0105245_10609213 | |||
| 1794 | Ga0105245_10795035 | |||
| 1795 | Ga0105245_11064121 | |||
| 1796 | Ga0105247_10239044 | |||
| 1797 | Ga0105247_10290602 | |||
| 1798 | Ga0114129_10016536 | |||
| 1799 | Ga0114129_10070385 | |||
| 1800 | Ga0114129_10099939 | |||
| 1801 | Ga0114129_10164011 | |||
| 1802 | Ga0114129_10246248 | |||
| 1803 | Ga0114129_10292963 | |||
| 1804 | Ga0114129_10295527 | |||
| 1805 | Ga0114129_10701493 | |||
| 1806 | Ga0114129_10860170 | |||
| 1807 | Ga0114129_11057041 | |||
| 1808 | Ga0105243_10028290 | |||
| 1809 | Ga0105243_10128232 | |||
| 1810 | Ga0105243_10282530 | |||
| 1811 | Ga0105243_10389800 | |||
| 1812 | Ga0105243_10625517 | |||
| 1813 | Ga0105241_10010007 | |||
| 1814 | Ga0105241_10110098 | |||
| 1815 | Ga0105241_10681524 | |||
| 1816 | Ga0105242_10006691 | |||
| 1817 | Ga0105242_10032138 | |||
| 1818 | Ga0105242_10082511 | |||
| 1819 | Ga0105242_10112166 | |||
| 1820 | Ga0105242_10270518 | |||
| 1821 | Ga0105242_10430223 | |||
| 1822 | Ga0105242_10468123 | |||
| 1823 | Ga0105248_10019066 | |||
| 1824 | Ga0105248_10023316 | |||
| 1825 | Ga0105248_10175023 | |||
| 1826 | Ga0105248_10186556 | |||
| 1827 | Ga0105248_10194549 | |||
| 1828 | Ga0105248_10324417 | |||
| 1829 | Ga0105237_10000037 | |||
| 1830 | Ga0105237_10198868 | |||
| 1831 | Ga0105237_10360923 | |||
| 1832 | Ga0105238_10060284 | |||
| 1833 | Ga0105238_10065350 | |||
| 1834 | Ga0105238_10879468 | |||
| 1835 | Ga0105238_11214748 | |||
| 1836 | Ga0105238_11232831 | |||
| 1837 | Ga0105249_10002735 | |||
| 1838 | Ga0105249_10024846 | |||
| 1839 | Ga0105249_10120216 | |||
| 1840 | Ga0105239_10105487 | |||
| 1841 | Ga0105239_10125646 | |||
| 1842 | Ga0105239_10405532 | |||
| 1843 | Ga0105239_10641417 | |||
| 1844 | Ga0105239_10726013 | |||
| 1845 | Ga0105239_10854570 | |||
| 1846 | Ga0105239_11081622 | |||
| 1847 | Ga0105239_11557599 | |||
| 1848 | Ga0105239_11970590 | |||
| 1849 | Ga0105246_10058244 | |||
| 1850 | Ga0105246_10060099 | |||
| 1851 | Ga0105246_10124321 | |||
| 1852 | Ga0105246_10225135 | |||
| 1853 | Ga0105246_10614809 | |||
| 1854 | Ga0105246_11060820 | |||
| 1855 | Ga0157329_1005250 | |||
| 1856 | Ga0157324_1001728 | |||
| 1857 | Ga0157338_1005275 | |||
| 1858 | Ga0157371_10086198 | |||
| 1859 | Ga0157371_10117202 | |||
| 1860 | Ga0157370_10077618 | |||
| 1861 | Ga0157369_10249147 | |||
| 1862 | Ga0157369_10607263 | |||
| 1863 | Ga0157374_10028012 | |||
| 1864 | Ga0157374_10768295 | |||
| 1865 | Ga0157378_10036713 | |||
| 1866 | Ga0157378_10041614 | |||
| 1867 | Ga0157378_10216987 | |||
| 1868 | Ga0163162_10003800 | |||
| 1869 | Ga0163162_10036629 | |||
| 1870 | Ga0163162_11080968 | |||
| 1871 | Ga0157372_10053020 | |||
| 1872 | Ga0157372_10103103 | |||
| 1873 | Ga0157372_10126423 | |||
| 1874 | Ga0157372_11301457 | |||
| 1875 | Ga0157375_10013777 | |||
| 1876 | Ga0157375_10017172 | |||
| 1877 | Ga0157375_10148833 | |||
| 1878 | Ga0157375_10255824 | |||
| 1879 | Ga0157375_10345738 | |||
| 1880 | Ga0157375_10473337 | |||
| 1881 | Ga0157375_11106246 | |||
| 1882 | Ga0163163_10361960 | |||
| 1883 | Ga0163163_10362136 | |||
| 1884 | Ga0163163_10745436 | |||
| 1885 | Ga0157380_10118872 | |||
| 1886 | Ga0157380_10524468 | |||
| 1887 | Ga0157380_11676883 | |||
| 1888 | Ga0182008_10050308 | |||
| 1889 | Ga0182008_10098766 | |||
| 1890 | Ga0182008_10341260 | |||
| 1891 | Ga0157377_10077893 | |||
| 1892 | Ga0157379_10005505 | |||
| 1893 | Ga0157379_10177545 | |||
| 1894 | Ga0157376_10028247 | |||
| 1895 | Ga0157376_10030023 | |||
| 1896 | Ga0157376_10042207 | |||
| 1897 | Ga0157376_10204820 | |||
| 1898 | Ga0157376_10278463 | |||
| 1899 | Ga0157376_10373795 | |||
| 1900 | Ga0157376_10394674 | |||
| 1901 | Ga0157376_10588298 | |||
| 1902 | Ga0163161_10134413 | |||
| 1903 | Ga0163161_10421163 | |||
| 1904 | Ga0197907_10383702 | |||
| 1905 | Ga0206349_1095632 | |||
| 1906 | Ga0206352_11166851 | |||
| 1907 | Ga0206352_11331296 | |||
| 1908 | Ga0206350_10398217 | |||
| 1909 | Ga0206353_10240172 | |||
| 1910 | Ga0206353_11538467 | |||
| 1911 | Ga0154015_1367111 | |||
| 1912 | Ga0154015_1674205 | |||
| 1913 | Ga0224712_10095369 | |||
| 1914 | Ga0207697_10217368 | |||
| 1915 | Ga0207653_10002891 | |||
| 1916 | Ga0207653_10051426 | |||
| 1917 | Ga0207692_10011411 | |||
| 1918 | Ga0207692_10027075 | |||
| 1919 | Ga0207692_10042751 | |||
| 1920 | Ga0207692_10073518 | |||
| 1921 | Ga0207642_10036559 | |||
| 1922 | Ga0207642_10118706 | |||
| 1923 | Ga0207642_10128113 | |||
| 1924 | Ga0207688_10086026 | |||
| 1925 | Ga0207688_10299292 | |||
| 1926 | Ga0207688_10532727 | |||
| 1927 | Ga0207680_10063955 | |||
| 1928 | Ga0207680_10090958 | |||
| 1929 | Ga0207680_10230648 | |||
| 1930 | Ga0207647_10206881 | |||
| 1931 | Ga0207685_10116466 | |||
| 1932 | Ga0207685_10121481 | |||
| 1933 | Ga0207699_10019694 | |||
| 1934 | Ga0207699_10069186 | |||
| 1935 | Ga0207699_10115957 | |||
| 1936 | Ga0207699_10399974 | |||
| 1937 | Ga0207699_10410041 | |||
| 1938 | Ga0207699_10541533 | |||
| 1939 | Ga0207643_10023603 | |||
| 1940 | Ga0207684_10044722 | |||
| 1941 | Ga0207684_10051590 | |||
| 1942 | Ga0207684_10066722 | |||
| 1943 | Ga0207684_10305365 | |||
| 1944 | Ga0207684_10414771 | |||
| 1945 | Ga0207684_10595554 | |||
| 1946 | Ga0207684_10687374 | |||
| 1947 | Ga0207654_10070170 | |||
| 1948 | Ga0207654_10134876 | |||
| 1949 | Ga0207654_10253167 | |||
| 1950 | Ga0207695_10018087 | |||
| 1951 | Ga0207695_10249325 | |||
| 1952 | Ga0207671_10000294 | |||
| 1953 | Ga0207671_10071951 | |||
| 1954 | Ga0207671_10436602 | |||
| 1955 | Ga0207671_10651189 | |||
| 1956 | Ga0207693_10001397 | |||
| 1957 | Ga0207693_10003063 | |||
| 1958 | Ga0207693_10003807 | |||
| 1959 | Ga0207693_10008745 | |||
| 1960 | Ga0207693_10023761 | |||
| 1961 | Ga0207693_10054740 | |||
| 1962 | Ga0207693_10055933 | |||
| 1963 | Ga0207693_10099182 | |||
| 1964 | Ga0207693_10191014 | |||
| 1965 | Ga0207693_11025677 | |||
| 1966 | Ga0207663_10001774 | |||
| 1967 | Ga0207663_10163764 | |||
| 1968 | Ga0207663_10265920 | |||
| 1969 | Ga0207660_10260486 | |||
| 1970 | Ga0207660_10315060 | |||
| 1971 | Ga0207660_10323323 | |||
| 1972 | Ga0207662_10019540 | |||
| 1973 | Ga0207662_10202051 | |||
| 1974 | Ga0207657_10070813 | |||
| 1975 | Ga0207657_10133883 | |||
| 1976 | Ga0207657_10183034 | |||
| 1977 | Ga0207657_10192028 | |||
| 1978 | Ga0207657_10465912 | |||
| 1979 | Ga0207649_10206656 | |||
| 1980 | Ga0207652_10043178 | |||
| 1981 | Ga0207652_10111916 | |||
| 1982 | Ga0207652_10143918 | |||
| 1983 | Ga0207652_10419886 | |||
| 1984 | Ga0207646_10005164 | |||
| 1985 | Ga0207646_10044170 | |||
| 1986 | Ga0207646_10052287 | |||
| 1987 | Ga0207646_10273619 | |||
| 1988 | Ga0207646_10674166 | |||
| 1989 | Ga0207681_10284991 | |||
| 1990 | Ga0207694_10066700 | |||
| 1991 | Ga0207694_10125502 | |||
| 1992 | Ga0207694_10186832 | |||
| 1993 | Ga0207694_10657706 | |||
| 1994 | Ga0207650_10295125 | |||
| 1995 | Ga0207659_10166119 | |||
| 1996 | Ga0207687_10042335 | |||
| 1997 | Ga0207687_10147799 | |||
| 1998 | Ga0207687_10247919 | |||
| 1999 | Ga0207687_10399666 | |||
| 2000 | Ga0207687_10507496 | |||
| 2001 | Ga0207687_10618189 | |||
| 2002 | Ga0207700_10010491 | |||
| 2003 | Ga0207700_10211510 | |||
| 2004 | Ga0207700_10245311 | |||
| 2005 | Ga0207700_10440340 | |||
| 2006 | Ga0207700_10587271 | |||
| 2007 | Ga0207700_10588511 | |||
| 2008 | Ga0207664_10013306 | |||
| 2009 | Ga0207664_10019531 | |||
| 2010 | Ga0207664_10079641 | |||
| 2011 | Ga0207664_10235202 | |||
| 2012 | Ga0207664_10242574 | |||
| 2013 | Ga0207664_11005468 | |||
| 2014 | Ga0207644_10360916 | |||
| 2015 | Ga0207690_10008253 | |||
| 2016 | Ga0207690_10084296 | |||
| 2017 | Ga0207706_10028228 | |||
| 2018 | Ga0207706_10034557 | |||
| 2019 | Ga0207706_10048594 | |||
| 2020 | Ga0207706_10116452 | |||
| 2021 | Ga0207706_10436149 | |||
| 2022 | Ga0207706_10577836 | |||
| 2023 | Ga0207686_10005329 | |||
| 2024 | Ga0207686_10066513 | |||
| 2025 | Ga0207686_10205083 | |||
| 2026 | Ga0207709_10002679 | |||
| 2027 | Ga0207709_10170735 | |||
| 2028 | Ga0207709_10614810 | |||
| 2029 | Ga0207670_10040585 | |||
| 2030 | Ga0207670_10077932 | |||
| 2031 | Ga0207670_10285495 | |||
| 2032 | Ga0207669_10021397 | |||
| 2033 | Ga0207669_10028967 | |||
| 2034 | Ga0207704_10030321 | |||
| 2035 | Ga0207704_10083355 | |||
| 2036 | Ga0207704_10189246 | |||
| 2037 | Ga0207704_10507870 | |||
| 2038 | Ga0207665_10041272 | |||
| 2039 | Ga0207665_10044745 | |||
| 2040 | Ga0207665_10074809 | |||
| 2041 | Ga0207665_10280429 | |||
| 2042 | Ga0207665_10435802 | |||
| 2043 | Ga0207691_10181406 | |||
| 2044 | Ga0207691_10328797 | |||
| 2045 | Ga0207711_10038983 | |||
| 2046 | Ga0207711_10198432 | |||
| 2047 | Ga0207711_10219976 | |||
| 2048 | Ga0207711_10269175 | |||
| 2049 | Ga0207711_10475954 | |||
| 2050 | Ga0207689_10210416 | |||
| 2051 | Ga0207661_10014009 | |||
| 2052 | Ga0207661_10258888 | |||
| 2053 | Ga0207661_10345457 | |||
| 2054 | Ga0207661_10512847 | |||
| 2055 | Ga0207661_10851454 | |||
| 2056 | Ga0207679_10107458 | |||
| 2057 | Ga0207679_10128420 | |||
| 2058 | Ga0207679_10277166 | |||
| 2059 | Ga0207679_10288320 | |||
| 2060 | Ga0207679_10689409 | |||
| 2061 | Ga0207679_10723765 | |||
| 2062 | Ga0207667_10276763 | |||
| 2063 | Ga0207667_10367086 | |||
| 2064 | Ga0207667_10499945 | |||
| 2065 | Ga0207651_10300858 | |||
| 2066 | Ga0207651_10626270 | |||
| 2067 | Ga0207712_10114484 | |||
| 2068 | Ga0207712_10196606 | |||
| 2069 | Ga0207668_10141878 | |||
| 2070 | Ga0207668_10360304 | |||
| 2071 | Ga0207668_10447354 | |||
| 2072 | Ga0207640_10075676 | |||
| 2073 | Ga0207658_10379372 | |||
| 2074 | Ga0207677_10094900 | |||
| 2075 | Ga0207677_10174720 | |||
| 2076 | Ga0207677_10184915 | |||
| 2077 | Ga0207677_11002667 | |||
| 2078 | Ga0207677_11245487 | |||
| 2079 | Ga0207703_10020015 | |||
| 2080 | Ga0207703_10032602 | |||
| 2081 | Ga0207703_10147853 | |||
| 2082 | Ga0207703_10341370 | |||
| 2083 | Ga0207639_10015571 | |||
| 2084 | Ga0207639_10392838 | |||
| 2085 | Ga0207678_10161912 | |||
| 2086 | Ga0207678_10194575 | |||
| 2087 | Ga0207678_10244121 | |||
| 2088 | Ga0207708_10000318 | |||
| 2089 | Ga0207708_10001272 | |||
| 2090 | Ga0207708_10023900 | |||
| 2091 | Ga0207708_10384606 | |||
| 2092 | Ga0207708_10513376 | |||
| 2093 | Ga0207702_10011169 | |||
| 2094 | Ga0207702_10035064 | |||
| 2095 | Ga0207702_10068952 | |||
| 2096 | Ga0207702_10219670 | |||
| 2097 | Ga0207702_11184294 | |||
| 2098 | Ga0207702_11260744 | |||
| 2099 | Ga0207641_11141700 | |||
| 2100 | Ga0207648_10003992 | |||
| 2101 | Ga0207648_10020641 | |||
| 2102 | Ga0207648_10198847 | |||
| 2103 | Ga0207648_10313251 | |||
| 2104 | Ga0207676_10038667 | |||
| 2105 | Ga0207676_10074588 | |||
| 2106 | Ga0207674_10000602 | |||
| 2107 | Ga0207674_10001034 | |||
| 2108 | Ga0207674_10009302 | |||
| 2109 | Ga0207674_10082086 | |||
| 2110 | Ga0207675_100003964 | |||
| 2111 | Ga0207675_100011807 | |||
| 2112 | Ga0207675_100041266 | |||
| 2113 | Ga0207675_100062109 | |||
| 2114 | Ga0207675_100162269 | |||
| 2115 | Ga0207683_10000215 | |||
| 2116 | Ga0207683_10002095 | |||
| 2117 | Ga0207683_10004391 | |||
| 2118 | Ga0207683_10050021 | |||
| 2119 | Ga0207683_10367466 | |||
| 2120 | Ga0207698_10126200 | |||
| 2121 | Ga0207698_10324086 | |||
| 2122 | Ga0209966_1002356 | |||
| 2123 | Ga0207428_10005092 | |||
| 2124 | Ga0207428_10007271 | |||
| 2125 | Ga0207428_10026245 | |||
| 2126 | Ga0207428_10118965 | |||
| 2127 | Ga0207428_10120950 | |||
| 2128 | Ga0207428_10261940 | |||
| 2129 | Ga0268266_10159422 | |||
| 2130 | Ga0268266_10229934 | |||
| 2131 | Ga0268266_10809673 | |||
| 2132 | Ga0268264_10026733 | |||
| 2133 | Ga0268264_10462830 | |||
| 2134 | Ga0265319_1036944 | |||
| 2135 | Ga0265320_10018694 | |||
| 2136 | Ga0307408_100583404 | |||
| 2137 | Ga0265314_10189034 | |||
| 2138 | Ga0307413_10034557 | |||
| 2139 | Ga0307413_11168665 | |||
| 2140 | Ga0307410_10028304 | |||
| 2141 | Ga0307410_10159319 | |||
| 2142 | Ga0307410_10543305 | |||
| 2143 | Ga0307410_11145263 | |||
| 2144 | Ga0307406_10099792 | |||
| 2145 | Ga0307406_10125445 | |||
| 2146 | Ga0307406_10140451 | |||
| 2147 | Ga0307409_100033311 | |||
| 2148 | Ga0307416_100014462 | |||
| 2149 | Ga0307416_100014964 | |||
| 2150 | Ga0307416_100075190 | |||
| 2151 | Ga0307416_100089581 | |||
| 2152 | Ga0307416_100166563 | |||
| 2153 | Ga0307416_100177782 | |||
| 2154 | Ga0307416_100323901 | |||
| 2155 | Ga0307414_10274653 | |||
| 2156 | Ga0307411_10198678 | |||
| 2157 | Ga0307415_100000283 | |||
| 2158 | Ga0307415_100588117 | |||
| 2159 | Ga0373948_0000987 | |||
| 2160 | Ga0373950_0006398 | |||
| 2161 | Ga0373958_0002079 | |||
| 2162 | Ga0373959_0008553 | |||
| 2163 | Ga0373938_0007321 | |||
| 2164 | Ga0373928_0006086 | |||
| 2165 | Ga0373929_0001505 | |||
| 2166 | Ga0373929_0037208 | |||
| 2167 | Ga0373940_0003105 | |||
| 2168 | Ga0373949_0001447 | |||
| 2169 | Ga0373949_0014141 | |||
| 2170 | Ga0373949_0094059 | |||
| 2171 | Ga0373951_0005316 | |||
| 2172 | Ga0373952_0001824 | |||
| 2173 | Ga0373952_0036549 | |||
| 2174 | Ga0373952_0060070 | |||
| 2175 | Ga0373932_0000884 | |||
| 2176 | Ga0373932_0079177 | |||
| 2177 | Ga0373932_0188049 | |||
| 2178 | Ga0373939_0003770 | |||
| 2179 | Ga0373941_0007609 | |||
| 2180 | Ga0373941_0039119 | |||
| 2181 | Ga0373941_0208125 | |||
| 2182 | Ga0373945_0008033 | |||
| 2183 | Ga0373960_0000300 | |||
| 2184 | Ga0373960_0005826 | |||
| 2185 | Ga0373960_0306280 | |||
| 2186 | Ga0373943_0090566 | |||
| 2187 | Ga0373943_0127907 | |||
| 2188 | Ga0373943_0139802 | |||
| 2189 | Ga0373942_0004007 | |||
| 2190 | Ga0373942_0037813 | |||
| 2191 | Ga0373942_0163541 | |||
| 2192 | Ga0373961_0002740 | |||
| 2193 | Ga0373961_0074772 | |||
| 2194 | Ga0373961_0104910 | |||
| 2195 | Ga0373961_0108015 | |||
| 2196 | Ga0373962_0000470 | |||
| 2197 | Ga0373962_0010348 | |||
| 2198 | Ga0316574_0077842 | |||
| 2199 | Ga0373931_0005860 | |||
| 2200 | Ga0373931_0014422 | |||
| 2201 | Ga0373931_0587323 | |||
| 2202 | Ga0373935_0079542 | |||
| 2203 | Ga0373935_0363106 | |||
| 2204 | Ga0373927_0124105 | |||
| 2205 | Ga0373933_0199870 | |||
| 2206 | Ga0373947_0038718 | |||
| 2207 | Ga0373947_0179136 | |||
| 2208 | Ga0373937_0311652 | |||
| 2209 | Ga0373937_0381837 | |||
| 2210 | Ga0373925_0041238 | |||
| 2211 | Ga0373925_0069444 | |||
| 2212 | Ga0373925_0401233 | |||
| 2213 | Ga0395899_0004381 | |||
| 2214 | Ga0395899_0006296 | |||
| 2215 | Ga0395899_0009034 | |||
| 2216 | Ga0395899_0009701 | |||
| 2217 | Ga0395899_0009738 | |||
| 2218 | Ga0395899_0018693 | |||
| 2219 | Ga0395899_0090114 | |||
| 2220 | Ga0395899_0100492 | |||
| 2221 | Ga0395899_0103355 | |||
| 2222 | Ga0395899_0109350 | |||
| 2223 | Ga0395899_0121975 | |||
| 2224 | Ga0395899_0141765 | |||
| 2225 | Ga0395900_0002094 | |||
| 2226 | Ga0395900_0002557 | |||
| 2227 | Ga0395900_0005285 | |||
| 2228 | Ga0395900_0006119 | |||
| 2229 | Ga0395900_0009995 | |||
| 2230 | Ga0395900_0032874 | |||
| 2231 | Ga0395900_0036840 | |||
| 2232 | Ga0395900_0054562 | |||
| 2233 | Ga0395900_0055402 | |||
| 2234 | Ga0395900_0070114 | |||
| 2235 | Ga0395900_0087955 | |||
| 2236 | Ga0395900_0099679 | |||
| 2237 | Ga0395900_0106579 | |||
| 2238 | Ga0395900_0108196 | |||
| 2239 | Ga0395900_0117837 | |||
| 2240 | Ga0395900_0172039 | |||
| 2241 | Ga0395900_0186796 | |||
| 2242 | Ga0395900_0206385 | |||
| 2243 | Ga0395900_0283018 | |||
| 2244 | Ga0395900_0287832 | |||
| 2245 | Ga0395900_0591291 | |||
| 2246 | Ga0395900_0642403 | |||
| 2247 | Ga0395900_0644498 | |||
| 2248 | Ga0395900_1266685 | |||
| 2249 | Ga0395898_0002920 | |||
| 2250 | Ga0395898_0005446 | |||
| 2251 | Ga0395898_0007665 | |||
| 2252 | Ga0395898_0008336 | |||
| 2253 | Ga0395898_0014060 | |||
| 2254 | Ga0395898_0016773 | |||
| 2255 | Ga0395898_0023607 | |||
| 2256 | Ga0395898_0025755 | |||
| 2257 | Ga0395898_0028354 | |||
| 2258 | Ga0395898_0031904 | |||
| 2259 | Ga0395898_0067017 | |||
| 2260 | Ga0395898_0175848 | |||
| 2261 | Ga0395898_0186093 | |||
| 2262 | Ga0395898_0209053 | |||
| 2263 | Ga0395898_0227878 | |||
| 2264 | Ga0395898_0360951 | |||
| 2265 | Ga0395898_0370198 | |||
| 2266 | Ga0395898_0370779 | |||
| 2267 | Ga0395898_0424408 | |||
| 2268 | Ga0395898_0455951 | |||
| 2269 | Ga0395898_0672639 | |||
| 2270 | Ga0395905_0000615 | |||
| 2271 | Ga0395905_0001573 | |||
| 2272 | Ga0395905_0004096 | |||
| 2273 | Ga0395905_0006308 | |||
| 2274 | Ga0395905_0006717 | |||
| 2275 | Ga0395905_0013697 | |||
| 2276 | Ga0395905_0021395 | |||
| 2277 | Ga0395905_0043580 | |||
| 2278 | Ga0395905_0053744 | |||
| 2279 | Ga0395905_0067743 | |||
| 2280 | Ga0395905_0091745 | |||
| 2281 | Ga0395905_0116819 | |||
| 2282 | Ga0395905_0146366 | |||
| 2283 | Ga0395905_0161816 | |||
| 2284 | Ga0395905_0215907 | |||
| 2285 | Ga0395905_0650318 | |||
| 2286 | Ga0395905_0755800 | |||
| 2287 | Ga0395905_0883556 | |||
| 2288 | Ga0395905_0958680 | |||
| 2289 | Ga0395901_0001769 | |||
| 2290 | Ga0395901_0003610 | |||
| 2291 | Ga0395901_0004266 | |||
| 2292 | Ga0395901_0005433 | |||
| 2293 | Ga0395901_0007585 | |||
| 2294 | Ga0395901_0016950 | |||
| 2295 | Ga0395901_0026811 | |||
| 2296 | Ga0395901_0032519 | |||
| 2297 | Ga0395901_0041499 | |||
| 2298 | Ga0395901_0043878 | |||
| 2299 | Ga0395901_0044425 | |||
| 2300 | Ga0395901_0053962 | |||
| 2301 | Ga0395901_0070288 | |||
| 2302 | Ga0395901_0074676 | |||
| 2303 | Ga0395901_0077102 | |||
| 2304 | Ga0395901_0109540 | |||
| 2305 | Ga0395901_0111707 | |||
| 2306 | Ga0395901_0115402 | |||
| 2307 | Ga0395901_0144427 | |||
| 2308 | Ga0395901_0148589 | |||
| 2309 | Ga0395901_0160209 | |||
| 2310 | Ga0395901_0198258 | |||
| 2311 | Ga0395901_0240051 | |||
| 2312 | Ga0395901_0257393 | |||
| 2313 | Ga0395901_0322862 | |||
| 2314 | Ga0395901_0344006 | |||
| 2315 | Ga0395901_0347435 | |||
| 2316 | Ga0395901_0518269 | |||
| 2317 | Ga0395901_0537790 | |||
| 2318 | Ga0395901_0549247 | |||
| 2319 | Ga0395901_0906463 | |||
| 2320 | Ga0395901_1279485 | |||
| 2321 | Ga0242420_037274 | |||
| 2322 | Ga0439466_0141176 | |||
| 2323 | Ga0451797_1467611 | |||
| 2324 | Ga0451802_1691267 | |||
| 2325 | Ga0451807_0097819 | |||
| 2326 | Ga0451807_1241121 | |||
| 2327 | Ga0451835_0553222 | |||
| 2328 | Ga0451837_1655606 | |||
| 2329 | Ga0451841_0721472 | |||
| 2330 | Ga0451845_0409218 | |||
| 2331 | Ga0451845_0836332 | |||
| 2332 | Ga0451847_0806778 | |||
| 2333 | Ga0451851_0166059 | |||
| 2334 | Ga0451853_0059875 | |||
| 2335 | Ga0451853_1772707 | |||
| 2336 | Ga0451853_1946777 | |||
| 2337 | Ga0439450_017884 | |||
| 2338 | Ga0439451_001152 | |||
| 2339 | Ga0439454_007894 | |||
| 2340 | Ga0439456_035532 | |||
| 2341 | Ga0439463_053845 | |||
| 2342 | Ga0439458_0060804 | |||
| 2343 | Ga0439435_0014525 | |||
| 2344 | Ga0439459_0131606 | |||
| 2345 | Ga0450918_031663 | |||
| 2346 | Ga0439440_0057277 | |||
| 2347 | Ga0439440_0058500 | |||
| 2348 | Ga0466969_0008738 | |||
| 2349 | Ga0466966_0044626 | |||
| 2350 | Ga0466961_0002904 | |||
| 2351 | Ga0466961_0212730 | |||
| 2352 | Ga0466963_0004919 | |||
| 2353 | Ga0466964_0007241 | |||
| 2354 | Ga0466964_0009363 | |||
| 2355 | Ga0466971_0002968 | |||
| 2356 | Ga0466968_0041210 | |||
| 2357 | Ga0466957_0001419 | |||
| 2358 | Ga0466957_0104398 | |||
| 2359 | Ga0466960_0041957 | |||
| 2360 | Ga0466960_0060342 | |||
| 2361 | Ga0466960_0065705 | |||
| 2362 | Ga0466959_0017850 | |||
| 2363 | Ga0466959_0107958 | |||
| 2364 | Ga0451576_0031312 | |||
| 2365 | Ga0451576_0085404 | |||
| 2366 | Ga0451576_0602839 | |||
| 2367 | Ga0466958_0024666 | |||
| 2368 | Ga0466967_0008294 | |||
| 2369 | Ga0466967_0050785 | |||
| 2370 | Ga0466967_0065595 | |||
| 2371 | Ga0466967_0069917 | |||
| 2372 | Ga0466967_0105251 | |||
| 2373 | Ga0495603_0001254 | |||
| 2374 | Ga0495603_0003282 | |||
| 2375 | Ga0495603_0023879 | |||
| 2376 | Ga0495590_0024229 | |||
| 2377 | Ga0495641_0109720 | |||
| 2378 | Ga0495641_0196017 | |||
| 2379 | Ga0495651_0100866 | |||
| 2380 | Ga0495651_0439136 | |||
| 2381 | Ga0495653_0384614 | |||
| 2382 | Ga0495580_0012092 | |||
| 2383 | Ga0495580_0139618 | |||
| 2384 | Ga0495580_0287843 | |||
| 2385 | Ga0495582_0013109 | |||
| 2386 | Ga0495582_0029479 | |||
| 2387 | Ga0495582_0041400 | |||
| 2388 | Ga0495582_0110975 | |||
| 2389 | Ga0495582_0166991 | |||
| 2390 | Ga0495605_0061978 | |||
| 2391 | Ga0495605_0105608 | |||
| 2392 | Ga0495605_0226410 | |||
| 2393 | Ga0495639_0076679 | |||
| 2394 | Ga0495639_0130695 | |||
| 2395 | Ga0495639_0191375 | |||
| 2396 | Ga0495662_0101690 | |||
| 2397 | Ga0495662_0136006 | |||
| 2398 | Ga0495584_0039360 | |||
| 2399 | Ga0495584_0055836 | |||
| 2400 | Ga0495584_0119056 | |||
| 2401 | Ga0495584_0245294 | |||
| 2402 | Ga0495584_0265287 | |||
| 2403 | Ga0495584_0372423 | |||
| 2404 | Ga0495584_0374782 | |||
| 2405 | Ga0495585_0111025 | |||
| 2406 | Ga0495594_0001015 | |||
| 2407 | Ga0495594_0081585 | |||
| 2408 | Ga0495594_0139143 | |||
| 2409 | Ga0495596_0006468 | |||
| 2410 | Ga0495596_0020797 | |||
| 2411 | Ga0495596_0109322 | |||
| 2412 | Ga0495596_0121433 | |||
| 2413 | Ga0495596_0155298 | |||
| 2414 | Ga0495607_0075484 | |||
| 2415 | Ga0495607_0200402 | |||
| 2416 | Ga0495583_0065757 | |||
| 2417 | Ga0495608_0129760 | |||
| 2418 | Ga0495608_0332954 | |||
| 2419 | Ga0495618_0066311 | |||
| 2420 | Ga0495628_0365518 | |||
| 2421 | Ga0495631_0016892 | |||
| 2422 | Ga0495631_0075870 | |||
| 2423 | Ga0495632_0095490 | |||
| 2424 | Ga0495643_0126590 | |||
| 2425 | Ga0495643_0341351 | |||
| 2426 | Ga0495663_0078791 | |||
| 2427 | Ga0495642_0040091 | |||
| 2428 | Ga0495642_0104273 | |||
| 2429 | Ga0495642_0124226 | |||
| 2430 | Ga0495652_0146936 | |||
| 2431 | Ga0495652_0276861 | |||
| 2432 | Ga0495652_0458653 | |||
| 2433 | Ga0495654_0128817 | |||
| 2434 | Ga0495640_0428603 | |||
| 2435 | Ga0495609_0054642 | |||
| 2436 | Ga0495609_0082046 | |||
| 2437 | Ga0495609_0088536 | |||
| 2438 | Ga0495609_0090278 | |||
| 2439 | Ga0495667_0088977 | |||
| 2440 | Ga0495656_0024249 | |||
| 2441 | Ga0495656_0072547 | |||
| 2442 | Ga0495656_0085206 | |||
| 2443 | Ga0495656_0132548 | |||
| 2444 | Ga0495656_0133226 | |||
| 2445 | Ga0495656_0220716 | |||
| 2446 | Ga0495656_0435519 | |||
| 2447 | Ga0495668_0073557 | |||
| 2448 | Ga0495668_0105446 | |||
| 2449 | Ga0495668_0268413 | |||
| 2450 | Ga0495634_0196208 | |||
| 2451 | Ga0495611_0137121 | |||
| 2452 | Ga0495635_0074043 | |||
| 2453 | Ga0495659_0011728 | |||
| 2454 | Ga0495661_0264446 | |||
| 2455 | Ga0495588_0000696 | |||
| 2456 | Ga0495588_0126094 | |||
| 2457 | Ga0495588_0171507 | |||
| 2458 | Ga0495588_0185277 | |||
| 2459 | Ga0495588_0410337 | |||
| 2460 | Ga0495623_0221074 | |||
| 2461 | Ga0495646_0165256 | |||
| 2462 | Ga0495646_0200524 | |||
| 2463 | Ga0495647_0022377 | |||
| 2464 | Ga0495647_0145540 | |||
| 2465 | Ga0495658_0027545 | |||
| 2466 | Ga0495658_0065955 | |||
| 2467 | Ga0495658_0103135 | |||
| 2468 | Ga0495669_0077715 | |||
| 2469 | Ga0495613_0059074 | |||
| 2470 | Ga0495613_0449472 | |||
| 2471 | Ga0495624_0188782 | |||
| 2472 | Ga0495670_0064403 | |||
| 2473 | Ga0495670_0209509 | |||
| 2474 | Ga0495670_0267663 | |||
| 2475 | Ga0495671_0096092 | |||
| 2476 | Ga0495589_0007188 | |||
| 2477 | Ga0495589_0217316 | |||
| 2478 | Ga0495589_0258599 | |||
| 2479 | Ga0495600_0105092 | |||
| 2480 | Ga0495581_0003961 | |||
| 2481 | Ga0495581_0005721 | |||
| 2482 | Ga0495581_0350081 | |||
| 2483 | Ga0495604_0057660 | |||
| 2484 | Ga0495636_0023358 | |||
| 2485 | Ga0495636_0089618 | |||
| 2486 | Ga0495674_0029754 | |||
| 2487 | Ga0495674_0041452 | |||
| 2488 | Ga0495674_0698396 | |||
| 2489 | Ga0495676_0000879 | |||
| 2490 | Ga0495676_0064108 | |||
| 2491 | Ga0495676_0111355 | |||
| 2492 | Ga0495676_0182105 | |||
| 2493 | Ga0495676_0500821 | |||
| 2494 | Ga0495683_0053927 | |||
| 2495 | Ga0495683_0208760 | |||
| 2496 | Ga0495675_0102645 | |||
| 2497 | Ga0495677_0038650 | |||
| 2498 | Ga0495677_0042134 | |||
| 2499 | Ga0495677_0107510 | |||
| 2500 | Ga0495679_046866 | |||
| 2501 | Ga0495685_022123 | |||
| 2502 | Ga0495685_105429 | |||
| 2503 | Ga0495684_0041444 | |||
| 2504 | Ga0495684_0104319 | |||
| 2505 | Ga0495626_0040809 | |||
| 2506 | Ga0496100_0009888 | |||
| 2507 | Ga0496100_0016648 | |||
| 2508 | Ga0496100_0037077 | |||
| 2509 | Ga0496100_0161319 | |||
| 2510 | Ga0496100_0193023 | |||
| 2511 | Ga0496100_0336058 | |||
| 2512 | Ga0496100_0439557 | |||
| 2513 | Ga0496100_0585981 | |||
| 2514 | Ga0496101_0027209 | |||
| 2515 | Ga0496101_0033793 | |||
| 2516 | Ga0496101_0133993 | |||
| 2517 | Ga0496101_0154747 | |||
| 2518 | Ga0496101_0194943 | |||
| 2519 | Ga0496101_0295644 | |||
| 2520 | Ga0496101_0449761 | |||
| 2521 | Ga0496101_0518280 | |||
| 2522 | Ga0496101_0807692 | |||
| 2523 | Ga0496102_0007258 | |||
| 2524 | Ga0496102_0066625 | |||
| 2525 | Ga0496102_0076345 | |||
| 2526 | Ga0496102_0111461 | |||
| 2527 | Ga0496102_0178625 | |||
| 2528 | Ga0496102_0220104 | |||
| 2529 | Ga0496102_0222257 | |||
| 2530 | Ga0496102_0636828 | |||
| 2531 | Ga0496102_1092784 | |||
| 2532 | Ga0496103_0007528 | |||
| 2533 | Ga0496103_0015734 | |||
| 2534 | Ga0496103_0021459 | |||
| 2535 | Ga0496103_0040061 | |||
| 2536 | Ga0496103_0079096 | |||
| 2537 | Ga0496103_0337717 | |||
| 2538 | Ga0496104_0000568 | |||
| 2539 | Ga0496104_0010563 | |||
| 2540 | Ga0496104_0043904 | |||
| 2541 | Ga0496104_0059519 | |||
| 2542 | Ga0496104_0137477 | |||
| 2543 | Ga0496104_0226148 | |||
| 2544 | Ga0496104_0399615 | |||
| 2545 | Ga0496104_0819904 | |||
| 2546 | Ga0496105_0000457 | |||
| 2547 | Ga0496105_0002396 | |||
| 2548 | Ga0496105_0004767 | |||
| 2549 | Ga0496105_0005072 | |||
| 2550 | Ga0496105_0006996 | |||
| 2551 | Ga0496105_0007239 | |||
| 2552 | Ga0496105_0022270 | |||
| 2553 | Ga0496105_0108306 | |||
| 2554 | Ga0496105_0239933 | |||
| 2555 | Ga0496105_0621179 | |||
| 2556 | Ga0496106_0003674 | |||
| 2557 | Ga0496106_0012382 | |||
| 2558 | Ga0496106_0072295 | |||
| 2559 | Ga0496106_0085511 | |||
| 2560 | Ga0496106_0116674 | |||
| 2561 | Ga0496106_0167030 | |||
| 2562 | Ga0496106_0622079 | |||
| 2563 | Ga0496107_0004641 | |||
| 2564 | Ga0496107_0043346 | |||
| 2565 | Ga0496107_0046988 | |||
| 2566 | Ga0496107_0182871 | |||
| 2567 | Ga0496107_0231764 | |||
| 2568 | Ga0496107_0258061 | |||
| 2569 | Ga0496107_0882661 | |||
| 2570 | Ga0496108_0002627 | |||
| 2571 | Ga0496108_0006684 | |||
| 2572 | Ga0496108_0024613 | |||
| 2573 | Ga0496108_0026971 | |||
| 2574 | Ga0496108_0030460 | |||
| 2575 | Ga0496108_0122697 | |||
| 2576 | Ga0496108_0207247 | |||
| 2577 | Ga0496108_0319801 | |||
| 2578 | Ga0496108_0346431 | |||
| 2579 | Ga0496108_0388697 | |||
| 2580 | Ga0496109_0002827 | |||
| 2581 | Ga0496109_0007630 | |||
| 2582 | Ga0496109_0008726 | |||
| 2583 | Ga0496109_0008994 | |||
| 2584 | Ga0496109_0014010 | |||
| 2585 | Ga0496109_0015471 | |||
| 2586 | Ga0496109_0059306 | |||
| 2587 | Ga0496109_0102525 | |||
| 2588 | Ga0496109_0102667 | |||
| 2589 | Ga0496109_0105412 | |||
| 2590 | Ga0496109_0139385 | |||
| 2591 | Ga0496109_0272041 | |||
| 2592 | Ga0496109_0335251 | |||
| 2593 | Ga0496109_0463888 | |||
| 2594 | Ga0496109_0709289 | |||
| 2595 | Ga0496110_0000054 | |||
| 2596 | Ga0496110_0000980 | |||
| 2597 | Ga0496110_0019346 | |||
| 2598 | Ga0496110_0020491 | |||
| 2599 | Ga0496110_0073489 | |||
| 2600 | Ga0496110_0216320 | |||
| 2601 | Ga0496111_0000156 | |||
| 2602 | Ga0496111_0000243 | |||
| 2603 | Ga0496111_0013181 | |||
| 2604 | Ga0496111_0020816 | |||
| 2605 | Ga0496111_0039385 | |||
| 2606 | Ga0496111_0082287 | |||
| 2607 | Ga0496111_0134640 | |||
| 2608 | Ga0496112_0000300 | |||
| 2609 | Ga0496112_0025114 | |||
| 2610 | Ga0496112_0035423 | |||
| 2611 | Ga0496112_0040341 | |||
| 2612 | Ga0496112_0051694 | |||
| 2613 | Ga0496112_0053844 | |||
| 2614 | Ga0496112_0058787 | |||
| 2615 | Ga0496112_0113776 | |||
| 2616 | Ga0496112_0136060 | |||
| 2617 | Ga0496112_0587901 | |||
| 2618 | Ga0496112_0762430 | |||
| 2619 | Ga0496113_0000275 | |||
| 2620 | Ga0496113_0041747 | |||
| 2621 | Ga0496113_0063608 | |||
| 2622 | Ga0496113_0089816 | |||
| 2623 | Ga0496114_0005825 | |||
| 2624 | Ga0496114_0008296 | |||
| 2625 | Ga0496114_0011918 | |||
| 2626 | Ga0496114_0028280 | |||
| 2627 | Ga0496114_0031921 | |||
| 2628 | Ga0496114_0034894 | |||
| 2629 | Ga0496114_0068918 | |||
| 2630 | Ga0496114_0082235 | |||
| 2631 | Ga0496114_0154982 | |||
| 2632 | Ga0496114_0221721 | |||
| 2633 | Ga0496114_0390771 | |||
| 2634 | Ga0496114_0438688 | |||
| 2635 | Ga0496114_0495874 | |||
| 2636 | Ga0496114_0512216 | |||
| 2637 | Ga0496114_0843231 | |||
| 2638 | Ga0496115_0008732 | |||
| 2639 | Ga0496115_0021128 | |||
| 2640 | Ga0496115_0033634 | |||
| 2641 | Ga0496115_0038218 | |||
| 2642 | Ga0496115_0092162 | |||
| 2643 | Ga0496115_0099710 | |||
| 2644 | Ga0496115_0116868 | |||
| 2645 | Ga0496115_0135960 | |||
| 2646 | Ga0496115_0225347 | |||
| 2647 | Ga0496115_0637962 | |||
| 2648 | Ga0501031_0137555 | |||
| 2649 | Ga0501033_0011314 | |||
| 2650 | Ga0501033_0153639 | |||
| 2651 | Ga0501034_0709802 | |||
| 2652 | Ga0501036_0064525 | |||
| 2653 | Ga0501036_0099881 | |||
| 2654 | Ga0501036_0192735 | |||
| 2655 | Ga0501036_0243293 | |||
| 2656 | Ga0501036_0643714 | |||
| 2657 | Ga0501037_0135447 | |||
| 2658 | Ga0501037_0156962 | |||
| 2659 | Ga0501037_0191287 | |||
| 2660 | Ga0501037_0465709 | |||
| 2661 | Ga0501038_0002835 | |||
| 2662 | Ga0501039_0002978 | |||
| 2663 | Ga0501039_0034693 | |||
| 2664 | Ga0501039_0297314 | |||
| 2665 | Ga0501039_0458766 | |||
| 2666 | Ga0501040_0003917 | |||
| 2667 | Ga0501040_0056074 | |||
| 2668 | Ga0501040_0160636 | |||
| 2669 | Ga0501041_0007132 | |||
| 2670 | Ga0501041_0013352 | |||
| 2671 | Ga0501041_0109467 | |||
| 2672 | Ga0501041_0155772 | |||
| 2673 | Ga0501041_0242916 | |||
| 2674 | Ga0501042_0034401 | |||
| 2675 | Ga0501042_0160716 | |||
| 2676 | Ga0501042_0349905 | |||
| 2677 | Ga0501042_0372307 | |||
| 2678 | Ga0501046_0170685 | |||
| 2679 | Ga0501047_0056961 | |||
| 2680 | Ga0501047_0113994 | |||
| 2681 | Ga0501047_0489799 | |||
| 2682 | Ga0501048_0002599 | |||
| 2683 | Ga0501048_0019984 | |||
| 2684 | Ga0501048_0030138 | |||
| 2685 | Ga0501048_0258234 | |||
| 2686 | Ga0501048_0466049 | |||
| 2687 | Ga0501067_0006992 | |||
| 2688 | Ga0501067_0019921 | |||
| 2689 | Ga0501067_0070099 | |||
| 2690 | Ga0501067_0075307 | |||
| 2691 | Ga0501067_0167565 | |||
| 2692 | Ga0501067_0260032 | |||
| 2693 | Ga0501068_0016659 | |||
| 2694 | Ga0501068_0034780 | |||
| 2695 | Ga0501068_0178574 | |||
| 2696 | Ga0501069_0027406 | |||
| 2697 | Ga0501069_0031671 | |||
| 2698 | Ga0501069_0082803 | |||
| 2699 | Ga0501069_0406856 | |||
| 2700 | Ga0501070_0049461 | |||
| 2701 | Ga0501070_0160124 | |||
| 2702 | Ga0501070_0639710 | |||
| 2703 | Ga0501071_0002211 | |||
| 2704 | Ga0501071_0049718 | |||
| 2705 | Ga0501071_0066101 | |||
| 2706 | Ga0501071_0103252 | |||
| 2707 | Ga0501071_0116465 | |||
| 2708 | Ga0501071_0497897 | |||
| 2709 | Ga0501072_0011137 | |||
| 2710 | Ga0501072_0080055 | |||
| 2711 | Ga0501072_0136297 | |||
| 2712 | Ga0501072_0313160 | |||
| 2713 | Ga0501072_0627938 | |||
| 2714 | Ga0501074_0007610 | |||
| 2715 | Ga0501074_0275471 | |||
| 2716 | Ga0501074_0329299 | |||
| 2717 | Ga0501074_0515855 | |||
| 2718 | Ga0501075_0003490 | |||
| 2719 | Ga0501075_0050367 | |||
| 2720 | Ga0501075_0063980 | |||
| 2721 | Ga0501075_0172661 | |||
| 2722 | Ga0501075_0308010 | |||
| 2723 | Ga0501075_0626285 | |||
| 2724 | Ga0501076_0006835 | |||
| 2725 | Ga0501076_0045765 | |||
| 2726 | Ga0501076_0129651 | |||
| 2727 | Ga0501076_0360422 | |||
| 2728 | Ga0501076_0815469 | |||
| 2729 | Ga0501077_0003797 | |||
| 2730 | Ga0501077_0011455 | |||
| 2731 | Ga0501077_0037016 | |||
| 2732 | Ga0501077_0072119 | |||
| 2733 | Ga0501077_0101464 | |||
| 2734 | Ga0501077_0102055 | |||
| 2735 | Ga0501077_0230285 | |||
| 2736 | Ga0501077_0237985 | |||
| 2737 | Ga0501079_0004409 | |||
| 2738 | Ga0501079_0098607 | |||
| 2739 | Ga0501079_0269982 | |||
| 2740 | Ga0501080_0204349 | |||
| 2741 | Ga0501080_0260291 | |||
| 2742 | Ga0501080_0285866 | |||
| 2743 | Ga0501080_0287419 | |||
| 2744 | Ga0501080_1108018 | |||
| 2745 | Ga0501081_0001579 | |||
| 2746 | Ga0501081_0089873 | |||
| 2747 | Ga0501081_0236908 | |||
| 2748 | Ga0501081_0274822 | |||
| 2749 | Ga0501083_0042992 | |||
| 2750 | Ga0501035_0007148 | |||
| 2751 | Ga0501044_0954161 | |||
| 2752 | Ga0501045_0109987 | |||
| 2753 | Ga0501045_0112180 | |||
| 2754 | Ga0501045_0461019 | |||
| 2755 | nmdc:mga03683_52902_c1 | |||
| 2756 | nmdc:mga00v17_442877_c1 | |||
| 2757 | nmdc:mga0k408_293362_c1 | |||
| 2758 | nmdc:mga05p37_154440_c1 | |||
| 2759 | nmdc:mga05p37_229940_c1 | |||
| 2760 | nmdc:mga05p37_444007_c1 | |||
| 2761 | nmdc:mga05p37_467866_c1 | |||
| 2762 | nmdc:mga05p37_52745_c1 | |||
| 2763 | nmdc:mga05p37_815300_c1 | |||
| 2764 | nmdc:mga05p37_844865_c1 | |||
| 2765 | nmdc:mga05p37_86206_c1 | |||
| 2766 | nmdc:mga09592_20016_c1 | |||
| 2767 | nmdc:mga09592_229046_c1 | |||
| 2768 | nmdc:mga09592_311048_c1 | |||
| 2769 | nmdc:mga09592_7064_c1 | |||
| 2770 | nmdc:mga09592_82492_c1 | |||
| 2771 | nmdc:mga0qj67_116856_c1 | |||
| 2772 | nmdc:mga0qj67_168230_c1 | |||
| 2773 | nmdc:mga0qj67_212520_c1 | |||
| 2774 | nmdc:mga0qj67_464757_c1 | |||
| 2775 | nmdc:mga0qj67_869199_c1 | |||
| 2776 | nmdc:mga06r32_108204_c1 | |||
| 2777 | nmdc:mga06r32_172594_c1 | |||
| 2778 | nmdc:mga06r32_343702_c1 | |||
| 2779 | nmdc:mga06r32_44390_c1 | |||
| 2780 | nmdc:mga06r32_512261_c1 | |||
| 2781 | nmdc:mga06r32_55175_c1 | |||
| 2782 | nmdc:mga06r32_719770_c1 | |||
| 2783 | nmdc:mga08y16_270030_c1 | |||
| 2784 | nmdc:mga08y16_2814_c1 | |||
| 2785 | nmdc:mga08y16_31729_c1 | |||
| 2786 | nmdc:mga08y16_32986_c1 | |||
| 2787 | nmdc:mga08y16_418545_c1 | |||
| 2788 | nmdc:mga08y16_59413_c1 | |||
| 2789 | nmdc:mga08y16_61338_c1 | |||
| 2790 | nmdc:mga08y16_643010_c1 | |||
| 2791 | nmdc:mga08y16_97069_c1 | |||
| 2792 | nmdc:mga0n895_117193_c1 | |||
| 2793 | nmdc:mga0n895_14920_c1 | |||
| 2794 | nmdc:mga0n895_228035_c1 | |||
| 2795 | nmdc:mga0n895_241324_c1 | |||
| 2796 | nmdc:mga0n895_311848_c1 | |||
| 2797 | nmdc:mga0n895_31746_c1 | |||
| 2798 | nmdc:mga0n895_325684_c1 | |||
| 2799 | nmdc:mga0n895_66179_c1 | |||
| 2800 | nmdc:mga0rr50_119590_c1 | |||
| 2801 | nmdc:mga0rr50_174028_c1 | |||
| 2802 | nmdc:mga0rr50_190381_c1 | |||
| 2803 | nmdc:mga0rr50_198141_c1 | |||
| 2804 | nmdc:mga08x19_157336_c1 | |||
| 2805 | nmdc:mga08x19_232619_c1 | |||
| 2806 | nmdc:mga08x19_30892_c1 | |||
| 2807 | nmdc:mga08x19_64245_c1 | |||
| 2808 | nmdc:mga0a205_16661_c1 | |||
| 2809 | nmdc:mga0a205_214689_c1 | |||
| 2810 | nmdc:mga0a205_217420_c1 | |||
| 2811 | nmdc:mga0a205_39141_c1 | |||
| 2812 | nmdc:mga0a205_467391_c1 | |||
| 2813 | nmdc:mga0a205_634673_c1 | |||
| 2814 | nmdc:mga0a205_66865_c2 | |||
| 2815 | nmdc:mga0a205_949291_c1 | |||
| 2816 | Ga0495601_0027307 | |||
| 2817 | Ga0495601_0173957 | |||
| 2818 | Ga0495601_0214714 | |||
| 2819 | Ga0495612_0044060 | |||
| 2820 | Ga0495655_0075976 | |||
| 2821 | Ga0495595_0280013 | |||
| 2822 | Ga0495595_0313413 | |||
| 2823 | Ga0495595_0314879 | |||
| 2824 | Ga0495619_0022307 | |||
| 2825 | Ga0495619_0578085 | |||
| 2826 | Ga0501084_0002637 | |||
| 2827 | Ga0501084_0018862 | |||
| 2828 | Ga0501084_0070642 | |||
| 2829 | Ga0501084_0229688 | |||
| 2830 | Ga0590075_131431 | |||
| 2831 | Ga0587084_023551 | |||
| 2832 | Ga0587066_046455 | |||
| 2833 | Ga0587077_023304 | |||
| 2834 | Ga0587082_032460 | |||
| 2835 | Ga0587082_053888 | |||
| 2836 | Ga0587083_0063175 | |||
| 2837 | Ga0587083_0082448 | |||
| 2838 | Ga0587085_015779 | |||
| 2839 | Ga0587085_074283 | |||
| 2840 | Ga0587091_050018 | |||
| 2841 | Ga0587094_022837 | |||
| 2842 | Ga0587128_027912 | |||
| 2843 | Ga0587069_075407 | |||
| 2844 | Ga0587079_069111 | |||
| 2845 | Ga0587119_012725 | |||
| 2846 | Ga0587071_024076 | |||
| 2847 | Ga0587071_050534 | |||
| 2848 | Ga0501082_0009071 | |||
| 2849 | Ga0501082_0030563 | |||
| 2850 | Ga0501082_0147088 | |||
| 2851 | Ga0501082_0288122 | |||
| 2852 | Ga0501082_0405716 | |||
| 2853 | Ga0466962_0016793 | |||
| 2854 | Ga0466962_0035971 | |||
| 2855 | Ga0530510_0010517 | |||
| 2856 | Ga0530510_0024772 | |||
| 2857 | Ga0530510_0048071 | |||
| 2858 | Ga0530510_0069058 | |||
| 2859 | Ga0530510_0162878 | |||
| 2860 | Ga0530510_0347020 | |||
| 2861 | Ga0530510_0490602 | |||
| 2862 | Ga0530510_0845559 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 1m8p-assembly1.cif.gz_A | crystal structure of p. chrysogenum atp sulfurylase in the t-state | 0.976 | 2 | 175 |
| 1i2d-assembly1.cif.gz_A | crystal structure of atp sulfurylase from penicillium chrysogenum | 0.9725 | 2 | 175 |
| 1m7g-assembly1.cif.gz_B | crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps | 0.9724 | 1 | 179 |
| 2gks-assembly1.cif.gz_A | crystal structure of the bi-functional atp sulfurylase-aps kinase from aquifex aeolicus, a chemolithotrophic thermophile | 0.9719 | 2 | 178 |
| 1m7g-assembly2.cif.gz_D | crystal structure of aps kinase from penicillium chrysogenum: ternary structure with adp and aps | 0.9707 | 1 | 178 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1i2dC03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9727 | 2 | 175 | 3.40.50.300 |
| 2gksA03 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9719 | 2 | 178 | 3.40.50.300 |
| af_A0A2R8RUC9_5_216_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9656 | 3 | 178 | 3.40.50.300 |
| 5cb8B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9614 | 2 | 178 | 3.40.50.300 |
| af_P9WNM5_418_614_3.40.50.300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases | 0.9523 | 2 | 172 | 3.40.50.300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1Q6XCS7-F1-model_v4 | Adenylyl-sulfate kinase (EC 2.7.1.25) | 0.984 | 2 | 147 |
GO:0004020
GO:0004781 GO:0005524 GO:0005737 GO:0010134 GO:0019379 GO:0070814 |
| AF-K2G412-F1-model_v4 | Adenylylsulfate kinase domain containing protein | 0.9835 | 2 | 177 |
GO:0004020
GO:0004781 GO:0005524 GO:0005737 GO:0010134 GO:0019379 |
| AF-A0A3M1B3W4-F1-model_v4 | Adenylyl-sulfate kinase (EC 2.7.1.25) | 0.9829 | 2 | 175 |
GO:0004020
GO:0004781 GO:0005524 GO:0005737 GO:0010134 GO:0019379 GO:0070814 |
| AF-A0A1S1RHF2-F1-model_v4 | deleted | 0.9826 | 2 | 178 |
|
| AF-A0A1V2IDL2-F1-model_v4 | Adenylyl-sulfate kinase | 0.9823 | 2 | 178 |
GO:0004020
GO:0004781 GO:0005524 GO:0005737 GO:0010134 GO:0019379 |