F493794
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1416 | 410 | 2832 | 173 |
Family's Representative Sequence
| Representative Sequence | 3300045976|Ga0466967_0030523|Ga0466967_0030523_678_1199 |
| Length | 162 |
| Sequence | VAEIDLRTCVREVPDFPEAGVGFKDISPLLLDPEALQQAVGELADWTRERKADLVLGAEARGFWLGAAIAVEAGCGFVAARRPGKLPPETVSATYALEYGQNTLEVAADAIGGGARVVIHDDVLATGGTVEAIVGVNFVIELSFLEGRKRLTQYDLVSLLTY |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 2 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 3 | 3300000043 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 young rhizosphere | Metagenome | Rhizosphere |
| 4 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 5 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 6 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 7 | 3300002073 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 | Metagenome | Rhizosphere |
| 8 | 3300002075 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 | Metagenome | Rhizosphere |
| 9 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 10 | 3300002244 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 | Metagenome | Rhizosphere |
| 11 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 50 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 51 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 52 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 57 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 58 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 59 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 61 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 62 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 78 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 79 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 80 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 81 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 82 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 83 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 87 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 89 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 90 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 91 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 92 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 93 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 94 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 95 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 96 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 97 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 98 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 99 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 101 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 106 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300012515 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.7.yng.070610 | Metagenome | Rhizosphere |
| 115 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 127 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 131 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 199 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 203 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 204 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 205 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 206 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 207 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 208 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 209 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 210 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 211 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 212 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 213 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 214 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 215 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 216 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 217 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 218 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 219 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 220 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 221 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 222 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 223 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 224 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 225 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 226 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 227 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 228 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 229 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 230 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 231 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 232 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 233 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 234 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 235 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 237 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 239 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 240 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 241 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 242 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 243 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 244 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 245 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 246 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 247 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 248 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 249 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 250 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 251 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 252 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 253 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 254 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 255 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 256 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 257 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 258 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 259 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 260 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 261 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 262 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 263 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 264 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 265 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 266 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 267 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 268 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 269 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 270 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 271 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 276 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 277 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 278 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 279 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 280 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 281 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 282 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 283 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 345 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 346 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 347 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 348 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 349 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 350 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 351 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 352 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 353 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 354 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 355 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 356 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 357 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 358 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 359 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 360 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 361 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 362 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 363 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 364 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 365 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 366 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 367 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 370 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 371 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 372 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 374 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 375 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 376 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 377 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 378 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 380 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 381 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 383 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 384 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 387 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 390 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 391 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 392 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 395 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 396 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 397 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 398 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 404 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 405 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 406 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 407 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 408 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 409 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 410 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.29 |
| Metatranscriptomes | 0.71 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.21 |
| Nodule | 0 |
| Rhizoplane | 10.24 |
| Rhizosphere | 89.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 4.1 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0466967_0030523 | 3300045976 | Bacteria | 4525 |
| 2 | 2214816880 | 2209111006 | Unclassified | 673 |
| 3 | ARcpr5yngRDRAFT_c006493 | 3300000043 | Bacteria | 1053 |
| 4 | ARSoilOldRDRAFT_c013101 | 3300000044 | Unclassified | 700 |
| 5 | ARCol0yngRDRAFT_1001458 | 3300000652 | Bacteria | 1927 |
| 6 | JGI24752J21851_1020796 | 3300001976 | Unclassified | 857 |
| 7 | JGI24745J21846_1025808 | 3300002073 | Unclassified | 699 |
| 8 | JGI24738J21930_10002089 | 3300002075 | Bacteria | 5346 |
| 9 | JGI24744J21845_10025080 | 3300002077 | Bacteria | 1163 |
| 10 | JGI24742J22300_10014548 | 3300002244 | Bacteria | 1322 |
| 11 | JGI25406J46586_10011377 | 3300003203 | Bacteria | 3905 |
| 12 | Ga0070658_10028387 | 3300005327 | Bacteria | 4491 |
| 13 | Ga0070658_10073865 | 3300005327 | Bacteria | 2797 |
| 14 | Ga0070658_10093254 | 3300005327 | Bacteria | 2483 |
| 15 | Ga0070658_10848866 | 3300005327 | Bacteria | 794 |
| 16 | Ga0070676_10153986 | 3300005328 | Bacteria | 1474 |
| 17 | Ga0070683_100029653 | 3300005329 | Bacteria | 4957 |
| 18 | Ga0070683_100144680 | 3300005329 | Bacteria | 2252 |
| 19 | Ga0070683_100174867 | 3300005329 | Bacteria | 2038 |
| 20 | Ga0070683_100253753 | 3300005329 | Bacteria | 1673 |
| 21 | Ga0070683_100284079 | 3300005329 | Bacteria | 1574 |
| 22 | Ga0070683_100521310 | 3300005329 | Bacteria | 1136 |
| 23 | Ga0070683_100573908 | 3300005329 | Bacteria | 1079 |
| 24 | Ga0070670_100338901 | 3300005331 | Bacteria | 1319 |
| 25 | Ga0070670_100556422 | 3300005331 | Bacteria | 1024 |
| 26 | Ga0068869_100173115 | 3300005334 | Bacteria | 1688 |
| 27 | Ga0068869_100225989 | 3300005334 | Bacteria | 1486 |
| 28 | Ga0068869_100305945 | 3300005334 | Bacteria | 1285 |
| 29 | Ga0068869_100542856 | 3300005334 | Unclassified | 976 |
| 30 | Ga0070666_10213096 | 3300005335 | Bacteria | 1361 |
| 31 | Ga0070680_100018347 | 3300005336 | Bacteria | 5527 |
| 32 | Ga0070680_100028372 | 3300005336 | Bacteria | 4489 |
| 33 | Ga0070680_100045740 | 3300005336 | Bacteria | 3559 |
| 34 | Ga0070680_100122044 | 3300005336 | Bacteria | 2175 |
| 35 | Ga0070680_100167926 | 3300005336 | Bacteria | 1845 |
| 36 | Ga0070680_100296531 | 3300005336 | Bacteria | 1371 |
| 37 | Ga0070680_101299595 | 3300005336 | Archaea | 629 |
| 38 | Ga0070682_100005555 | 3300005337 | Bacteria | 7023 |
| 39 | Ga0070682_100087214 | 3300005337 | Bacteria | 2034 |
| 40 | Ga0070682_100093714 | 3300005337 | Bacteria | 1969 |
| 41 | Ga0070682_101069954 | 3300005337 | Bacteria | 674 |
| 42 | Ga0068868_100248807 | 3300005338 | Bacteria | 1496 |
| 43 | Ga0068868_100387187 | 3300005338 | Bacteria | 1204 |
| 44 | Ga0068868_100451946 | 3300005338 | Bacteria | 1118 |
| 45 | Ga0068868_100755232 | 3300005338 | Bacteria | 874 |
| 46 | Ga0070660_100015792 | 3300005339 | Bacteria | 5462 |
| 47 | Ga0070660_100056838 | 3300005339 | Bacteria | 3028 |
| 48 | Ga0070660_100088676 | 3300005339 | Bacteria | 2436 |
| 49 | Ga0070660_100169908 | 3300005339 | Bacteria | 1761 |
| 50 | Ga0070660_100273716 | 3300005339 | Bacteria | 1381 |
| 51 | Ga0070660_100394629 | 3300005339 | Bacteria | 1143 |
| 52 | Ga0070660_100561474 | 3300005339 | Bacteria | 953 |
| 53 | Ga0070660_101184581 | 3300005339 | Bacteria | 648 |
| 54 | Ga0070689_100005340 | 3300005340 | Bacteria | 8761 |
| 55 | Ga0070691_10003771 | 3300005341 | Bacteria | 6850 |
| 56 | Ga0070691_10021850 | 3300005341 | Bacteria | 2965 |
| 57 | Ga0070691_10022999 | 3300005341 | Bacteria | 2894 |
| 58 | Ga0070691_10037542 | 3300005341 | Bacteria | 2286 |
| 59 | Ga0070691_10097045 | 3300005341 | Bacteria | 1460 |
| 60 | Ga0070687_100068541 | 3300005343 | Bacteria | 1897 |
| 61 | Ga0070661_100035074 | 3300005344 | Bacteria | 3641 |
| 62 | Ga0070661_100063469 | 3300005344 | Bacteria | 2713 |
| 63 | Ga0070661_100107194 | 3300005344 | Bacteria | 2083 |
| 64 | Ga0070661_100140677 | 3300005344 | Bacteria | 1819 |
| 65 | Ga0070692_10043742 | 3300005345 | Bacteria | 2305 |
| 66 | Ga0070692_10065909 | 3300005345 | Bacteria | 1918 |
| 67 | Ga0070692_10066375 | 3300005345 | Bacteria | 1912 |
| 68 | Ga0070692_10222380 | 3300005345 | Bacteria | 1117 |
| 69 | Ga0070668_100022054 | 3300005347 | Bacteria | 4814 |
| 70 | Ga0070668_100735734 | 3300005347 | Bacteria | 872 |
| 71 | Ga0070669_100161049 | 3300005353 | Bacteria | 1744 |
| 72 | Ga0070669_100500629 | 3300005353 | Unclassified | 1008 |
| 73 | Ga0070669_101631180 | 3300005353 | Bacteria | 562 |
| 74 | Ga0070675_100028162 | 3300005354 | Bacteria | 4521 |
| 75 | Ga0070671_100071026 | 3300005355 | Bacteria | 2905 |
| 76 | Ga0070671_100109526 | 3300005355 | Bacteria | 2320 |
| 77 | Ga0070671_100226993 | 3300005355 | Bacteria | 1584 |
| 78 | Ga0070671_100292196 | 3300005355 | Bacteria | 1387 |
| 79 | Ga0070674_100008284 | 3300005356 | Bacteria | 6183 |
| 80 | Ga0070674_100100235 | 3300005356 | Bacteria | 2108 |
| 81 | Ga0070674_100324839 | 3300005356 | Bacteria | 1235 |
| 82 | Ga0070674_100663246 | 3300005356 | Bacteria | 888 |
| 83 | Ga0070673_100370208 | 3300005364 | Bacteria | 1276 |
| 84 | Ga0070673_100420476 | 3300005364 | Unclassified | 1198 |
| 85 | Ga0070673_100469981 | 3300005364 | Bacteria | 1134 |
| 86 | Ga0070673_100564376 | 3300005364 | Bacteria | 1035 |
| 87 | Ga0070673_100940782 | 3300005364 | Unclassified | 803 |
| 88 | Ga0070688_100051201 | 3300005365 | Bacteria | 2576 |
| 89 | Ga0070659_100001998 | 3300005366 | Bacteria | 14582 |
| 90 | Ga0070659_100103888 | 3300005366 | Bacteria | 2289 |
| 91 | Ga0070659_100326295 | 3300005366 | Bacteria | 1284 |
| 92 | Ga0070659_100451928 | 3300005366 | Bacteria | 1090 |
| 93 | Ga0070659_100666363 | 3300005366 | Bacteria | 898 |
| 94 | Ga0070659_101061817 | 3300005366 | Bacteria | 713 |
| 95 | Ga0070667_100446894 | 3300005367 | Bacteria | 1181 |
| 96 | Ga0070667_101016450 | 3300005367 | Bacteria | 774 |
| 97 | Ga0070703_10212878 | 3300005406 | Bacteria | 765 |
| 98 | Ga0070703_10337002 | 3300005406 | Bacteria | 640 |
| 99 | Ga0070709_10009177 | 3300005434 | Bacteria | 5445 |
| 100 | Ga0070714_100202872 | 3300005435 | Bacteria | 1814 |
| 101 | Ga0070714_100300577 | 3300005435 | Bacteria | 1496 |
| 102 | Ga0070714_100667393 | 3300005435 | Bacteria | 1001 |
| 103 | Ga0070714_100760722 | 3300005435 | Bacteria | 937 |
| 104 | Ga0070714_101058897 | 3300005435 | Bacteria | 790 |
| 105 | Ga0070713_100041201 | 3300005436 | Bacteria | 3761 |
| 106 | Ga0070713_100167838 | 3300005436 | Bacteria | 1964 |
| 107 | Ga0070701_10007675 | 3300005438 | Bacteria | 4626 |
| 108 | Ga0070701_10049727 | 3300005438 | Bacteria | 2168 |
| 109 | Ga0070701_10073213 | 3300005438 | Bacteria | 1837 |
| 110 | Ga0070701_10324580 | 3300005438 | Bacteria | 953 |
| 111 | Ga0070705_100091597 | 3300005440 | Bacteria | 1896 |
| 112 | Ga0070700_100012145 | 3300005441 | Bacteria | 4795 |
| 113 | Ga0070700_100069903 | 3300005441 | Bacteria | 2237 |
| 114 | Ga0070700_100072809 | 3300005441 | Bacteria | 2197 |
| 115 | Ga0070700_100128893 | 3300005441 | Bacteria | 1704 |
| 116 | Ga0070694_100021140 | 3300005444 | Bacteria | 4155 |
| 117 | Ga0070694_100187024 | 3300005444 | Bacteria | 1536 |
| 118 | Ga0070708_100542962 | 3300005445 | Unclassified | 1097 |
| 119 | Ga0070708_100856526 | 3300005445 | Bacteria | 854 |
| 120 | Ga0070663_100036850 | 3300005455 | Bacteria | 3400 |
| 121 | Ga0070663_100280369 | 3300005455 | Bacteria | 1328 |
| 122 | Ga0070678_100021514 | 3300005456 | Bacteria | 4255 |
| 123 | Ga0070678_100058257 | 3300005456 | Bacteria | 2834 |
| 124 | Ga0070678_100373311 | 3300005456 | Bacteria | 1232 |
| 125 | Ga0070678_101308266 | 3300005456 | Archaea | 675 |
| 126 | Ga0070662_100038735 | 3300005457 | Bacteria | 3387 |
| 127 | Ga0070662_100082784 | 3300005457 | Bacteria | 2393 |
| 128 | Ga0070662_100133834 | 3300005457 | Bacteria | 1915 |
| 129 | Ga0070681_10005563 | 3300005458 | Bacteria | 12170 |
| 130 | Ga0070681_10015890 | 3300005458 | Bacteria | 7505 |
| 131 | Ga0070681_10044358 | 3300005458 | Bacteria | 4450 |
| 132 | Ga0070681_10052938 | 3300005458 | Bacteria | 4047 |
| 133 | Ga0068867_100097261 | 3300005459 | Bacteria | 2242 |
| 134 | Ga0068867_100113353 | 3300005459 | Bacteria | 2086 |
| 135 | Ga0068867_101199102 | 3300005459 | Unclassified | 697 |
| 136 | Ga0070685_10065405 | 3300005466 | Bacteria | 2140 |
| 137 | Ga0070706_100695611 | 3300005467 | Bacteria | 943 |
| 138 | Ga0070707_100033996 | 3300005468 | Bacteria | 4863 |
| 139 | Ga0070707_100456006 | 3300005468 | Bacteria | 1239 |
| 140 | Ga0070698_100232291 | 3300005471 | Bacteria | 1778 |
| 141 | Ga0070698_100315678 | 3300005471 | Bacteria | 1493 |
| 142 | Ga0070699_100052321 | 3300005518 | Bacteria | 3535 |
| 143 | Ga0070699_100317388 | 3300005518 | Unclassified | 1400 |
| 144 | Ga0070699_100626240 | 3300005518 | Bacteria | 982 |
| 145 | Ga0070679_100028786 | 3300005530 | Bacteria | 5479 |
| 146 | Ga0070679_100042749 | 3300005530 | Bacteria | 4513 |
| 147 | Ga0070679_100048557 | 3300005530 | Bacteria | 4228 |
| 148 | Ga0070679_100104029 | 3300005530 | Bacteria | 2826 |
| 149 | Ga0070679_100112797 | 3300005530 | Bacteria | 2704 |
| 150 | Ga0070679_100203155 | 3300005530 | Bacteria | 1946 |
| 151 | Ga0070679_100300255 | 3300005530 | Bacteria | 1556 |
| 152 | Ga0070679_100875268 | 3300005530 | Bacteria | 842 |
| 153 | Ga0070684_100026440 | 3300005535 | Bacteria | 4889 |
| 154 | Ga0070684_100040062 | 3300005535 | Bacteria | 4032 |
| 155 | Ga0070684_100073575 | 3300005535 | Bacteria | 3011 |
| 156 | Ga0070684_100094323 | 3300005535 | Bacteria | 2665 |
| 157 | Ga0070684_100175510 | 3300005535 | Bacteria | 1947 |
| 158 | Ga0070684_100334053 | 3300005535 | Bacteria | 1393 |
| 159 | Ga0070684_100355908 | 3300005535 | Bacteria | 1347 |
| 160 | Ga0070684_100357682 | 3300005535 | Bacteria | 1343 |
| 161 | Ga0070684_100434411 | 3300005535 | Bacteria | 1213 |
| 162 | Ga0070684_100633245 | 3300005535 | Bacteria | 995 |
| 163 | Ga0070684_100642411 | 3300005535 | Bacteria | 988 |
| 164 | Ga0070697_100113025 | 3300005536 | Bacteria | 2265 |
| 165 | Ga0068853_100029138 | 3300005539 | Bacteria | 4651 |
| 166 | Ga0068853_100238566 | 3300005539 | Bacteria | 1666 |
| 167 | Ga0068853_100547649 | 3300005539 | Bacteria | 1096 |
| 168 | Ga0070672_100100450 | 3300005543 | Bacteria | 2346 |
| 169 | Ga0070672_100647668 | 3300005543 | Bacteria | 923 |
| 170 | Ga0070686_100035224 | 3300005544 | Bacteria | 3090 |
| 171 | Ga0070686_100133310 | 3300005544 | Bacteria | 1721 |
| 172 | Ga0070686_100143504 | 3300005544 | Bacteria | 1665 |
| 173 | Ga0070686_100195440 | 3300005544 | Bacteria | 1447 |
| 174 | Ga0070686_100969159 | 3300005544 | Bacteria | 696 |
| 175 | Ga0070695_100139720 | 3300005545 | Bacteria | 1678 |
| 176 | Ga0070695_100862221 | 3300005545 | Bacteria | 729 |
| 177 | Ga0070696_100027367 | 3300005546 | Bacteria | 3884 |
| 178 | Ga0070696_100037188 | 3300005546 | Bacteria | 3357 |
| 179 | Ga0070696_100179110 | 3300005546 | Bacteria | 1571 |
| 180 | Ga0070693_100000955 | 3300005547 | Bacteria | 12824 |
| 181 | Ga0070693_100007441 | 3300005547 | Bacteria | 5354 |
| 182 | Ga0070693_100010299 | 3300005547 | Bacteria | 4681 |
| 183 | Ga0070693_100012398 | 3300005547 | Bacteria | 4313 |
| 184 | Ga0070693_100112252 | 3300005547 | Bacteria | 1679 |
| 185 | Ga0070693_100157733 | 3300005547 | Unclassified | 1443 |
| 186 | Ga0070665_100055818 | 3300005548 | Bacteria | 3961 |
| 187 | Ga0070665_100142341 | 3300005548 | Unclassified | 2401 |
| 188 | Ga0070665_100275563 | 3300005548 | Bacteria | 1684 |
| 189 | Ga0070665_100495561 | 3300005548 | Bacteria | 1233 |
| 190 | Ga0070665_100918604 | 3300005548 | Bacteria | 888 |
| 191 | Ga0070665_101025520 | 3300005548 | Bacteria | 837 |
| 192 | Ga0070704_100011496 | 3300005549 | Bacteria | 5427 |
| 193 | Ga0070704_100028007 | 3300005549 | Bacteria | 3743 |
| 194 | Ga0070704_100172887 | 3300005549 | Bacteria | 1720 |
| 195 | Ga0070704_100248865 | 3300005549 | Bacteria | 1458 |
| 196 | Ga0070704_100667980 | 3300005549 | Bacteria | 919 |
| 197 | Ga0070704_101250459 | 3300005549 | Bacteria | 678 |
| 198 | Ga0068855_100018717 | 3300005563 | Bacteria | 8327 |
| 199 | Ga0068855_100069343 | 3300005563 | Bacteria | 4103 |
| 200 | Ga0068855_100368910 | 3300005563 | Bacteria | 1578 |
| 201 | Ga0068855_101430985 | 3300005563 | Bacteria | 712 |
| 202 | Ga0068855_101985825 | 3300005563 | Bacteria | 588 |
| 203 | Ga0070664_100022069 | 3300005564 | Bacteria | 5250 |
| 204 | Ga0070664_100117243 | 3300005564 | Bacteria | 2329 |
| 205 | Ga0070664_100257052 | 3300005564 | Bacteria | 1571 |
| 206 | Ga0070664_100608741 | 3300005564 | Bacteria | 1013 |
| 207 | Ga0070664_100974131 | 3300005564 | Bacteria | 797 |
| 208 | Ga0068857_100174378 | 3300005577 | Bacteria | 1955 |
| 209 | Ga0068857_101490271 | 3300005577 | Bacteria | 659 |
| 210 | Ga0068854_100005503 | 3300005578 | Bacteria | 8001 |
| 211 | Ga0068854_100017986 | 3300005578 | Bacteria | 4738 |
| 212 | Ga0068854_100041637 | 3300005578 | Bacteria | 3247 |
| 213 | Ga0068854_100160871 | 3300005578 | Bacteria | 1739 |
| 214 | Ga0068854_101104131 | 3300005578 | Bacteria | 707 |
| 215 | Ga0068856_100301701 | 3300005614 | Unclassified | 1619 |
| 216 | Ga0068856_100702320 | 3300005614 | Bacteria | 1032 |
| 217 | Ga0068856_101927647 | 3300005614 | Bacteria | 602 |
| 218 | Ga0070702_100004649 | 3300005615 | Bacteria | 6294 |
| 219 | Ga0070702_100029641 | 3300005615 | Bacteria | 2978 |
| 220 | Ga0070702_100068243 | 3300005615 | Bacteria | 2092 |
| 221 | Ga0070702_100108138 | 3300005615 | Bacteria | 1718 |
| 222 | Ga0070702_100126384 | 3300005615 | Bacteria | 1608 |
| 223 | Ga0070702_101013547 | 3300005615 | Unclassified | 658 |
| 224 | Ga0068852_100196323 | 3300005616 | Bacteria | 1907 |
| 225 | Ga0068852_100684358 | 3300005616 | Bacteria | 1035 |
| 226 | Ga0068864_100185310 | 3300005618 | Bacteria | 1905 |
| 227 | Ga0068864_100208880 | 3300005618 | Bacteria | 1797 |
| 228 | Ga0068864_100266022 | 3300005618 | Bacteria | 1596 |
| 229 | Ga0068864_100296616 | 3300005618 | Bacteria | 1512 |
| 230 | Ga0068866_10051601 | 3300005718 | Bacteria | 2095 |
| 231 | Ga0068861_100064152 | 3300005719 | Bacteria | 2825 |
| 232 | Ga0068861_100106828 | 3300005719 | Bacteria | 2237 |
| 233 | Ga0068861_100123551 | 3300005719 | Bacteria | 2091 |
| 234 | Ga0068861_100249235 | 3300005719 | Bacteria | 1514 |
| 235 | Ga0068861_100257669 | 3300005719 | Bacteria | 1492 |
| 236 | Ga0068861_100480735 | 3300005719 | Bacteria | 1119 |
| 237 | Ga0068851_10233514 | 3300005834 | Bacteria | 1038 |
| 238 | Ga0068863_100055686 | 3300005841 | Bacteria | 3744 |
| 239 | Ga0068863_100360055 | 3300005841 | Bacteria | 1418 |
| 240 | Ga0068858_100049668 | 3300005842 | Bacteria | 3884 |
| 241 | Ga0068860_100086472 | 3300005843 | Bacteria | 2984 |
| 242 | Ga0068860_100143821 | 3300005843 | Bacteria | 2294 |
| 243 | Ga0068860_101489921 | 3300005843 | Bacteria | 698 |
| 244 | Ga0068862_100097810 | 3300005844 | Bacteria | 2563 |
| 245 | Ga0081455_10005540 | 3300005937 | Bacteria | 13828 |
| 246 | Ga0081455_10018652 | 3300005937 | Bacteria | 6593 |
| 247 | Ga0081455_10030576 | 3300005937 | Bacteria | 4890 |
| 248 | Ga0081455_10044774 | 3300005937 | Bacteria | 3856 |
| 249 | Ga0081455_10081438 | 3300005937 | Bacteria | 2651 |
| 250 | Ga0081455_10106203 | 3300005937 | Bacteria | 2242 |
| 251 | Ga0081455_10596446 | 3300005937 | Bacteria | 721 |
| 252 | Ga0081540_1003067 | 3300005983 | Bacteria | 13383 |
| 253 | Ga0081539_10002405 | 3300005985 | Bacteria | 26516 |
| 254 | Ga0070717_10027966 | 3300006028 | Bacteria | 4510 |
| 255 | Ga0070717_10070065 | 3300006028 | Bacteria | 2921 |
| 256 | Ga0075364_10122466 | 3300006051 | Bacteria | 1741 |
| 257 | Ga0075432_10010010 | 3300006058 | Unclassified | 3221 |
| 258 | Ga0075432_10025565 | 3300006058 | Bacteria | 2026 |
| 259 | Ga0070715_10001178 | 3300006163 | Bacteria | 7508 |
| 260 | Ga0070716_100041743 | 3300006173 | Bacteria | 2557 |
| 261 | Ga0075367_10507755 | 3300006178 | Bacteria | 765 |
| 262 | Ga0097621_100197668 | 3300006237 | Bacteria | 1744 |
| 263 | Ga0068871_100009711 | 3300006358 | Bacteria | 6985 |
| 264 | Ga0068871_100148916 | 3300006358 | Bacteria | 1995 |
| 265 | Ga0068871_100726235 | 3300006358 | Bacteria | 911 |
| 266 | Ga0068871_100996724 | 3300006358 | Bacteria | 780 |
| 267 | Ga0075428_100004596 | 3300006844 | Bacteria | 15260 |
| 268 | Ga0075428_101146762 | 3300006844 | Bacteria | 820 |
| 269 | Ga0075431_101167585 | 3300006847 | Bacteria | 733 |
| 270 | Ga0075433_10133079 | 3300006852 | Bacteria | 2210 |
| 271 | Ga0075433_10181343 | 3300006852 | Bacteria | 1874 |
| 272 | Ga0075433_10407730 | 3300006852 | Bacteria | 1199 |
| 273 | Ga0075433_10672554 | 3300006852 | Bacteria | 907 |
| 274 | Ga0075433_11115868 | 3300006852 | Bacteria | 686 |
| 275 | Ga0075434_100084436 | 3300006871 | Bacteria | 3174 |
| 276 | Ga0075434_100130780 | 3300006871 | Bacteria | 2529 |
| 277 | Ga0075434_100254003 | 3300006871 | Bacteria | 1777 |
| 278 | Ga0075429_100004653 | 3300006880 | Bacteria | 11805 |
| 279 | Ga0068865_100014843 | 3300006881 | Bacteria | 4957 |
| 280 | Ga0068865_100071374 | 3300006881 | Bacteria | 2463 |
| 281 | Ga0068865_100133112 | 3300006881 | Bacteria | 1865 |
| 282 | Ga0068865_100219739 | 3300006881 | Bacteria | 1485 |
| 283 | Ga0068865_100251630 | 3300006881 | Bacteria | 1395 |
| 284 | Ga0068865_100554030 | 3300006881 | Bacteria | 966 |
| 285 | Ga0075436_100108668 | 3300006914 | Bacteria | 1935 |
| 286 | Ga0075436_100167473 | 3300006914 | Bacteria | 1551 |
| 287 | Ga0097620_101503863 | 3300006931 | Bacteria | 743 |
| 288 | Ga0075435_100022089 | 3300007076 | Bacteria | 4906 |
| 289 | Ga0075435_100085601 | 3300007076 | Bacteria | 2595 |
| 290 | Ga0075435_100159844 | 3300007076 | Bacteria | 1897 |
| 291 | Ga0105240_10046298 | 3300009093 | Bacteria | 5512 |
| 292 | Ga0105240_10086768 | 3300009093 | Bacteria | 3833 |
| 293 | Ga0111539_10012161 | 3300009094 | Bacteria | 10797 |
| 294 | Ga0111539_10027630 | 3300009094 | Bacteria | 6931 |
| 295 | Ga0111539_10034195 | 3300009094 | Bacteria | 6167 |
| 296 | Ga0111539_10066501 | 3300009094 | Bacteria | 4258 |
| 297 | Ga0111539_10196927 | 3300009094 | Bacteria | 2350 |
| 298 | Ga0111539_10613413 | 3300009094 | Bacteria | 1267 |
| 299 | Ga0105245_10016168 | 3300009098 | Bacteria | 6502 |
| 300 | Ga0105245_10017950 | 3300009098 | Bacteria | 6179 |
| 301 | Ga0105245_10034223 | 3300009098 | Bacteria | 4505 |
| 302 | Ga0105245_10103413 | 3300009098 | Bacteria | 2639 |
| 303 | Ga0105245_10157127 | 3300009098 | Bacteria | 2155 |
| 304 | Ga0105245_10169323 | 3300009098 | Bacteria | 2079 |
| 305 | Ga0105245_10224391 | 3300009098 | Bacteria | 1814 |
| 306 | Ga0105245_10450912 | 3300009098 | Bacteria | 1295 |
| 307 | Ga0105245_10478056 | 3300009098 | Unclassified | 1259 |
| 308 | Ga0105245_10964181 | 3300009098 | Unclassified | 896 |
| 309 | Ga0105245_11214127 | 3300009098 | Bacteria | 802 |
| 310 | Ga0105247_10090884 | 3300009101 | Unclassified | 1937 |
| 311 | Ga0114129_10057375 | 3300009147 | Bacteria | 5449 |
| 312 | Ga0114129_10166456 | 3300009147 | Bacteria | 3008 |
| 313 | Ga0114129_10201631 | 3300009147 | Bacteria | 2694 |
| 314 | Ga0114129_11387111 | 3300009147 | Bacteria | 868 |
| 315 | Ga0105243_10004509 | 3300009148 | Bacteria | 11009 |
| 316 | Ga0105243_10034643 | 3300009148 | Bacteria | 3910 |
| 317 | Ga0105243_10040712 | 3300009148 | Bacteria | 3630 |
| 318 | Ga0105243_10043648 | 3300009148 | Bacteria | 3514 |
| 319 | Ga0105243_10065198 | 3300009148 | Bacteria | 2925 |
| 320 | Ga0105243_10328602 | 3300009148 | Bacteria | 1396 |
| 321 | Ga0105243_10519454 | 3300009148 | Bacteria | 1132 |
| 322 | Ga0105243_10894800 | 3300009148 | Bacteria | 882 |
| 323 | Ga0105241_10139308 | 3300009174 | Bacteria | 1973 |
| 324 | Ga0105241_10285805 | 3300009174 | Unclassified | 1410 |
| 325 | Ga0105242_10018527 | 3300009176 | Bacteria | 5445 |
| 326 | Ga0105242_10042065 | 3300009176 | Bacteria | 3687 |
| 327 | Ga0105242_10043725 | 3300009176 | Bacteria | 3625 |
| 328 | Ga0105242_10154676 | 3300009176 | Bacteria | 2002 |
| 329 | Ga0105242_10159544 | 3300009176 | Bacteria | 1973 |
| 330 | Ga0105242_11109767 | 3300009176 | Bacteria | 805 |
| 331 | Ga0105242_11547213 | 3300009176 | Unclassified | 695 |
| 332 | Ga0105248_10024279 | 3300009177 | Bacteria | 6741 |
| 333 | Ga0105248_10036032 | 3300009177 | Bacteria | 5534 |
| 334 | Ga0105248_10059234 | 3300009177 | Bacteria | 4301 |
| 335 | Ga0105248_10377056 | 3300009177 | Bacteria | 1597 |
| 336 | Ga0105248_10733528 | 3300009177 | Bacteria | 1115 |
| 337 | Ga0105248_10934126 | 3300009177 | Bacteria | 980 |
| 338 | Ga0105238_10033949 | 3300009551 | Bacteria | 5191 |
| 339 | Ga0105238_10036622 | 3300009551 | Bacteria | 4989 |
| 340 | Ga0105238_10755076 | 3300009551 | Bacteria | 987 |
| 341 | Ga0105249_10071687 | 3300009553 | Bacteria | 3202 |
| 342 | Ga0105249_10088435 | 3300009553 | Bacteria | 2893 |
| 343 | Ga0105239_10013078 | 3300010375 | Bacteria | 9222 |
| 344 | Ga0105239_10132229 | 3300010375 | Bacteria | 2776 |
| 345 | Ga0105239_10197709 | 3300010375 | Bacteria | 2252 |
| 346 | Ga0105239_10305401 | 3300010375 | Bacteria | 1792 |
| 347 | Ga0105239_10393235 | 3300010375 | Bacteria | 1568 |
| 348 | Ga0105239_11058591 | 3300010375 | Bacteria | 933 |
| 349 | Ga0105246_10023522 | 3300011119 | Bacteria | 3988 |
| 350 | Ga0105246_10055747 | 3300011119 | Bacteria | 2729 |
| 351 | Ga0105246_10077688 | 3300011119 | Bacteria | 2356 |
| 352 | Ga0105246_10335427 | 3300011119 | Bacteria | 1234 |
| 353 | Ga0105246_10661409 | 3300011119 | Bacteria | 911 |
| 354 | Ga0157338_1038496 | 3300012515 | Bacteria | 642 |
| 355 | Ga0157373_10020182 | 3300013100 | Bacteria | 4847 |
| 356 | Ga0157373_10156617 | 3300013100 | Bacteria | 1602 |
| 357 | Ga0157373_10883675 | 3300013100 | Bacteria | 662 |
| 358 | Ga0157371_10014835 | 3300013102 | Bacteria | 5866 |
| 359 | Ga0157370_10032325 | 3300013104 | Bacteria | 5110 |
| 360 | Ga0157370_10065360 | 3300013104 | Bacteria | 3441 |
| 361 | Ga0157370_10584357 | 3300013104 | Bacteria | 1023 |
| 362 | Ga0157369_10064948 | 3300013105 | Bacteria | 3930 |
| 363 | Ga0157369_10071566 | 3300013105 | Bacteria | 3722 |
| 364 | Ga0157369_10415816 | 3300013105 | Bacteria | 1394 |
| 365 | Ga0157369_10691360 | 3300013105 | Bacteria | 1051 |
| 366 | Ga0157374_10179776 | 3300013296 | Bacteria | 2066 |
| 367 | Ga0157374_10906797 | 3300013296 | Bacteria | 899 |
| 368 | Ga0157378_10570038 | 3300013297 | Bacteria | 1140 |
| 369 | Ga0163162_10081352 | 3300013306 | Bacteria | 3310 |
| 370 | Ga0163162_10117336 | 3300013306 | Bacteria | 2763 |
| 371 | Ga0163162_10270177 | 3300013306 | Bacteria | 1832 |
| 372 | Ga0163162_10366223 | 3300013306 | Bacteria | 1574 |
| 373 | Ga0163162_11097633 | 3300013306 | Bacteria | 901 |
| 374 | Ga0157372_10002633 | 3300013307 | Bacteria | 19434 |
| 375 | Ga0157372_10015471 | 3300013307 | Bacteria | 8177 |
| 376 | Ga0157372_10257736 | 3300013307 | Bacteria | 2025 |
| 377 | Ga0157372_10297694 | 3300013307 | Bacteria | 1877 |
| 378 | Ga0157372_10500620 | 3300013307 | Bacteria | 1417 |
| 379 | Ga0157372_10654792 | 3300013307 | Bacteria | 1223 |
| 380 | Ga0157372_10665809 | 3300013307 | Bacteria | 1212 |
| 381 | Ga0157372_10801584 | 3300013307 | Bacteria | 1094 |
| 382 | Ga0157372_10871628 | 3300013307 | Bacteria | 1045 |
| 383 | Ga0157372_11062675 | 3300013307 | Bacteria | 937 |
| 384 | Ga0157372_11972920 | 3300013307 | Bacteria | 671 |
| 385 | Ga0157375_10097561 | 3300013308 | Bacteria | 3014 |
| 386 | Ga0157375_10114437 | 3300013308 | Bacteria | 2799 |
| 387 | Ga0157375_10115250 | 3300013308 | Bacteria | 2790 |
| 388 | Ga0157375_10120317 | 3300013308 | Bacteria | 2734 |
| 389 | Ga0157375_10189922 | 3300013308 | Bacteria | 2209 |
| 390 | Ga0157375_10224667 | 3300013308 | Bacteria | 2037 |
| 391 | Ga0157375_10439935 | 3300013308 | Bacteria | 1470 |
| 392 | Ga0157375_11385213 | 3300013308 | Bacteria | 828 |
| 393 | Ga0157375_11580461 | 3300013308 | Bacteria | 775 |
| 394 | Ga0157375_12253909 | 3300013308 | Bacteria | 649 |
| 395 | Ga0163163_10008456 | 3300014325 | Bacteria | 9146 |
| 396 | Ga0163163_10048159 | 3300014325 | Bacteria | 4191 |
| 397 | Ga0163163_10058780 | 3300014325 | Bacteria | 3802 |
| 398 | Ga0163163_10267134 | 3300014325 | Bacteria | 1762 |
| 399 | Ga0163163_10315591 | 3300014325 | Bacteria | 1616 |
| 400 | Ga0157380_10008767 | 3300014326 | Bacteria | 7224 |
| 401 | Ga0157380_10032619 | 3300014326 | Bacteria | 4008 |
| 402 | Ga0157380_10078410 | 3300014326 | Bacteria | 2695 |
| 403 | Ga0157380_10858271 | 3300014326 | Bacteria | 930 |
| 404 | Ga0157380_11035618 | 3300014326 | Bacteria | 856 |
| 405 | Ga0157380_11372217 | 3300014326 | Bacteria | 756 |
| 406 | Ga0182008_10002069 | 3300014497 | Bacteria | 12859 |
| 407 | Ga0157377_10030420 | 3300014745 | Bacteria | 2925 |
| 408 | Ga0157377_10322723 | 3300014745 | Bacteria | 1026 |
| 409 | Ga0157377_10612571 | 3300014745 | Bacteria | 778 |
| 410 | Ga0157377_10721547 | 3300014745 | Bacteria | 726 |
| 411 | Ga0157379_10041357 | 3300014968 | Bacteria | 4115 |
| 412 | Ga0157379_10099485 | 3300014968 | Bacteria | 2611 |
| 413 | Ga0157379_10182301 | 3300014968 | Bacteria | 1897 |
| 414 | Ga0157376_10005934 | 3300014969 | Bacteria | 8577 |
| 415 | Ga0157376_10874566 | 3300014969 | Bacteria | 915 |
| 416 | Ga0157376_11168922 | 3300014969 | Bacteria | 797 |
| 417 | Ga0157376_11196933 | 3300014969 | Bacteria | 788 |
| 418 | Ga0182006_1025563 | 3300015261 | Bacteria | 2424 |
| 419 | Ga0163161_10020229 | 3300017792 | Bacteria | 4669 |
| 420 | Ga0163161_10037290 | 3300017792 | Bacteria | 3485 |
| 421 | Ga0163161_10194229 | 3300017792 | Bacteria | 1562 |
| 422 | Ga0197907_11209785 | 3300020069 | Bacteria | 1453 |
| 423 | Ga0206356_10135276 | 3300020070 | Bacteria | 641 |
| 424 | Ga0206356_10729576 | 3300020070 | Bacteria | 1222 |
| 425 | Ga0206356_11490355 | 3300020070 | Bacteria | 903 |
| 426 | Ga0206354_10422378 | 3300020081 | Bacteria | 3133 |
| 427 | Ga0206353_10256256 | 3300020082 | Bacteria | 3333 |
| 428 | Ga0206353_10259330 | 3300020082 | Bacteria | 2410 |
| 429 | Ga0206353_10521711 | 3300020082 | Bacteria | 1570 |
| 430 | Ga0206353_10781712 | 3300020082 | Bacteria | 3429 |
| 431 | Ga0224712_10205056 | 3300022467 | Bacteria | 897 |
| 432 | Ga0207656_10048249 | 3300025321 | Bacteria | 1833 |
| 433 | Ga0207656_10101612 | 3300025321 | Bacteria | 1319 |
| 434 | Ga0207682_10345904 | 3300025893 | Bacteria | 700 |
| 435 | Ga0207692_10082205 | 3300025898 | Bacteria | 1725 |
| 436 | Ga0207692_10119985 | 3300025898 | Bacteria | 1471 |
| 437 | Ga0207710_10043804 | 3300025900 | Unclassified | 1992 |
| 438 | Ga0207688_10009610 | 3300025901 | Bacteria | 5266 |
| 439 | Ga0207688_10047872 | 3300025901 | Bacteria | 2388 |
| 440 | Ga0207688_10073397 | 3300025901 | Bacteria | 1945 |
| 441 | Ga0207688_10087640 | 3300025901 | Bacteria | 1785 |
| 442 | Ga0207688_10343491 | 3300025901 | Bacteria | 919 |
| 443 | Ga0207680_10087965 | 3300025903 | Unclassified | 1968 |
| 444 | Ga0207680_10456607 | 3300025903 | Bacteria | 907 |
| 445 | Ga0207647_10284571 | 3300025904 | Bacteria | 943 |
| 446 | Ga0207647_10348956 | 3300025904 | Bacteria | 838 |
| 447 | Ga0207685_10020731 | 3300025905 | Bacteria | 2190 |
| 448 | Ga0207685_10027426 | 3300025905 | Bacteria | 1993 |
| 449 | Ga0207685_10032999 | 3300025905 | Bacteria | 1868 |
| 450 | Ga0207699_10029836 | 3300025906 | Bacteria | 3045 |
| 451 | Ga0207699_10544783 | 3300025906 | Bacteria | 841 |
| 452 | Ga0207645_10013240 | 3300025907 | Bacteria | 5565 |
| 453 | Ga0207643_10099320 | 3300025908 | Bacteria | 1706 |
| 454 | Ga0207643_10139344 | 3300025908 | Unclassified | 1448 |
| 455 | Ga0207643_10203941 | 3300025908 | Bacteria | 1205 |
| 456 | Ga0207643_10318890 | 3300025908 | Bacteria | 970 |
| 457 | Ga0207705_10083493 | 3300025909 | Bacteria | 2330 |
| 458 | Ga0207705_10203147 | 3300025909 | Bacteria | 1502 |
| 459 | Ga0207705_10210395 | 3300025909 | Unclassified | 1475 |
| 460 | Ga0207684_10643310 | 3300025910 | Bacteria | 904 |
| 461 | Ga0207654_10009906 | 3300025911 | Bacteria | 4846 |
| 462 | Ga0207707_10012425 | 3300025912 | Bacteria | 7402 |
| 463 | Ga0207707_10042612 | 3300025912 | Bacteria | 3960 |
| 464 | Ga0207707_10076571 | 3300025912 | Bacteria | 2920 |
| 465 | Ga0207707_10129253 | 3300025912 | Bacteria | 2209 |
| 466 | Ga0207707_10453523 | 3300025912 | Bacteria | 1097 |
| 467 | Ga0207707_10657181 | 3300025912 | Unclassified | 883 |
| 468 | Ga0207695_10074445 | 3300025913 | Bacteria | 3458 |
| 469 | Ga0207693_10033503 | 3300025915 | Bacteria | 4054 |
| 470 | Ga0207693_10035327 | 3300025915 | Bacteria | 3941 |
| 471 | Ga0207693_10035435 | 3300025915 | Bacteria | 3935 |
| 472 | Ga0207693_10038584 | 3300025915 | Bacteria | 3760 |
| 473 | Ga0207693_10264597 | 3300025915 | Bacteria | 1348 |
| 474 | Ga0207663_10288184 | 3300025916 | Bacteria | 1222 |
| 475 | Ga0207663_10676339 | 3300025916 | Bacteria | 816 |
| 476 | Ga0207660_10022525 | 3300025917 | Bacteria | 4245 |
| 477 | Ga0207660_10228136 | 3300025917 | Bacteria | 1464 |
| 478 | Ga0207660_10241712 | 3300025917 | Bacteria | 1422 |
| 479 | Ga0207660_10375944 | 3300025917 | Bacteria | 1141 |
| 480 | Ga0207660_10687194 | 3300025917 | Bacteria | 835 |
| 481 | Ga0207660_10858697 | 3300025917 | Archaea | 741 |
| 482 | Ga0207657_10000054 | 3300025919 | Bacteria | 106767 |
| 483 | Ga0207657_10029131 | 3300025919 | Bacteria | 5030 |
| 484 | Ga0207657_10035785 | 3300025919 | Bacteria | 4449 |
| 485 | Ga0207657_10041998 | 3300025919 | Bacteria | 4038 |
| 486 | Ga0207657_10047519 | 3300025919 | Bacteria | 3752 |
| 487 | Ga0207657_10056470 | 3300025919 | Bacteria | 3387 |
| 488 | Ga0207657_10092812 | 3300025919 | Bacteria | 2515 |
| 489 | Ga0207657_10210131 | 3300025919 | Bacteria | 1562 |
| 490 | Ga0207657_10343042 | 3300025919 | Bacteria | 1179 |
| 491 | Ga0207649_10031902 | 3300025920 | Bacteria | 3135 |
| 492 | Ga0207649_10088076 | 3300025920 | Bacteria | 2027 |
| 493 | Ga0207649_10121614 | 3300025920 | Bacteria | 1761 |
| 494 | Ga0207649_10447122 | 3300025920 | Bacteria | 975 |
| 495 | Ga0207652_10053360 | 3300025921 | Bacteria | 3472 |
| 496 | Ga0207652_10074054 | 3300025921 | Bacteria | 2964 |
| 497 | Ga0207652_10098968 | 3300025921 | Bacteria | 2573 |
| 498 | Ga0207652_10140516 | 3300025921 | Bacteria | 2159 |
| 499 | Ga0207652_10165542 | 3300025921 | Bacteria | 1982 |
| 500 | Ga0207652_10694118 | 3300025921 | Bacteria | 908 |
| 501 | Ga0207652_10817739 | 3300025921 | Bacteria | 827 |
| 502 | Ga0207652_11192882 | 3300025921 | Unclassified | 663 |
| 503 | Ga0207646_10001441 | 3300025922 | Bacteria | 29529 |
| 504 | Ga0207646_10080864 | 3300025922 | Bacteria | 2905 |
| 505 | Ga0207646_10380760 | 3300025922 | Bacteria | 1275 |
| 506 | Ga0207646_10498163 | 3300025922 | Bacteria | 1098 |
| 507 | Ga0207681_10342217 | 3300025923 | Unclassified | 1195 |
| 508 | Ga0207681_11274936 | 3300025923 | Bacteria | 617 |
| 509 | Ga0207694_10012672 | 3300025924 | Bacteria | 6352 |
| 510 | Ga0207659_10023159 | 3300025926 | Bacteria | 4142 |
| 511 | Ga0207659_10029960 | 3300025926 | Bacteria | 3713 |
| 512 | Ga0207659_10080953 | 3300025926 | Bacteria | 2400 |
| 513 | Ga0207659_10367234 | 3300025926 | Bacteria | 1197 |
| 514 | Ga0207659_10670842 | 3300025926 | Bacteria | 887 |
| 515 | Ga0207687_10003116 | 3300025927 | Bacteria | 11239 |
| 516 | Ga0207687_10037565 | 3300025927 | Bacteria | 3305 |
| 517 | Ga0207687_10043574 | 3300025927 | Bacteria | 3093 |
| 518 | Ga0207687_10080179 | 3300025927 | Bacteria | 2355 |
| 519 | Ga0207687_10093037 | 3300025927 | Bacteria | 2203 |
| 520 | Ga0207687_10164698 | 3300025927 | Bacteria | 1705 |
| 521 | Ga0207664_10016122 | 3300025929 | Bacteria | 5444 |
| 522 | Ga0207664_10021164 | 3300025929 | Bacteria | 4831 |
| 523 | Ga0207664_11405245 | 3300025929 | Bacteria | 619 |
| 524 | Ga0207644_10027581 | 3300025931 | Bacteria | 3925 |
| 525 | Ga0207644_10264171 | 3300025931 | Bacteria | 1377 |
| 526 | Ga0207644_11313796 | 3300025931 | Bacteria | 608 |
| 527 | Ga0207690_10011544 | 3300025932 | Bacteria | 5277 |
| 528 | Ga0207690_10083695 | 3300025932 | Bacteria | 2234 |
| 529 | Ga0207690_10336354 | 3300025932 | Bacteria | 1190 |
| 530 | Ga0207690_10340586 | 3300025932 | Bacteria | 1183 |
| 531 | Ga0207690_10416823 | 3300025932 | Bacteria | 1074 |
| 532 | Ga0207690_10688795 | 3300025932 | Bacteria | 840 |
| 533 | Ga0207706_10019170 | 3300025933 | Bacteria | 6153 |
| 534 | Ga0207706_10019932 | 3300025933 | Bacteria | 6028 |
| 535 | Ga0207706_10056364 | 3300025933 | Bacteria | 3465 |
| 536 | Ga0207706_10076303 | 3300025933 | Bacteria | 2948 |
| 537 | Ga0207706_10351211 | 3300025933 | Bacteria | 1282 |
| 538 | Ga0207706_10626370 | 3300025933 | Bacteria | 923 |
| 539 | Ga0207706_10641886 | 3300025933 | Bacteria | 910 |
| 540 | Ga0207686_10051255 | 3300025934 | Bacteria | 2571 |
| 541 | Ga0207686_10052028 | 3300025934 | Bacteria | 2554 |
| 542 | Ga0207686_10079068 | 3300025934 | Bacteria | 2140 |
| 543 | Ga0207686_10119646 | 3300025934 | Bacteria | 1790 |
| 544 | Ga0207686_10127200 | 3300025934 | Bacteria | 1743 |
| 545 | Ga0207686_10719765 | 3300025934 | Unclassified | 795 |
| 546 | Ga0207709_10024800 | 3300025935 | Bacteria | 3429 |
| 547 | Ga0207709_10063058 | 3300025935 | Bacteria | 2322 |
| 548 | Ga0207709_10084364 | 3300025935 | Bacteria | 2056 |
| 549 | Ga0207709_10103797 | 3300025935 | Bacteria | 1885 |
| 550 | Ga0207709_10141942 | 3300025935 | Bacteria | 1652 |
| 551 | Ga0207670_10021151 | 3300025936 | Bacteria | 4008 |
| 552 | Ga0207670_10031152 | 3300025936 | Bacteria | 3414 |
| 553 | Ga0207669_10015238 | 3300025937 | Bacteria | 3873 |
| 554 | Ga0207669_10017321 | 3300025937 | Bacteria | 3692 |
| 555 | Ga0207669_10077313 | 3300025937 | Bacteria | 2116 |
| 556 | Ga0207669_10778733 | 3300025937 | Bacteria | 792 |
| 557 | Ga0207704_10014214 | 3300025938 | Bacteria | 4013 |
| 558 | Ga0207704_10095190 | 3300025938 | Bacteria | 1968 |
| 559 | Ga0207704_10107107 | 3300025938 | Bacteria | 1879 |
| 560 | Ga0207704_10189945 | 3300025938 | Bacteria | 1493 |
| 561 | Ga0207704_10390794 | 3300025938 | Bacteria | 1095 |
| 562 | Ga0207704_10734793 | 3300025938 | Bacteria | 820 |
| 563 | Ga0207704_10758491 | 3300025938 | Bacteria | 807 |
| 564 | Ga0207665_10006983 | 3300025939 | Bacteria | 7472 |
| 565 | Ga0207691_10046414 | 3300025940 | Bacteria | 3992 |
| 566 | Ga0207691_10323221 | 3300025940 | Unclassified | 1323 |
| 567 | Ga0207691_10562838 | 3300025940 | Bacteria | 966 |
| 568 | Ga0207711_10149671 | 3300025941 | Bacteria | 2105 |
| 569 | Ga0207711_10184542 | 3300025941 | Bacteria | 1898 |
| 570 | Ga0207711_10446746 | 3300025941 | Bacteria | 1203 |
| 571 | Ga0207711_10582311 | 3300025941 | Bacteria | 1044 |
| 572 | Ga0207689_10115215 | 3300025942 | Bacteria | 2209 |
| 573 | Ga0207689_10380754 | 3300025942 | Bacteria | 1175 |
| 574 | Ga0207689_10830153 | 3300025942 | Bacteria | 780 |
| 575 | Ga0207661_10070838 | 3300025944 | Bacteria | 2847 |
| 576 | Ga0207661_10100685 | 3300025944 | Bacteria | 2426 |
| 577 | Ga0207661_10154164 | 3300025944 | Bacteria | 1988 |
| 578 | Ga0207661_10154260 | 3300025944 | Bacteria | 1987 |
| 579 | Ga0207661_10288411 | 3300025944 | Bacteria | 1468 |
| 580 | Ga0207661_10386854 | 3300025944 | Bacteria | 1267 |
| 581 | Ga0207661_10436104 | 3300025944 | Unclassified | 1192 |
| 582 | Ga0207661_10440757 | 3300025944 | Bacteria | 1185 |
| 583 | Ga0207661_10638200 | 3300025944 | Bacteria | 978 |
| 584 | Ga0207679_10170855 | 3300025945 | Unclassified | 1790 |
| 585 | Ga0207679_10203686 | 3300025945 | Bacteria | 1654 |
| 586 | Ga0207679_10266203 | 3300025945 | Bacteria | 1464 |
| 587 | Ga0207679_10541923 | 3300025945 | Bacteria | 1043 |
| 588 | Ga0207679_11092934 | 3300025945 | Bacteria | 732 |
| 589 | Ga0207667_10115354 | 3300025949 | Bacteria | 2768 |
| 590 | Ga0207667_10203588 | 3300025949 | Bacteria | 2030 |
| 591 | Ga0207667_10206066 | 3300025949 | Bacteria | 2016 |
| 592 | Ga0207667_10622982 | 3300025949 | Bacteria | 1086 |
| 593 | Ga0207667_10769296 | 3300025949 | Bacteria | 961 |
| 594 | Ga0207667_11269817 | 3300025949 | Bacteria | 714 |
| 595 | Ga0207651_10147436 | 3300025960 | Bacteria | 1827 |
| 596 | Ga0207651_10514309 | 3300025960 | Bacteria | 1037 |
| 597 | Ga0207651_10729419 | 3300025960 | Bacteria | 875 |
| 598 | Ga0207712_10203216 | 3300025961 | Bacteria | 1572 |
| 599 | Ga0207712_10220178 | 3300025961 | Bacteria | 1517 |
| 600 | Ga0207712_11188871 | 3300025961 | Bacteria | 680 |
| 601 | Ga0207668_10128283 | 3300025972 | Bacteria | 1933 |
| 602 | Ga0207668_10319352 | 3300025972 | Bacteria | 1288 |
| 603 | Ga0207668_11037360 | 3300025972 | Bacteria | 734 |
| 604 | Ga0207640_10004968 | 3300025981 | Bacteria | 7231 |
| 605 | Ga0207640_10273327 | 3300025981 | Bacteria | 1323 |
| 606 | Ga0207640_10875129 | 3300025981 | Bacteria | 783 |
| 607 | Ga0207658_10509984 | 3300025986 | Bacteria | 1072 |
| 608 | Ga0207677_10210973 | 3300026023 | Bacteria | 1551 |
| 609 | Ga0207677_10288149 | 3300026023 | Bacteria | 1351 |
| 610 | Ga0207677_10474296 | 3300026023 | Bacteria | 1077 |
| 611 | Ga0207703_10140365 | 3300026035 | Bacteria | 2096 |
| 612 | Ga0207639_10203530 | 3300026041 | Bacteria | 1699 |
| 613 | Ga0207639_10243378 | 3300026041 | Bacteria | 1565 |
| 614 | Ga0207639_10268349 | 3300026041 | Bacteria | 1496 |
| 615 | Ga0207639_11144064 | 3300026041 | Unclassified | 730 |
| 616 | Ga0207678_10281772 | 3300026067 | Bacteria | 1427 |
| 617 | Ga0207678_10492582 | 3300026067 | Bacteria | 1068 |
| 618 | Ga0207678_11328623 | 3300026067 | Bacteria | 636 |
| 619 | Ga0207708_10004374 | 3300026075 | Bacteria | 10410 |
| 620 | Ga0207708_10101687 | 3300026075 | Bacteria | 2225 |
| 621 | Ga0207708_10201367 | 3300026075 | Bacteria | 1588 |
| 622 | Ga0207708_10215004 | 3300026075 | Bacteria | 1538 |
| 623 | Ga0207702_10009726 | 3300026078 | Bacteria | 8076 |
| 624 | Ga0207702_10241739 | 3300026078 | Bacteria | 1692 |
| 625 | Ga0207702_10338441 | 3300026078 | Bacteria | 1437 |
| 626 | Ga0207702_10883036 | 3300026078 | Bacteria | 886 |
| 627 | Ga0207702_11259904 | 3300026078 | Bacteria | 734 |
| 628 | Ga0207641_10608347 | 3300026088 | Bacteria | 1071 |
| 629 | Ga0207641_10715923 | 3300026088 | Bacteria | 986 |
| 630 | Ga0207648_10013296 | 3300026089 | Bacteria | 7666 |
| 631 | Ga0207648_10037570 | 3300026089 | Bacteria | 4267 |
| 632 | Ga0207648_10050124 | 3300026089 | Bacteria | 3651 |
| 633 | Ga0207648_10053480 | 3300026089 | Bacteria | 3529 |
| 634 | Ga0207648_10142842 | 3300026089 | Unclassified | 2110 |
| 635 | Ga0207648_10221068 | 3300026089 | Bacteria | 1683 |
| 636 | Ga0207648_10350343 | 3300026089 | Bacteria | 1331 |
| 637 | Ga0207676_10471344 | 3300026095 | Bacteria | 1187 |
| 638 | Ga0207676_10551769 | 3300026095 | Bacteria | 1101 |
| 639 | Ga0207674_10086866 | 3300026116 | Bacteria | 3122 |
| 640 | Ga0207674_10736653 | 3300026116 | Bacteria | 951 |
| 641 | Ga0207675_100028939 | 3300026118 | Bacteria | 5162 |
| 642 | Ga0207675_100043372 | 3300026118 | Bacteria | 4200 |
| 643 | Ga0207675_100117352 | 3300026118 | Bacteria | 2516 |
| 644 | Ga0207675_100195469 | 3300026118 | Bacteria | 1941 |
| 645 | Ga0207675_100285121 | 3300026118 | Bacteria | 1605 |
| 646 | Ga0207675_101060621 | 3300026118 | Bacteria | 830 |
| 647 | Ga0207683_10000626 | 3300026121 | Bacteria | 32385 |
| 648 | Ga0207683_10033434 | 3300026121 | Bacteria | 4466 |
| 649 | Ga0207683_10089666 | 3300026121 | Bacteria | 2737 |
| 650 | Ga0207683_10273045 | 3300026121 | Bacteria | 1545 |
| 651 | Ga0207698_10075572 | 3300026142 | Bacteria | 2693 |
| 652 | Ga0207698_10255923 | 3300026142 | Bacteria | 1605 |
| 653 | Ga0207428_10000401 | 3300027907 | Bacteria | 53789 |
| 654 | Ga0207428_10027603 | 3300027907 | Bacteria | 4725 |
| 655 | Ga0207428_10276392 | 3300027907 | Bacteria | 1248 |
| 656 | Ga0207428_10773599 | 3300027907 | Unclassified | 683 |
| 657 | Ga0268266_10111552 | 3300028379 | Bacteria | 2423 |
| 658 | Ga0268266_10156006 | 3300028379 | Bacteria | 2062 |
| 659 | Ga0268265_10213370 | 3300028380 | Bacteria | 1684 |
| 660 | Ga0268265_10288531 | 3300028380 | Bacteria | 1472 |
| 661 | Ga0268265_10597842 | 3300028380 | Bacteria | 1054 |
| 662 | Ga0268264_10089408 | 3300028381 | Bacteria | 2652 |
| 663 | Ga0268264_10141209 | 3300028381 | Bacteria | 2148 |
| 664 | Ga0265338_10005100 | 3300028800 | Bacteria | 17325 |
| 665 | Ga0265338_10026919 | 3300028800 | Bacteria | 5785 |
| 666 | Ga0265324_10047554 | 3300029957 | Bacteria | 1475 |
| 667 | Ga0265320_10115915 | 3300031240 | Bacteria | 1225 |
| 668 | Ga0265339_10017373 | 3300031249 | Bacteria | 4264 |
| 669 | Ga0265331_10221649 | 3300031250 | Bacteria | 850 |
| 670 | Ga0265327_10033373 | 3300031251 | Bacteria | 2869 |
| 671 | Ga0265327_10096058 | 3300031251 | Bacteria | 1437 |
| 672 | Ga0265316_10038392 | 3300031344 | Bacteria | 3858 |
| 673 | Ga0307408_100032954 | 3300031548 | Bacteria | 3616 |
| 674 | Ga0265313_10004487 | 3300031595 | Bacteria | 10683 |
| 675 | Ga0265313_10019290 | 3300031595 | Bacteria | 3800 |
| 676 | Ga0265314_10003413 | 3300031711 | Bacteria | 15378 |
| 677 | Ga0265314_10317209 | 3300031711 | Bacteria | 868 |
| 678 | Ga0307407_10178709 | 3300031903 | Bacteria | 1405 |
| 679 | Ga0307407_10187484 | 3300031903 | Bacteria | 1376 |
| 680 | Ga0307409_100006970 | 3300031995 | Bacteria | 6713 |
| 681 | Ga0307409_100096452 | 3300031995 | Bacteria | 2440 |
| 682 | Ga0307409_100133900 | 3300031995 | Bacteria | 2123 |
| 683 | Ga0307409_100219808 | 3300031995 | Bacteria | 1714 |
| 684 | Ga0307409_100778539 | 3300031995 | Bacteria | 963 |
| 685 | Ga0307409_100907416 | 3300031995 | Bacteria | 895 |
| 686 | Ga0307416_100014800 | 3300032002 | Bacteria | 5362 |
| 687 | Ga0307416_100177582 | 3300032002 | Bacteria | 1992 |
| 688 | Ga0307416_100666396 | 3300032002 | Bacteria | 1127 |
| 689 | Ga0307415_100134832 | 3300032126 | Bacteria | 1876 |
| 690 | Ga0307415_101147569 | 3300032126 | Bacteria | 730 |
| 691 | Ga0373930_0020078 | 3300034816 | Bacteria | 1299 |
| 692 | Ga0373950_0054462 | 3300034818 | Bacteria | 792 |
| 693 | Ga0373950_0081055 | 3300034818 | Unclassified | 678 |
| 694 | Ga0373958_0085891 | 3300034819 | Bacteria | 719 |
| 695 | Ga0373926_0023536 | 3300035083 | Bacteria | 2140 |
| 696 | Ga0373929_0029689 | 3300035085 | Bacteria | 1162 |
| 697 | Ga0373929_0082844 | 3300035085 | Bacteria | 785 |
| 698 | Ga0373940_0021837 | 3300035088 | Bacteria | 1640 |
| 699 | Ga0373940_0154883 | 3300035088 | Bacteria | 732 |
| 700 | Ga0373944_0003405 | 3300035089 | Bacteria | 4100 |
| 701 | Ga0373944_0015378 | 3300035089 | Bacteria | 2146 |
| 702 | Ga0373944_0045098 | 3300035089 | Bacteria | 1375 |
| 703 | Ga0373949_0078415 | 3300035090 | Bacteria | 877 |
| 704 | Ga0373949_0128952 | 3300035090 | Bacteria | 716 |
| 705 | Ga0373951_0062796 | 3300035091 | Unclassified | 933 |
| 706 | Ga0373951_0075090 | 3300035091 | Bacteria | 867 |
| 707 | Ga0373952_0008741 | 3300035092 | Bacteria | 1926 |
| 708 | Ga0373952_0062307 | 3300035092 | Bacteria | 915 |
| 709 | Ga0373932_0042130 | 3300035112 | Bacteria | 1323 |
| 710 | Ga0373936_0046059 | 3300035113 | Bacteria | 1758 |
| 711 | Ga0373936_0046941 | 3300035113 | Bacteria | 1741 |
| 712 | Ga0373936_0106153 | 3300035113 | Bacteria | 1189 |
| 713 | Ga0373939_0039799 | 3300035114 | Unclassified | 1409 |
| 714 | Ga0373941_0003296 | 3300035115 | Bacteria | 3643 |
| 715 | Ga0373945_0001474 | 3300035116 | Bacteria | 7190 |
| 716 | Ga0373945_0003331 | 3300035116 | Bacteria | 5047 |
| 717 | Ga0373945_0099862 | 3300035116 | Bacteria | 1134 |
| 718 | Ga0373960_0003999 | 3300035121 | Bacteria | 3364 |
| 719 | Ga0373960_0098088 | 3300035121 | Bacteria | 946 |
| 720 | Ga0373943_0000693 | 3300035170 | Bacteria | 14694 |
| 721 | Ga0373943_0001040 | 3300035170 | Bacteria | 12335 |
| 722 | Ga0373943_0015075 | 3300035170 | Bacteria | 3509 |
| 723 | Ga0373946_0010485 | 3300035171 | Bacteria | 3431 |
| 724 | Ga0373946_0012758 | 3300035171 | Bacteria | 3150 |
| 725 | Ga0373946_0043584 | 3300035171 | Bacteria | 1849 |
| 726 | Ga0373955_0064278 | 3300035172 | Bacteria | 2034 |
| 727 | Ga0373942_0011121 | 3300035207 | Bacteria | 2129 |
| 728 | Ga0373942_0024381 | 3300035207 | Bacteria | 1551 |
| 729 | Ga0373942_0042025 | 3300035207 | Bacteria | 1252 |
| 730 | Ga0373962_0079267 | 3300035242 | Bacteria | 994 |
| 731 | Ga0373962_0118443 | 3300035242 | Bacteria | 842 |
| 732 | Ga0373931_0024664 | 3300035691 | Bacteria | 3049 |
| 733 | Ga0373935_0027291 | 3300035692 | Bacteria | 3529 |
| 734 | Ga0373935_0056375 | 3300035692 | Bacteria | 2505 |
| 735 | Ga0373935_0776194 | 3300035692 | Bacteria | 707 |
| 736 | Ga0373927_0179963 | 3300035695 | Bacteria | 1387 |
| 737 | Ga0373927_0608921 | 3300035695 | Bacteria | 722 |
| 738 | Ga0373947_0001170 | 3300035725 | Bacteria | 16135 |
| 739 | Ga0373947_0021881 | 3300035725 | Bacteria | 3705 |
| 740 | Ga0373947_0077723 | 3300035725 | Bacteria | 2047 |
| 741 | Ga0373925_0002413 | 3300037068 | Bacteria | 14989 |
| 742 | Ga0373925_0005888 | 3300037068 | Bacteria | 9086 |
| 743 | Ga0395899_0020886 | 3300037312 | Bacteria | 4965 |
| 744 | Ga0395899_0028347 | 3300037312 | Bacteria | 4218 |
| 745 | Ga0395899_0046455 | 3300037312 | Bacteria | 3234 |
| 746 | Ga0395899_0067817 | 3300037312 | Bacteria | 2617 |
| 747 | Ga0395899_0138564 | 3300037312 | Bacteria | 1733 |
| 748 | Ga0395899_0139362 | 3300037312 | Bacteria | 1727 |
| 749 | Ga0395899_0211262 | 3300037312 | Bacteria | 1348 |
| 750 | Ga0395899_0487693 | 3300037312 | Bacteria | 801 |
| 751 | Ga0395900_0005039 | 3300037418 | Bacteria | 13865 |
| 752 | Ga0395900_0006191 | 3300037418 | Bacteria | 12500 |
| 753 | Ga0395900_0016906 | 3300037418 | Bacteria | 7446 |
| 754 | Ga0395900_0018665 | 3300037418 | Bacteria | 7072 |
| 755 | Ga0395900_0034383 | 3300037418 | Bacteria | 5219 |
| 756 | Ga0395900_0042427 | 3300037418 | Bacteria | 4688 |
| 757 | Ga0395900_0154219 | 3300037418 | Bacteria | 2346 |
| 758 | Ga0395900_0301212 | 3300037418 | Bacteria | 1589 |
| 759 | Ga0395900_0415207 | 3300037418 | Bacteria | 1307 |
| 760 | Ga0395900_0696984 | 3300037418 | Bacteria | 949 |
| 761 | Ga0395900_1122354 | 3300037418 | Bacteria | 703 |
| 762 | Ga0395898_0007564 | 3300037466 | Bacteria | 11531 |
| 763 | Ga0395898_0008297 | 3300037466 | Bacteria | 10981 |
| 764 | Ga0395898_0008928 | 3300037466 | Bacteria | 10558 |
| 765 | Ga0395898_0012453 | 3300037466 | Bacteria | 8793 |
| 766 | Ga0395898_0020929 | 3300037466 | Bacteria | 6639 |
| 767 | Ga0395898_0029711 | 3300037466 | Bacteria | 5471 |
| 768 | Ga0395898_0030941 | 3300037466 | Bacteria | 5352 |
| 769 | Ga0395898_0049014 | 3300037466 | Bacteria | 4140 |
| 770 | Ga0395898_0237459 | 3300037466 | Bacteria | 1738 |
| 771 | Ga0395898_0357703 | 3300037466 | Bacteria | 1392 |
| 772 | Ga0395898_0795630 | 3300037466 | Bacteria | 886 |
| 773 | Ga0395898_1175391 | 3300037466 | Bacteria | 699 |
| 774 | Ga0395905_0008121 | 3300037471 | Bacteria | 10371 |
| 775 | Ga0395905_0013654 | 3300037471 | Bacteria | 7780 |
| 776 | Ga0395905_0028429 | 3300037471 | Bacteria | 5271 |
| 777 | Ga0395905_0093108 | 3300037471 | Bacteria | 2826 |
| 778 | Ga0395905_0255584 | 3300037471 | Bacteria | 1636 |
| 779 | Ga0395905_0259425 | 3300037471 | Bacteria | 1623 |
| 780 | Ga0395901_0001394 | 3300038443 | Bacteria | 25270 |
| 781 | Ga0395901_0018677 | 3300038443 | Bacteria | 7082 |
| 782 | Ga0395901_0030335 | 3300038443 | Bacteria | 5570 |
| 783 | Ga0395901_0045262 | 3300038443 | Bacteria | 4566 |
| 784 | Ga0395901_0046914 | 3300038443 | Bacteria | 4488 |
| 785 | Ga0395901_0048579 | 3300038443 | Bacteria | 4407 |
| 786 | Ga0395901_0049742 | 3300038443 | Bacteria | 4355 |
| 787 | Ga0395901_0076133 | 3300038443 | Bacteria | 3500 |
| 788 | Ga0395901_0084892 | 3300038443 | Bacteria | 3309 |
| 789 | Ga0395901_0108752 | 3300038443 | Bacteria | 2910 |
| 790 | Ga0395901_0641993 | 3300038443 | Bacteria | 1066 |
| 791 | Ga0395901_0685863 | 3300038443 | Bacteria | 1024 |
| 792 | Ga0395901_0776522 | 3300038443 | Bacteria | 949 |
| 793 | Ga0395901_0880175 | 3300038443 | Bacteria | 879 |
| 794 | Ga0395901_0949067 | 3300038443 | Bacteria | 839 |
| 795 | Ga0395901_1027776 | 3300038443 | Bacteria | 798 |
| 796 | Ga0395901_1355547 | 3300038443 | Bacteria | 671 |
| 797 | Ga0436362_0333183 | 3300039453 | Bacteria | 858 |
| 798 | Ga0439453_0031430 | 3300041408 | Bacteria | 1008 |
| 799 | Ga0439461_0002509 | 3300041410 | Bacteria | 2939 |
| 800 | Ga0439461_0006604 | 3300041410 | Bacteria | 2027 |
| 801 | Ga0451845_0755589 | 3300041501 | Bacteria | 558 |
| 802 | Ga0451855_0630633 | 3300041511 | Bacteria | 708 |
| 803 | Ga0451853_3441756 | 3300041512 | Bacteria | 1080 |
| 804 | Ga0439431_0062890 | 3300041997 | Bacteria | 979 |
| 805 | Ga0439441_069043 | 3300042001 | Bacteria | 755 |
| 806 | Ga0439448_0006641 | 3300042005 | Bacteria | 3331 |
| 807 | Ga0439448_0059887 | 3300042005 | Bacteria | 1257 |
| 808 | Ga0450914_013631 | 3300042118 | Bacteria | 830 |
| 809 | Ga0450915_010463 | 3300042119 | Bacteria | 648 |
| 810 | Ga0450920_060395 | 3300042122 | Bacteria | 765 |
| 811 | Ga0450923_144099 | 3300042125 | Bacteria | 574 |
| 812 | Ga0450906_008578 | 3300042145 | Bacteria | 1971 |
| 813 | Ga0450907_012704 | 3300042146 | Bacteria | 1402 |
| 814 | Ga0450907_024917 | 3300042146 | Bacteria | 1011 |
| 815 | Ga0439458_0060493 | 3300042157 | Bacteria | 945 |
| 816 | Ga0450908_053481 | 3300042184 | Bacteria | 704 |
| 817 | Ga0439434_0007093 | 3300042435 | Bacteria | 3276 |
| 818 | Ga0439459_0035129 | 3300042438 | Bacteria | 1040 |
| 819 | Ga0450918_031432 | 3300042531 | Bacteria | 938 |
| 820 | Ga0466972_0016657 | 3300044658 | Bacteria | 3675 |
| 821 | Ga0466972_0115747 | 3300044658 | Bacteria | 1266 |
| 822 | Ga0453683_0000116 | 3300044673 | Bacteria | 117881 |
| 823 | Ga0466965_0293467 | 3300044683 | Bacteria | 881 |
| 824 | Ga0466966_0001812 | 3300044684 | Bacteria | 13865 |
| 825 | Ga0466961_0086259 | 3300044693 | Bacteria | 1984 |
| 826 | Ga0466961_0374596 | 3300044693 | Bacteria | 865 |
| 827 | Ga0466963_0011190 | 3300044694 | Bacteria | 5460 |
| 828 | Ga0466963_0018934 | 3300044694 | Bacteria | 4311 |
| 829 | Ga0466963_0045320 | 3300044694 | Bacteria | 2896 |
| 830 | Ga0466963_0095016 | 3300044694 | Bacteria | 2034 |
| 831 | Ga0466963_0100329 | 3300044694 | Bacteria | 1981 |
| 832 | Ga0466963_0103009 | 3300044694 | Bacteria | 1955 |
| 833 | Ga0466963_0192814 | 3300044694 | Bacteria | 1424 |
| 834 | Ga0466964_0004071 | 3300044706 | Bacteria | 5378 |
| 835 | Ga0466964_0005786 | 3300044706 | Bacteria | 4602 |
| 836 | Ga0466964_0085338 | 3300044706 | Bacteria | 1363 |
| 837 | Ga0466964_0221651 | 3300044706 | Bacteria | 919 |
| 838 | Ga0466964_0254218 | 3300044706 | Bacteria | 868 |
| 839 | Ga0453684_0000711 | 3300044712 | Bacteria | 117909 |
| 840 | Ga0466971_0363870 | 3300044719 | Bacteria | 701 |
| 841 | Ga0466968_0248761 | 3300044735 | Bacteria | 844 |
| 842 | Ga0466970_0061954 | 3300044765 | Bacteria | 2005 |
| 843 | Ga0466957_0420956 | 3300044842 | Bacteria | 916 |
| 844 | Ga0466960_0373131 | 3300044901 | Bacteria | 818 |
| 845 | Ga0466959_0003470 | 3300045049 | Bacteria | 10326 |
| 846 | Ga0466959_0213889 | 3300045049 | Bacteria | 1339 |
| 847 | Ga0466959_0254413 | 3300045049 | Bacteria | 1211 |
| 848 | Ga0451576_0060221 | 3300045051 | Bacteria | 3961 |
| 849 | Ga0466958_0011397 | 3300045836 | Bacteria | 5008 |
| 850 | Ga0466958_0223750 | 3300045836 | Unclassified | 1201 |
| 851 | Ga0466958_0259212 | 3300045836 | Bacteria | 1113 |
| 852 | Ga0466958_0299250 | 3300045836 | Bacteria | 1033 |
| 853 | Ga0466958_0349608 | 3300045836 | Bacteria | 952 |
| 854 | Ga0466967_0005367 | 3300045976 | Bacteria | 8866 |
| 855 | Ga0466967_0007799 | 3300045976 | Bacteria | 7774 |
| 856 | Ga0466967_0022395 | 3300045976 | Bacteria | 5153 |
| 857 | Ga0466967_0053989 | 3300045976 | Bacteria | 3534 |
| 858 | Ga0466967_0081657 | 3300045976 | Bacteria | 2920 |
| 859 | Ga0466967_0123105 | 3300045976 | Bacteria | 2399 |
| 860 | Ga0466967_0221806 | 3300045976 | Bacteria | 1797 |
| 861 | Ga0466967_0242874 | 3300045976 | Bacteria | 1718 |
| 862 | Ga0466967_0315386 | 3300045976 | Bacteria | 1507 |
| 863 | Ga0466967_0383938 | 3300045976 | Bacteria | 1364 |
| 864 | Ga0466967_0406467 | 3300045976 | Bacteria | 1325 |
| 865 | Ga0466967_0406966 | 3300045976 | Bacteria | 1324 |
| 866 | Ga0466967_0700342 | 3300045976 | Bacteria | 1003 |
| 867 | Ga0466967_0731955 | 3300045976 | Bacteria | 980 |
| 868 | Ga0495592_0105305 | 3300046454 | Bacteria | 2004 |
| 869 | Ga0495592_0225742 | 3300046454 | Bacteria | 1249 |
| 870 | Ga0495603_0003409 | 3300046455 | Bacteria | 9462 |
| 871 | Ga0495603_0008654 | 3300046455 | Bacteria | 6151 |
| 872 | Ga0495603_0055478 | 3300046455 | Bacteria | 2348 |
| 873 | Ga0495603_0122233 | 3300046455 | Bacteria | 1517 |
| 874 | Ga0495603_0167318 | 3300046455 | Bacteria | 1274 |
| 875 | Ga0495590_0302303 | 3300046457 | Unclassified | 602 |
| 876 | Ga0495629_0000319 | 3300046459 | Bacteria | 41153 |
| 877 | Ga0495629_0164954 | 3300046459 | Bacteria | 1538 |
| 878 | Ga0495629_0473276 | 3300046459 | Unclassified | 847 |
| 879 | Ga0495638_0261555 | 3300046460 | Bacteria | 949 |
| 880 | Ga0495641_0001038 | 3300046461 | Bacteria | 23885 |
| 881 | Ga0495641_0005764 | 3300046461 | Bacteria | 8229 |
| 882 | Ga0495641_0019178 | 3300046461 | Bacteria | 3509 |
| 883 | Ga0495641_0101654 | 3300046461 | Bacteria | 1283 |
| 884 | Ga0495641_0231798 | 3300046461 | Bacteria | 829 |
| 885 | Ga0495651_0053665 | 3300046462 | Bacteria | 3102 |
| 886 | Ga0495653_0141917 | 3300046463 | Bacteria | 1688 |
| 887 | Ga0495582_0000358 | 3300046473 | Bacteria | 24948 |
| 888 | Ga0495582_0042154 | 3300046473 | Bacteria | 2515 |
| 889 | Ga0495582_0092750 | 3300046473 | Bacteria | 1685 |
| 890 | Ga0495582_0226188 | 3300046473 | Bacteria | 1071 |
| 891 | Ga0495582_0487138 | 3300046473 | Bacteria | 713 |
| 892 | Ga0495639_0029704 | 3300046475 | Bacteria | 2426 |
| 893 | Ga0495639_0076174 | 3300046475 | Bacteria | 1556 |
| 894 | Ga0495639_0384755 | 3300046475 | Bacteria | 707 |
| 895 | Ga0495662_0023259 | 3300046476 | Unclassified | 2992 |
| 896 | Ga0495584_0107194 | 3300046491 | Bacteria | 1413 |
| 897 | Ga0495585_0247203 | 3300046492 | Bacteria | 891 |
| 898 | Ga0495585_0311479 | 3300046492 | Bacteria | 772 |
| 899 | Ga0495594_0000335 | 3300046499 | Bacteria | 23428 |
| 900 | Ga0495594_0129617 | 3300046499 | Bacteria | 1428 |
| 901 | Ga0495583_0260461 | 3300046506 | Bacteria | 694 |
| 902 | Ga0495608_0095675 | 3300046511 | Bacteria | 1918 |
| 903 | Ga0495608_0543054 | 3300046511 | Bacteria | 701 |
| 904 | Ga0495616_0195853 | 3300046513 | Bacteria | 891 |
| 905 | Ga0495618_0051633 | 3300046514 | Bacteria | 2598 |
| 906 | Ga0495618_0521577 | 3300046514 | Bacteria | 714 |
| 907 | Ga0495628_0419492 | 3300046516 | Bacteria | 975 |
| 908 | Ga0495630_0055378 | 3300046517 | Bacteria | 2972 |
| 909 | Ga0495630_0098348 | 3300046517 | Bacteria | 2213 |
| 910 | Ga0495630_0284389 | 3300046517 | Unclassified | 1263 |
| 911 | Ga0495630_0577217 | 3300046517 | Bacteria | 862 |
| 912 | Ga0495630_0911446 | 3300046517 | Bacteria | 669 |
| 913 | Ga0495631_0172881 | 3300046518 | Bacteria | 926 |
| 914 | Ga0495637_0141180 | 3300046520 | Bacteria | 914 |
| 915 | Ga0495637_0301275 | 3300046520 | Bacteria | 569 |
| 916 | Ga0495644_0038281 | 3300046523 | Bacteria | 1809 |
| 917 | Ga0495652_0080303 | 3300046529 | Bacteria | 2694 |
| 918 | Ga0495665_0009202 | 3300046531 | Bacteria | 5350 |
| 919 | Ga0495640_0039198 | 3300046533 | Bacteria | 3326 |
| 920 | Ga0495640_0130517 | 3300046533 | Bacteria | 1627 |
| 921 | Ga0495587_0129732 | 3300046536 | Unclassified | 1441 |
| 922 | Ga0495587_0226193 | 3300046536 | Bacteria | 1055 |
| 923 | Ga0495609_0034769 | 3300046538 | Bacteria | 2283 |
| 924 | Ga0495645_0026238 | 3300046543 | Bacteria | 4229 |
| 925 | Ga0495645_0069153 | 3300046543 | Bacteria | 2548 |
| 926 | Ga0495622_0083398 | 3300046557 | Bacteria | 1471 |
| 927 | Ga0495633_0231050 | 3300046558 | Bacteria | 846 |
| 928 | Ga0495667_0031121 | 3300046559 | Bacteria | 3583 |
| 929 | Ga0495667_0074632 | 3300046559 | Bacteria | 2208 |
| 930 | Ga0495667_0190474 | 3300046559 | Bacteria | 1314 |
| 931 | Ga0495656_0069527 | 3300046615 | Bacteria | 1560 |
| 932 | Ga0495656_0308945 | 3300046615 | Bacteria | 812 |
| 933 | Ga0495656_0328480 | 3300046615 | Bacteria | 789 |
| 934 | Ga0495656_0480150 | 3300046615 | Bacteria | 657 |
| 935 | Ga0495668_0215257 | 3300046616 | Bacteria | 1052 |
| 936 | Ga0495668_0215651 | 3300046616 | Bacteria | 1051 |
| 937 | Ga0495634_0116191 | 3300046642 | Bacteria | 1716 |
| 938 | Ga0495634_0235255 | 3300046642 | Bacteria | 1126 |
| 939 | Ga0495635_0088573 | 3300046663 | Bacteria | 2118 |
| 940 | Ga0495635_0090789 | 3300046663 | Bacteria | 2089 |
| 941 | Ga0495635_0342524 | 3300046663 | Bacteria | 998 |
| 942 | Ga0495588_0001807 | 3300046674 | Bacteria | 9121 |
| 943 | Ga0495657_0140413 | 3300046675 | Bacteria | 1506 |
| 944 | Ga0495657_0199284 | 3300046675 | Bacteria | 1221 |
| 945 | Ga0495657_0245978 | 3300046675 | Bacteria | 1078 |
| 946 | Ga0495657_0304596 | 3300046675 | Bacteria | 950 |
| 947 | Ga0495599_0200693 | 3300046678 | Bacteria | 1225 |
| 948 | Ga0495646_0045430 | 3300046680 | Bacteria | 2683 |
| 949 | Ga0495646_0347046 | 3300046680 | Bacteria | 778 |
| 950 | Ga0495647_0009460 | 3300046681 | Bacteria | 3303 |
| 951 | Ga0495647_0017910 | 3300046681 | Bacteria | 2514 |
| 952 | Ga0495658_0000384 | 3300046683 | Bacteria | 24849 |
| 953 | Ga0495658_0086752 | 3300046683 | Bacteria | 1847 |
| 954 | Ga0495658_0314464 | 3300046683 | Bacteria | 992 |
| 955 | Ga0495658_0588674 | 3300046683 | Bacteria | 713 |
| 956 | Ga0495613_0012745 | 3300046689 | Bacteria | 6250 |
| 957 | Ga0495613_0659882 | 3300046689 | Bacteria | 691 |
| 958 | Ga0495624_0209392 | 3300046690 | Bacteria | 1183 |
| 959 | Ga0495624_0493691 | 3300046690 | Unclassified | 732 |
| 960 | Ga0495670_0143692 | 3300046691 | Bacteria | 1249 |
| 961 | Ga0495671_0297207 | 3300046692 | Bacteria | 777 |
| 962 | Ga0495589_0178992 | 3300046794 | Bacteria | 1006 |
| 963 | Ga0495589_0232643 | 3300046794 | Unclassified | 864 |
| 964 | Ga0495600_0269084 | 3300046809 | Bacteria | 1081 |
| 965 | Ga0495581_0003702 | 3300047315 | Bacteria | 8805 |
| 966 | Ga0495581_0062252 | 3300047315 | Bacteria | 2156 |
| 967 | Ga0495581_0301707 | 3300047315 | Bacteria | 936 |
| 968 | Ga0495604_0016942 | 3300047317 | Bacteria | 5827 |
| 969 | Ga0495636_0166821 | 3300047318 | Bacteria | 994 |
| 970 | Ga0495674_0078894 | 3300047319 | Bacteria | 2828 |
| 971 | Ga0495674_0102044 | 3300047319 | Bacteria | 2440 |
| 972 | Ga0495674_0166994 | 3300047319 | Bacteria | 1838 |
| 973 | Ga0495674_0340652 | 3300047319 | Bacteria | 1219 |
| 974 | Ga0495674_0529008 | 3300047319 | Bacteria | 940 |
| 975 | Ga0495674_0811740 | 3300047319 | Bacteria | 727 |
| 976 | Ga0495676_0005182 | 3300047321 | Bacteria | 11930 |
| 977 | Ga0495676_0013466 | 3300047321 | Bacteria | 7349 |
| 978 | Ga0495676_0028678 | 3300047321 | Bacteria | 4750 |
| 979 | Ga0495676_0315822 | 3300047321 | Bacteria | 1051 |
| 980 | Ga0495676_0443737 | 3300047321 | Unclassified | 857 |
| 981 | Ga0495676_0450806 | 3300047321 | Bacteria | 849 |
| 982 | Ga0495676_0832144 | 3300047321 | Unclassified | 593 |
| 983 | Ga0495680_0006719 | 3300047322 | Bacteria | 10637 |
| 984 | Ga0495680_0074473 | 3300047322 | Bacteria | 2578 |
| 985 | Ga0495680_0076759 | 3300047322 | Bacteria | 2532 |
| 986 | Ga0495675_0222075 | 3300047444 | Bacteria | 1143 |
| 987 | Ga0495677_0094053 | 3300047445 | Bacteria | 1131 |
| 988 | Ga0495685_099224 | 3300047447 | Bacteria | 962 |
| 989 | Ga0495684_0004656 | 3300047471 | Bacteria | 10704 |
| 990 | Ga0495684_0049998 | 3300047471 | Bacteria | 3193 |
| 991 | Ga0495684_0077443 | 3300047471 | Bacteria | 2524 |
| 992 | Ga0495593_0022099 | 3300047673 | Bacteria | 3549 |
| 993 | Ga0495602_0500699 | 3300048088 | Bacteria | 849 |
| 994 | Ga0495614_0006789 | 3300048089 | Bacteria | 5121 |
| 995 | Ga0496100_0009532 | 3300048903 | Bacteria | 5457 |
| 996 | Ga0496100_0021451 | 3300048903 | Bacteria | 3890 |
| 997 | Ga0496100_0065983 | 3300048903 | Bacteria | 2400 |
| 998 | Ga0496100_0082745 | 3300048903 | Bacteria | 2171 |
| 999 | Ga0496100_0084580 | 3300048903 | Bacteria | 2150 |
| 1000 | Ga0496100_0139109 | 3300048903 | Unclassified | 1718 |
| 1001 | Ga0496100_0576361 | 3300048903 | Bacteria | 872 |
| 1002 | Ga0496101_0004773 | 3300048904 | Bacteria | 8596 |
| 1003 | Ga0496101_0007708 | 3300048904 | Bacteria | 6993 |
| 1004 | Ga0496101_0017360 | 3300048904 | Bacteria | 4883 |
| 1005 | Ga0496101_0021420 | 3300048904 | Bacteria | 4441 |
| 1006 | Ga0496101_0051812 | 3300048904 | Bacteria | 2958 |
| 1007 | Ga0496101_0093099 | 3300048904 | Bacteria | 2244 |
| 1008 | Ga0496101_0093836 | 3300048904 | Bacteria | 2235 |
| 1009 | Ga0496101_0122133 | 3300048904 | Bacteria | 1970 |
| 1010 | Ga0496101_0136927 | 3300048904 | Bacteria | 1864 |
| 1011 | Ga0496102_0015057 | 3300048905 | Bacteria | 6732 |
| 1012 | Ga0496102_0055258 | 3300048905 | Bacteria | 3620 |
| 1013 | Ga0496102_0152111 | 3300048905 | Bacteria | 2175 |
| 1014 | Ga0496102_0158096 | 3300048905 | Bacteria | 2131 |
| 1015 | Ga0496102_0158574 | 3300048905 | Bacteria | 2128 |
| 1016 | Ga0496102_0174995 | 3300048905 | Bacteria | 2021 |
| 1017 | Ga0496102_0203294 | 3300048905 | Bacteria | 1867 |
| 1018 | Ga0496102_0218907 | 3300048905 | Bacteria | 1794 |
| 1019 | Ga0496102_0227462 | 3300048905 | Bacteria | 1759 |
| 1020 | Ga0496102_0257607 | 3300048905 | Bacteria | 1645 |
| 1021 | Ga0496102_0349185 | 3300048905 | Bacteria | 1393 |
| 1022 | Ga0496102_0368644 | 3300048905 | Bacteria | 1352 |
| 1023 | Ga0496102_0615537 | 3300048905 | Bacteria | 1009 |
| 1024 | Ga0496102_0629819 | 3300048905 | Bacteria | 996 |
| 1025 | Ga0496103_0010477 | 3300048906 | Bacteria | 5486 |
| 1026 | Ga0496103_0084399 | 3300048906 | Bacteria | 2001 |
| 1027 | Ga0496103_0174960 | 3300048906 | Bacteria | 1379 |
| 1028 | Ga0496103_0177118 | 3300048906 | Bacteria | 1370 |
| 1029 | Ga0496103_0202855 | 3300048906 | Bacteria | 1275 |
| 1030 | Ga0496103_0536520 | 3300048906 | Bacteria | 747 |
| 1031 | Ga0496103_0877071 | 3300048906 | Bacteria | 563 |
| 1032 | Ga0496104_0000772 | 3300048907 | Bacteria | 27396 |
| 1033 | Ga0496104_0007557 | 3300048907 | Bacteria | 9613 |
| 1034 | Ga0496104_0008292 | 3300048907 | Bacteria | 9229 |
| 1035 | Ga0496104_0027431 | 3300048907 | Bacteria | 5270 |
| 1036 | Ga0496104_0033493 | 3300048907 | Bacteria | 4787 |
| 1037 | Ga0496104_0082762 | 3300048907 | Bacteria | 3061 |
| 1038 | Ga0496104_0162349 | 3300048907 | Bacteria | 2143 |
| 1039 | Ga0496104_0165574 | 3300048907 | Bacteria | 2120 |
| 1040 | Ga0496104_0224198 | 3300048907 | Unclassified | 1792 |
| 1041 | Ga0496104_0365797 | 3300048907 | Bacteria | 1354 |
| 1042 | Ga0496104_1651705 | 3300048907 | Bacteria | 543 |
| 1043 | Ga0496105_0000542 | 3300048908 | Bacteria | 24896 |
| 1044 | Ga0496105_0001696 | 3300048908 | Bacteria | 15709 |
| 1045 | Ga0496105_0007198 | 3300048908 | Bacteria | 8588 |
| 1046 | Ga0496105_0009206 | 3300048908 | Bacteria | 7710 |
| 1047 | Ga0496105_0164031 | 3300048908 | Bacteria | 1823 |
| 1048 | Ga0496105_0221924 | 3300048908 | Bacteria | 1538 |
| 1049 | Ga0496105_0809802 | 3300048908 | Bacteria | 711 |
| 1050 | Ga0496106_0001537 | 3300048909 | Bacteria | 17362 |
| 1051 | Ga0496106_0020948 | 3300048909 | Bacteria | 4851 |
| 1052 | Ga0496106_0038705 | 3300048909 | Bacteria | 3570 |
| 1053 | Ga0496106_0072840 | 3300048909 | Bacteria | 2628 |
| 1054 | Ga0496106_0194109 | 3300048909 | Bacteria | 1615 |
| 1055 | Ga0496106_0393602 | 3300048909 | Bacteria | 1113 |
| 1056 | Ga0496106_0446657 | 3300048909 | Bacteria | 1039 |
| 1057 | Ga0496106_0455690 | 3300048909 | Unclassified | 1027 |
| 1058 | Ga0496106_0582096 | 3300048909 | Bacteria | 897 |
| 1059 | Ga0496107_0026371 | 3300048910 | Bacteria | 4118 |
| 1060 | Ga0496107_0064781 | 3300048910 | Unclassified | 2649 |
| 1061 | Ga0496107_0089944 | 3300048910 | Bacteria | 2242 |
| 1062 | Ga0496107_0105432 | 3300048910 | Bacteria | 2069 |
| 1063 | Ga0496107_0120359 | 3300048910 | Bacteria | 1934 |
| 1064 | Ga0496107_0125988 | 3300048910 | Bacteria | 1889 |
| 1065 | Ga0496107_0160394 | 3300048910 | Bacteria | 1666 |
| 1066 | Ga0496107_0179758 | 3300048910 | Bacteria | 1571 |
| 1067 | Ga0496107_0346403 | 3300048910 | Bacteria | 1106 |
| 1068 | Ga0496107_0414483 | 3300048910 | Bacteria | 1002 |
| 1069 | Ga0496108_0005130 | 3300048911 | Bacteria | 10585 |
| 1070 | Ga0496108_0006227 | 3300048911 | Bacteria | 9662 |
| 1071 | Ga0496108_0010320 | 3300048911 | Bacteria | 7585 |
| 1072 | Ga0496108_0014895 | 3300048911 | Bacteria | 6345 |
| 1073 | Ga0496108_0052707 | 3300048911 | Bacteria | 3411 |
| 1074 | Ga0496108_1124620 | 3300048911 | Bacteria | 667 |
| 1075 | Ga0496109_0004123 | 3300048912 | Bacteria | 12137 |
| 1076 | Ga0496109_0004692 | 3300048912 | Bacteria | 11405 |
| 1077 | Ga0496109_0008161 | 3300048912 | Bacteria | 8880 |
| 1078 | Ga0496109_0014104 | 3300048912 | Bacteria | 6946 |
| 1079 | Ga0496109_0025582 | 3300048912 | Bacteria | 5261 |
| 1080 | Ga0496109_0144490 | 3300048912 | Bacteria | 2225 |
| 1081 | Ga0496109_0147690 | 3300048912 | Bacteria | 2200 |
| 1082 | Ga0496109_0305220 | 3300048912 | Bacteria | 1501 |
| 1083 | Ga0496109_0319201 | 3300048912 | Bacteria | 1466 |
| 1084 | Ga0496109_0542384 | 3300048912 | Bacteria | 1097 |
| 1085 | Ga0496109_0607467 | 3300048912 | Bacteria | 1030 |
| 1086 | Ga0496109_0661243 | 3300048912 | Bacteria | 982 |
| 1087 | Ga0496109_0683354 | 3300048912 | Bacteria | 964 |
| 1088 | Ga0496110_0003110 | 3300048913 | Bacteria | 12598 |
| 1089 | Ga0496110_0006858 | 3300048913 | Bacteria | 9052 |
| 1090 | Ga0496110_0008633 | 3300048913 | Bacteria | 8207 |
| 1091 | Ga0496110_0041284 | 3300048913 | Bacteria | 4025 |
| 1092 | Ga0496110_0065452 | 3300048913 | Bacteria | 3213 |
| 1093 | Ga0496110_0114907 | 3300048913 | Bacteria | 2422 |
| 1094 | Ga0496110_0124386 | 3300048913 | Bacteria | 2326 |
| 1095 | Ga0496110_0212723 | 3300048913 | Bacteria | 1758 |
| 1096 | Ga0496110_0328068 | 3300048913 | Bacteria | 1394 |
| 1097 | Ga0496110_1289295 | 3300048913 | Bacteria | 640 |
| 1098 | Ga0496110_1304664 | 3300048913 | Bacteria | 635 |
| 1099 | Ga0496111_0003211 | 3300048914 | Bacteria | 10089 |
| 1100 | Ga0496111_0019344 | 3300048914 | Bacteria | 4728 |
| 1101 | Ga0496111_0092384 | 3300048914 | Bacteria | 2218 |
| 1102 | Ga0496111_0204143 | 3300048914 | Bacteria | 1469 |
| 1103 | Ga0496111_0609762 | 3300048914 | Bacteria | 799 |
| 1104 | Ga0496111_0765025 | 3300048914 | Bacteria | 700 |
| 1105 | Ga0496112_0040085 | 3300048915 | Bacteria | 4578 |
| 1106 | Ga0496112_0041236 | 3300048915 | Bacteria | 4516 |
| 1107 | Ga0496112_0108928 | 3300048915 | Bacteria | 2740 |
| 1108 | Ga0496112_0126958 | 3300048915 | Bacteria | 2521 |
| 1109 | Ga0496112_0212202 | 3300048915 | Bacteria | 1893 |
| 1110 | Ga0496112_0477886 | 3300048915 | Bacteria | 1183 |
| 1111 | Ga0496112_0556413 | 3300048915 | Unclassified | 1081 |
| 1112 | Ga0496112_0919876 | 3300048915 | Bacteria | 796 |
| 1113 | Ga0496113_0003511 | 3300048916 | Bacteria | 9405 |
| 1114 | Ga0496113_0008566 | 3300048916 | Bacteria | 6671 |
| 1115 | Ga0496113_0088583 | 3300048916 | Bacteria | 2381 |
| 1116 | Ga0496113_0173723 | 3300048916 | Bacteria | 1707 |
| 1117 | Ga0496113_0353131 | 3300048916 | Bacteria | 1179 |
| 1118 | Ga0496113_0849271 | 3300048916 | Bacteria | 724 |
| 1119 | Ga0496114_0022160 | 3300048917 | Bacteria | 5174 |
| 1120 | Ga0496114_0028260 | 3300048917 | Bacteria | 4600 |
| 1121 | Ga0496114_0030707 | 3300048917 | Bacteria | 4421 |
| 1122 | Ga0496114_0047640 | 3300048917 | Bacteria | 3565 |
| 1123 | Ga0496114_0057194 | 3300048917 | Bacteria | 3256 |
| 1124 | Ga0496114_0164863 | 3300048917 | Bacteria | 1929 |
| 1125 | Ga0496114_0166269 | 3300048917 | Bacteria | 1920 |
| 1126 | Ga0496114_0167938 | 3300048917 | Bacteria | 1911 |
| 1127 | Ga0496114_0228613 | 3300048917 | Bacteria | 1634 |
| 1128 | Ga0496114_0264859 | 3300048917 | Bacteria | 1514 |
| 1129 | Ga0496114_0271826 | 3300048917 | Unclassified | 1493 |
| 1130 | Ga0496114_0358395 | 3300048917 | Bacteria | 1290 |
| 1131 | Ga0496114_0651925 | 3300048917 | Bacteria | 926 |
| 1132 | Ga0496115_0001529 | 3300048918 | Bacteria | 16618 |
| 1133 | Ga0496115_0007349 | 3300048918 | Bacteria | 8105 |
| 1134 | Ga0496115_0041664 | 3300048918 | Bacteria | 3655 |
| 1135 | Ga0496115_0041826 | 3300048918 | Bacteria | 3649 |
| 1136 | Ga0496115_0083210 | 3300048918 | Bacteria | 2608 |
| 1137 | Ga0496115_0184557 | 3300048918 | Bacteria | 1724 |
| 1138 | Ga0496115_0371049 | 3300048918 | Bacteria | 1165 |
| 1139 | Ga0496115_0753583 | 3300048918 | Bacteria | 761 |
| 1140 | Ga0496126_0087126 | 3300048929 | Bacteria | 2751 |
| 1141 | Ga0501031_0003117 | 3300049568 | Bacteria | 10619 |
| 1142 | Ga0501031_0004009 | 3300049568 | Bacteria | 9500 |
| 1143 | Ga0501031_0110248 | 3300049568 | Unclassified | 1797 |
| 1144 | Ga0501031_0128640 | 3300049568 | Bacteria | 1654 |
| 1145 | Ga0501031_0150697 | 3300049568 | Bacteria | 1519 |
| 1146 | Ga0501032_0013857 | 3300049569 | Bacteria | 5720 |
| 1147 | Ga0501032_0069401 | 3300049569 | Bacteria | 2352 |
| 1148 | Ga0501032_0165608 | 3300049569 | Bacteria | 1450 |
| 1149 | Ga0501033_0001257 | 3300049570 | Bacteria | 22689 |
| 1150 | Ga0501033_0005970 | 3300049570 | Bacteria | 9558 |
| 1151 | Ga0501033_0131619 | 3300049570 | Bacteria | 1812 |
| 1152 | Ga0501033_0332127 | 3300049570 | Bacteria | 1067 |
| 1153 | Ga0501033_0336540 | 3300049570 | Bacteria | 1059 |
| 1154 | Ga0501034_0030117 | 3300049571 | Bacteria | 5516 |
| 1155 | Ga0501034_0502011 | 3300049571 | Bacteria | 1127 |
| 1156 | Ga0501034_0525367 | 3300049571 | Bacteria | 1095 |
| 1157 | Ga0501036_0000438 | 3300049572 | Bacteria | 29594 |
| 1158 | Ga0501036_0022774 | 3300049572 | Bacteria | 5274 |
| 1159 | Ga0501036_0059392 | 3300049572 | Bacteria | 3240 |
| 1160 | Ga0501036_0089202 | 3300049572 | Bacteria | 2605 |
| 1161 | Ga0501036_0200136 | 3300049572 | Bacteria | 1680 |
| 1162 | Ga0501036_0307188 | 3300049572 | Bacteria | 1326 |
| 1163 | Ga0501036_0446298 | 3300049572 | Bacteria | 1078 |
| 1164 | Ga0501036_0478699 | 3300049572 | Bacteria | 1036 |
| 1165 | Ga0501036_0605088 | 3300049572 | Bacteria | 909 |
| 1166 | Ga0501037_0005711 | 3300049573 | Bacteria | 9080 |
| 1167 | Ga0501037_0015947 | 3300049573 | Bacteria | 5531 |
| 1168 | Ga0501037_0028761 | 3300049573 | Bacteria | 4107 |
| 1169 | Ga0501038_0018357 | 3300049574 | Bacteria | 6315 |
| 1170 | Ga0501038_0164821 | 3300049574 | Bacteria | 1798 |
| 1171 | Ga0501039_0003341 | 3300049575 | Bacteria | 11987 |
| 1172 | Ga0501039_0014065 | 3300049575 | Bacteria | 6125 |
| 1173 | Ga0501039_0048311 | 3300049575 | Bacteria | 3290 |
| 1174 | Ga0501039_0112619 | 3300049575 | Bacteria | 2127 |
| 1175 | Ga0501039_0253224 | 3300049575 | Bacteria | 1384 |
| 1176 | Ga0501039_1243012 | 3300049575 | Bacteria | 575 |
| 1177 | Ga0501040_0002595 | 3300049576 | Bacteria | 11646 |
| 1178 | Ga0501040_0018259 | 3300049576 | Bacteria | 4656 |
| 1179 | Ga0501040_0040871 | 3300049576 | Bacteria | 3157 |
| 1180 | Ga0501040_0061429 | 3300049576 | Bacteria | 2584 |
| 1181 | Ga0501040_0096608 | 3300049576 | Bacteria | 2057 |
| 1182 | Ga0501040_0100589 | 3300049576 | Bacteria | 2016 |
| 1183 | Ga0501040_0367104 | 3300049576 | Bacteria | 1032 |
| 1184 | Ga0501040_0436585 | 3300049576 | Bacteria | 942 |
| 1185 | Ga0501041_0000272 | 3300049577 | Bacteria | 24566 |
| 1186 | Ga0501041_0008817 | 3300049577 | Bacteria | 5937 |
| 1187 | Ga0501041_0020721 | 3300049577 | Bacteria | 3933 |
| 1188 | Ga0501041_0159918 | 3300049577 | Bacteria | 1408 |
| 1189 | Ga0501041_0224279 | 3300049577 | Bacteria | 1179 |
| 1190 | Ga0501042_0005652 | 3300049578 | Bacteria | 8068 |
| 1191 | Ga0501042_0011216 | 3300049578 | Bacteria | 6039 |
| 1192 | Ga0501042_0021152 | 3300049578 | Bacteria | 4530 |
| 1193 | Ga0501042_0035607 | 3300049578 | Bacteria | 3531 |
| 1194 | Ga0501042_0038652 | 3300049578 | Bacteria | 3388 |
| 1195 | Ga0501042_0073548 | 3300049578 | Bacteria | 2445 |
| 1196 | Ga0501042_0191048 | 3300049578 | Bacteria | 1477 |
| 1197 | Ga0501042_0197680 | 3300049578 | Bacteria | 1450 |
| 1198 | Ga0501042_0329468 | 3300049578 | Bacteria | 1104 |
| 1199 | Ga0501043_0002934 | 3300049579 | Bacteria | 14238 |
| 1200 | Ga0501043_0040102 | 3300049579 | Bacteria | 3680 |
| 1201 | Ga0501043_0064747 | 3300049579 | Bacteria | 2871 |
| 1202 | Ga0501043_0082556 | 3300049579 | Bacteria | 2526 |
| 1203 | Ga0501043_0313334 | 3300049579 | Bacteria | 1197 |
| 1204 | Ga0501046_0004980 | 3300049580 | Bacteria | 11923 |
| 1205 | Ga0501046_0010277 | 3300049580 | Bacteria | 8053 |
| 1206 | Ga0501046_0033878 | 3300049580 | Bacteria | 4124 |
| 1207 | Ga0501046_0039062 | 3300049580 | Bacteria | 3804 |
| 1208 | Ga0501046_0136096 | 3300049580 | Bacteria | 1861 |
| 1209 | Ga0501047_0087698 | 3300049581 | Bacteria | 2989 |
| 1210 | Ga0501047_0153364 | 3300049581 | Bacteria | 2178 |
| 1211 | Ga0501047_0619336 | 3300049581 | Bacteria | 903 |
| 1212 | Ga0501048_0003848 | 3300049582 | Bacteria | 11439 |
| 1213 | Ga0501048_0008582 | 3300049582 | Bacteria | 7716 |
| 1214 | Ga0501048_0008591 | 3300049582 | Bacteria | 7711 |
| 1215 | Ga0501048_0008943 | 3300049582 | Bacteria | 7540 |
| 1216 | Ga0501048_0029086 | 3300049582 | Bacteria | 4009 |
| 1217 | Ga0501048_0143972 | 3300049582 | Bacteria | 1686 |
| 1218 | Ga0501048_0209159 | 3300049582 | Bacteria | 1384 |
| 1219 | Ga0501048_0262641 | 3300049582 | Bacteria | 1227 |
| 1220 | Ga0501048_0741379 | 3300049582 | Bacteria | 706 |
| 1221 | Ga0501067_0009782 | 3300049583 | Bacteria | 5307 |
| 1222 | Ga0501067_0012551 | 3300049583 | Bacteria | 4701 |
| 1223 | Ga0501067_0025167 | 3300049583 | Bacteria | 3299 |
| 1224 | Ga0501067_0061377 | 3300049583 | Bacteria | 2081 |
| 1225 | Ga0501067_0149483 | 3300049583 | Bacteria | 1301 |
| 1226 | Ga0501067_0362182 | 3300049583 | Bacteria | 808 |
| 1227 | Ga0501068_0008676 | 3300049584 | Bacteria | 5668 |
| 1228 | Ga0501068_0030659 | 3300049584 | Bacteria | 3191 |
| 1229 | Ga0501068_0107923 | 3300049584 | Bacteria | 1729 |
| 1230 | Ga0501068_0139159 | 3300049584 | Bacteria | 1521 |
| 1231 | Ga0501068_0216603 | 3300049584 | Unclassified | 1216 |
| 1232 | Ga0501068_0688412 | 3300049584 | Bacteria | 668 |
| 1233 | Ga0501069_0000320 | 3300049585 | Bacteria | 21738 |
| 1234 | Ga0501069_0006299 | 3300049585 | Bacteria | 6201 |
| 1235 | Ga0501069_0013380 | 3300049585 | Bacteria | 4375 |
| 1236 | Ga0501069_0028480 | 3300049585 | Bacteria | 3063 |
| 1237 | Ga0501069_0097277 | 3300049585 | Bacteria | 1668 |
| 1238 | Ga0501069_0263542 | 3300049585 | Bacteria | 1006 |
| 1239 | Ga0501069_0657289 | 3300049585 | Bacteria | 631 |
| 1240 | Ga0501070_0003597 | 3300049586 | Bacteria | 13404 |
| 1241 | Ga0501070_0057784 | 3300049586 | Bacteria | 3216 |
| 1242 | Ga0501070_0080998 | 3300049586 | Bacteria | 2686 |
| 1243 | Ga0501070_0134039 | 3300049586 | Bacteria | 2045 |
| 1244 | Ga0501070_0172381 | 3300049586 | Bacteria | 1782 |
| 1245 | Ga0501070_0189518 | 3300049586 | Bacteria | 1691 |
| 1246 | Ga0501070_0355580 | 3300049586 | Bacteria | 1188 |
| 1247 | Ga0501070_0378997 | 3300049586 | Bacteria | 1146 |
| 1248 | Ga0501070_0816546 | 3300049586 | Bacteria | 731 |
| 1249 | Ga0501071_0007099 | 3300049587 | Bacteria | 7320 |
| 1250 | Ga0501071_0010243 | 3300049587 | Bacteria | 6275 |
| 1251 | Ga0501071_0013262 | 3300049587 | Bacteria | 5616 |
| 1252 | Ga0501071_0029755 | 3300049587 | Bacteria | 3857 |
| 1253 | Ga0501071_0033239 | 3300049587 | Bacteria | 3664 |
| 1254 | Ga0501071_0038220 | 3300049587 | Bacteria | 3429 |
| 1255 | Ga0501071_0361858 | 3300049587 | Bacteria | 1105 |
| 1256 | Ga0501071_1002816 | 3300049587 | Bacteria | 645 |
| 1257 | Ga0501072_0003690 | 3300049588 | Bacteria | 11545 |
| 1258 | Ga0501072_0011922 | 3300049588 | Bacteria | 6639 |
| 1259 | Ga0501072_0061848 | 3300049588 | Bacteria | 2953 |
| 1260 | Ga0501072_0099416 | 3300049588 | Bacteria | 2312 |
| 1261 | Ga0501072_0109324 | 3300049588 | Bacteria | 2200 |
| 1262 | Ga0501072_0158818 | 3300049588 | Bacteria | 1803 |
| 1263 | Ga0501072_0200084 | 3300049588 | Bacteria | 1593 |
| 1264 | Ga0501072_0691013 | 3300049588 | Bacteria | 802 |
| 1265 | Ga0501073_0015343 | 3300049589 | Bacteria | 5555 |
| 1266 | Ga0501073_0018304 | 3300049589 | Bacteria | 5061 |
| 1267 | Ga0501073_0076717 | 3300049589 | Bacteria | 2325 |
| 1268 | Ga0501073_0591276 | 3300049589 | Bacteria | 767 |
| 1269 | Ga0501073_0612696 | 3300049589 | Bacteria | 752 |
| 1270 | Ga0501074_0007978 | 3300049590 | Bacteria | 7665 |
| 1271 | Ga0501074_0011208 | 3300049590 | Bacteria | 6512 |
| 1272 | Ga0501074_0027167 | 3300049590 | Bacteria | 4149 |
| 1273 | Ga0501074_0027630 | 3300049590 | Bacteria | 4114 |
| 1274 | Ga0501074_0056720 | 3300049590 | Bacteria | 2823 |
| 1275 | Ga0501074_0084538 | 3300049590 | Bacteria | 2274 |
| 1276 | Ga0501075_0012033 | 3300049591 | Bacteria | 6142 |
| 1277 | Ga0501075_0014141 | 3300049591 | Bacteria | 5717 |
| 1278 | Ga0501075_0018119 | 3300049591 | Bacteria | 5092 |
| 1279 | Ga0501075_0081785 | 3300049591 | Bacteria | 2446 |
| 1280 | Ga0501075_0145712 | 3300049591 | Bacteria | 1805 |
| 1281 | Ga0501075_0160232 | 3300049591 | Bacteria | 1716 |
| 1282 | Ga0501075_0170923 | 3300049591 | Bacteria | 1658 |
| 1283 | Ga0501075_0428227 | 3300049591 | Bacteria | 1009 |
| 1284 | Ga0501075_0457839 | 3300049591 | Bacteria | 973 |
| 1285 | Ga0501076_0006818 | 3300049592 | Bacteria | 8286 |
| 1286 | Ga0501076_0008410 | 3300049592 | Bacteria | 7562 |
| 1287 | Ga0501076_0042315 | 3300049592 | Bacteria | 3585 |
| 1288 | Ga0501076_0051268 | 3300049592 | Bacteria | 3266 |
| 1289 | Ga0501076_0078315 | 3300049592 | Bacteria | 2653 |
| 1290 | Ga0501076_0096468 | 3300049592 | Bacteria | 2381 |
| 1291 | Ga0501076_0159449 | 3300049592 | Bacteria | 1837 |
| 1292 | Ga0501076_0255619 | 3300049592 | Bacteria | 1434 |
| 1293 | Ga0501076_0285250 | 3300049592 | Bacteria | 1353 |
| 1294 | Ga0501076_0292015 | 3300049592 | Bacteria | 1336 |
| 1295 | Ga0501076_0299530 | 3300049592 | Bacteria | 1318 |
| 1296 | Ga0501076_0575635 | 3300049592 | Bacteria | 929 |
| 1297 | Ga0501077_0002390 | 3300049593 | Bacteria | 11262 |
| 1298 | Ga0501077_0003190 | 3300049593 | Bacteria | 9879 |
| 1299 | Ga0501077_0007502 | 3300049593 | Bacteria | 6728 |
| 1300 | Ga0501077_0020949 | 3300049593 | Bacteria | 4137 |
| 1301 | Ga0501077_0127292 | 3300049593 | Bacteria | 1614 |
| 1302 | Ga0501077_0247216 | 3300049593 | Bacteria | 1134 |
| 1303 | Ga0501077_0360546 | 3300049593 | Bacteria | 928 |
| 1304 | Ga0501077_0413553 | 3300049593 | Bacteria | 862 |
| 1305 | Ga0501077_0416715 | 3300049593 | Bacteria | 859 |
| 1306 | Ga0501079_0010920 | 3300049741 | Bacteria | 6918 |
| 1307 | Ga0501079_0024417 | 3300049741 | Bacteria | 4637 |
| 1308 | Ga0501079_0048826 | 3300049741 | Bacteria | 3266 |
| 1309 | Ga0501079_0071141 | 3300049741 | Bacteria | 2687 |
| 1310 | Ga0501079_0071500 | 3300049741 | Bacteria | 2681 |
| 1311 | Ga0501079_0109253 | 3300049741 | Bacteria | 2148 |
| 1312 | Ga0501079_0114184 | 3300049741 | Bacteria | 2099 |
| 1313 | Ga0501079_0332861 | 3300049741 | Bacteria | 1189 |
| 1314 | Ga0501079_0543490 | 3300049741 | Bacteria | 914 |
| 1315 | Ga0501080_0013722 | 3300049742 | Bacteria | 7459 |
| 1316 | Ga0501080_0042483 | 3300049742 | Bacteria | 4233 |
| 1317 | Ga0501080_0107805 | 3300049742 | Bacteria | 2581 |
| 1318 | Ga0501080_0188497 | 3300049742 | Bacteria | 1896 |
| 1319 | Ga0501080_0290194 | 3300049742 | Bacteria | 1485 |
| 1320 | Ga0501080_0365568 | 3300049742 | Bacteria | 1301 |
| 1321 | Ga0501080_0972820 | 3300049742 | Bacteria | 737 |
| 1322 | Ga0501080_1393181 | 3300049742 | Bacteria | 598 |
| 1323 | Ga0501081_0000320 | 3300049743 | Bacteria | 25716 |
| 1324 | Ga0501081_0003083 | 3300049743 | Bacteria | 10583 |
| 1325 | Ga0501081_0007598 | 3300049743 | Bacteria | 7028 |
| 1326 | Ga0501081_0071856 | 3300049743 | Bacteria | 2412 |
| 1327 | Ga0501081_0146952 | 3300049743 | Bacteria | 1692 |
| 1328 | Ga0501081_0156640 | 3300049743 | Bacteria | 1639 |
| 1329 | Ga0501081_0287116 | 3300049743 | Bacteria | 1205 |
| 1330 | Ga0501081_0419682 | 3300049743 | Bacteria | 992 |
| 1331 | Ga0501083_0013286 | 3300049744 | Bacteria | 5757 |
| 1332 | Ga0501083_0021534 | 3300049744 | Bacteria | 4477 |
| 1333 | Ga0501083_0055055 | 3300049744 | Bacteria | 2668 |
| 1334 | Ga0501083_0134452 | 3300049744 | Bacteria | 1621 |
| 1335 | Ga0501083_0243608 | 3300049744 | Bacteria | 1171 |
| 1336 | Ga0501035_0005359 | 3300049822 | Bacteria | 12126 |
| 1337 | Ga0501035_0034327 | 3300049822 | Bacteria | 4609 |
| 1338 | Ga0501035_0336122 | 3300049822 | Bacteria | 1266 |
| 1339 | Ga0501044_0029131 | 3300049823 | Bacteria | 5823 |
| 1340 | Ga0501044_0109626 | 3300049823 | Bacteria | 2769 |
| 1341 | Ga0501044_0337131 | 3300049823 | Bacteria | 1429 |
| 1342 | Ga0501045_0009699 | 3300049824 | Bacteria | 6735 |
| 1343 | Ga0501045_0016286 | 3300049824 | Bacteria | 5278 |
| 1344 | Ga0501045_0082789 | 3300049824 | Bacteria | 2366 |
| 1345 | Ga0501045_0123484 | 3300049824 | Bacteria | 1923 |
| 1346 | Ga0501045_0145088 | 3300049824 | Bacteria | 1765 |
| 1347 | Ga0501045_0193392 | 3300049824 | Bacteria | 1516 |
| 1348 | nmdc:mga06z11_325617_c1 | 3300050494 | Bacteria | 917 |
| 1349 | nmdc:mga05p37_44713_c1 | 3300050507 | Bacteria | 5448 |
| 1350 | nmdc:mga05p37_5798_c1 | 3300050507 | Bacteria | 14515 |
| 1351 | nmdc:mga05p37_767360_c1 | 3300050507 | Bacteria | 1060 |
| 1352 | nmdc:mga05p37_77242_c1 | 3300050507 | Bacteria | 4099 |
| 1353 | nmdc:mga09592_5777_c1 | 3300050508 | Bacteria | 10091 |
| 1354 | nmdc:mga06r32_534639_c1 | 3300050510 | Bacteria | 1147 |
| 1355 | nmdc:mga06r32_879291_c1 | 3300050510 | Bacteria | 853 |
| 1356 | nmdc:mga08y16_45695_c1 | 3300050511 | Bacteria | 4587 |
| 1357 | nmdc:mga08y16_45854_c1 | 3300050511 | Bacteria | 4579 |
| 1358 | nmdc:mga08y16_4641_c1 | 3300050511 | Bacteria | 14314 |
| 1359 | nmdc:mga08y16_7339_c1 | 3300050511 | Bacteria | 11567 |
| 1360 | nmdc:mga0n895_1281208_c1 | 3300050512 | Unclassified | 704 |
| 1361 | nmdc:mga0n895_21569_c1 | 3300050512 | Bacteria | 6027 |
| 1362 | nmdc:mga0n895_39596_c1 | 3300050512 | Bacteria | 4574 |
| 1363 | nmdc:mga0n895_51009_c1 | 3300050512 | Bacteria | 4058 |
| 1364 | nmdc:mga0n895_708519_c1 | 3300050512 | Bacteria | 1002 |
| 1365 | nmdc:mga0rr50_106430_c1 | 3300050513 | Bacteria | 2213 |
| 1366 | nmdc:mga0rr50_166436_c1 | 3300050513 | Bacteria | 1793 |
| 1367 | nmdc:mga0rr50_17069_c1 | 3300050513 | Bacteria | 4836 |
| 1368 | nmdc:mga0rr50_704856_c1 | 3300050513 | Bacteria | 861 |
| 1369 | nmdc:mga0rr50_891718_c1 | 3300050513 | Bacteria | 758 |
| 1370 | nmdc:mga08x19_145980_c1 | 3300050514 | Bacteria | 1600 |
| 1371 | nmdc:mga0a205_13018_c2 | 3300050515 | Bacteria | 4261 |
| 1372 | nmdc:mga0a205_163016_c1 | 3300050515 | Bacteria | 2125 |
| 1373 | nmdc:mga0a205_235509_c1 | 3300050515 | Bacteria | 1713 |
| 1374 | nmdc:mga0a205_238652_c1 | 3300050515 | Bacteria | 1699 |
| 1375 | Ga0495601_0019356 | 3300053077 | Bacteria | 4152 |
| 1376 | Ga0495601_0020364 | 3300053077 | Bacteria | 4051 |
| 1377 | Ga0495612_0228470 | 3300053078 | Bacteria | 825 |
| 1378 | Ga0495595_0121019 | 3300053084 | Bacteria | 1275 |
| 1379 | Ga0495595_0122614 | 3300053084 | Bacteria | 1267 |
| 1380 | Ga0495619_0002851 | 3300053085 | Bacteria | 11265 |
| 1381 | Ga0495619_0101844 | 3300053085 | Bacteria | 1955 |
| 1382 | Ga0495619_0232925 | 3300053085 | Bacteria | 1276 |
| 1383 | Ga0501084_0035054 | 3300054114 | Bacteria | 4194 |
| 1384 | Ga0501084_0065112 | 3300054114 | Bacteria | 3049 |
| 1385 | Ga0501084_0082184 | 3300054114 | Bacteria | 2703 |
| 1386 | Ga0501084_0090499 | 3300054114 | Bacteria | 2569 |
| 1387 | Ga0501084_0094618 | 3300054114 | Bacteria | 2508 |
| 1388 | Ga0501084_0114662 | 3300054114 | Bacteria | 2265 |
| 1389 | Ga0501084_0419278 | 3300054114 | Bacteria | 1132 |
| 1390 | Ga0501084_0577005 | 3300054114 | Bacteria | 950 |
| 1391 | Ga0501082_0003920 | 3300060353 | Bacteria | 12988 |
| 1392 | Ga0501082_0059360 | 3300060353 | Bacteria | 3297 |
| 1393 | Ga0501082_0069262 | 3300060353 | Bacteria | 3037 |
| 1394 | Ga0501082_0109111 | 3300060353 | Bacteria | 2395 |
| 1395 | Ga0501082_0119647 | 3300060353 | Bacteria | 2282 |
| 1396 | Ga0501082_0163308 | 3300060353 | Bacteria | 1935 |
| 1397 | Ga0501082_0216182 | 3300060353 | Bacteria | 1668 |
| 1398 | Ga0501082_0256480 | 3300060353 | Bacteria | 1521 |
| 1399 | Ga0501082_0539516 | 3300060353 | Bacteria | 1020 |
| 1400 | Ga0501082_0548452 | 3300060353 | Bacteria | 1011 |
| 1401 | Ga0501082_0727045 | 3300060353 | Bacteria | 869 |
| 1402 | Ga0501082_1698323 | 3300060353 | Bacteria | 551 |
| 1403 | Ga0466962_0051738 | 3300061719 | Bacteria | 1964 |
| 1404 | Ga0530510_0005132 | 3300061734 | Bacteria | 9033 |
| 1405 | Ga0530510_0015539 | 3300061734 | Bacteria | 5380 |
| 1406 | Ga0530510_0080379 | 3300061734 | Bacteria | 2372 |
| 1407 | Ga0530510_0146610 | 3300061734 | Bacteria | 1741 |
| 1408 | Ga0530510_0174458 | 3300061734 | Bacteria | 1593 |
| 1409 | Ga0530510_0226503 | 3300061734 | Bacteria | 1390 |
| 1410 | Ga0530510_0285664 | 3300061734 | Bacteria | 1233 |
| 1411 | Ga0530510_0297651 | 3300061734 | Bacteria | 1207 |
| 1412 | Ga0530510_0538157 | 3300061734 | Bacteria | 887 |
| 1413 | Ga0530510_0662627 | 3300061734 | Bacteria | 795 |
| 1414 | Ga0530510_0789688 | 3300061734 | Bacteria | 724 |
| 1415 | Ga0530510_0879495 | 3300061734 | Unclassified | 684 |
| 1416 | Ga0530510_1251017 | 3300061734 | Bacteria | 569 |
| 1417 | Ga0466967_0030523 | |||
| 1418 | 2214816880 | |||
| 1419 | ARcpr5yngRDRAFT_c006493 | |||
| 1420 | ARSoilOldRDRAFT_c013101 | |||
| 1421 | ARCol0yngRDRAFT_1001458 | |||
| 1422 | JGI24752J21851_1020796 | |||
| 1423 | JGI24745J21846_1025808 | |||
| 1424 | JGI24738J21930_10002089 | |||
| 1425 | JGI24744J21845_10025080 | |||
| 1426 | JGI24742J22300_10014548 | |||
| 1427 | JGI25406J46586_10011377 | |||
| 1428 | Ga0070658_10028387 | |||
| 1429 | Ga0070658_10073865 | |||
| 1430 | Ga0070658_10093254 | |||
| 1431 | Ga0070658_10848866 | |||
| 1432 | Ga0070676_10153986 | |||
| 1433 | Ga0070683_100029653 | |||
| 1434 | Ga0070683_100144680 | |||
| 1435 | Ga0070683_100174867 | |||
| 1436 | Ga0070683_100253753 | |||
| 1437 | Ga0070683_100284079 | |||
| 1438 | Ga0070683_100521310 | |||
| 1439 | Ga0070683_100573908 | |||
| 1440 | Ga0070670_100338901 | |||
| 1441 | Ga0070670_100556422 | |||
| 1442 | Ga0068869_100173115 | |||
| 1443 | Ga0068869_100225989 | |||
| 1444 | Ga0068869_100305945 | |||
| 1445 | Ga0068869_100542856 | |||
| 1446 | Ga0070666_10213096 | |||
| 1447 | Ga0070680_100018347 | |||
| 1448 | Ga0070680_100028372 | |||
| 1449 | Ga0070680_100045740 | |||
| 1450 | Ga0070680_100122044 | |||
| 1451 | Ga0070680_100167926 | |||
| 1452 | Ga0070680_100296531 | |||
| 1453 | Ga0070680_101299595 | |||
| 1454 | Ga0070682_100005555 | |||
| 1455 | Ga0070682_100087214 | |||
| 1456 | Ga0070682_100093714 | |||
| 1457 | Ga0070682_101069954 | |||
| 1458 | Ga0068868_100248807 | |||
| 1459 | Ga0068868_100387187 | |||
| 1460 | Ga0068868_100451946 | |||
| 1461 | Ga0068868_100755232 | |||
| 1462 | Ga0070660_100015792 | |||
| 1463 | Ga0070660_100056838 | |||
| 1464 | Ga0070660_100088676 | |||
| 1465 | Ga0070660_100169908 | |||
| 1466 | Ga0070660_100273716 | |||
| 1467 | Ga0070660_100394629 | |||
| 1468 | Ga0070660_100561474 | |||
| 1469 | Ga0070660_101184581 | |||
| 1470 | Ga0070689_100005340 | |||
| 1471 | Ga0070691_10003771 | |||
| 1472 | Ga0070691_10021850 | |||
| 1473 | Ga0070691_10022999 | |||
| 1474 | Ga0070691_10037542 | |||
| 1475 | Ga0070691_10097045 | |||
| 1476 | Ga0070687_100068541 | |||
| 1477 | Ga0070661_100035074 | |||
| 1478 | Ga0070661_100063469 | |||
| 1479 | Ga0070661_100107194 | |||
| 1480 | Ga0070661_100140677 | |||
| 1481 | Ga0070692_10043742 | |||
| 1482 | Ga0070692_10065909 | |||
| 1483 | Ga0070692_10066375 | |||
| 1484 | Ga0070692_10222380 | |||
| 1485 | Ga0070668_100022054 | |||
| 1486 | Ga0070668_100735734 | |||
| 1487 | Ga0070669_100161049 | |||
| 1488 | Ga0070669_100500629 | |||
| 1489 | Ga0070669_101631180 | |||
| 1490 | Ga0070675_100028162 | |||
| 1491 | Ga0070671_100071026 | |||
| 1492 | Ga0070671_100109526 | |||
| 1493 | Ga0070671_100226993 | |||
| 1494 | Ga0070671_100292196 | |||
| 1495 | Ga0070674_100008284 | |||
| 1496 | Ga0070674_100100235 | |||
| 1497 | Ga0070674_100324839 | |||
| 1498 | Ga0070674_100663246 | |||
| 1499 | Ga0070673_100370208 | |||
| 1500 | Ga0070673_100420476 | |||
| 1501 | Ga0070673_100469981 | |||
| 1502 | Ga0070673_100564376 | |||
| 1503 | Ga0070673_100940782 | |||
| 1504 | Ga0070688_100051201 | |||
| 1505 | Ga0070659_100001998 | |||
| 1506 | Ga0070659_100103888 | |||
| 1507 | Ga0070659_100326295 | |||
| 1508 | Ga0070659_100451928 | |||
| 1509 | Ga0070659_100666363 | |||
| 1510 | Ga0070659_101061817 | |||
| 1511 | Ga0070667_100446894 | |||
| 1512 | Ga0070667_101016450 | |||
| 1513 | Ga0070703_10212878 | |||
| 1514 | Ga0070703_10337002 | |||
| 1515 | Ga0070709_10009177 | |||
| 1516 | Ga0070714_100202872 | |||
| 1517 | Ga0070714_100300577 | |||
| 1518 | Ga0070714_100667393 | |||
| 1519 | Ga0070714_100760722 | |||
| 1520 | Ga0070714_101058897 | |||
| 1521 | Ga0070713_100041201 | |||
| 1522 | Ga0070713_100167838 | |||
| 1523 | Ga0070701_10007675 | |||
| 1524 | Ga0070701_10049727 | |||
| 1525 | Ga0070701_10073213 | |||
| 1526 | Ga0070701_10324580 | |||
| 1527 | Ga0070705_100091597 | |||
| 1528 | Ga0070700_100012145 | |||
| 1529 | Ga0070700_100069903 | |||
| 1530 | Ga0070700_100072809 | |||
| 1531 | Ga0070700_100128893 | |||
| 1532 | Ga0070694_100021140 | |||
| 1533 | Ga0070694_100187024 | |||
| 1534 | Ga0070708_100542962 | |||
| 1535 | Ga0070708_100856526 | |||
| 1536 | Ga0070663_100036850 | |||
| 1537 | Ga0070663_100280369 | |||
| 1538 | Ga0070678_100021514 | |||
| 1539 | Ga0070678_100058257 | |||
| 1540 | Ga0070678_100373311 | |||
| 1541 | Ga0070678_101308266 | |||
| 1542 | Ga0070662_100038735 | |||
| 1543 | Ga0070662_100082784 | |||
| 1544 | Ga0070662_100133834 | |||
| 1545 | Ga0070681_10005563 | |||
| 1546 | Ga0070681_10015890 | |||
| 1547 | Ga0070681_10044358 | |||
| 1548 | Ga0070681_10052938 | |||
| 1549 | Ga0068867_100097261 | |||
| 1550 | Ga0068867_100113353 | |||
| 1551 | Ga0068867_101199102 | |||
| 1552 | Ga0070685_10065405 | |||
| 1553 | Ga0070706_100695611 | |||
| 1554 | Ga0070707_100033996 | |||
| 1555 | Ga0070707_100456006 | |||
| 1556 | Ga0070698_100232291 | |||
| 1557 | Ga0070698_100315678 | |||
| 1558 | Ga0070699_100052321 | |||
| 1559 | Ga0070699_100317388 | |||
| 1560 | Ga0070699_100626240 | |||
| 1561 | Ga0070679_100028786 | |||
| 1562 | Ga0070679_100042749 | |||
| 1563 | Ga0070679_100048557 | |||
| 1564 | Ga0070679_100104029 | |||
| 1565 | Ga0070679_100112797 | |||
| 1566 | Ga0070679_100203155 | |||
| 1567 | Ga0070679_100300255 | |||
| 1568 | Ga0070679_100875268 | |||
| 1569 | Ga0070684_100026440 | |||
| 1570 | Ga0070684_100040062 | |||
| 1571 | Ga0070684_100073575 | |||
| 1572 | Ga0070684_100094323 | |||
| 1573 | Ga0070684_100175510 | |||
| 1574 | Ga0070684_100334053 | |||
| 1575 | Ga0070684_100355908 | |||
| 1576 | Ga0070684_100357682 | |||
| 1577 | Ga0070684_100434411 | |||
| 1578 | Ga0070684_100633245 | |||
| 1579 | Ga0070684_100642411 | |||
| 1580 | Ga0070697_100113025 | |||
| 1581 | Ga0068853_100029138 | |||
| 1582 | Ga0068853_100238566 | |||
| 1583 | Ga0068853_100547649 | |||
| 1584 | Ga0070672_100100450 | |||
| 1585 | Ga0070672_100647668 | |||
| 1586 | Ga0070686_100035224 | |||
| 1587 | Ga0070686_100133310 | |||
| 1588 | Ga0070686_100143504 | |||
| 1589 | Ga0070686_100195440 | |||
| 1590 | Ga0070686_100969159 | |||
| 1591 | Ga0070695_100139720 | |||
| 1592 | Ga0070695_100862221 | |||
| 1593 | Ga0070696_100027367 | |||
| 1594 | Ga0070696_100037188 | |||
| 1595 | Ga0070696_100179110 | |||
| 1596 | Ga0070693_100000955 | |||
| 1597 | Ga0070693_100007441 | |||
| 1598 | Ga0070693_100010299 | |||
| 1599 | Ga0070693_100012398 | |||
| 1600 | Ga0070693_100112252 | |||
| 1601 | Ga0070693_100157733 | |||
| 1602 | Ga0070665_100055818 | |||
| 1603 | Ga0070665_100142341 | |||
| 1604 | Ga0070665_100275563 | |||
| 1605 | Ga0070665_100495561 | |||
| 1606 | Ga0070665_100918604 | |||
| 1607 | Ga0070665_101025520 | |||
| 1608 | Ga0070704_100011496 | |||
| 1609 | Ga0070704_100028007 | |||
| 1610 | Ga0070704_100172887 | |||
| 1611 | Ga0070704_100248865 | |||
| 1612 | Ga0070704_100667980 | |||
| 1613 | Ga0070704_101250459 | |||
| 1614 | Ga0068855_100018717 | |||
| 1615 | Ga0068855_100069343 | |||
| 1616 | Ga0068855_100368910 | |||
| 1617 | Ga0068855_101430985 | |||
| 1618 | Ga0068855_101985825 | |||
| 1619 | Ga0070664_100022069 | |||
| 1620 | Ga0070664_100117243 | |||
| 1621 | Ga0070664_100257052 | |||
| 1622 | Ga0070664_100608741 | |||
| 1623 | Ga0070664_100974131 | |||
| 1624 | Ga0068857_100174378 | |||
| 1625 | Ga0068857_101490271 | |||
| 1626 | Ga0068854_100005503 | |||
| 1627 | Ga0068854_100017986 | |||
| 1628 | Ga0068854_100041637 | |||
| 1629 | Ga0068854_100160871 | |||
| 1630 | Ga0068854_101104131 | |||
| 1631 | Ga0068856_100301701 | |||
| 1632 | Ga0068856_100702320 | |||
| 1633 | Ga0068856_101927647 | |||
| 1634 | Ga0070702_100004649 | |||
| 1635 | Ga0070702_100029641 | |||
| 1636 | Ga0070702_100068243 | |||
| 1637 | Ga0070702_100108138 | |||
| 1638 | Ga0070702_100126384 | |||
| 1639 | Ga0070702_101013547 | |||
| 1640 | Ga0068852_100196323 | |||
| 1641 | Ga0068852_100684358 | |||
| 1642 | Ga0068864_100185310 | |||
| 1643 | Ga0068864_100208880 | |||
| 1644 | Ga0068864_100266022 | |||
| 1645 | Ga0068864_100296616 | |||
| 1646 | Ga0068866_10051601 | |||
| 1647 | Ga0068861_100064152 | |||
| 1648 | Ga0068861_100106828 | |||
| 1649 | Ga0068861_100123551 | |||
| 1650 | Ga0068861_100249235 | |||
| 1651 | Ga0068861_100257669 | |||
| 1652 | Ga0068861_100480735 | |||
| 1653 | Ga0068851_10233514 | |||
| 1654 | Ga0068863_100055686 | |||
| 1655 | Ga0068863_100360055 | |||
| 1656 | Ga0068858_100049668 | |||
| 1657 | Ga0068860_100086472 | |||
| 1658 | Ga0068860_100143821 | |||
| 1659 | Ga0068860_101489921 | |||
| 1660 | Ga0068862_100097810 | |||
| 1661 | Ga0081455_10005540 | |||
| 1662 | Ga0081455_10018652 | |||
| 1663 | Ga0081455_10030576 | |||
| 1664 | Ga0081455_10044774 | |||
| 1665 | Ga0081455_10081438 | |||
| 1666 | Ga0081455_10106203 | |||
| 1667 | Ga0081455_10596446 | |||
| 1668 | Ga0081540_1003067 | |||
| 1669 | Ga0081539_10002405 | |||
| 1670 | Ga0070717_10027966 | |||
| 1671 | Ga0070717_10070065 | |||
| 1672 | Ga0075364_10122466 | |||
| 1673 | Ga0075432_10010010 | |||
| 1674 | Ga0075432_10025565 | |||
| 1675 | Ga0070715_10001178 | |||
| 1676 | Ga0070716_100041743 | |||
| 1677 | Ga0075367_10507755 | |||
| 1678 | Ga0097621_100197668 | |||
| 1679 | Ga0068871_100009711 | |||
| 1680 | Ga0068871_100148916 | |||
| 1681 | Ga0068871_100726235 | |||
| 1682 | Ga0068871_100996724 | |||
| 1683 | Ga0075428_100004596 | |||
| 1684 | Ga0075428_101146762 | |||
| 1685 | Ga0075431_101167585 | |||
| 1686 | Ga0075433_10133079 | |||
| 1687 | Ga0075433_10181343 | |||
| 1688 | Ga0075433_10407730 | |||
| 1689 | Ga0075433_10672554 | |||
| 1690 | Ga0075433_11115868 | |||
| 1691 | Ga0075434_100084436 | |||
| 1692 | Ga0075434_100130780 | |||
| 1693 | Ga0075434_100254003 | |||
| 1694 | Ga0075429_100004653 | |||
| 1695 | Ga0068865_100014843 | |||
| 1696 | Ga0068865_100071374 | |||
| 1697 | Ga0068865_100133112 | |||
| 1698 | Ga0068865_100219739 | |||
| 1699 | Ga0068865_100251630 | |||
| 1700 | Ga0068865_100554030 | |||
| 1701 | Ga0075436_100108668 | |||
| 1702 | Ga0075436_100167473 | |||
| 1703 | Ga0097620_101503863 | |||
| 1704 | Ga0075435_100022089 | |||
| 1705 | Ga0075435_100085601 | |||
| 1706 | Ga0075435_100159844 | |||
| 1707 | Ga0105240_10046298 | |||
| 1708 | Ga0105240_10086768 | |||
| 1709 | Ga0111539_10012161 | |||
| 1710 | Ga0111539_10027630 | |||
| 1711 | Ga0111539_10034195 | |||
| 1712 | Ga0111539_10066501 | |||
| 1713 | Ga0111539_10196927 | |||
| 1714 | Ga0111539_10613413 | |||
| 1715 | Ga0105245_10016168 | |||
| 1716 | Ga0105245_10017950 | |||
| 1717 | Ga0105245_10034223 | |||
| 1718 | Ga0105245_10103413 | |||
| 1719 | Ga0105245_10157127 | |||
| 1720 | Ga0105245_10169323 | |||
| 1721 | Ga0105245_10224391 | |||
| 1722 | Ga0105245_10450912 | |||
| 1723 | Ga0105245_10478056 | |||
| 1724 | Ga0105245_10964181 | |||
| 1725 | Ga0105245_11214127 | |||
| 1726 | Ga0105247_10090884 | |||
| 1727 | Ga0114129_10057375 | |||
| 1728 | Ga0114129_10166456 | |||
| 1729 | Ga0114129_10201631 | |||
| 1730 | Ga0114129_11387111 | |||
| 1731 | Ga0105243_10004509 | |||
| 1732 | Ga0105243_10034643 | |||
| 1733 | Ga0105243_10040712 | |||
| 1734 | Ga0105243_10043648 | |||
| 1735 | Ga0105243_10065198 | |||
| 1736 | Ga0105243_10328602 | |||
| 1737 | Ga0105243_10519454 | |||
| 1738 | Ga0105243_10894800 | |||
| 1739 | Ga0105241_10139308 | |||
| 1740 | Ga0105241_10285805 | |||
| 1741 | Ga0105242_10018527 | |||
| 1742 | Ga0105242_10042065 | |||
| 1743 | Ga0105242_10043725 | |||
| 1744 | Ga0105242_10154676 | |||
| 1745 | Ga0105242_10159544 | |||
| 1746 | Ga0105242_11109767 | |||
| 1747 | Ga0105242_11547213 | |||
| 1748 | Ga0105248_10024279 | |||
| 1749 | Ga0105248_10036032 | |||
| 1750 | Ga0105248_10059234 | |||
| 1751 | Ga0105248_10377056 | |||
| 1752 | Ga0105248_10733528 | |||
| 1753 | Ga0105248_10934126 | |||
| 1754 | Ga0105238_10033949 | |||
| 1755 | Ga0105238_10036622 | |||
| 1756 | Ga0105238_10755076 | |||
| 1757 | Ga0105249_10071687 | |||
| 1758 | Ga0105249_10088435 | |||
| 1759 | Ga0105239_10013078 | |||
| 1760 | Ga0105239_10132229 | |||
| 1761 | Ga0105239_10197709 | |||
| 1762 | Ga0105239_10305401 | |||
| 1763 | Ga0105239_10393235 | |||
| 1764 | Ga0105239_11058591 | |||
| 1765 | Ga0105246_10023522 | |||
| 1766 | Ga0105246_10055747 | |||
| 1767 | Ga0105246_10077688 | |||
| 1768 | Ga0105246_10335427 | |||
| 1769 | Ga0105246_10661409 | |||
| 1770 | Ga0157338_1038496 | |||
| 1771 | Ga0157373_10020182 | |||
| 1772 | Ga0157373_10156617 | |||
| 1773 | Ga0157373_10883675 | |||
| 1774 | Ga0157371_10014835 | |||
| 1775 | Ga0157370_10032325 | |||
| 1776 | Ga0157370_10065360 | |||
| 1777 | Ga0157370_10584357 | |||
| 1778 | Ga0157369_10064948 | |||
| 1779 | Ga0157369_10071566 | |||
| 1780 | Ga0157369_10415816 | |||
| 1781 | Ga0157369_10691360 | |||
| 1782 | Ga0157374_10179776 | |||
| 1783 | Ga0157374_10906797 | |||
| 1784 | Ga0157378_10570038 | |||
| 1785 | Ga0163162_10081352 | |||
| 1786 | Ga0163162_10117336 | |||
| 1787 | Ga0163162_10270177 | |||
| 1788 | Ga0163162_10366223 | |||
| 1789 | Ga0163162_11097633 | |||
| 1790 | Ga0157372_10002633 | |||
| 1791 | Ga0157372_10015471 | |||
| 1792 | Ga0157372_10257736 | |||
| 1793 | Ga0157372_10297694 | |||
| 1794 | Ga0157372_10500620 | |||
| 1795 | Ga0157372_10654792 | |||
| 1796 | Ga0157372_10665809 | |||
| 1797 | Ga0157372_10801584 | |||
| 1798 | Ga0157372_10871628 | |||
| 1799 | Ga0157372_11062675 | |||
| 1800 | Ga0157372_11972920 | |||
| 1801 | Ga0157375_10097561 | |||
| 1802 | Ga0157375_10114437 | |||
| 1803 | Ga0157375_10115250 | |||
| 1804 | Ga0157375_10120317 | |||
| 1805 | Ga0157375_10189922 | |||
| 1806 | Ga0157375_10224667 | |||
| 1807 | Ga0157375_10439935 | |||
| 1808 | Ga0157375_11385213 | |||
| 1809 | Ga0157375_11580461 | |||
| 1810 | Ga0157375_12253909 | |||
| 1811 | Ga0163163_10008456 | |||
| 1812 | Ga0163163_10048159 | |||
| 1813 | Ga0163163_10058780 | |||
| 1814 | Ga0163163_10267134 | |||
| 1815 | Ga0163163_10315591 | |||
| 1816 | Ga0157380_10008767 | |||
| 1817 | Ga0157380_10032619 | |||
| 1818 | Ga0157380_10078410 | |||
| 1819 | Ga0157380_10858271 | |||
| 1820 | Ga0157380_11035618 | |||
| 1821 | Ga0157380_11372217 | |||
| 1822 | Ga0182008_10002069 | |||
| 1823 | Ga0157377_10030420 | |||
| 1824 | Ga0157377_10322723 | |||
| 1825 | Ga0157377_10612571 | |||
| 1826 | Ga0157377_10721547 | |||
| 1827 | Ga0157379_10041357 | |||
| 1828 | Ga0157379_10099485 | |||
| 1829 | Ga0157379_10182301 | |||
| 1830 | Ga0157376_10005934 | |||
| 1831 | Ga0157376_10874566 | |||
| 1832 | Ga0157376_11168922 | |||
| 1833 | Ga0157376_11196933 | |||
| 1834 | Ga0182006_1025563 | |||
| 1835 | Ga0163161_10020229 | |||
| 1836 | Ga0163161_10037290 | |||
| 1837 | Ga0163161_10194229 | |||
| 1838 | Ga0197907_11209785 | |||
| 1839 | Ga0206356_10135276 | |||
| 1840 | Ga0206356_10729576 | |||
| 1841 | Ga0206356_11490355 | |||
| 1842 | Ga0206354_10422378 | |||
| 1843 | Ga0206353_10256256 | |||
| 1844 | Ga0206353_10259330 | |||
| 1845 | Ga0206353_10521711 | |||
| 1846 | Ga0206353_10781712 | |||
| 1847 | Ga0224712_10205056 | |||
| 1848 | Ga0207656_10048249 | |||
| 1849 | Ga0207656_10101612 | |||
| 1850 | Ga0207682_10345904 | |||
| 1851 | Ga0207692_10082205 | |||
| 1852 | Ga0207692_10119985 | |||
| 1853 | Ga0207710_10043804 | |||
| 1854 | Ga0207688_10009610 | |||
| 1855 | Ga0207688_10047872 | |||
| 1856 | Ga0207688_10073397 | |||
| 1857 | Ga0207688_10087640 | |||
| 1858 | Ga0207688_10343491 | |||
| 1859 | Ga0207680_10087965 | |||
| 1860 | Ga0207680_10456607 | |||
| 1861 | Ga0207647_10284571 | |||
| 1862 | Ga0207647_10348956 | |||
| 1863 | Ga0207685_10020731 | |||
| 1864 | Ga0207685_10027426 | |||
| 1865 | Ga0207685_10032999 | |||
| 1866 | Ga0207699_10029836 | |||
| 1867 | Ga0207699_10544783 | |||
| 1868 | Ga0207645_10013240 | |||
| 1869 | Ga0207643_10099320 | |||
| 1870 | Ga0207643_10139344 | |||
| 1871 | Ga0207643_10203941 | |||
| 1872 | Ga0207643_10318890 | |||
| 1873 | Ga0207705_10083493 | |||
| 1874 | Ga0207705_10203147 | |||
| 1875 | Ga0207705_10210395 | |||
| 1876 | Ga0207684_10643310 | |||
| 1877 | Ga0207654_10009906 | |||
| 1878 | Ga0207707_10012425 | |||
| 1879 | Ga0207707_10042612 | |||
| 1880 | Ga0207707_10076571 | |||
| 1881 | Ga0207707_10129253 | |||
| 1882 | Ga0207707_10453523 | |||
| 1883 | Ga0207707_10657181 | |||
| 1884 | Ga0207695_10074445 | |||
| 1885 | Ga0207693_10033503 | |||
| 1886 | Ga0207693_10035327 | |||
| 1887 | Ga0207693_10035435 | |||
| 1888 | Ga0207693_10038584 | |||
| 1889 | Ga0207693_10264597 | |||
| 1890 | Ga0207663_10288184 | |||
| 1891 | Ga0207663_10676339 | |||
| 1892 | Ga0207660_10022525 | |||
| 1893 | Ga0207660_10228136 | |||
| 1894 | Ga0207660_10241712 | |||
| 1895 | Ga0207660_10375944 | |||
| 1896 | Ga0207660_10687194 | |||
| 1897 | Ga0207660_10858697 | |||
| 1898 | Ga0207657_10000054 | |||
| 1899 | Ga0207657_10029131 | |||
| 1900 | Ga0207657_10035785 | |||
| 1901 | Ga0207657_10041998 | |||
| 1902 | Ga0207657_10047519 | |||
| 1903 | Ga0207657_10056470 | |||
| 1904 | Ga0207657_10092812 | |||
| 1905 | Ga0207657_10210131 | |||
| 1906 | Ga0207657_10343042 | |||
| 1907 | Ga0207649_10031902 | |||
| 1908 | Ga0207649_10088076 | |||
| 1909 | Ga0207649_10121614 | |||
| 1910 | Ga0207649_10447122 | |||
| 1911 | Ga0207652_10053360 | |||
| 1912 | Ga0207652_10074054 | |||
| 1913 | Ga0207652_10098968 | |||
| 1914 | Ga0207652_10140516 | |||
| 1915 | Ga0207652_10165542 | |||
| 1916 | Ga0207652_10694118 | |||
| 1917 | Ga0207652_10817739 | |||
| 1918 | Ga0207652_11192882 | |||
| 1919 | Ga0207646_10001441 | |||
| 1920 | Ga0207646_10080864 | |||
| 1921 | Ga0207646_10380760 | |||
| 1922 | Ga0207646_10498163 | |||
| 1923 | Ga0207681_10342217 | |||
| 1924 | Ga0207681_11274936 | |||
| 1925 | Ga0207694_10012672 | |||
| 1926 | Ga0207659_10023159 | |||
| 1927 | Ga0207659_10029960 | |||
| 1928 | Ga0207659_10080953 | |||
| 1929 | Ga0207659_10367234 | |||
| 1930 | Ga0207659_10670842 | |||
| 1931 | Ga0207687_10003116 | |||
| 1932 | Ga0207687_10037565 | |||
| 1933 | Ga0207687_10043574 | |||
| 1934 | Ga0207687_10080179 | |||
| 1935 | Ga0207687_10093037 | |||
| 1936 | Ga0207687_10164698 | |||
| 1937 | Ga0207664_10016122 | |||
| 1938 | Ga0207664_10021164 | |||
| 1939 | Ga0207664_11405245 | |||
| 1940 | Ga0207644_10027581 | |||
| 1941 | Ga0207644_10264171 | |||
| 1942 | Ga0207644_11313796 | |||
| 1943 | Ga0207690_10011544 | |||
| 1944 | Ga0207690_10083695 | |||
| 1945 | Ga0207690_10336354 | |||
| 1946 | Ga0207690_10340586 | |||
| 1947 | Ga0207690_10416823 | |||
| 1948 | Ga0207690_10688795 | |||
| 1949 | Ga0207706_10019170 | |||
| 1950 | Ga0207706_10019932 | |||
| 1951 | Ga0207706_10056364 | |||
| 1952 | Ga0207706_10076303 | |||
| 1953 | Ga0207706_10351211 | |||
| 1954 | Ga0207706_10626370 | |||
| 1955 | Ga0207706_10641886 | |||
| 1956 | Ga0207686_10051255 | |||
| 1957 | Ga0207686_10052028 | |||
| 1958 | Ga0207686_10079068 | |||
| 1959 | Ga0207686_10119646 | |||
| 1960 | Ga0207686_10127200 | |||
| 1961 | Ga0207686_10719765 | |||
| 1962 | Ga0207709_10024800 | |||
| 1963 | Ga0207709_10063058 | |||
| 1964 | Ga0207709_10084364 | |||
| 1965 | Ga0207709_10103797 | |||
| 1966 | Ga0207709_10141942 | |||
| 1967 | Ga0207670_10021151 | |||
| 1968 | Ga0207670_10031152 | |||
| 1969 | Ga0207669_10015238 | |||
| 1970 | Ga0207669_10017321 | |||
| 1971 | Ga0207669_10077313 | |||
| 1972 | Ga0207669_10778733 | |||
| 1973 | Ga0207704_10014214 | |||
| 1974 | Ga0207704_10095190 | |||
| 1975 | Ga0207704_10107107 | |||
| 1976 | Ga0207704_10189945 | |||
| 1977 | Ga0207704_10390794 | |||
| 1978 | Ga0207704_10734793 | |||
| 1979 | Ga0207704_10758491 | |||
| 1980 | Ga0207665_10006983 | |||
| 1981 | Ga0207691_10046414 | |||
| 1982 | Ga0207691_10323221 | |||
| 1983 | Ga0207691_10562838 | |||
| 1984 | Ga0207711_10149671 | |||
| 1985 | Ga0207711_10184542 | |||
| 1986 | Ga0207711_10446746 | |||
| 1987 | Ga0207711_10582311 | |||
| 1988 | Ga0207689_10115215 | |||
| 1989 | Ga0207689_10380754 | |||
| 1990 | Ga0207689_10830153 | |||
| 1991 | Ga0207661_10070838 | |||
| 1992 | Ga0207661_10100685 | |||
| 1993 | Ga0207661_10154164 | |||
| 1994 | Ga0207661_10154260 | |||
| 1995 | Ga0207661_10288411 | |||
| 1996 | Ga0207661_10386854 | |||
| 1997 | Ga0207661_10436104 | |||
| 1998 | Ga0207661_10440757 | |||
| 1999 | Ga0207661_10638200 | |||
| 2000 | Ga0207679_10170855 | |||
| 2001 | Ga0207679_10203686 | |||
| 2002 | Ga0207679_10266203 | |||
| 2003 | Ga0207679_10541923 | |||
| 2004 | Ga0207679_11092934 | |||
| 2005 | Ga0207667_10115354 | |||
| 2006 | Ga0207667_10203588 | |||
| 2007 | Ga0207667_10206066 | |||
| 2008 | Ga0207667_10622982 | |||
| 2009 | Ga0207667_10769296 | |||
| 2010 | Ga0207667_11269817 | |||
| 2011 | Ga0207651_10147436 | |||
| 2012 | Ga0207651_10514309 | |||
| 2013 | Ga0207651_10729419 | |||
| 2014 | Ga0207712_10203216 | |||
| 2015 | Ga0207712_10220178 | |||
| 2016 | Ga0207712_11188871 | |||
| 2017 | Ga0207668_10128283 | |||
| 2018 | Ga0207668_10319352 | |||
| 2019 | Ga0207668_11037360 | |||
| 2020 | Ga0207640_10004968 | |||
| 2021 | Ga0207640_10273327 | |||
| 2022 | Ga0207640_10875129 | |||
| 2023 | Ga0207658_10509984 | |||
| 2024 | Ga0207677_10210973 | |||
| 2025 | Ga0207677_10288149 | |||
| 2026 | Ga0207677_10474296 | |||
| 2027 | Ga0207703_10140365 | |||
| 2028 | Ga0207639_10203530 | |||
| 2029 | Ga0207639_10243378 | |||
| 2030 | Ga0207639_10268349 | |||
| 2031 | Ga0207639_11144064 | |||
| 2032 | Ga0207678_10281772 | |||
| 2033 | Ga0207678_10492582 | |||
| 2034 | Ga0207678_11328623 | |||
| 2035 | Ga0207708_10004374 | |||
| 2036 | Ga0207708_10101687 | |||
| 2037 | Ga0207708_10201367 | |||
| 2038 | Ga0207708_10215004 | |||
| 2039 | Ga0207702_10009726 | |||
| 2040 | Ga0207702_10241739 | |||
| 2041 | Ga0207702_10338441 | |||
| 2042 | Ga0207702_10883036 | |||
| 2043 | Ga0207702_11259904 | |||
| 2044 | Ga0207641_10608347 | |||
| 2045 | Ga0207641_10715923 | |||
| 2046 | Ga0207648_10013296 | |||
| 2047 | Ga0207648_10037570 | |||
| 2048 | Ga0207648_10050124 | |||
| 2049 | Ga0207648_10053480 | |||
| 2050 | Ga0207648_10142842 | |||
| 2051 | Ga0207648_10221068 | |||
| 2052 | Ga0207648_10350343 | |||
| 2053 | Ga0207676_10471344 | |||
| 2054 | Ga0207676_10551769 | |||
| 2055 | Ga0207674_10086866 | |||
| 2056 | Ga0207674_10736653 | |||
| 2057 | Ga0207675_100028939 | |||
| 2058 | Ga0207675_100043372 | |||
| 2059 | Ga0207675_100117352 | |||
| 2060 | Ga0207675_100195469 | |||
| 2061 | Ga0207675_100285121 | |||
| 2062 | Ga0207675_101060621 | |||
| 2063 | Ga0207683_10000626 | |||
| 2064 | Ga0207683_10033434 | |||
| 2065 | Ga0207683_10089666 | |||
| 2066 | Ga0207683_10273045 | |||
| 2067 | Ga0207698_10075572 | |||
| 2068 | Ga0207698_10255923 | |||
| 2069 | Ga0207428_10000401 | |||
| 2070 | Ga0207428_10027603 | |||
| 2071 | Ga0207428_10276392 | |||
| 2072 | Ga0207428_10773599 | |||
| 2073 | Ga0268266_10111552 | |||
| 2074 | Ga0268266_10156006 | |||
| 2075 | Ga0268265_10213370 | |||
| 2076 | Ga0268265_10288531 | |||
| 2077 | Ga0268265_10597842 | |||
| 2078 | Ga0268264_10089408 | |||
| 2079 | Ga0268264_10141209 | |||
| 2080 | Ga0265338_10005100 | |||
| 2081 | Ga0265338_10026919 | |||
| 2082 | Ga0265324_10047554 | |||
| 2083 | Ga0265320_10115915 | |||
| 2084 | Ga0265339_10017373 | |||
| 2085 | Ga0265331_10221649 | |||
| 2086 | Ga0265327_10033373 | |||
| 2087 | Ga0265327_10096058 | |||
| 2088 | Ga0265316_10038392 | |||
| 2089 | Ga0307408_100032954 | |||
| 2090 | Ga0265313_10004487 | |||
| 2091 | Ga0265313_10019290 | |||
| 2092 | Ga0265314_10003413 | |||
| 2093 | Ga0265314_10317209 | |||
| 2094 | Ga0307407_10178709 | |||
| 2095 | Ga0307407_10187484 | |||
| 2096 | Ga0307409_100006970 | |||
| 2097 | Ga0307409_100096452 | |||
| 2098 | Ga0307409_100133900 | |||
| 2099 | Ga0307409_100219808 | |||
| 2100 | Ga0307409_100778539 | |||
| 2101 | Ga0307409_100907416 | |||
| 2102 | Ga0307416_100014800 | |||
| 2103 | Ga0307416_100177582 | |||
| 2104 | Ga0307416_100666396 | |||
| 2105 | Ga0307415_100134832 | |||
| 2106 | Ga0307415_101147569 | |||
| 2107 | Ga0373930_0020078 | |||
| 2108 | Ga0373950_0054462 | |||
| 2109 | Ga0373950_0081055 | |||
| 2110 | Ga0373958_0085891 | |||
| 2111 | Ga0373926_0023536 | |||
| 2112 | Ga0373929_0029689 | |||
| 2113 | Ga0373929_0082844 | |||
| 2114 | Ga0373940_0021837 | |||
| 2115 | Ga0373940_0154883 | |||
| 2116 | Ga0373944_0003405 | |||
| 2117 | Ga0373944_0015378 | |||
| 2118 | Ga0373944_0045098 | |||
| 2119 | Ga0373949_0078415 | |||
| 2120 | Ga0373949_0128952 | |||
| 2121 | Ga0373951_0062796 | |||
| 2122 | Ga0373951_0075090 | |||
| 2123 | Ga0373952_0008741 | |||
| 2124 | Ga0373952_0062307 | |||
| 2125 | Ga0373932_0042130 | |||
| 2126 | Ga0373936_0046059 | |||
| 2127 | Ga0373936_0046941 | |||
| 2128 | Ga0373936_0106153 | |||
| 2129 | Ga0373939_0039799 | |||
| 2130 | Ga0373941_0003296 | |||
| 2131 | Ga0373945_0001474 | |||
| 2132 | Ga0373945_0003331 | |||
| 2133 | Ga0373945_0099862 | |||
| 2134 | Ga0373960_0003999 | |||
| 2135 | Ga0373960_0098088 | |||
| 2136 | Ga0373943_0000693 | |||
| 2137 | Ga0373943_0001040 | |||
| 2138 | Ga0373943_0015075 | |||
| 2139 | Ga0373946_0010485 | |||
| 2140 | Ga0373946_0012758 | |||
| 2141 | Ga0373946_0043584 | |||
| 2142 | Ga0373955_0064278 | |||
| 2143 | Ga0373942_0011121 | |||
| 2144 | Ga0373942_0024381 | |||
| 2145 | Ga0373942_0042025 | |||
| 2146 | Ga0373962_0079267 | |||
| 2147 | Ga0373962_0118443 | |||
| 2148 | Ga0373931_0024664 | |||
| 2149 | Ga0373935_0027291 | |||
| 2150 | Ga0373935_0056375 | |||
| 2151 | Ga0373935_0776194 | |||
| 2152 | Ga0373927_0179963 | |||
| 2153 | Ga0373927_0608921 | |||
| 2154 | Ga0373947_0001170 | |||
| 2155 | Ga0373947_0021881 | |||
| 2156 | Ga0373947_0077723 | |||
| 2157 | Ga0373925_0002413 | |||
| 2158 | Ga0373925_0005888 | |||
| 2159 | Ga0395899_0020886 | |||
| 2160 | Ga0395899_0028347 | |||
| 2161 | Ga0395899_0046455 | |||
| 2162 | Ga0395899_0067817 | |||
| 2163 | Ga0395899_0138564 | |||
| 2164 | Ga0395899_0139362 | |||
| 2165 | Ga0395899_0211262 | |||
| 2166 | Ga0395899_0487693 | |||
| 2167 | Ga0395900_0005039 | |||
| 2168 | Ga0395900_0006191 | |||
| 2169 | Ga0395900_0016906 | |||
| 2170 | Ga0395900_0018665 | |||
| 2171 | Ga0395900_0034383 | |||
| 2172 | Ga0395900_0042427 | |||
| 2173 | Ga0395900_0154219 | |||
| 2174 | Ga0395900_0301212 | |||
| 2175 | Ga0395900_0415207 | |||
| 2176 | Ga0395900_0696984 | |||
| 2177 | Ga0395900_1122354 | |||
| 2178 | Ga0395898_0007564 | |||
| 2179 | Ga0395898_0008297 | |||
| 2180 | Ga0395898_0008928 | |||
| 2181 | Ga0395898_0012453 | |||
| 2182 | Ga0395898_0020929 | |||
| 2183 | Ga0395898_0029711 | |||
| 2184 | Ga0395898_0030941 | |||
| 2185 | Ga0395898_0049014 | |||
| 2186 | Ga0395898_0237459 | |||
| 2187 | Ga0395898_0357703 | |||
| 2188 | Ga0395898_0795630 | |||
| 2189 | Ga0395898_1175391 | |||
| 2190 | Ga0395905_0008121 | |||
| 2191 | Ga0395905_0013654 | |||
| 2192 | Ga0395905_0028429 | |||
| 2193 | Ga0395905_0093108 | |||
| 2194 | Ga0395905_0255584 | |||
| 2195 | Ga0395905_0259425 | |||
| 2196 | Ga0395901_0001394 | |||
| 2197 | Ga0395901_0018677 | |||
| 2198 | Ga0395901_0030335 | |||
| 2199 | Ga0395901_0045262 | |||
| 2200 | Ga0395901_0046914 | |||
| 2201 | Ga0395901_0048579 | |||
| 2202 | Ga0395901_0049742 | |||
| 2203 | Ga0395901_0076133 | |||
| 2204 | Ga0395901_0084892 | |||
| 2205 | Ga0395901_0108752 | |||
| 2206 | Ga0395901_0641993 | |||
| 2207 | Ga0395901_0685863 | |||
| 2208 | Ga0395901_0776522 | |||
| 2209 | Ga0395901_0880175 | |||
| 2210 | Ga0395901_0949067 | |||
| 2211 | Ga0395901_1027776 | |||
| 2212 | Ga0395901_1355547 | |||
| 2213 | Ga0436362_0333183 | |||
| 2214 | Ga0439453_0031430 | |||
| 2215 | Ga0439461_0002509 | |||
| 2216 | Ga0439461_0006604 | |||
| 2217 | Ga0451845_0755589 | |||
| 2218 | Ga0451855_0630633 | |||
| 2219 | Ga0451853_3441756 | |||
| 2220 | Ga0439431_0062890 | |||
| 2221 | Ga0439441_069043 | |||
| 2222 | Ga0439448_0006641 | |||
| 2223 | Ga0439448_0059887 | |||
| 2224 | Ga0450914_013631 | |||
| 2225 | Ga0450915_010463 | |||
| 2226 | Ga0450920_060395 | |||
| 2227 | Ga0450923_144099 | |||
| 2228 | Ga0450906_008578 | |||
| 2229 | Ga0450907_012704 | |||
| 2230 | Ga0450907_024917 | |||
| 2231 | Ga0439458_0060493 | |||
| 2232 | Ga0450908_053481 | |||
| 2233 | Ga0439434_0007093 | |||
| 2234 | Ga0439459_0035129 | |||
| 2235 | Ga0450918_031432 | |||
| 2236 | Ga0466972_0016657 | |||
| 2237 | Ga0466972_0115747 | |||
| 2238 | Ga0453683_0000116 | |||
| 2239 | Ga0466965_0293467 | |||
| 2240 | Ga0466966_0001812 | |||
| 2241 | Ga0466961_0086259 | |||
| 2242 | Ga0466961_0374596 | |||
| 2243 | Ga0466963_0011190 | |||
| 2244 | Ga0466963_0018934 | |||
| 2245 | Ga0466963_0045320 | |||
| 2246 | Ga0466963_0095016 | |||
| 2247 | Ga0466963_0100329 | |||
| 2248 | Ga0466963_0103009 | |||
| 2249 | Ga0466963_0192814 | |||
| 2250 | Ga0466964_0004071 | |||
| 2251 | Ga0466964_0005786 | |||
| 2252 | Ga0466964_0085338 | |||
| 2253 | Ga0466964_0221651 | |||
| 2254 | Ga0466964_0254218 | |||
| 2255 | Ga0453684_0000711 | |||
| 2256 | Ga0466971_0363870 | |||
| 2257 | Ga0466968_0248761 | |||
| 2258 | Ga0466970_0061954 | |||
| 2259 | Ga0466957_0420956 | |||
| 2260 | Ga0466960_0373131 | |||
| 2261 | Ga0466959_0003470 | |||
| 2262 | Ga0466959_0213889 | |||
| 2263 | Ga0466959_0254413 | |||
| 2264 | Ga0451576_0060221 | |||
| 2265 | Ga0466958_0011397 | |||
| 2266 | Ga0466958_0223750 | |||
| 2267 | Ga0466958_0259212 | |||
| 2268 | Ga0466958_0299250 | |||
| 2269 | Ga0466958_0349608 | |||
| 2270 | Ga0466967_0005367 | |||
| 2271 | Ga0466967_0007799 | |||
| 2272 | Ga0466967_0022395 | |||
| 2273 | Ga0466967_0053989 | |||
| 2274 | Ga0466967_0081657 | |||
| 2275 | Ga0466967_0123105 | |||
| 2276 | Ga0466967_0221806 | |||
| 2277 | Ga0466967_0242874 | |||
| 2278 | Ga0466967_0315386 | |||
| 2279 | Ga0466967_0383938 | |||
| 2280 | Ga0466967_0406467 | |||
| 2281 | Ga0466967_0406966 | |||
| 2282 | Ga0466967_0700342 | |||
| 2283 | Ga0466967_0731955 | |||
| 2284 | Ga0495592_0105305 | |||
| 2285 | Ga0495592_0225742 | |||
| 2286 | Ga0495603_0003409 | |||
| 2287 | Ga0495603_0008654 | |||
| 2288 | Ga0495603_0055478 | |||
| 2289 | Ga0495603_0122233 | |||
| 2290 | Ga0495603_0167318 | |||
| 2291 | Ga0495590_0302303 | |||
| 2292 | Ga0495629_0000319 | |||
| 2293 | Ga0495629_0164954 | |||
| 2294 | Ga0495629_0473276 | |||
| 2295 | Ga0495638_0261555 | |||
| 2296 | Ga0495641_0001038 | |||
| 2297 | Ga0495641_0005764 | |||
| 2298 | Ga0495641_0019178 | |||
| 2299 | Ga0495641_0101654 | |||
| 2300 | Ga0495641_0231798 | |||
| 2301 | Ga0495651_0053665 | |||
| 2302 | Ga0495653_0141917 | |||
| 2303 | Ga0495582_0000358 | |||
| 2304 | Ga0495582_0042154 | |||
| 2305 | Ga0495582_0092750 | |||
| 2306 | Ga0495582_0226188 | |||
| 2307 | Ga0495582_0487138 | |||
| 2308 | Ga0495639_0029704 | |||
| 2309 | Ga0495639_0076174 | |||
| 2310 | Ga0495639_0384755 | |||
| 2311 | Ga0495662_0023259 | |||
| 2312 | Ga0495584_0107194 | |||
| 2313 | Ga0495585_0247203 | |||
| 2314 | Ga0495585_0311479 | |||
| 2315 | Ga0495594_0000335 | |||
| 2316 | Ga0495594_0129617 | |||
| 2317 | Ga0495583_0260461 | |||
| 2318 | Ga0495608_0095675 | |||
| 2319 | Ga0495608_0543054 | |||
| 2320 | Ga0495616_0195853 | |||
| 2321 | Ga0495618_0051633 | |||
| 2322 | Ga0495618_0521577 | |||
| 2323 | Ga0495628_0419492 | |||
| 2324 | Ga0495630_0055378 | |||
| 2325 | Ga0495630_0098348 | |||
| 2326 | Ga0495630_0284389 | |||
| 2327 | Ga0495630_0577217 | |||
| 2328 | Ga0495630_0911446 | |||
| 2329 | Ga0495631_0172881 | |||
| 2330 | Ga0495637_0141180 | |||
| 2331 | Ga0495637_0301275 | |||
| 2332 | Ga0495644_0038281 | |||
| 2333 | Ga0495652_0080303 | |||
| 2334 | Ga0495665_0009202 | |||
| 2335 | Ga0495640_0039198 | |||
| 2336 | Ga0495640_0130517 | |||
| 2337 | Ga0495587_0129732 | |||
| 2338 | Ga0495587_0226193 | |||
| 2339 | Ga0495609_0034769 | |||
| 2340 | Ga0495645_0026238 | |||
| 2341 | Ga0495645_0069153 | |||
| 2342 | Ga0495622_0083398 | |||
| 2343 | Ga0495633_0231050 | |||
| 2344 | Ga0495667_0031121 | |||
| 2345 | Ga0495667_0074632 | |||
| 2346 | Ga0495667_0190474 | |||
| 2347 | Ga0495656_0069527 | |||
| 2348 | Ga0495656_0308945 | |||
| 2349 | Ga0495656_0328480 | |||
| 2350 | Ga0495656_0480150 | |||
| 2351 | Ga0495668_0215257 | |||
| 2352 | Ga0495668_0215651 | |||
| 2353 | Ga0495634_0116191 | |||
| 2354 | Ga0495634_0235255 | |||
| 2355 | Ga0495635_0088573 | |||
| 2356 | Ga0495635_0090789 | |||
| 2357 | Ga0495635_0342524 | |||
| 2358 | Ga0495588_0001807 | |||
| 2359 | Ga0495657_0140413 | |||
| 2360 | Ga0495657_0199284 | |||
| 2361 | Ga0495657_0245978 | |||
| 2362 | Ga0495657_0304596 | |||
| 2363 | Ga0495599_0200693 | |||
| 2364 | Ga0495646_0045430 | |||
| 2365 | Ga0495646_0347046 | |||
| 2366 | Ga0495647_0009460 | |||
| 2367 | Ga0495647_0017910 | |||
| 2368 | Ga0495658_0000384 | |||
| 2369 | Ga0495658_0086752 | |||
| 2370 | Ga0495658_0314464 | |||
| 2371 | Ga0495658_0588674 | |||
| 2372 | Ga0495613_0012745 | |||
| 2373 | Ga0495613_0659882 | |||
| 2374 | Ga0495624_0209392 | |||
| 2375 | Ga0495624_0493691 | |||
| 2376 | Ga0495670_0143692 | |||
| 2377 | Ga0495671_0297207 | |||
| 2378 | Ga0495589_0178992 | |||
| 2379 | Ga0495589_0232643 | |||
| 2380 | Ga0495600_0269084 | |||
| 2381 | Ga0495581_0003702 | |||
| 2382 | Ga0495581_0062252 | |||
| 2383 | Ga0495581_0301707 | |||
| 2384 | Ga0495604_0016942 | |||
| 2385 | Ga0495636_0166821 | |||
| 2386 | Ga0495674_0078894 | |||
| 2387 | Ga0495674_0102044 | |||
| 2388 | Ga0495674_0166994 | |||
| 2389 | Ga0495674_0340652 | |||
| 2390 | Ga0495674_0529008 | |||
| 2391 | Ga0495674_0811740 | |||
| 2392 | Ga0495676_0005182 | |||
| 2393 | Ga0495676_0013466 | |||
| 2394 | Ga0495676_0028678 | |||
| 2395 | Ga0495676_0315822 | |||
| 2396 | Ga0495676_0443737 | |||
| 2397 | Ga0495676_0450806 | |||
| 2398 | Ga0495676_0832144 | |||
| 2399 | Ga0495680_0006719 | |||
| 2400 | Ga0495680_0074473 | |||
| 2401 | Ga0495680_0076759 | |||
| 2402 | Ga0495675_0222075 | |||
| 2403 | Ga0495677_0094053 | |||
| 2404 | Ga0495685_099224 | |||
| 2405 | Ga0495684_0004656 | |||
| 2406 | Ga0495684_0049998 | |||
| 2407 | Ga0495684_0077443 | |||
| 2408 | Ga0495593_0022099 | |||
| 2409 | Ga0495602_0500699 | |||
| 2410 | Ga0495614_0006789 | |||
| 2411 | Ga0496100_0009532 | |||
| 2412 | Ga0496100_0021451 | |||
| 2413 | Ga0496100_0065983 | |||
| 2414 | Ga0496100_0082745 | |||
| 2415 | Ga0496100_0084580 | |||
| 2416 | Ga0496100_0139109 | |||
| 2417 | Ga0496100_0576361 | |||
| 2418 | Ga0496101_0004773 | |||
| 2419 | Ga0496101_0007708 | |||
| 2420 | Ga0496101_0017360 | |||
| 2421 | Ga0496101_0021420 | |||
| 2422 | Ga0496101_0051812 | |||
| 2423 | Ga0496101_0093099 | |||
| 2424 | Ga0496101_0093836 | |||
| 2425 | Ga0496101_0122133 | |||
| 2426 | Ga0496101_0136927 | |||
| 2427 | Ga0496102_0015057 | |||
| 2428 | Ga0496102_0055258 | |||
| 2429 | Ga0496102_0152111 | |||
| 2430 | Ga0496102_0158096 | |||
| 2431 | Ga0496102_0158574 | |||
| 2432 | Ga0496102_0174995 | |||
| 2433 | Ga0496102_0203294 | |||
| 2434 | Ga0496102_0218907 | |||
| 2435 | Ga0496102_0227462 | |||
| 2436 | Ga0496102_0257607 | |||
| 2437 | Ga0496102_0349185 | |||
| 2438 | Ga0496102_0368644 | |||
| 2439 | Ga0496102_0615537 | |||
| 2440 | Ga0496102_0629819 | |||
| 2441 | Ga0496103_0010477 | |||
| 2442 | Ga0496103_0084399 | |||
| 2443 | Ga0496103_0174960 | |||
| 2444 | Ga0496103_0177118 | |||
| 2445 | Ga0496103_0202855 | |||
| 2446 | Ga0496103_0536520 | |||
| 2447 | Ga0496103_0877071 | |||
| 2448 | Ga0496104_0000772 | |||
| 2449 | Ga0496104_0007557 | |||
| 2450 | Ga0496104_0008292 | |||
| 2451 | Ga0496104_0027431 | |||
| 2452 | Ga0496104_0033493 | |||
| 2453 | Ga0496104_0082762 | |||
| 2454 | Ga0496104_0162349 | |||
| 2455 | Ga0496104_0165574 | |||
| 2456 | Ga0496104_0224198 | |||
| 2457 | Ga0496104_0365797 | |||
| 2458 | Ga0496104_1651705 | |||
| 2459 | Ga0496105_0000542 | |||
| 2460 | Ga0496105_0001696 | |||
| 2461 | Ga0496105_0007198 | |||
| 2462 | Ga0496105_0009206 | |||
| 2463 | Ga0496105_0164031 | |||
| 2464 | Ga0496105_0221924 | |||
| 2465 | Ga0496105_0809802 | |||
| 2466 | Ga0496106_0001537 | |||
| 2467 | Ga0496106_0020948 | |||
| 2468 | Ga0496106_0038705 | |||
| 2469 | Ga0496106_0072840 | |||
| 2470 | Ga0496106_0194109 | |||
| 2471 | Ga0496106_0393602 | |||
| 2472 | Ga0496106_0446657 | |||
| 2473 | Ga0496106_0455690 | |||
| 2474 | Ga0496106_0582096 | |||
| 2475 | Ga0496107_0026371 | |||
| 2476 | Ga0496107_0064781 | |||
| 2477 | Ga0496107_0089944 | |||
| 2478 | Ga0496107_0105432 | |||
| 2479 | Ga0496107_0120359 | |||
| 2480 | Ga0496107_0125988 | |||
| 2481 | Ga0496107_0160394 | |||
| 2482 | Ga0496107_0179758 | |||
| 2483 | Ga0496107_0346403 | |||
| 2484 | Ga0496107_0414483 | |||
| 2485 | Ga0496108_0005130 | |||
| 2486 | Ga0496108_0006227 | |||
| 2487 | Ga0496108_0010320 | |||
| 2488 | Ga0496108_0014895 | |||
| 2489 | Ga0496108_0052707 | |||
| 2490 | Ga0496108_1124620 | |||
| 2491 | Ga0496109_0004123 | |||
| 2492 | Ga0496109_0004692 | |||
| 2493 | Ga0496109_0008161 | |||
| 2494 | Ga0496109_0014104 | |||
| 2495 | Ga0496109_0025582 | |||
| 2496 | Ga0496109_0144490 | |||
| 2497 | Ga0496109_0147690 | |||
| 2498 | Ga0496109_0305220 | |||
| 2499 | Ga0496109_0319201 | |||
| 2500 | Ga0496109_0542384 | |||
| 2501 | Ga0496109_0607467 | |||
| 2502 | Ga0496109_0661243 | |||
| 2503 | Ga0496109_0683354 | |||
| 2504 | Ga0496110_0003110 | |||
| 2505 | Ga0496110_0006858 | |||
| 2506 | Ga0496110_0008633 | |||
| 2507 | Ga0496110_0041284 | |||
| 2508 | Ga0496110_0065452 | |||
| 2509 | Ga0496110_0114907 | |||
| 2510 | Ga0496110_0124386 | |||
| 2511 | Ga0496110_0212723 | |||
| 2512 | Ga0496110_0328068 | |||
| 2513 | Ga0496110_1289295 | |||
| 2514 | Ga0496110_1304664 | |||
| 2515 | Ga0496111_0003211 | |||
| 2516 | Ga0496111_0019344 | |||
| 2517 | Ga0496111_0092384 | |||
| 2518 | Ga0496111_0204143 | |||
| 2519 | Ga0496111_0609762 | |||
| 2520 | Ga0496111_0765025 | |||
| 2521 | Ga0496112_0040085 | |||
| 2522 | Ga0496112_0041236 | |||
| 2523 | Ga0496112_0108928 | |||
| 2524 | Ga0496112_0126958 | |||
| 2525 | Ga0496112_0212202 | |||
| 2526 | Ga0496112_0477886 | |||
| 2527 | Ga0496112_0556413 | |||
| 2528 | Ga0496112_0919876 | |||
| 2529 | Ga0496113_0003511 | |||
| 2530 | Ga0496113_0008566 | |||
| 2531 | Ga0496113_0088583 | |||
| 2532 | Ga0496113_0173723 | |||
| 2533 | Ga0496113_0353131 | |||
| 2534 | Ga0496113_0849271 | |||
| 2535 | Ga0496114_0022160 | |||
| 2536 | Ga0496114_0028260 | |||
| 2537 | Ga0496114_0030707 | |||
| 2538 | Ga0496114_0047640 | |||
| 2539 | Ga0496114_0057194 | |||
| 2540 | Ga0496114_0164863 | |||
| 2541 | Ga0496114_0166269 | |||
| 2542 | Ga0496114_0167938 | |||
| 2543 | Ga0496114_0228613 | |||
| 2544 | Ga0496114_0264859 | |||
| 2545 | Ga0496114_0271826 | |||
| 2546 | Ga0496114_0358395 | |||
| 2547 | Ga0496114_0651925 | |||
| 2548 | Ga0496115_0001529 | |||
| 2549 | Ga0496115_0007349 | |||
| 2550 | Ga0496115_0041664 | |||
| 2551 | Ga0496115_0041826 | |||
| 2552 | Ga0496115_0083210 | |||
| 2553 | Ga0496115_0184557 | |||
| 2554 | Ga0496115_0371049 | |||
| 2555 | Ga0496115_0753583 | |||
| 2556 | Ga0496126_0087126 | |||
| 2557 | Ga0501031_0003117 | |||
| 2558 | Ga0501031_0004009 | |||
| 2559 | Ga0501031_0110248 | |||
| 2560 | Ga0501031_0128640 | |||
| 2561 | Ga0501031_0150697 | |||
| 2562 | Ga0501032_0013857 | |||
| 2563 | Ga0501032_0069401 | |||
| 2564 | Ga0501032_0165608 | |||
| 2565 | Ga0501033_0001257 | |||
| 2566 | Ga0501033_0005970 | |||
| 2567 | Ga0501033_0131619 | |||
| 2568 | Ga0501033_0332127 | |||
| 2569 | Ga0501033_0336540 | |||
| 2570 | Ga0501034_0030117 | |||
| 2571 | Ga0501034_0502011 | |||
| 2572 | Ga0501034_0525367 | |||
| 2573 | Ga0501036_0000438 | |||
| 2574 | Ga0501036_0022774 | |||
| 2575 | Ga0501036_0059392 | |||
| 2576 | Ga0501036_0089202 | |||
| 2577 | Ga0501036_0200136 | |||
| 2578 | Ga0501036_0307188 | |||
| 2579 | Ga0501036_0446298 | |||
| 2580 | Ga0501036_0478699 | |||
| 2581 | Ga0501036_0605088 | |||
| 2582 | Ga0501037_0005711 | |||
| 2583 | Ga0501037_0015947 | |||
| 2584 | Ga0501037_0028761 | |||
| 2585 | Ga0501038_0018357 | |||
| 2586 | Ga0501038_0164821 | |||
| 2587 | Ga0501039_0003341 | |||
| 2588 | Ga0501039_0014065 | |||
| 2589 | Ga0501039_0048311 | |||
| 2590 | Ga0501039_0112619 | |||
| 2591 | Ga0501039_0253224 | |||
| 2592 | Ga0501039_1243012 | |||
| 2593 | Ga0501040_0002595 | |||
| 2594 | Ga0501040_0018259 | |||
| 2595 | Ga0501040_0040871 | |||
| 2596 | Ga0501040_0061429 | |||
| 2597 | Ga0501040_0096608 | |||
| 2598 | Ga0501040_0100589 | |||
| 2599 | Ga0501040_0367104 | |||
| 2600 | Ga0501040_0436585 | |||
| 2601 | Ga0501041_0000272 | |||
| 2602 | Ga0501041_0008817 | |||
| 2603 | Ga0501041_0020721 | |||
| 2604 | Ga0501041_0159918 | |||
| 2605 | Ga0501041_0224279 | |||
| 2606 | Ga0501042_0005652 | |||
| 2607 | Ga0501042_0011216 | |||
| 2608 | Ga0501042_0021152 | |||
| 2609 | Ga0501042_0035607 | |||
| 2610 | Ga0501042_0038652 | |||
| 2611 | Ga0501042_0073548 | |||
| 2612 | Ga0501042_0191048 | |||
| 2613 | Ga0501042_0197680 | |||
| 2614 | Ga0501042_0329468 | |||
| 2615 | Ga0501043_0002934 | |||
| 2616 | Ga0501043_0040102 | |||
| 2617 | Ga0501043_0064747 | |||
| 2618 | Ga0501043_0082556 | |||
| 2619 | Ga0501043_0313334 | |||
| 2620 | Ga0501046_0004980 | |||
| 2621 | Ga0501046_0010277 | |||
| 2622 | Ga0501046_0033878 | |||
| 2623 | Ga0501046_0039062 | |||
| 2624 | Ga0501046_0136096 | |||
| 2625 | Ga0501047_0087698 | |||
| 2626 | Ga0501047_0153364 | |||
| 2627 | Ga0501047_0619336 | |||
| 2628 | Ga0501048_0003848 | |||
| 2629 | Ga0501048_0008582 | |||
| 2630 | Ga0501048_0008591 | |||
| 2631 | Ga0501048_0008943 | |||
| 2632 | Ga0501048_0029086 | |||
| 2633 | Ga0501048_0143972 | |||
| 2634 | Ga0501048_0209159 | |||
| 2635 | Ga0501048_0262641 | |||
| 2636 | Ga0501048_0741379 | |||
| 2637 | Ga0501067_0009782 | |||
| 2638 | Ga0501067_0012551 | |||
| 2639 | Ga0501067_0025167 | |||
| 2640 | Ga0501067_0061377 | |||
| 2641 | Ga0501067_0149483 | |||
| 2642 | Ga0501067_0362182 | |||
| 2643 | Ga0501068_0008676 | |||
| 2644 | Ga0501068_0030659 | |||
| 2645 | Ga0501068_0107923 | |||
| 2646 | Ga0501068_0139159 | |||
| 2647 | Ga0501068_0216603 | |||
| 2648 | Ga0501068_0688412 | |||
| 2649 | Ga0501069_0000320 | |||
| 2650 | Ga0501069_0006299 | |||
| 2651 | Ga0501069_0013380 | |||
| 2652 | Ga0501069_0028480 | |||
| 2653 | Ga0501069_0097277 | |||
| 2654 | Ga0501069_0263542 | |||
| 2655 | Ga0501069_0657289 | |||
| 2656 | Ga0501070_0003597 | |||
| 2657 | Ga0501070_0057784 | |||
| 2658 | Ga0501070_0080998 | |||
| 2659 | Ga0501070_0134039 | |||
| 2660 | Ga0501070_0172381 | |||
| 2661 | Ga0501070_0189518 | |||
| 2662 | Ga0501070_0355580 | |||
| 2663 | Ga0501070_0378997 | |||
| 2664 | Ga0501070_0816546 | |||
| 2665 | Ga0501071_0007099 | |||
| 2666 | Ga0501071_0010243 | |||
| 2667 | Ga0501071_0013262 | |||
| 2668 | Ga0501071_0029755 | |||
| 2669 | Ga0501071_0033239 | |||
| 2670 | Ga0501071_0038220 | |||
| 2671 | Ga0501071_0361858 | |||
| 2672 | Ga0501071_1002816 | |||
| 2673 | Ga0501072_0003690 | |||
| 2674 | Ga0501072_0011922 | |||
| 2675 | Ga0501072_0061848 | |||
| 2676 | Ga0501072_0099416 | |||
| 2677 | Ga0501072_0109324 | |||
| 2678 | Ga0501072_0158818 | |||
| 2679 | Ga0501072_0200084 | |||
| 2680 | Ga0501072_0691013 | |||
| 2681 | Ga0501073_0015343 | |||
| 2682 | Ga0501073_0018304 | |||
| 2683 | Ga0501073_0076717 | |||
| 2684 | Ga0501073_0591276 | |||
| 2685 | Ga0501073_0612696 | |||
| 2686 | Ga0501074_0007978 | |||
| 2687 | Ga0501074_0011208 | |||
| 2688 | Ga0501074_0027167 | |||
| 2689 | Ga0501074_0027630 | |||
| 2690 | Ga0501074_0056720 | |||
| 2691 | Ga0501074_0084538 | |||
| 2692 | Ga0501075_0012033 | |||
| 2693 | Ga0501075_0014141 | |||
| 2694 | Ga0501075_0018119 | |||
| 2695 | Ga0501075_0081785 | |||
| 2696 | Ga0501075_0145712 | |||
| 2697 | Ga0501075_0160232 | |||
| 2698 | Ga0501075_0170923 | |||
| 2699 | Ga0501075_0428227 | |||
| 2700 | Ga0501075_0457839 | |||
| 2701 | Ga0501076_0006818 | |||
| 2702 | Ga0501076_0008410 | |||
| 2703 | Ga0501076_0042315 | |||
| 2704 | Ga0501076_0051268 | |||
| 2705 | Ga0501076_0078315 | |||
| 2706 | Ga0501076_0096468 | |||
| 2707 | Ga0501076_0159449 | |||
| 2708 | Ga0501076_0255619 | |||
| 2709 | Ga0501076_0285250 | |||
| 2710 | Ga0501076_0292015 | |||
| 2711 | Ga0501076_0299530 | |||
| 2712 | Ga0501076_0575635 | |||
| 2713 | Ga0501077_0002390 | |||
| 2714 | Ga0501077_0003190 | |||
| 2715 | Ga0501077_0007502 | |||
| 2716 | Ga0501077_0020949 | |||
| 2717 | Ga0501077_0127292 | |||
| 2718 | Ga0501077_0247216 | |||
| 2719 | Ga0501077_0360546 | |||
| 2720 | Ga0501077_0413553 | |||
| 2721 | Ga0501077_0416715 | |||
| 2722 | Ga0501079_0010920 | |||
| 2723 | Ga0501079_0024417 | |||
| 2724 | Ga0501079_0048826 | |||
| 2725 | Ga0501079_0071141 | |||
| 2726 | Ga0501079_0071500 | |||
| 2727 | Ga0501079_0109253 | |||
| 2728 | Ga0501079_0114184 | |||
| 2729 | Ga0501079_0332861 | |||
| 2730 | Ga0501079_0543490 | |||
| 2731 | Ga0501080_0013722 | |||
| 2732 | Ga0501080_0042483 | |||
| 2733 | Ga0501080_0107805 | |||
| 2734 | Ga0501080_0188497 | |||
| 2735 | Ga0501080_0290194 | |||
| 2736 | Ga0501080_0365568 | |||
| 2737 | Ga0501080_0972820 | |||
| 2738 | Ga0501080_1393181 | |||
| 2739 | Ga0501081_0000320 | |||
| 2740 | Ga0501081_0003083 | |||
| 2741 | Ga0501081_0007598 | |||
| 2742 | Ga0501081_0071856 | |||
| 2743 | Ga0501081_0146952 | |||
| 2744 | Ga0501081_0156640 | |||
| 2745 | Ga0501081_0287116 | |||
| 2746 | Ga0501081_0419682 | |||
| 2747 | Ga0501083_0013286 | |||
| 2748 | Ga0501083_0021534 | |||
| 2749 | Ga0501083_0055055 | |||
| 2750 | Ga0501083_0134452 | |||
| 2751 | Ga0501083_0243608 | |||
| 2752 | Ga0501035_0005359 | |||
| 2753 | Ga0501035_0034327 | |||
| 2754 | Ga0501035_0336122 | |||
| 2755 | Ga0501044_0029131 | |||
| 2756 | Ga0501044_0109626 | |||
| 2757 | Ga0501044_0337131 | |||
| 2758 | Ga0501045_0009699 | |||
| 2759 | Ga0501045_0016286 | |||
| 2760 | Ga0501045_0082789 | |||
| 2761 | Ga0501045_0123484 | |||
| 2762 | Ga0501045_0145088 | |||
| 2763 | Ga0501045_0193392 | |||
| 2764 | nmdc:mga06z11_325617_c1 | |||
| 2765 | nmdc:mga05p37_44713_c1 | |||
| 2766 | nmdc:mga05p37_5798_c1 | |||
| 2767 | nmdc:mga05p37_767360_c1 | |||
| 2768 | nmdc:mga05p37_77242_c1 | |||
| 2769 | nmdc:mga09592_5777_c1 | |||
| 2770 | nmdc:mga06r32_534639_c1 | |||
| 2771 | nmdc:mga06r32_879291_c1 | |||
| 2772 | nmdc:mga08y16_45695_c1 | |||
| 2773 | nmdc:mga08y16_45854_c1 | |||
| 2774 | nmdc:mga08y16_4641_c1 | |||
| 2775 | nmdc:mga08y16_7339_c1 | |||
| 2776 | nmdc:mga0n895_1281208_c1 | |||
| 2777 | nmdc:mga0n895_21569_c1 | |||
| 2778 | nmdc:mga0n895_39596_c1 | |||
| 2779 | nmdc:mga0n895_51009_c1 | |||
| 2780 | nmdc:mga0n895_708519_c1 | |||
| 2781 | nmdc:mga0rr50_106430_c1 | |||
| 2782 | nmdc:mga0rr50_166436_c1 | |||
| 2783 | nmdc:mga0rr50_17069_c1 | |||
| 2784 | nmdc:mga0rr50_704856_c1 | |||
| 2785 | nmdc:mga0rr50_891718_c1 | |||
| 2786 | nmdc:mga08x19_145980_c1 | |||
| 2787 | nmdc:mga0a205_13018_c2 | |||
| 2788 | nmdc:mga0a205_163016_c1 | |||
| 2789 | nmdc:mga0a205_235509_c1 | |||
| 2790 | nmdc:mga0a205_238652_c1 | |||
| 2791 | Ga0495601_0019356 | |||
| 2792 | Ga0495601_0020364 | |||
| 2793 | Ga0495612_0228470 | |||
| 2794 | Ga0495595_0121019 | |||
| 2795 | Ga0495595_0122614 | |||
| 2796 | Ga0495619_0002851 | |||
| 2797 | Ga0495619_0101844 | |||
| 2798 | Ga0495619_0232925 | |||
| 2799 | Ga0501084_0035054 | |||
| 2800 | Ga0501084_0065112 | |||
| 2801 | Ga0501084_0082184 | |||
| 2802 | Ga0501084_0090499 | |||
| 2803 | Ga0501084_0094618 | |||
| 2804 | Ga0501084_0114662 | |||
| 2805 | Ga0501084_0419278 | |||
| 2806 | Ga0501084_0577005 | |||
| 2807 | Ga0501082_0003920 | |||
| 2808 | Ga0501082_0059360 | |||
| 2809 | Ga0501082_0069262 | |||
| 2810 | Ga0501082_0109111 | |||
| 2811 | Ga0501082_0119647 | |||
| 2812 | Ga0501082_0163308 | |||
| 2813 | Ga0501082_0216182 | |||
| 2814 | Ga0501082_0256480 | |||
| 2815 | Ga0501082_0539516 | |||
| 2816 | Ga0501082_0548452 | |||
| 2817 | Ga0501082_0727045 | |||
| 2818 | Ga0501082_1698323 | |||
| 2819 | Ga0466962_0051738 | |||
| 2820 | Ga0530510_0005132 | |||
| 2821 | Ga0530510_0015539 | |||
| 2822 | Ga0530510_0080379 | |||
| 2823 | Ga0530510_0146610 | |||
| 2824 | Ga0530510_0174458 | |||
| 2825 | Ga0530510_0226503 | |||
| 2826 | Ga0530510_0285664 | |||
| 2827 | Ga0530510_0297651 | |||
| 2828 | Ga0530510_0538157 | |||
| 2829 | Ga0530510_0662627 | |||
| 2830 | Ga0530510_0789688 | |||
| 2831 | Ga0530510_0879495 | |||
| 2832 | Ga0530510_1251017 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9851 | 2 | 173 |
| 4lza-assembly1.cif.gz_B | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9794 | 2 | 173 |
| 6fd6-assembly1.cif.gz_B | crystal structure of human aprt-tyr105phe variant in complex with adenine, prpp and mg2+, 30 days post crystallization (with amp and ppi products fully generated) | 0.9667 | 3 | 173 |
| 4lza-assembly1.cif.gz_A | crystal structure of adenine phosphoribosyltransferase from thermoanaerobacter pseudethanolicus atcc 33223, nysgrc target 029700. | 0.9665 | 2 | 173 |
| 4m0k-assembly2.cif.gz_D | crystal structure of adenine phosphoribosyltransferase from rhodothermus marinus dsm 4252, nysgrc target 029775. | 0.9663 | 3 | 173 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P91455_5_184_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9686 | 3 | 173 | 3.40.50.2020 |
| af_P69503_1_183_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9605 | 1 | 173 | 3.40.50.2020 |
| 4m0kC00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9592 | 3 | 173 | 3.40.50.2020 |
| af_A0A0P0WCD3_31_176_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9573 | 4 | 141 | 3.40.50.2020 |
| af_P12426_6_182_3.40.50.2020 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9572 | 3 | 173 | 3.40.50.2020 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7K8KGZ8-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.991 | 66 | 173 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A1F9K2E1-F1-model_v4 | Adenine phosphoribosyltransferase (APRT) (EC 2.4.2.7) | 0.9901 | 3 | 173 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A1A6HGP1-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9901 | 59 | 173 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |
| AF-A0A7J8Q206-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9895 | 81 | 173 |
GO:0003999
GO:0005829 GO:0006166 |
| AF-A0A7J4CZX2-F1-model_v4 | adenine phosphoribosyltransferase (EC 2.4.2.7) | 0.9889 | 56 | 173 |
GO:0002055
GO:0003999 GO:0005737 GO:0006166 GO:0006168 GO:0016208 GO:0044209 |