F493725

General Info

Members Datasets Scaffolds Average Seq Length
1406 397 2812 194

Family's Representative Sequence

Representative Sequence 3300046684|Ga0495669_0341773|Ga0495669_0341773_11_676
Length 221
Sequence MRRLPAHRDRRRRTHEARGGGDGRSAVRRAVVDRQTTETQIALTLGLDGSGRYTVRTGIRFLDHMLELVARHGAFDLRIDARGDLDVDQHHTVEDLGIALGEAVSQALGTRKGINRAGYFVMPMDETLAVAAIDLGGRPHAVVDLQVKVAQVGDLQTELVHDFFEGFAIGARANVHLKVLYGRSSHHKIEAVFKAFARALRVACAKDKRMAKMLPSTKGLL

Samples

Sample ID Description Type Environment
1 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
2 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
3 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
4 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
5 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
6 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
7 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
8 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
12 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
13 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
14 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
15 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
16 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
24 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
25 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
26 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
27 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
28 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
29 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
30 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
31 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
32 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
35 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
36 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
41 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
42 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
43 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
44 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
45 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
46 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
47 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
48 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
49 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
50 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
51 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
52 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
53 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
54 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
55 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
56 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
57 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
58 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
59 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
60 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
61 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
62 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
63 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
64 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
65 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
66 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
67 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
68 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
69 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
70 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
71 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
72 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
73 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
74 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
75 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
76 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
77 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
78 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
79 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
80 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
81 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
86 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
87 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
88 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
91 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
92 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
105 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
106 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
107 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
108 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
109 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
110 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
111 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
118 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
119 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
135 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
200 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
201 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
202 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
203 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
207 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
208 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
209 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
210 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
211 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
212 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
213 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
214 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
215 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
216 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
217 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
218 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
219 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
220 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
221 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
222 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
223 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
224 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
227 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
228 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
229 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
230 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
231 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
232 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
233 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
234 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
235 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
236 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
239 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
240 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
241 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
244 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
251 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
252 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
253 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
258 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
259 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
260 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
261 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
262 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
263 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
264 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
265 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
266 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
269 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
270 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
271 3300042437 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z081617_5554 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
277 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
278 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
279 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
280 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
281 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
284 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
285 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
286 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
287 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
288 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
289 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
290 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
297 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
298 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
299 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
302 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
303 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
304 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
305 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
306 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
307 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
308 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
309 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
310 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
311 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
312 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
313 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
314 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
319 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
320 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
321 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
322 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
323 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
324 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
325 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
326 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300049519 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C22_B_7_drought Metagenome Rhizosphere
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
338 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
339 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
347 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
348 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
349 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
350 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
351 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
352 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
353 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
354 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
355 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
356 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
357 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
360 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
361 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
362 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
363 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
364 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
365 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
366 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
367 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
368 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
369 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
370 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
371 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
372 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
373 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
374 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
375 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
376 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
377 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
378 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
379 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
380 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
381 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
382 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
383 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
384 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
385 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
386 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
387 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
388 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
389 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
390 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
391 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
392 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
393 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
394 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
395 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
396 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 100
Metatranscriptomes 0
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 3.27
Nodule 0
Rhizoplane 4.2
Rhizosphere 91.96
Stem 0
Stem Tuber 0
Unclassified 4.13

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0495669_0341773 3300046684 Bacteria 723
2 JGI24751J29686_10035944 3300002459 Bacteria 1027
3 JGI24751J29686_10036434 3300002459 Bacteria 1019
4 Ga0065704_10400019 3300005289 Bacteria 753
5 Ga0065712_10079777 3300005290 Bacteria 3157
6 Ga0065712_10083302 3300005290 Bacteria 2848
7 Ga0065712_10083910 3300005290 Bacteria 2802
8 Ga0065712_10102548 3300005290 Bacteria 2006
9 Ga0065712_10140410 3300005290 Bacteria 1455
10 Ga0065712_10294925 3300005290 Bacteria 870
11 Ga0065712_10347691 3300005290 Bacteria 787
12 Ga0065715_10090427 3300005293 Bacteria 7033
13 Ga0065715_10144531 3300005293 Bacteria 1806
14 Ga0065715_10287272 3300005293 Bacteria 1072
15 Ga0065715_10313440 3300005293 Bacteria 1016
16 Ga0065707_10015181 3300005295 Bacteria 4024
17 Ga0065707_10083382 3300005295 Bacteria 9378
18 Ga0065707_10084811 3300005295 Bacteria 6752
19 Ga0065707_10136421 3300005295 Bacteria 1835
20 Ga0065707_10351160 3300005295 Bacteria 918
21 Ga0070658_10035447 3300005327 Bacteria 4019
22 Ga0070676_10003399 3300005328 Bacteria 8284
23 Ga0070676_10218888 3300005328 Bacteria 1257
24 Ga0070683_100069581 3300005329 Bacteria 3282
25 Ga0070690_100096179 3300005330 Bacteria 1957
26 Ga0070690_100245765 3300005330 Bacteria 1264
27 Ga0070670_100016309 3300005331 Bacteria 6380
28 Ga0070670_100029512 3300005331 Bacteria 4722
29 Ga0070670_100071951 3300005331 Bacteria 2969
30 Ga0070670_100140509 3300005331 Unclassified 2088
31 Ga0070670_100206642 3300005331 Bacteria 1707
32 Ga0070670_100244299 3300005331 Bacteria 1563
33 Ga0070670_100249616 3300005331 Bacteria 1546
34 Ga0070670_100278514 3300005331 Bacteria 1460
35 Ga0070670_100693524 3300005331 Bacteria 915
36 Ga0070677_10105942 3300005333 Bacteria 1248
37 Ga0068869_100434858 3300005334 Bacteria 1085
38 Ga0068869_100489708 3300005334 Bacteria 1025
39 Ga0068869_100563896 3300005334 Bacteria 958
40 Ga0070666_10246587 3300005335 Bacteria 1264
41 Ga0070680_100032896 3300005336 Bacteria 4175
42 Ga0070680_100036260 3300005336 Bacteria 3984
43 Ga0070680_100046161 3300005336 Bacteria 3543
44 Ga0070680_100992755 3300005336 Bacteria 725
45 Ga0070682_100102573 3300005337 Bacteria 1891
46 Ga0070682_100819560 3300005337 Bacteria 758
47 Ga0068868_100037062 3300005338 Bacteria 3779
48 Ga0068868_100096669 3300005338 Bacteria 2386
49 Ga0068868_100168189 3300005338 Bacteria 1814
50 Ga0068868_100181332 3300005338 Bacteria 1747
51 Ga0068868_100354868 3300005338 Bacteria 1257
52 Ga0068868_100381479 3300005338 Bacteria 1213
53 Ga0068868_100434479 3300005338 Bacteria 1139
54 Ga0070660_100045684 3300005339 Bacteria 3354
55 Ga0070660_100171668 3300005339 Bacteria 1752
56 Ga0070660_100183323 3300005339 Bacteria 1695
57 Ga0070689_100003616 3300005340 Bacteria 10308
58 Ga0070689_100631674 3300005340 Bacteria 930
59 Ga0070691_10004501 3300005341 Bacteria 6326
60 Ga0070687_100024974 3300005343 Bacteria 2861
61 Ga0070661_100029871 3300005344 Bacteria 3936
62 Ga0070661_100323926 3300005344 Bacteria 1204
63 Ga0070661_100433006 3300005344 Bacteria 1044
64 Ga0070668_100181719 3300005347 Bacteria 1718
65 Ga0070668_101020620 3300005347 Bacteria 744
66 Ga0070669_100021889 3300005353 Bacteria 4572
67 Ga0070669_100023473 3300005353 Bacteria 4416
68 Ga0070669_100028044 3300005353 Bacteria 4053
69 Ga0070669_100059858 3300005353 Bacteria 2797
70 Ga0070669_100130421 3300005353 Bacteria 1928
71 Ga0070669_100289312 3300005353 Bacteria 1315
72 Ga0070675_100099272 3300005354 Bacteria 2450
73 Ga0070675_100427596 3300005354 Bacteria 1185
74 Ga0070675_100743601 3300005354 Bacteria 895
75 Ga0070675_100766325 3300005354 Bacteria 881
76 Ga0070671_100029088 3300005355 Bacteria 4555
77 Ga0070671_100134688 3300005355 Bacteria 2082
78 Ga0070671_100193481 3300005355 Bacteria 1724
79 Ga0070671_100338893 3300005355 Bacteria 1282
80 Ga0070671_100478686 3300005355 Bacteria 1070
81 Ga0070674_100003653 3300005356 Bacteria 8667
82 Ga0070674_100091329 3300005356 Bacteria 2199
83 Ga0070674_100959932 3300005356 Bacteria 748
84 Ga0070673_100073982 3300005364 Bacteria 2744
85 Ga0070673_100082227 3300005364 Bacteria 2614
86 Ga0070673_100100727 3300005364 Bacteria 2379
87 Ga0070673_100185178 3300005364 Bacteria 1784
88 Ga0070673_100241177 3300005364 Bacteria 1572
89 Ga0070673_100469686 3300005364 Bacteria 1134
90 Ga0070688_100006203 3300005365 Bacteria 6366
91 Ga0070688_100303427 3300005365 Bacteria 1155
92 Ga0070659_100022632 3300005366 Bacteria 4798
93 Ga0070659_100092201 3300005366 Bacteria 2429
94 Ga0070659_100157913 3300005366 Bacteria 1853
95 Ga0070659_100177282 3300005366 Bacteria 1748
96 Ga0070659_100684569 3300005366 Bacteria 886
97 Ga0070667_100039127 3300005367 Bacteria 3974
98 Ga0070667_100171840 3300005367 Bacteria 1914
99 Ga0070667_100856398 3300005367 Bacteria 845
100 Ga0070667_101166236 3300005367 Bacteria 721
101 Ga0070667_101518810 3300005367 Bacteria 629
102 Ga0070703_10032786 3300005406 Bacteria 1579
103 Ga0070709_10004423 3300005434 Bacteria 7582
104 Ga0070709_10475434 3300005434 Bacteria 945
105 Ga0070713_100019633 3300005436 Bacteria 5167
106 Ga0070713_100734370 3300005436 Unclassified 944
107 Ga0070710_10112341 3300005437 Bacteria 1638
108 Ga0070701_10034839 3300005438 Bacteria 2525
109 Ga0070701_10075953 3300005438 Bacteria 1807
110 Ga0070701_10077824 3300005438 Bacteria 1788
111 Ga0070701_10373454 3300005438 Bacteria 897
112 Ga0070711_100201229 3300005439 Bacteria 1537
113 Ga0070705_100006537 3300005440 Bacteria 5720
114 Ga0070700_100004115 3300005441 Bacteria 7577
115 Ga0070700_100009100 3300005441 Bacteria 5442
116 Ga0070700_100311112 3300005441 Bacteria 1153
117 Ga0070700_100645259 3300005441 Unclassified 835
118 Ga0070694_100040793 3300005444 Bacteria 3095
119 Ga0070694_100049833 3300005444 Bacteria 2821
120 Ga0070694_100135006 3300005444 Bacteria 1787
121 Ga0070694_101075958 3300005444 Bacteria 670
122 Ga0070708_100045479 3300005445 Bacteria 3867
123 Ga0070708_100722821 3300005445 Bacteria 937
124 Ga0070708_100912049 3300005445 Unclassified 825
125 Ga0070663_100345095 3300005455 Bacteria 1204
126 Ga0070678_100270773 3300005456 Bacteria 1432
127 Ga0070678_100272974 3300005456 Bacteria 1427
128 Ga0070678_100314231 3300005456 Bacteria 1336
129 Ga0070678_100392840 3300005456 Bacteria 1203
130 Ga0070678_100433126 3300005456 Bacteria 1148
131 Ga0070678_100506314 3300005456 Bacteria 1066
132 Ga0070662_100140784 3300005457 Bacteria 1869
133 Ga0070662_100219265 3300005457 Bacteria 1517
134 Ga0070662_100261526 3300005457 Bacteria 1394
135 Ga0070662_100518304 3300005457 Bacteria 996
136 Ga0070662_100972101 3300005457 Bacteria 726
137 Ga0070681_10005429 3300005458 Bacteria 12314
138 Ga0070681_10018679 3300005458 Bacteria 6934
139 Ga0070681_10116218 3300005458 Bacteria 2612
140 Ga0070681_10126419 3300005458 Bacteria 2489
141 Ga0070681_10235429 3300005458 Bacteria 1745
142 Ga0070681_10369485 3300005458 Bacteria 1345
143 Ga0070681_10728174 3300005458 Bacteria 908
144 Ga0068867_100001221 3300005459 Bacteria 17681
145 Ga0068867_100029048 3300005459 Bacteria 3984
146 Ga0068867_100031411 3300005459 Bacteria 3834
147 Ga0068867_100108774 3300005459 Bacteria 2127
148 Ga0068867_101464357 3300005459 Bacteria 635
149 Ga0070685_10022366 3300005466 Bacteria 3446
150 Ga0070685_10204946 3300005466 Bacteria 1284
151 Ga0070685_10249875 3300005466 Bacteria 1174
152 Ga0070685_10325560 3300005466 Bacteria 1043
153 Ga0070706_100323038 3300005467 Bacteria 1439
154 Ga0070706_100373246 3300005467 Bacteria 1329
155 Ga0070707_100015898 3300005468 Bacteria 7063
156 Ga0070707_100202303 3300005468 Unclassified 1936
157 Ga0070707_100219152 3300005468 Bacteria 1854
158 Ga0070707_100245881 3300005468 Bacteria 1741
159 Ga0070698_100000286 3300005471 Bacteria 51545
160 Ga0070698_100023457 3300005471 Bacteria 6450
161 Ga0070698_100046872 3300005471 Bacteria 4419
162 Ga0070698_100295429 3300005471 Bacteria 1551
163 Ga0070698_100458192 3300005471 Bacteria 1211
164 Ga0070698_100479511 3300005471 Bacteria 1181
165 Ga0070699_100020526 3300005518 Bacteria 5700
166 Ga0070699_100031548 3300005518 Bacteria 4575
167 Ga0070699_100131180 3300005518 Bacteria 2209
168 Ga0070699_100864447 3300005518 Bacteria 828
169 Ga0070679_100048750 3300005530 Bacteria 4219
170 Ga0070679_100059849 3300005530 Bacteria 3796
171 Ga0070679_100095270 3300005530 Bacteria 2964
172 Ga0070679_100178842 3300005530 Bacteria 2094
173 Ga0070679_100259227 3300005530 Archaea 1694
174 Ga0070684_100256855 3300005535 Bacteria 1598
175 Ga0070684_100266986 3300005535 Bacteria 1566
176 Ga0070684_100477894 3300005535 Bacteria 1153
177 Ga0070697_100059662 3300005536 Bacteria 3107
178 Ga0070697_100137885 3300005536 Bacteria 2050
179 Ga0070697_100178603 3300005536 Bacteria 1799
180 Ga0070697_100319550 3300005536 Bacteria 1337
181 Ga0070697_100333442 3300005536 Bacteria 1308
182 Ga0068853_101362669 3300005539 Bacteria 686
183 Ga0070672_100022705 3300005543 Bacteria 4614
184 Ga0070672_100034198 3300005543 Bacteria 3856
185 Ga0070672_100040821 3300005543 Bacteria 3563
186 Ga0070672_100061635 3300005543 Bacteria 2958
187 Ga0070672_100109339 3300005543 Bacteria 2251
188 Ga0070672_100169198 3300005543 Bacteria 1816
189 Ga0070686_100001728 3300005544 Bacteria 12204
190 Ga0070686_100033860 3300005544 Bacteria 3143
191 Ga0070686_100068710 3300005544 Bacteria 2312
192 Ga0070686_100593243 3300005544 Bacteria 872
193 Ga0070686_100989670 3300005544 Bacteria 689
194 Ga0070695_100005860 3300005545 Bacteria 7250
195 Ga0070695_100009685 3300005545 Bacteria 5738
196 Ga0070695_100036685 3300005545 Bacteria 3085
197 Ga0070695_100055096 3300005545 Bacteria 2562
198 Ga0070695_100078084 3300005545 Bacteria 2182
199 Ga0070695_100200918 3300005545 Bacteria 1424
200 Ga0070695_100772318 3300005545 Bacteria 768
201 Ga0070695_100808435 3300005545 Bacteria 752
202 Ga0070696_100014970 3300005546 Bacteria 5207
203 Ga0070696_101047234 3300005546 Bacteria 684
204 Ga0070693_100077886 3300005547 Bacteria 1969
205 Ga0070665_100003078 3300005548 Bacteria 17959
206 Ga0070665_100003293 3300005548 Bacteria 17316
207 Ga0070665_100011707 3300005548 Bacteria 8865
208 Ga0070665_100013030 3300005548 Bacteria 8374
209 Ga0070665_100022242 3300005548 Bacteria 6378
210 Ga0070665_100062216 3300005548 Bacteria 3743
211 Ga0070665_100084966 3300005548 Bacteria 3170
212 Ga0070665_100093236 3300005548 Bacteria 3016
213 Ga0070665_100152393 3300005548 Bacteria 2314
214 Ga0070665_100176775 3300005548 Bacteria 2136
215 Ga0070665_100611660 3300005548 Bacteria 1103
216 Ga0070665_100778361 3300005548 Bacteria 970
217 Ga0070704_100004559 3300005549 Bacteria 8006
218 Ga0070704_100013909 3300005549 Bacteria 5012
219 Ga0070704_100058051 3300005549 Bacteria 2755
220 Ga0070704_100085004 3300005549 Bacteria 2341
221 Ga0070704_100125727 3300005549 Bacteria 1978
222 Ga0070704_100319177 3300005549 Bacteria 1301
223 Ga0068855_100003974 3300005563 Bacteria 18058
224 Ga0070664_100203212 3300005564 Bacteria 1769
225 Ga0070664_100243512 3300005564 Bacteria 1615
226 Ga0070664_100439380 3300005564 Bacteria 1197
227 Ga0070664_100797534 3300005564 Bacteria 883
228 Ga0068857_100162896 3300005577 Bacteria 2024
229 Ga0068854_100003422 3300005578 Bacteria 9895
230 Ga0068854_100019066 3300005578 Bacteria 4617
231 Ga0068854_100039765 3300005578 Bacteria 3315
232 Ga0068854_100180875 3300005578 Bacteria 1647
233 Ga0068854_100204633 3300005578 Bacteria 1554
234 Ga0068854_100351133 3300005578 Bacteria 1207
235 Ga0068856_100222245 3300005614 Bacteria 1904
236 Ga0068856_100683768 3300005614 Unclassified 1047
237 Ga0068856_101315512 3300005614 Bacteria 738
238 Ga0070702_100000436 3300005615 Bacteria 14867
239 Ga0070702_100096234 3300005615 Bacteria 1806
240 Ga0068852_100057705 3300005616 Bacteria 3360
241 Ga0068852_100058681 3300005616 Bacteria 3335
242 Ga0068852_100298108 3300005616 Bacteria 1559
243 Ga0068852_100457190 3300005616 Bacteria 1265
244 Ga0068852_100497770 3300005616 Bacteria 1213
245 Ga0068859_100002238 3300005617 Bacteria 19628
246 Ga0068859_100020915 3300005617 Bacteria 6567
247 Ga0068859_100051448 3300005617 Unclassified 4141
248 Ga0068859_100058422 3300005617 Bacteria 3885
249 Ga0068859_100102718 3300005617 Bacteria 2916
250 Ga0068859_100107786 3300005617 Bacteria 2846
251 Ga0068859_100204999 3300005617 Bacteria 2057
252 Ga0068859_100285203 3300005617 Unclassified 1744
253 Ga0068859_100559309 3300005617 Bacteria 1238
254 Ga0068859_100559690 3300005617 Bacteria 1238
255 Ga0068859_100748742 3300005617 Bacteria 1066
256 Ga0068864_100024024 3300005618 Bacteria 5124
257 Ga0068864_100046038 3300005618 Bacteria 3743
258 Ga0068864_100117092 3300005618 Bacteria 2378
259 Ga0068864_100119749 3300005618 Bacteria 2352
260 Ga0068864_100142622 3300005618 Bacteria 2163
261 Ga0068864_100195886 3300005618 Bacteria 1854
262 Ga0068864_100308707 3300005618 Bacteria 1483
263 Ga0068864_100511573 3300005618 Bacteria 1156
264 Ga0068866_10021572 3300005718 Bacteria 2969
265 Ga0068866_10037290 3300005718 Bacteria 2387
266 Ga0068866_10181022 3300005718 Bacteria 1245
267 Ga0068861_100000519 3300005719 Bacteria 22568
268 Ga0068861_100017344 3300005719 Bacteria 5110
269 Ga0068861_100030114 3300005719 Bacteria 3976
270 Ga0068861_100034075 3300005719 Bacteria 3763
271 Ga0068861_100119075 3300005719 Bacteria 2128
272 Ga0068861_100475558 3300005719 Bacteria 1125
273 Ga0068861_100697077 3300005719 Bacteria 943
274 Ga0068851_10411643 3300005834 Bacteria 797
275 Ga0068870_10135746 3300005840 Bacteria 1434
276 Ga0068870_10263398 3300005840 Bacteria 1074
277 Ga0068863_100027636 3300005841 Bacteria 5413
278 Ga0068863_100104043 3300005841 Bacteria 2701
279 Ga0068863_100535204 3300005841 Bacteria 1156
280 Ga0068858_100003288 3300005842 Bacteria 16098
281 Ga0068858_100023830 3300005842 Bacteria 5703
282 Ga0068858_100034564 3300005842 Bacteria 4689
283 Ga0068858_100042536 3300005842 Bacteria 4212
284 Ga0068858_100066043 3300005842 Bacteria 3349
285 Ga0068858_100095327 3300005842 Bacteria 2772
286 Ga0068858_100101002 3300005842 Bacteria 2690
287 Ga0068858_100184121 3300005842 Bacteria 1973
288 Ga0068858_100247700 3300005842 Bacteria 1692
289 Ga0068858_100298048 3300005842 Bacteria 1538
290 Ga0068858_100455052 3300005842 Bacteria 1234
291 Ga0068858_101212842 3300005842 Bacteria 742
292 Ga0068860_100114722 3300005843 Bacteria 2576
293 Ga0068860_100174476 3300005843 Bacteria 2077
294 Ga0068860_100438825 3300005843 Bacteria 1297
295 Ga0068860_100644316 3300005843 Bacteria 1067
296 Ga0068862_100024390 3300005844 Bacteria 5074
297 Ga0068862_100062993 3300005844 Bacteria 3190
298 Ga0068862_100123238 3300005844 Bacteria 2286
299 Ga0068862_100331558 3300005844 Bacteria 1407
300 Ga0068862_100544371 3300005844 Unclassified 1108
301 Ga0081455_10028039 3300005937 Bacteria 5149
302 Ga0081455_10341382 3300005937 Bacteria 1060
303 Ga0081539_10131197 3300005985 Bacteria 1230
304 Ga0070717_10026372 3300006028 Bacteria 4634
305 Ga0070717_10438721 3300006028 Bacteria 1176
306 Ga0075365_10018889 3300006038 Bacteria 4245
307 Ga0075368_10185550 3300006042 Bacteria 877
308 Ga0075363_100184943 3300006048 Bacteria 1187
309 Ga0075363_100194414 3300006048 Bacteria 1158
310 Ga0075364_10027132 3300006051 Bacteria 3657
311 Ga0075364_10031642 3300006051 Bacteria 3399
312 Ga0075364_10187642 3300006051 Bacteria 1400
313 Ga0075364_10424773 3300006051 Bacteria 907
314 Ga0070715_10316188 3300006163 Bacteria 841
315 Ga0070716_100000242 3300006173 Bacteria 21872
316 Ga0070716_100010837 3300006173 Bacteria 4584
317 Ga0070716_100092811 3300006173 Bacteria 1831
318 Ga0075367_10015725 3300006178 Bacteria 4119
319 Ga0075367_10196942 3300006178 Bacteria 1258
320 Ga0075367_10272125 3300006178 Bacteria 1064
321 Ga0075367_10514457 3300006178 Bacteria 760
322 Ga0075366_10091736 3300006195 Bacteria 1820
323 Ga0075366_10126123 3300006195 Bacteria 1544
324 Ga0075366_10129199 3300006195 Bacteria 1524
325 Ga0075366_10276627 3300006195 Bacteria 1026
326 Ga0075366_10493237 3300006195 Bacteria 757
327 Ga0075366_10627544 3300006195 Bacteria 666
328 Ga0097621_100000434 3300006237 Bacteria 29118
329 Ga0097621_100003292 3300006237 Bacteria 11111
330 Ga0097621_100007485 3300006237 Bacteria 7816
331 Ga0097621_100007719 3300006237 Bacteria 7713
332 Ga0097621_100025477 3300006237 Unclassified 4629
333 Ga0097621_100044189 3300006237 Bacteria 3594
334 Ga0097621_100365617 3300006237 Bacteria 1286
335 Ga0097621_100688147 3300006237 Bacteria 941
336 Ga0097621_101076451 3300006237 Bacteria 754
337 Ga0075370_10051280 3300006353 Bacteria 2340
338 Ga0075370_10081271 3300006353 Bacteria 1863
339 Ga0075370_10395229 3300006353 Bacteria 829
340 Ga0068871_100002048 3300006358 Bacteria 13659
341 Ga0068871_100007497 3300006358 Bacteria 7802
342 Ga0068871_100012838 3300006358 Bacteria 6201
343 Ga0068871_100042985 3300006358 Bacteria 3630
344 Ga0068871_100056262 3300006358 Bacteria 3196
345 Ga0068871_100078665 3300006358 Bacteria 2727
346 Ga0068871_100110687 3300006358 Bacteria 2310
347 Ga0068871_100119155 3300006358 Unclassified 2228
348 Ga0068871_100160767 3300006358 Bacteria 1921
349 Ga0068871_100500679 3300006358 Bacteria 1095
350 Ga0068871_100631992 3300006358 Bacteria 976
351 Ga0068871_100782242 3300006358 Bacteria 879
352 Ga0068871_101422530 3300006358 Bacteria 654
353 Ga0075428_100000007 3300006844 Bacteria 273226
354 Ga0075428_100007009 3300006844 Bacteria 12496
355 Ga0075428_100012131 3300006844 Bacteria 9587
356 Ga0075428_100233355 3300006844 Bacteria 1985
357 Ga0075428_100311657 3300006844 Bacteria 1692
358 Ga0075428_100383847 3300006844 Bacteria 1506
359 Ga0075428_100567339 3300006844 Bacteria 1213
360 Ga0075428_100586396 3300006844 Bacteria 1191
361 Ga0075428_100602185 3300006844 Unclassified 1174
362 Ga0075428_100779289 3300006844 Unclassified 1017
363 Ga0075428_100796234 3300006844 Bacteria 1005
364 Ga0075430_100003874 3300006846 Bacteria 12602
365 Ga0075430_100062757 3300006846 Bacteria 3120
366 Ga0075430_100239940 3300006846 Bacteria 1502
367 Ga0075431_100047480 3300006847 Bacteria 4427
368 Ga0075431_100077943 3300006847 Bacteria 3420
369 Ga0075431_100103630 3300006847 Bacteria 2936
370 Ga0075431_100185714 3300006847 Bacteria 2132
371 Ga0075431_100365075 3300006847 Bacteria 1450
372 Ga0075431_100422011 3300006847 Bacteria 1333
373 Ga0075431_100804815 3300006847 Bacteria 913
374 Ga0075433_10018321 3300006852 Bacteria 5817
375 Ga0075433_10025117 3300006852 Bacteria 5036
376 Ga0075433_10040585 3300006852 Bacteria 4029
377 Ga0075433_10041260 3300006852 Bacteria 3997
378 Ga0075433_10106536 3300006852 Bacteria 2485
379 Ga0075433_10195138 3300006852 Bacteria 1801
380 Ga0075433_10257903 3300006852 Bacteria 1546
381 Ga0075433_10330145 3300006852 Bacteria 1349
382 Ga0075433_10631101 3300006852 Bacteria 940
383 Ga0075433_10819534 3300006852 Bacteria 813
384 Ga0075434_100000264 3300006871 Bacteria 37263
385 Ga0075434_100002266 3300006871 Bacteria 16832
386 Ga0075434_100002447 3300006871 Bacteria 16345
387 Ga0075434_100005560 3300006871 Bacteria 11486
388 Ga0075434_100016375 3300006871 Bacteria 7126
389 Ga0075434_100084568 3300006871 Bacteria 3171
390 Ga0075434_100088026 3300006871 Bacteria 3107
391 Ga0075434_100236434 3300006871 Bacteria 1847
392 Ga0075434_100268332 3300006871 Bacteria 1726
393 Ga0075434_101228565 3300006871 Bacteria 761
394 Ga0075429_100015513 3300006880 Bacteria 6602
395 Ga0075429_100024086 3300006880 Bacteria 5279
396 Ga0075429_100068388 3300006880 Bacteria 3091
397 Ga0075429_100069834 3300006880 Bacteria 3058
398 Ga0075429_100074853 3300006880 Unclassified 2949
399 Ga0075429_100136352 3300006880 Bacteria 2148
400 Ga0075429_100182264 3300006880 Bacteria 1840
401 Ga0075429_100620825 3300006880 Bacteria 947
402 Ga0068865_100034959 3300006881 Bacteria 3376
403 Ga0068865_100101472 3300006881 Bacteria 2107
404 Ga0075436_100000694 3300006914 Bacteria 22204
405 Ga0075436_100025705 3300006914 Archaea 4052
406 Ga0075436_100034245 3300006914 Bacteria 3502
407 Ga0075436_100036957 3300006914 Bacteria 3371
408 Ga0075436_100343547 3300006914 Bacteria 1075
409 Ga0097620_100002238 3300006931 Bacteria 19628
410 Ga0097620_100020915 3300006931 Bacteria 6567
411 Ga0097620_100042725 3300006931 Bacteria 4554
412 Ga0097620_100051445 3300006931 Unclassified 4141
413 Ga0097620_100058424 3300006931 Bacteria 3885
414 Ga0097620_100102720 3300006931 Bacteria 2916
415 Ga0097620_100107786 3300006931 Bacteria 2846
416 Ga0097620_100205018 3300006931 Bacteria 2057
417 Ga0097620_100285213 3300006931 Unclassified 1744
418 Ga0097620_100559289 3300006931 Bacteria 1238
419 Ga0097620_100559634 3300006931 Bacteria 1238
420 Ga0097620_100748776 3300006931 Bacteria 1066
421 Ga0075435_100000163 3300007076 Bacteria 38632
422 Ga0075435_100004567 3300007076 Bacteria 9526
423 Ga0075435_100018103 3300007076 Bacteria 5346
424 Ga0075435_100031814 3300007076 Bacteria 4161
425 Ga0075435_100086041 3300007076 Bacteria 2588
426 Ga0075435_100096673 3300007076 Bacteria 2443
427 Ga0075435_100118324 3300007076 Bacteria 2208
428 Ga0075435_100148516 3300007076 Bacteria 1970
429 Ga0075435_100151765 3300007076 Bacteria 1948
430 Ga0075435_100218728 3300007076 Bacteria 1617
431 Ga0075435_100255450 3300007076 Bacteria 1492
432 Ga0075435_100366913 3300007076 Bacteria 1236
433 Ga0105251_10187166 3300009011 Bacteria 932
434 Ga0105240_10085713 3300009093 Bacteria 3859
435 Ga0105240_10225388 3300009093 Bacteria 2181
436 Ga0105240_10295845 3300009093 Bacteria 1854
437 Ga0105240_10613700 3300009093 Unclassified 1196
438 Ga0105240_10761255 3300009093 Bacteria 1052
439 Ga0105240_11120396 3300009093 Bacteria 836
440 Ga0111539_10000009 3300009094 Bacteria 375223
441 Ga0111539_10000907 3300009094 Bacteria 38710
442 Ga0111539_10001003 3300009094 Bacteria 36985
443 Ga0111539_10011384 3300009094 Bacteria 11168
444 Ga0111539_10019714 3300009094 Bacteria 8317
445 Ga0111539_10022857 3300009094 Bacteria 7679
446 Ga0111539_10036581 3300009094 Bacteria 5934
447 Ga0111539_10044159 3300009094 Bacteria 5340
448 Ga0111539_10044373 3300009094 Bacteria 5326
449 Ga0111539_10068661 3300009094 Bacteria 4185
450 Ga0111539_10396920 3300009094 Bacteria 1606
451 Ga0111539_10436627 3300009094 Bacteria 1525
452 Ga0111539_10510542 3300009094 Bacteria 1400
453 Ga0111539_10521135 3300009094 Bacteria 1385
454 Ga0111539_10540274 3300009094 Bacteria 1358
455 Ga0111539_10782875 3300009094 Bacteria 1110
456 Ga0111539_11248889 3300009094 Bacteria 862
457 Ga0105245_10027561 3300009098 Bacteria 5006
458 Ga0105245_10048807 3300009098 Bacteria 3788
459 Ga0105245_10060671 3300009098 Bacteria 3406
460 Ga0105245_10109887 3300009098 Bacteria 2563
461 Ga0105245_10342223 3300009098 Bacteria 1479
462 Ga0105245_10581937 3300009098 Unclassified 1144
463 Ga0105245_10903425 3300009098 Bacteria 925
464 Ga0105245_10963435 3300009098 Bacteria 896
465 Ga0105245_11395127 3300009098 Bacteria 751
466 Ga0105247_10035422 3300009101 Bacteria 3042
467 Ga0105247_10131904 3300009101 Bacteria 1629
468 Ga0105247_10241621 3300009101 Bacteria 1231
469 Ga0105247_10399808 3300009101 Bacteria 979
470 Ga0114129_10000833 3300009147 Bacteria 39896
471 Ga0114129_10002855 3300009147 Bacteria 24166
472 Ga0114129_10003232 3300009147 Bacteria 22871
473 Ga0114129_10005775 3300009147 Bacteria 17527
474 Ga0114129_10010422 3300009147 Bacteria 13254
475 Ga0114129_10011696 3300009147 Bacteria 12487
476 Ga0114129_10015399 3300009147 Bacteria 10881
477 Ga0114129_10052156 3300009147 Bacteria 5741
478 Ga0114129_10133129 3300009147 Bacteria 3413
479 Ga0114129_10142989 3300009147 Bacteria 3278
480 Ga0114129_10178848 3300009147 Bacteria 2888
481 Ga0114129_10428767 3300009147 Bacteria 1738
482 Ga0114129_10478973 3300009147 Bacteria 1629
483 Ga0105243_10004718 3300009148 Bacteria 10732
484 Ga0105243_10132516 3300009148 Bacteria 2116
485 Ga0105243_10186119 3300009148 Bacteria 1810
486 Ga0105243_10305157 3300009148 Bacteria 1444
487 Ga0105243_10465014 3300009148 Bacteria 1190
488 Ga0105243_10530139 3300009148 Bacteria 1121
489 Ga0105243_10533543 3300009148 Bacteria 1118
490 Ga0105243_10829064 3300009148 Bacteria 914
491 Ga0105243_10833287 3300009148 Bacteria 912
492 Ga0105241_10357553 3300009174 Bacteria 1270
493 Ga0105242_10020241 3300009176 Bacteria 5217
494 Ga0105242_10103916 3300009176 Bacteria 2411
495 Ga0105242_10463823 3300009176 Bacteria 1197
496 Ga0105242_11322478 3300009176 Bacteria 745
497 Ga0105248_10022452 3300009177 Bacteria 6999
498 Ga0105248_10038706 3300009177 Bacteria 5338
499 Ga0105248_10040154 3300009177 Bacteria 5246
500 Ga0105248_10044083 3300009177 Bacteria 5002
501 Ga0105248_10056685 3300009177 Bacteria 4396
502 Ga0105248_10076842 3300009177 Bacteria 3753
503 Ga0105248_10081054 3300009177 Bacteria 3648
504 Ga0105248_10140887 3300009177 Bacteria 2720
505 Ga0105248_11377622 3300009177 Bacteria 798
506 Ga0105248_11535787 3300009177 Bacteria 754
507 Ga0105237_11158933 3300009545 Bacteria 780
508 Ga0105238_10022115 3300009551 Bacteria 6485
509 Ga0105238_10082980 3300009551 Bacteria 3194
510 Ga0105238_10954758 3300009551 Bacteria 877
511 Ga0105249_10027405 3300009553 Bacteria 5140
512 Ga0105249_10120533 3300009553 Bacteria 2492
513 Ga0105249_10146780 3300009553 Bacteria 2267
514 Ga0105249_10214664 3300009553 Bacteria 1890
515 Ga0105249_10499043 3300009553 Bacteria 1262
516 Ga0105249_10690085 3300009553 Bacteria 1080
517 Ga0105249_10837123 3300009553 Bacteria 985
518 Ga0105249_11379848 3300009553 Bacteria 777
519 Ga0105239_10316032 3300010375 Bacteria 1761
520 Ga0105246_10160678 3300011119 Bacteria 1711
521 Ga0157371_10605862 3300013102 Bacteria 815
522 Ga0157370_10081038 3300013104 Bacteria 3055
523 Ga0157370_10147560 3300013104 Bacteria 2190
524 Ga0157369_10094426 3300013105 Bacteria 3193
525 Ga0157374_10015726 3300013296 Bacteria 6644
526 Ga0157378_10072346 3300013297 Bacteria 3098
527 Ga0157378_10116036 3300013297 Bacteria 2461
528 Ga0157378_10760022 3300013297 Bacteria 993
529 Ga0163162_10075233 3300013306 Bacteria 3437
530 Ga0163162_10240479 3300013306 Bacteria 1941
531 Ga0163162_10528977 3300013306 Bacteria 1308
532 Ga0157372_10162441 3300013307 Bacteria 2582
533 Ga0157375_10092942 3300013308 Bacteria 3081
534 Ga0157375_10102918 3300013308 Bacteria 2942
535 Ga0157375_10203006 3300013308 Bacteria 2138
536 Ga0157375_10228546 3300013308 Bacteria 2019
537 Ga0157375_10247928 3300013308 Bacteria 1941
538 Ga0157375_10250062 3300013308 Bacteria 1933
539 Ga0157375_10880337 3300013308 Bacteria 1040
540 Ga0157375_10899969 3300013308 Unclassified 1029
541 Ga0157375_11013882 3300013308 Bacteria 969
542 Ga0163163_10007504 3300014325 Bacteria 9626
543 Ga0163163_10081161 3300014325 Bacteria 3244
544 Ga0163163_10085519 3300014325 Bacteria 3162
545 Ga0163163_10095685 3300014325 Bacteria 2989
546 Ga0163163_10547931 3300014325 Unclassified 1219
547 Ga0163163_10884176 3300014325 Bacteria 957
548 Ga0157380_10020088 3300014326 Bacteria 4989
549 Ga0157380_10021339 3300014326 Bacteria 4856
550 Ga0157380_10031867 3300014326 Bacteria 4049
551 Ga0157380_10035730 3300014326 Bacteria 3840
552 Ga0157380_10513131 3300014326 Bacteria 1167
553 Ga0157380_10704704 3300014326 Bacteria 1015
554 Ga0157380_10707499 3300014326 Bacteria 1013
555 Ga0157380_10799789 3300014326 Bacteria 960
556 Ga0182008_10183773 3300014497 Unclassified 1059
557 Ga0157377_10030611 3300014745 Bacteria 2917
558 Ga0157377_10207049 3300014745 Bacteria 1249
559 Ga0157379_10002448 3300014968 Bacteria 15547
560 Ga0157379_10010798 3300014968 Bacteria 7961
561 Ga0157379_10026054 3300014968 Bacteria 5202
562 Ga0157379_10367180 3300014968 Bacteria 1319
563 Ga0157379_10418459 3300014968 Bacteria 1234
564 Ga0157379_10838398 3300014968 Bacteria 869
565 Ga0157376_10077255 3300014969 Bacteria 2847
566 Ga0157376_10088018 3300014969 Bacteria 2681
567 Ga0157376_10139670 3300014969 Bacteria 2172
568 Ga0157376_10139889 3300014969 Bacteria 2170
569 Ga0157376_10229491 3300014969 Bacteria 1724
570 Ga0157376_10448802 3300014969 Bacteria 1257
571 Ga0157376_10478650 3300014969 Bacteria 1220
572 Ga0163161_10098443 3300017792 Bacteria 2174
573 Ga0163161_10187785 3300017792 Bacteria 1587
574 Ga0163161_10313556 3300017792 Bacteria 1238
575 Ga0163161_10409090 3300017792 Bacteria 1089
576 Ga0213876_10062987 3300021384 Bacteria 1958
577 Ga0213876_10112616 3300021384 Bacteria 1444
578 Ga0207666_1009507 3300025271 Bacteria 1315
579 Ga0207697_10037823 3300025315 Bacteria 1978
580 Ga0207656_10251705 3300025321 Bacteria 866
581 Ga0207653_10036984 3300025885 Bacteria 1591
582 Ga0207682_10077733 3300025893 Bacteria 1417
583 Ga0207642_10028625 3300025899 Bacteria 2297
584 Ga0207642_10252236 3300025899 Bacteria 1002
585 Ga0207642_10475626 3300025899 Bacteria 761
586 Ga0207710_10075897 3300025900 Bacteria 1550
587 Ga0207688_10228348 3300025901 Bacteria 1123
588 Ga0207688_10325480 3300025901 Bacteria 944
589 Ga0207680_10041682 3300025903 Bacteria 2681
590 Ga0207685_10008444 3300025905 Bacteria 2933
591 Ga0207699_10006849 3300025906 Bacteria 5543
592 Ga0207699_10011472 3300025906 Bacteria 4476
593 Ga0207645_10010064 3300025907 Bacteria 6511
594 Ga0207645_10033811 3300025907 Bacteria 3286
595 Ga0207645_10134928 3300025907 Bacteria 1607
596 Ga0207645_10294149 3300025907 Bacteria 1080
597 Ga0207643_10038129 3300025908 Bacteria 2699
598 Ga0207643_10054655 3300025908 Bacteria 2270
599 Ga0207705_10020745 3300025909 Bacteria 4690
600 Ga0207684_10051808 3300025910 Bacteria 3483
601 Ga0207684_10678901 3300025910 Bacteria 876
602 Ga0207684_10775642 3300025910 Bacteria 811
603 Ga0207654_10736661 3300025911 Bacteria 709
604 Ga0207707_10053710 3300025912 Bacteria 3508
605 Ga0207707_10085986 3300025912 Bacteria 2748
606 Ga0207707_10160980 3300025912 Bacteria 1962
607 Ga0207707_10232414 3300025912 Bacteria 1604
608 Ga0207695_10098667 3300025913 Bacteria 2920
609 Ga0207695_10184050 3300025913 Bacteria 2009
610 Ga0207695_10530225 3300025913 Bacteria 1059
611 Ga0207671_10741611 3300025914 Bacteria 780
612 Ga0207660_10021516 3300025917 Bacteria 4338
613 Ga0207660_10126162 3300025917 Bacteria 1944
614 Ga0207660_11081784 3300025917 Bacteria 653
615 Ga0207657_10004533 3300025919 Bacteria 14676
616 Ga0207649_10007249 3300025920 Bacteria 6026
617 Ga0207649_10386724 3300025920 Bacteria 1044
618 Ga0207649_10409713 3300025920 Bacteria 1016
619 Ga0207652_10037506 3300025921 Bacteria 4103
620 Ga0207652_10038002 3300025921 Bacteria 4078
621 Ga0207652_10091211 3300025921 Bacteria 2679
622 Ga0207652_10321355 3300025921 Bacteria 1397
623 Ga0207646_10030753 3300025922 Bacteria 4865
624 Ga0207681_10005649 3300025923 Bacteria 7677
625 Ga0207681_10016450 3300025923 Bacteria 4628
626 Ga0207681_10067536 3300025923 Bacteria 2479
627 Ga0207681_10233866 3300025923 Bacteria 1427
628 Ga0207681_10259851 3300025923 Bacteria 1359
629 Ga0207681_10326081 3300025923 Bacteria 1223
630 Ga0207694_10031624 3300025924 Bacteria 4045
631 Ga0207694_10062421 3300025924 Bacteria 2901
632 Ga0207694_10486545 3300025924 Bacteria 1032
633 Ga0207650_10028107 3300025925 Bacteria 4030
634 Ga0207650_10032978 3300025925 Bacteria 3748
635 Ga0207650_10193940 3300025925 Bacteria 1624
636 Ga0207650_10429141 3300025925 Unclassified 1097
637 Ga0207650_10544865 3300025925 Bacteria 972
638 Ga0207659_10014455 3300025926 Bacteria 5092
639 Ga0207659_10059392 3300025926 Bacteria 2749
640 Ga0207659_10077607 3300025926 Bacteria 2445
641 Ga0207659_10080072 3300025926 Bacteria 2412
642 Ga0207659_10082550 3300025926 Bacteria 2379
643 Ga0207659_10094644 3300025926 Bacteria 2239
644 Ga0207659_10261575 3300025926 Bacteria 1408
645 Ga0207659_10432964 3300025926 Bacteria 1105
646 Ga0207687_10009331 3300025927 Bacteria 6417
647 Ga0207687_10228636 3300025927 Bacteria 1468
648 Ga0207687_10359752 3300025927 Bacteria 1188
649 Ga0207687_10469095 3300025927 Unclassified 1047
650 Ga0207687_10642225 3300025927 Bacteria 897
651 Ga0207700_10004218 3300025928 Bacteria 8442
652 Ga0207700_10023052 3300025928 Bacteria 4284
653 Ga0207644_10091746 3300025931 Bacteria 2265
654 Ga0207644_10146921 3300025931 Bacteria 1821
655 Ga0207644_10152093 3300025931 Bacteria 1791
656 Ga0207690_10107110 3300025932 Bacteria 2007
657 Ga0207690_10298064 3300025932 Bacteria 1261
658 Ga0207690_10358983 3300025932 Bacteria 1154
659 Ga0207690_10533486 3300025932 Bacteria 952
660 Ga0207706_10035600 3300025933 Bacteria 4425
661 Ga0207706_10104457 3300025933 Bacteria 2493
662 Ga0207706_10591687 3300025933 Bacteria 953
663 Ga0207706_10593557 3300025933 Bacteria 952
664 Ga0207686_10010294 3300025934 Bacteria 5089
665 Ga0207686_10025566 3300025934 Bacteria 3436
666 Ga0207686_10034059 3300025934 Bacteria 3046
667 Ga0207686_10048528 3300025934 Bacteria 2630
668 Ga0207686_10088924 3300025934 Bacteria 2034
669 Ga0207686_10126238 3300025934 Bacteria 1749
670 Ga0207686_10236728 3300025934 Bacteria 1327
671 Ga0207709_10068957 3300025935 Bacteria 2237
672 Ga0207709_10161569 3300025935 Bacteria 1563
673 Ga0207670_10039755 3300025936 Bacteria 3083
674 Ga0207670_10082760 3300025936 Bacteria 2250
675 Ga0207670_10190874 3300025936 Bacteria 1550
676 Ga0207670_10360412 3300025936 Bacteria 1153
677 Ga0207670_10577410 3300025936 Bacteria 921
678 Ga0207669_10065201 3300025937 Bacteria 2258
679 Ga0207669_10299041 3300025937 Bacteria 1222
680 Ga0207669_10351134 3300025937 Bacteria 1139
681 Ga0207669_10835341 3300025937 Bacteria 766
682 Ga0207704_10024735 3300025938 Bacteria 3263
683 Ga0207704_10077011 3300025938 Bacteria 2139
684 Ga0207704_10078370 3300025938 Bacteria 2125
685 Ga0207704_10169815 3300025938 Bacteria 1563
686 Ga0207704_10186769 3300025938 Bacteria 1503
687 Ga0207704_10312274 3300025938 Bacteria 1209
688 Ga0207665_10006221 3300025939 Bacteria 7930
689 Ga0207665_10026731 3300025939 Bacteria 3811
690 Ga0207665_10048061 3300025939 Bacteria 2862
691 Ga0207665_10672587 3300025939 Bacteria 813
692 Ga0207691_10010360 3300025940 Bacteria 8942
693 Ga0207691_10043764 3300025940 Bacteria 4125
694 Ga0207691_10059084 3300025940 Bacteria 3487
695 Ga0207691_10086161 3300025940 Bacteria 2819
696 Ga0207691_10249516 3300025940 Bacteria 1532
697 Ga0207691_10272390 3300025940 Bacteria 1457
698 Ga0207691_10330576 3300025940 Bacteria 1306
699 Ga0207691_10586580 3300025940 Bacteria 944
700 Ga0207711_10023512 3300025941 Bacteria 5158
701 Ga0207711_10032702 3300025941 Bacteria 4398
702 Ga0207711_10038401 3300025941 Bacteria 4072
703 Ga0207711_10051841 3300025941 Bacteria 3515
704 Ga0207711_10101872 3300025941 Bacteria 2541
705 Ga0207711_10177120 3300025941 Bacteria 1937
706 Ga0207711_10188398 3300025941 Bacteria 1879
707 Ga0207711_10290660 3300025941 Bacteria 1506
708 Ga0207711_10351099 3300025941 Bacteria 1366
709 Ga0207689_10048993 3300025942 Bacteria 3485
710 Ga0207689_10055233 3300025942 Bacteria 3269
711 Ga0207689_10121586 3300025942 Bacteria 2147
712 Ga0207689_10158998 3300025942 Bacteria 1862
713 Ga0207689_10305202 3300025942 Bacteria 1319
714 Ga0207689_10572619 3300025942 Bacteria 949
715 Ga0207661_10113844 3300025944 Bacteria 2293
716 Ga0207661_10356271 3300025944 Bacteria 1321
717 Ga0207661_10426068 3300025944 Bacteria 1206
718 Ga0207661_10747471 3300025944 Bacteria 900
719 Ga0207679_10127564 3300025945 Bacteria 2036
720 Ga0207679_10280108 3300025945 Bacteria 1430
721 Ga0207667_10052392 3300025949 Bacteria 4298
722 Ga0207667_10789342 3300025949 Bacteria 947
723 Ga0207651_10073589 3300025960 Bacteria 2430
724 Ga0207651_10148068 3300025960 Bacteria 1823
725 Ga0207651_10152087 3300025960 Bacteria 1803
726 Ga0207651_10194052 3300025960 Bacteria 1622
727 Ga0207651_10487809 3300025960 Bacteria 1063
728 Ga0207712_10503045 3300025961 Bacteria 1036
729 Ga0207712_10629834 3300025961 Bacteria 930
730 Ga0207712_10687555 3300025961 Unclassified 892
731 Ga0207668_10487572 3300025972 Bacteria 1058
732 Ga0207668_10729933 3300025972 Bacteria 873
733 Ga0207668_10970868 3300025972 Bacteria 758
734 Ga0207640_10010072 3300025981 Bacteria 5313
735 Ga0207640_10029453 3300025981 Bacteria 3370
736 Ga0207640_10031620 3300025981 Bacteria 3273
737 Ga0207640_10033666 3300025981 Bacteria 3190
738 Ga0207640_10051754 3300025981 Bacteria 2671
739 Ga0207640_10398664 3300025981 Bacteria 1120
740 Ga0207658_10083082 3300025986 Bacteria 2461
741 Ga0207658_10443523 3300025986 Bacteria 1148
742 Ga0207658_10511652 3300025986 Bacteria 1071
743 Ga0207658_10692005 3300025986 Bacteria 921
744 Ga0207677_10004306 3300026023 Bacteria 7623
745 Ga0207677_10029124 3300026023 Bacteria 3504
746 Ga0207677_10157599 3300026023 Bacteria 1760
747 Ga0207677_10614267 3300026023 Bacteria 955
748 Ga0207703_10028142 3300026035 Bacteria 4428
749 Ga0207703_10030820 3300026035 Bacteria 4239
750 Ga0207703_10030964 3300026035 Bacteria 4230
751 Ga0207703_10035162 3300026035 Bacteria 3981
752 Ga0207703_10063728 3300026035 Bacteria 3023
753 Ga0207703_10169001 3300026035 Bacteria 1922
754 Ga0207703_10280717 3300026035 Bacteria 1512
755 Ga0207703_10342815 3300026035 Bacteria 1374
756 Ga0207703_10540314 3300026035 Bacteria 1098
757 Ga0207703_10546494 3300026035 Bacteria 1092
758 Ga0207703_10581672 3300026035 Bacteria 1058
759 Ga0207703_10871524 3300026035 Bacteria 861
760 Ga0207639_10705004 3300026041 Bacteria 937
761 Ga0207678_10318885 3300026067 Bacteria 1337
762 Ga0207708_10003903 3300026075 Bacteria 10973
763 Ga0207708_10016651 3300026075 Bacteria 5531
764 Ga0207708_10029836 3300026075 Bacteria 4135
765 Ga0207708_10103621 3300026075 Bacteria 2204
766 Ga0207708_10168359 3300026075 Bacteria 1734
767 Ga0207708_11012873 3300026075 Unclassified 722
768 Ga0207702_10211334 3300026078 Bacteria 1804
769 Ga0207641_10000723 3300026088 Bacteria 35443
770 Ga0207641_10027030 3300026088 Bacteria 4738
771 Ga0207641_10098984 3300026088 Bacteria 2565
772 Ga0207641_10173210 3300026088 Bacteria 1972
773 Ga0207641_10212024 3300026088 Bacteria 1792
774 Ga0207641_10460406 3300026088 Bacteria 1230
775 Ga0207648_10004153 3300026089 Bacteria 14980
776 Ga0207648_10023751 3300026089 Bacteria 5485
777 Ga0207648_10032569 3300026089 Bacteria 4601
778 Ga0207648_10052969 3300026089 Bacteria 3548
779 Ga0207648_10077998 3300026089 Bacteria 2889
780 Ga0207648_10332227 3300026089 Bacteria 1367
781 Ga0207676_10029410 3300026095 Bacteria 4113
782 Ga0207676_10049921 3300026095 Bacteria 3259
783 Ga0207676_10050364 3300026095 Bacteria 3247
784 Ga0207676_10067402 3300026095 Bacteria 2859
785 Ga0207676_10094067 3300026095 Bacteria 2469
786 Ga0207676_10126498 3300026095 Bacteria 2165
787 Ga0207676_10170831 3300026095 Bacteria 1894
788 Ga0207676_10180818 3300026095 Unclassified 1846
789 Ga0207676_10606466 3300026095 Bacteria 1052
790 Ga0207676_10753891 3300026095 Bacteria 947
791 Ga0207676_11107931 3300026095 Bacteria 783
792 Ga0207674_10102207 3300026116 Bacteria 2846
793 Ga0207674_10265270 3300026116 Bacteria 1665
794 Ga0207674_10726433 3300026116 Bacteria 959
795 Ga0207674_10901759 3300026116 Unclassified 852
796 Ga0207675_100001546 3300026118 Bacteria 23054
797 Ga0207675_100010841 3300026118 Bacteria 8539
798 Ga0207675_100013818 3300026118 Bacteria 7529
799 Ga0207675_100018097 3300026118 Bacteria 6568
800 Ga0207675_100029257 3300026118 Bacteria 5132
801 Ga0207675_100119307 3300026118 Bacteria 2495
802 Ga0207675_100154793 3300026118 Bacteria 2184
803 Ga0207675_100174705 3300026118 Bacteria 2055
804 Ga0207675_100176566 3300026118 Bacteria 2044
805 Ga0207675_100358999 3300026118 Bacteria 1429
806 Ga0207675_100700450 3300026118 Bacteria 1022
807 Ga0207675_100734567 3300026118 Bacteria 998
808 Ga0207675_100870848 3300026118 Bacteria 916
809 Ga0207675_100967978 3300026118 Bacteria 869
810 Ga0207683_10003587 3300026121 Bacteria 13535
811 Ga0207683_10007694 3300026121 Bacteria 9228
812 Ga0207683_10018503 3300026121 Bacteria 5945
813 Ga0207683_10039381 3300026121 Bacteria 4123
814 Ga0207683_10185915 3300026121 Bacteria 1885
815 Ga0207683_10214326 3300026121 Bacteria 1753
816 Ga0207683_10393063 3300026121 Bacteria 1275
817 Ga0207683_10433310 3300026121 Bacteria 1211
818 Ga0207683_10455150 3300026121 Bacteria 1180
819 Ga0207683_10682385 3300026121 Bacteria 952
820 Ga0207683_11213484 3300026121 Bacteria 699
821 Ga0207698_10189649 3300026142 Bacteria 1830
822 Ga0207698_10410296 3300026142 Bacteria 1297
823 Ga0207698_10507577 3300026142 Bacteria 1174
824 Ga0209588_1002109 3300027671 Bacteria 5368
825 Ga0209966_1080341 3300027695 Bacteria 722
826 Ga0209813_10039753 3300027866 Bacteria 1427
827 Ga0209813_10167221 3300027866 Bacteria 797
828 Ga0209974_10090329 3300027876 Bacteria 1062
829 Ga0207428_10000022 3300027907 Bacteria 273333
830 Ga0207428_10006808 3300027907 Bacteria 10483
831 Ga0207428_10009509 3300027907 Bacteria 8707
832 Ga0207428_10010908 3300027907 Bacteria 8088
833 Ga0207428_10120115 3300027907 Bacteria 2016
834 Ga0207428_10205714 3300027907 Unclassified 1480
835 Ga0268266_10000267 3300028379 Bacteria 86736
836 Ga0268266_10009913 3300028379 Bacteria 8368
837 Ga0268266_10052047 3300028379 Bacteria 3516
838 Ga0268266_10060779 3300028379 Bacteria 3258
839 Ga0268266_10060798 3300028379 Bacteria 3257
840 Ga0268266_10060998 3300028379 Bacteria 3252
841 Ga0268266_10066101 3300028379 Bacteria 3126
842 Ga0268266_10164055 3300028379 Bacteria 2012
843 Ga0268266_10206522 3300028379 Bacteria 1800
844 Ga0268266_10268363 3300028379 Bacteria 1583
845 Ga0268265_10018349 3300028380 Bacteria 4846
846 Ga0268265_10055077 3300028380 Bacteria 3020
847 Ga0268265_10106873 3300028380 Bacteria 2274
848 Ga0268265_10186538 3300028380 Bacteria 1787
849 Ga0268265_10293254 3300028380 Bacteria 1461
850 Ga0268265_10334851 3300028380 Bacteria 1376
851 Ga0268265_10657869 3300028380 Bacteria 1008
852 Ga0268265_10820976 3300028380 Bacteria 908
853 Ga0268264_10016766 3300028381 Bacteria 5994
854 Ga0268264_10055653 3300028381 Bacteria 3306
855 Ga0268264_10163109 3300028381 Bacteria 2010
856 Ga0268264_10207876 3300028381 Bacteria 1795
857 Ga0268264_10222284 3300028381 Bacteria 1739
858 Ga0268264_10322315 3300028381 Bacteria 1462
859 Ga0268264_10428231 3300028381 Bacteria 1277
860 Ga0268264_10484128 3300028381 Bacteria 1204
861 Ga0268264_10774327 3300028381 Bacteria 957
862 Ga0268264_11298336 3300028381 Bacteria 738
863 Ga0265318_10091486 3300028577 Bacteria 1120
864 Ga0265332_10037411 3300031238 Bacteria 2105
865 Ga0265332_10061252 3300031238 Bacteria 1609
866 Ga0265331_10074527 3300031250 Bacteria 1584
867 Ga0307408_100058188 3300031548 Bacteria 2809
868 Ga0307408_100161906 3300031548 Bacteria 1778
869 Ga0307408_100297722 3300031548 Bacteria 1350
870 Ga0265314_10030128 3300031711 Bacteria 4021
871 Ga0265314_10036820 3300031711 Bacteria 3551
872 Ga0307405_10038834 3300031731 Bacteria 2873
873 Ga0307405_10331034 3300031731 Bacteria 1167
874 Ga0307413_10154131 3300031824 Bacteria 1605
875 Ga0307413_10485211 3300031824 Bacteria 989
876 Ga0307413_10935430 3300031824 Unclassified 739
877 Ga0307410_10013517 3300031852 Bacteria 4766
878 Ga0307410_10548212 3300031852 Unclassified 958
879 Ga0307410_10781686 3300031852 Bacteria 811
880 Ga0307406_10028931 3300031901 Bacteria 3351
881 Ga0307406_10045055 3300031901 Unclassified 2767
882 Ga0307406_10144860 3300031901 Bacteria 1687
883 Ga0307406_10688614 3300031901 Bacteria 852
884 Ga0307406_10972691 3300031901 Bacteria 727
885 Ga0307406_11067552 3300031901 Bacteria 696
886 Ga0307407_10008924 3300031903 Bacteria 4635
887 Ga0307407_10972997 3300031903 Bacteria 655
888 Ga0307412_10006752 3300031911 Bacteria 6507
889 Ga0307412_10246438 3300031911 Bacteria 1385
890 Ga0307412_10568325 3300031911 Bacteria 955
891 Ga0307412_11184857 3300031911 Bacteria 683
892 Ga0307409_100056255 3300031995 Bacteria 3041
893 Ga0307409_100131491 3300031995 Bacteria 2140
894 Ga0307409_100187592 3300031995 Bacteria 1837
895 Ga0307409_100288048 3300031995 Bacteria 1522
896 Ga0307409_100305293 3300031995 Bacteria 1483
897 Ga0307416_100041219 3300032002 Bacteria 3594
898 Ga0307416_100056454 3300032002 Bacteria 3169
899 Ga0307416_100155193 3300032002 Bacteria 2106
900 Ga0307416_100347843 3300032002 Unclassified 1499
901 Ga0307416_100353969 3300032002 Unclassified 1487
902 Ga0307416_100389486 3300032002 Bacteria 1427
903 Ga0307416_100419157 3300032002 Bacteria 1382
904 Ga0307416_100879117 3300032002 Bacteria 995
905 Ga0307416_100989316 3300032002 Bacteria 944
906 Ga0307416_101345498 3300032002 Bacteria 820
907 Ga0307414_10173151 3300032004 Bacteria 1728
908 Ga0307411_10006424 3300032005 Bacteria 5880
909 Ga0307411_10163523 3300032005 Bacteria 1670
910 Ga0307411_10934608 3300032005 Bacteria 772
911 Ga0307415_100032110 3300032126 Bacteria 3392
912 Ga0307415_100040169 3300032126 Bacteria 3098
913 Ga0307415_100263062 3300032126 Bacteria 1409
914 Ga0307415_100561253 3300032126 Bacteria 1009
915 Ga0373948_0001151 3300034817 Bacteria 3582
916 Ga0373950_0000305 3300034818 Bacteria 6188
917 Ga0373958_0004141 3300034819 Bacteria 2132
918 Ga0373959_0044786 3300034820 Bacteria 939
919 Ga0373938_0000220 3300034957 Bacteria 8769
920 Ga0373929_0000281 3300035085 Bacteria 9448
921 Ga0373929_0075603 3300035085 Bacteria 813
922 Ga0373934_0023655 3300035086 Bacteria 2374
923 Ga0373940_0002909 3300035088 Bacteria 3412
924 Ga0373944_0046282 3300035089 Bacteria 1360
925 Ga0373951_0012636 3300035091 Bacteria 1897
926 Ga0373952_0002395 3300035092 Bacteria 3377
927 Ga0373952_0079657 3300035092 Bacteria 834
928 Ga0373923_0256096 3300035111 Bacteria 820
929 Ga0373932_0018018 3300035112 Bacteria 1821
930 Ga0373932_0094042 3300035112 Bacteria 966
931 Ga0373936_0027159 3300035113 Bacteria 2245
932 Ga0373939_0001341 3300035114 Bacteria 5963
933 Ga0373939_0064109 3300035114 Bacteria 1179
934 Ga0373941_0000459 3300035115 Bacteria 8133
935 Ga0373941_0008846 3300035115 Bacteria 2519
936 Ga0373941_0033592 3300035115 Bacteria 1543
937 Ga0373953_0108455 3300035117 Bacteria 1173
938 Ga0373953_0125586 3300035117 Bacteria 1092
939 Ga0373956_0159713 3300035119 Bacteria 1062
940 Ga0373957_0169527 3300035120 Bacteria 902
941 Ga0373960_0000115 3300035121 Bacteria 12973
942 Ga0373943_0087358 3300035170 Bacteria 1609
943 Ga0373943_0111072 3300035170 Bacteria 1446
944 Ga0373943_0112643 3300035170 Bacteria 1437
945 Ga0373943_0203659 3300035170 Bacteria 1096
946 Ga0373955_0085317 3300035172 Bacteria 1792
947 Ga0373955_0118127 3300035172 Bacteria 1539
948 Ga0373955_0131384 3300035172 Bacteria 1462
949 Ga0373955_0182855 3300035172 Bacteria 1244
950 Ga0373955_0630348 3300035172 Bacteria 657
951 Ga0373942_0000216 3300035207 Bacteria 15152
952 Ga0373961_0002594 3300035241 Bacteria 4651
953 Ga0373962_0001428 3300035242 Bacteria 5637
954 Ga0373962_0084401 3300035242 Bacteria 969
955 Ga0373924_0299566 3300035410 Bacteria 714
956 Ga0373931_0014367 3300035691 Bacteria 3867
957 Ga0373935_0050259 3300035692 Bacteria 2646
958 Ga0373935_0205759 3300035692 Bacteria 1362
959 Ga0373935_0570396 3300035692 Bacteria 826
960 Ga0373933_0297753 3300035724 Bacteria 1044
961 Ga0373933_0380220 3300035724 Bacteria 920
962 Ga0373933_0425033 3300035724 Bacteria 868
963 Ga0373933_0536876 3300035724 Bacteria 767
964 Ga0373947_0103362 3300035725 Bacteria 1793
965 Ga0373947_0106564 3300035725 Bacteria 1767
966 Ga0373947_0170869 3300035725 Bacteria 1410
967 Ga0373947_0488250 3300035725 Bacteria 836
968 Ga0373937_0000908 3300036401 Bacteria 25201
969 Ga0373937_0053089 3300036401 Bacteria 3718
970 Ga0373937_0060901 3300036401 Bacteria 3469
971 Ga0373937_0103466 3300036401 Bacteria 2645
972 Ga0373937_0141498 3300036401 Bacteria 2251
973 Ga0373937_0243377 3300036401 Bacteria 1695
974 Ga0373937_0300835 3300036401 Bacteria 1516
975 Ga0373937_1206010 3300036401 Bacteria 705
976 Ga0373925_0000407 3300037068 Bacteria 43887
977 Ga0373925_0020175 3300037068 Bacteria 4851
978 Ga0373925_0060722 3300037068 Bacteria 2839
979 Ga0373925_0253868 3300037068 Bacteria 1411
980 Ga0373925_0264101 3300037068 Bacteria 1383
981 Ga0395905_0668202 3300037471 Bacteria 941
982 Ga0395905_0843029 3300037471 Bacteria 820
983 Ga0436364_0490704 3300037853 Bacteria 7138
984 Ga0436365_0077351 3300039437 Bacteria 2666
985 Ga0436365_0123225 3300039437 Bacteria 2241
986 Ga0436363_0359495 3300039450 Bacteria 846
987 Ga0436362_0139354 3300039453 Bacteria 5292
988 Ga0439453_0018331 3300041408 Unclassified 1237
989 Ga0439453_0046325 3300041408 Bacteria 867
990 Ga0451853_0750283 3300041512 Bacteria 888
991 Ga0451853_2765793 3300041512 Bacteria 1354
992 Ga0439433_0004248 3300041999 Bacteria 3078
993 Ga0450897_012168 3300042128 Bacteria 847
994 Ga0450894_000961 3300042131 Bacteria 4533
995 Ga0450896_001008 3300042133 Bacteria 3287
996 Ga0450896_015326 3300042133 Bacteria 1097
997 Ga0450899_018388 3300042135 Bacteria 808
998 Ga0450905_015376 3300042142 Bacteria 1097
999 Ga0439446_0105100 3300042156 Unclassified 896
1000 Ga0450908_011392 3300042184 Bacteria 1628
1001 Ga0439434_0009754 3300042435 Bacteria 2824
1002 Ga0439435_0008885 3300042436 Bacteria 2342
1003 Ga0439435_0046381 3300042436 Bacteria 1231
1004 Ga0439435_0066633 3300042436 Bacteria 1059
1005 Ga0439435_0092426 3300042436 Bacteria 920
1006 Ga0439444_0019105 3300042437 Bacteria 1192
1007 Ga0439464_0035988 3300042439 Bacteria 1400
1008 Ga0439460_0012540 3300042461 Bacteria 2202
1009 Ga0439460_0016288 3300042461 Unclassified 1978
1010 Ga0451577_0412845 3300042876 Bacteria 1225
1011 Ga0451577_0600480 3300042876 Bacteria 999
1012 Ga0451577_1317719 3300042876 Bacteria 642
1013 Ga0453683_0723205 3300044673 Bacteria 653
1014 Ga0466964_0148407 3300044706 Unclassified 1084
1015 Ga0453684_0108882 3300044712 Bacteria 3371
1016 Ga0451576_0005342 3300045051 Bacteria 16150
1017 Ga0451576_0010859 3300045051 Bacteria 10423
1018 Ga0451576_0791038 3300045051 Bacteria 996
1019 Ga0451576_1143967 3300045051 Bacteria 814
1020 Ga0466967_0075954 3300045976 Unclassified 3021
1021 Ga0466967_0353035 3300045976 Bacteria 1424
1022 Ga0466967_0473971 3300045976 Bacteria 1226
1023 Ga0466967_1147291 3300045976 Unclassified 774
1024 Ga0495592_0037832 3300046454 Bacteria 3631
1025 Ga0495603_0247011 3300046455 Bacteria 1027
1026 Ga0495629_0209662 3300046459 Bacteria 1346
1027 Ga0495638_0073386 3300046460 Bacteria 2088
1028 Ga0495641_0106712 3300046461 Bacteria 1250
1029 Ga0495651_0192926 3300046462 Bacteria 1432
1030 Ga0495653_0062124 3300046463 Bacteria 2824
1031 Ga0495653_0132001 3300046463 Bacteria 1767
1032 Ga0495653_0271049 3300046463 Bacteria 1118
1033 Ga0495580_0611867 3300046472 Bacteria 719
1034 Ga0495582_0461697 3300046473 Bacteria 733
1035 Ga0495582_0495897 3300046473 Bacteria 706
1036 Ga0495639_0071265 3300046475 Bacteria 1606
1037 Ga0495639_0147663 3300046475 Bacteria 1133
1038 Ga0495639_0496475 3300046475 Bacteria 623
1039 Ga0495662_0305717 3300046476 Bacteria 782
1040 Ga0495664_0226417 3300046477 Bacteria 1132
1041 Ga0495608_0005849 3300046511 Bacteria 8756
1042 Ga0495618_0160351 3300046514 Bacteria 1434
1043 Ga0495618_0410654 3300046514 Bacteria 827
1044 Ga0495628_0023017 3300046516 Bacteria 5115
1045 Ga0495628_0470580 3300046516 Bacteria 910
1046 Ga0495630_0027662 3300046517 Bacteria 4209
1047 Ga0495630_0174656 3300046517 Bacteria 1638
1048 Ga0495652_0439202 3300046529 Bacteria 916
1049 Ga0495652_0685777 3300046529 Bacteria 691
1050 Ga0495586_0278250 3300046535 Bacteria 957
1051 Ga0495587_0152732 3300046536 Bacteria 1316
1052 Ga0495587_0268490 3300046536 Bacteria 957
1053 Ga0495645_0001612 3300046543 Bacteria 15271
1054 Ga0495645_0043909 3300046543 Bacteria 3260
1055 Ga0495645_0532198 3300046543 Bacteria 731
1056 Ga0495645_0538914 3300046543 Bacteria 725
1057 Ga0495667_0179752 3300046559 Bacteria 1358
1058 Ga0495667_0227327 3300046559 Bacteria 1190
1059 Ga0495667_0307332 3300046559 Bacteria 1004
1060 Ga0495634_0171222 3300046642 Bacteria 1364
1061 Ga0495634_0193446 3300046642 Bacteria 1267
1062 Ga0495634_0197114 3300046642 Bacteria 1253
1063 Ga0495635_0332156 3300046663 Bacteria 1016
1064 Ga0495659_0145311 3300046664 Bacteria 949
1065 Ga0495588_0268487 3300046674 Bacteria 899
1066 Ga0495599_0186349 3300046678 Bacteria 1278
1067 Ga0495646_0242509 3300046680 Bacteria 968
1068 Ga0495647_0081279 3300046681 Bacteria 1315
1069 Ga0495658_0051246 3300046683 Bacteria 2338
1070 Ga0495658_0140375 3300046683 Bacteria 1477
1071 Ga0495658_0175134 3300046683 Bacteria 1329
1072 Ga0495658_0194264 3300046683 Bacteria 1263
1073 Ga0495658_0520698 3300046683 Bacteria 761
1074 Ga0495669_0089826 3300046684 Bacteria 1417
1075 Ga0495669_0244596 3300046684 Bacteria 861
1076 Ga0495613_0013803 3300046689 Bacteria 5992
1077 Ga0495613_0037800 3300046689 Bacteria 3579
1078 Ga0495613_0233434 3300046689 Bacteria 1288
1079 Ga0495613_0463818 3300046689 Bacteria 857
1080 Ga0495670_0274108 3300046691 Bacteria 902
1081 Ga0495649_0384712 3300046694 Bacteria 706
1082 Ga0495600_0027231 3300046809 Bacteria 3694
1083 Ga0495600_0181165 3300046809 Bacteria 1358
1084 Ga0495600_0450946 3300046809 Bacteria 795
1085 Ga0495604_0021253 3300047317 Bacteria 5181
1086 Ga0495604_0181556 3300047317 Bacteria 1472
1087 Ga0495674_0032485 3300047319 Bacteria 4733
1088 Ga0495674_0325518 3300047319 Bacteria 1251
1089 Ga0495674_0345303 3300047319 Bacteria 1209
1090 Ga0495680_0187229 3300047322 Bacteria 1491
1091 Ga0495675_0119401 3300047444 Bacteria 1642
1092 Ga0495684_0018047 3300047471 Bacteria 5437
1093 Ga0495602_0289962 3300048088 Bacteria 1202
1094 Ga0496100_0000941 3300048903 Bacteria 13917
1095 Ga0496100_0135748 3300048903 Bacteria 1738
1096 Ga0496101_0001279 3300048904 Bacteria 15052
1097 Ga0496101_0195660 3300048904 Bacteria 1562
1098 Ga0496102_0162405 3300048905 Bacteria 2102
1099 Ga0496102_0546365 3300048905 Bacteria 1081
1100 Ga0496102_1066980 3300048905 Bacteria 728
1101 Ga0496103_0350016 3300048906 Bacteria 950
1102 Ga0496103_0485296 3300048906 Bacteria 791
1103 Ga0496103_0524692 3300048906 Bacteria 757
1104 Ga0496104_0039358 3300048907 Bacteria 4427
1105 Ga0496104_0060217 3300048907 Bacteria 3597
1106 Ga0496104_0103641 3300048907 Bacteria 2725
1107 Ga0496104_0105262 3300048907 Bacteria 2704
1108 Ga0496104_0370826 3300048907 Bacteria 1344
1109 Ga0496104_0425185 3300048907 Bacteria 1240
1110 Ga0496104_0829871 3300048907 Bacteria 830
1111 Ga0496104_0898987 3300048907 Bacteria 790
1112 Ga0496104_0942080 3300048907 Bacteria 768
1113 Ga0496105_0023414 3300048908 Bacteria 5008
1114 Ga0496105_0054714 3300048908 Unclassified 3295
1115 Ga0496105_0067393 3300048908 Bacteria 2955
1116 Ga0496105_0245425 3300048908 Bacteria 1452
1117 Ga0496105_0263735 3300048908 Bacteria 1392
1118 Ga0496106_0055640 3300048909 Bacteria 2991
1119 Ga0496106_0493747 3300048909 Unclassified 983
1120 Ga0496106_0687148 3300048909 Bacteria 816
1121 Ga0496106_1060018 3300048909 Bacteria 636
1122 Ga0496106_1071916 3300048909 Bacteria 632
1123 Ga0496107_0053874 3300048910 Bacteria 2902
1124 Ga0496108_0001370 3300048911 Bacteria 19169
1125 Ga0496108_0002181 3300048911 Bacteria 15709
1126 Ga0496108_0249853 3300048911 Bacteria 1543
1127 Ga0496108_0581466 3300048911 Bacteria 976
1128 Ga0496109_0013530 3300048912 Bacteria 7082
1129 Ga0496109_0058736 3300048912 Bacteria 3514
1130 Ga0496109_0768119 3300048912 Bacteria 902
1131 Ga0496110_0024307 3300048913 Bacteria 5163
1132 Ga0496110_0049924 3300048913 Bacteria 3672
1133 Ga0496110_0078646 3300048913 Bacteria 2936
1134 Ga0496110_0254607 3300048913 Bacteria 1598
1135 Ga0496111_0030400 3300048914 Bacteria 3840
1136 Ga0496111_0325081 3300048914 Bacteria 1139
1137 Ga0496111_0353112 3300048914 Bacteria 1088
1138 Ga0496112_0097753 3300048915 Bacteria 2906
1139 Ga0496112_0104043 3300048915 Bacteria 2809
1140 Ga0496112_0126259 3300048915 Bacteria 2529
1141 Ga0496112_0231539 3300048915 Unclassified 1802
1142 Ga0496112_0365699 3300048915 Bacteria 1384
1143 Ga0496112_0385411 3300048915 Bacteria 1342
1144 Ga0496112_0577015 3300048915 Bacteria 1057
1145 Ga0496112_0790439 3300048915 Bacteria 874
1146 Ga0496112_0972706 3300048915 Bacteria 769
1147 Ga0496113_0032267 3300048916 Bacteria 3806
1148 Ga0496114_0031028 3300048917 Bacteria 4396
1149 Ga0496114_0037274 3300048917 Bacteria 4021
1150 Ga0496114_0099182 3300048917 Bacteria 2484
1151 Ga0496114_0666219 3300048917 Bacteria 914
1152 Ga0496115_0054923 3300048918 Bacteria 3199
1153 Ga0501296_019557 3300049519 Bacteria 859
1154 Ga0501031_0183627 3300049568 Bacteria 1366
1155 Ga0501031_0256782 3300049568 Bacteria 1136
1156 Ga0501033_0059314 3300049570 Unclassified 2826
1157 Ga0501034_0002071 3300049571 Bacteria 25037
1158 Ga0501034_0352348 3300049571 Bacteria 1400
1159 Ga0501036_0183307 3300049572 Bacteria 1762
1160 Ga0501036_0258035 3300049572 Unclassified 1460
1161 Ga0501036_0378908 3300049572 Bacteria 1181
1162 Ga0501037_0319680 3300049573 Bacteria 1075
1163 Ga0501037_0511903 3300049573 Bacteria 813
1164 Ga0501038_0031634 3300049574 Bacteria 4675
1165 Ga0501038_0113080 3300049574 Bacteria 2247
1166 Ga0501038_0176067 3300049574 Bacteria 1729
1167 Ga0501038_0443708 3300049574 Bacteria 999
1168 Ga0501039_0241817 3300049575 Unclassified 1419
1169 Ga0501039_0708860 3300049575 Unclassified 787
1170 Ga0501040_0049676 3300049576 Bacteria 2868
1171 Ga0501040_0078441 3300049576 Bacteria 2285
1172 Ga0501040_0102072 3300049576 Bacteria 2001
1173 Ga0501040_0146360 3300049576 Bacteria 1665
1174 Ga0501040_0178312 3300049576 Bacteria 1505
1175 Ga0501041_0011650 3300049577 Bacteria 5205
1176 Ga0501041_0204470 3300049577 Unclassified 1238
1177 Ga0501042_0080784 3300049578 Bacteria 2329
1178 Ga0501042_0091915 3300049578 Bacteria 2178
1179 Ga0501042_0106854 3300049578 Bacteria 2015
1180 Ga0501042_0115811 3300049578 Bacteria 1930
1181 Ga0501042_0135421 3300049578 Bacteria 1776
1182 Ga0501046_0025123 3300049580 Bacteria 4879
1183 Ga0501046_0153825 3300049580 Bacteria 1734
1184 Ga0501046_0158281 3300049580 Bacteria 1705
1185 Ga0501046_0227960 3300049580 Bacteria 1378
1186 Ga0501047_0132079 3300049581 Bacteria 2377
1187 Ga0501048_0073436 3300049582 Unclassified 2414
1188 Ga0501048_0101789 3300049582 Bacteria 2027
1189 Ga0501048_0205821 3300049582 Bacteria 1395
1190 Ga0501048_0211599 3300049582 Bacteria 1375
1191 Ga0501048_0221465 3300049582 Bacteria 1342
1192 Ga0501048_0519921 3300049582 Bacteria 854
1193 Ga0501067_0057111 3300049583 Bacteria 2162
1194 Ga0501067_0342450 3300049583 Bacteria 833
1195 Ga0501068_0213916 3300049584 Unclassified 1224
1196 Ga0501069_0296493 3300049585 Bacteria 948
1197 Ga0501071_0007516 3300049587 Bacteria 7168
1198 Ga0501071_0028258 3300049587 Bacteria 3951
1199 Ga0501071_0109223 3300049587 Bacteria 2043
1200 Ga0501071_0245244 3300049587 Unclassified 1351
1201 Ga0501071_0386477 3300049587 Bacteria 1068
1202 Ga0501072_0014651 3300049588 Bacteria 6011
1203 Ga0501072_0022226 3300049588 Bacteria 4921
1204 Ga0501072_0030792 3300049588 Bacteria 4198
1205 Ga0501072_0130984 3300049588 Bacteria 1999
1206 Ga0501072_0797676 3300049588 Bacteria 740
1207 Ga0501073_0019525 3300049589 Bacteria 4892
1208 Ga0501073_0213661 3300049589 Bacteria 1333
1209 Ga0501073_0350850 3300049589 Bacteria 1019
1210 Ga0501074_0036974 3300049590 Bacteria 3539
1211 Ga0501074_0120321 3300049590 Bacteria 1878
1212 Ga0501074_0133844 3300049590 Unclassified 1773
1213 Ga0501074_0332450 3300049590 Bacteria 1078
1214 Ga0501074_0445808 3300049590 Bacteria 918
1215 Ga0501075_0004510 3300049591 Bacteria 9427
1216 Ga0501075_0004708 3300049591 Bacteria 9265
1217 Ga0501075_0006237 3300049591 Bacteria 8195
1218 Ga0501075_0024124 3300049591 Bacteria 4455
1219 Ga0501075_0069159 3300049591 Bacteria 2668
1220 Ga0501075_0089446 3300049591 Bacteria 2335
1221 Ga0501075_0577141 3300049591 Bacteria 858
1222 Ga0501076_0009464 3300049592 Bacteria 7198
1223 Ga0501076_0020973 3300049592 Bacteria 5006
1224 Ga0501076_0024736 3300049592 Bacteria 4643
1225 Ga0501076_0053252 3300049592 Bacteria 3206
1226 Ga0501076_0057067 3300049592 Bacteria 3100
1227 Ga0501076_0162466 3300049592 Bacteria 1820
1228 Ga0501076_0191511 3300049592 Bacteria 1669
1229 Ga0501076_0203809 3300049592 Bacteria 1616
1230 Ga0501076_0379105 3300049592 Bacteria 1162
1231 Ga0501076_0417970 3300049592 Bacteria 1103
1232 Ga0501076_0524153 3300049592 Bacteria 977
1233 Ga0501077_0098781 3300049593 Bacteria 1850
1234 Ga0501077_0133386 3300049593 Bacteria 1575
1235 Ga0501077_0141361 3300049593 Bacteria 1527
1236 Ga0501079_0018386 3300049741 Bacteria 5342
1237 Ga0501079_0289632 3300049741 Bacteria 1280
1238 Ga0501079_0331756 3300049741 Bacteria 1191
1239 Ga0501079_0365959 3300049741 Unclassified 1130
1240 Ga0501080_0072326 3300049742 Bacteria 3208
1241 Ga0501081_0003378 3300049743 Bacteria 10158
1242 Ga0501081_0040623 3300049743 Bacteria 3185
1243 Ga0501081_0098282 3300049743 Bacteria 2067
1244 Ga0501081_0325776 3300049743 Bacteria 1130
1245 Ga0501083_0671904 3300049744 Bacteria 674
1246 Ga0501035_0362772 3300049822 Bacteria 1211
1247 Ga0501045_0002786 3300049824 Bacteria 11947
1248 Ga0501045_0055020 3300049824 Bacteria 2910
1249 Ga0501045_0061036 3300049824 Bacteria 2765
1250 Ga0501045_0093604 3300049824 Bacteria 2222
1251 Ga0501045_0118213 3300049824 Bacteria 1967
1252 Ga0501045_0134160 3300049824 Bacteria 1841
1253 Ga0501045_0872696 3300049824 Bacteria 661
1254 nmdc:mga03n38_57460_c1 3300050490 Bacteria 1759
1255 nmdc:mga00v17_187031_c1 3300050491 Bacteria 1337
1256 nmdc:mga00v17_65241_c1 3300050491 Bacteria 2246
1257 nmdc:mga0k408_136963_c1 3300050493 Bacteria 1455
1258 nmdc:mga0k408_267381_c1 3300050493 Bacteria 1021
1259 nmdc:mga0k408_388861_c1 3300050493 Bacteria 831
1260 nmdc:mga0k408_628013_c1 3300050493 Bacteria 633
1261 nmdc:mga0k408_64236_c1 3300050493 Bacteria 2136
1262 nmdc:mga06z11_11534_c1 3300050494 Bacteria 3815
1263 nmdc:mga06z11_34889_c2 3300050494 Bacteria 1513
1264 nmdc:mga06z11_399731_c1 3300050494 Bacteria 827
1265 nmdc:mga06z11_85492_c1 3300050494 Bacteria 1702
1266 nmdc:mga04h51_30173_c1 3300050495 Bacteria 1704
1267 nmdc:mga07m45_160093_c1 3300050496 Bacteria 1307
1268 nmdc:mga07m45_58083_c1 3300050496 Bacteria 2189
1269 nmdc:mga05p37_108938_c1 3300050507 Unclassified 3407
1270 nmdc:mga05p37_10907_c1 3300050507 Bacteria 10790
1271 nmdc:mga05p37_115030_c1 3300050507 Bacteria 3307
1272 nmdc:mga05p37_125961_c1 3300050507 Bacteria 3146
1273 nmdc:mga05p37_15017_c1 3300050507 Bacteria 9297
1274 nmdc:mga05p37_181471_c1 3300050507 Bacteria 2560
1275 nmdc:mga05p37_206952_c1 3300050507 Bacteria 2373
1276 nmdc:mga05p37_239469_c1 3300050507 Bacteria 2183
1277 nmdc:mga05p37_40665_c1 3300050507 Bacteria 5709
1278 nmdc:mga05p37_40999_c1 3300050507 Bacteria 5685
1279 nmdc:mga05p37_414324_c1 3300050507 Bacteria 1570
1280 nmdc:mga05p37_417257_c1 3300050507 Bacteria 1563
1281 nmdc:mga05p37_432219_c1 3300050507 Bacteria 1529
1282 nmdc:mga05p37_433670_c1 3300050507 Bacteria 1526
1283 nmdc:mga05p37_615820_c1 3300050507 Bacteria 1223
1284 nmdc:mga05p37_6413_c1 3300050507 Bacteria 13868
1285 nmdc:mga05p37_7936_c1 3300050507 Bacteria 12528
1286 nmdc:mga05p37_808217_c1 3300050507 Bacteria 1025
1287 nmdc:mga09592_170085_c1 3300050508 Bacteria 1884
1288 nmdc:mga09592_185299_c1 3300050508 Unclassified 1801
1289 nmdc:mga09592_193574_c1 3300050508 Bacteria 1760
1290 nmdc:mga09592_213591_c2 3300050508 Bacteria 940
1291 nmdc:mga09592_531358_c1 3300050508 Bacteria 1011
1292 nmdc:mga09592_54422_c1 3300050508 Bacteria 3381
1293 nmdc:mga09592_554307_c1 3300050508 Bacteria 987
1294 nmdc:mga09592_69318_c1 3300050508 Bacteria 2991
1295 nmdc:mga09592_7490_c1 3300050508 Bacteria 8876
1296 nmdc:mga09592_92666_c1 3300050508 Bacteria 2583
1297 nmdc:mga0qj67_196259_c1 3300050509 Bacteria 1640
1298 nmdc:mga0qj67_20496_c1 3300050509 Bacteria 5063
1299 nmdc:mga0qj67_243549_c1 3300050509 Bacteria 1459
1300 nmdc:mga0qj67_31104_c1 3300050509 Bacteria 4157
1301 nmdc:mga06r32_141812_c1 3300050510 Bacteria 2380
1302 nmdc:mga06r32_24484_c1 3300050510 Bacteria 5604
1303 nmdc:mga06r32_31923_c1 3300050510 Bacteria 4951
1304 nmdc:mga06r32_481680_c1 3300050510 Bacteria 1219
1305 nmdc:mga06r32_53561_c1 3300050510 Bacteria 3865
1306 nmdc:mga06r32_59685_c1 3300050510 Unclassified 3669
1307 nmdc:mga06r32_66722_c1 3300050510 Bacteria 3472
1308 nmdc:mga06r32_713181_c1 3300050510 Bacteria 968
1309 nmdc:mga06r32_72622_c1 3300050510 Bacteria 3331
1310 nmdc:mga06r32_815903_c1 3300050510 Bacteria 893
1311 nmdc:mga08y16_1422658_c1 3300050511 Bacteria 656
1312 nmdc:mga08y16_161440_c1 3300050511 Bacteria 2329
1313 nmdc:mga08y16_207754_c1 3300050511 Bacteria 2028
1314 nmdc:mga08y16_21_c1 3300050511 Bacteria 254790
1315 nmdc:mga08y16_2325_c1 3300050511 Bacteria 19487
1316 nmdc:mga08y16_2881_c1 3300050511 Bacteria 17699
1317 nmdc:mga08y16_30909_c1 3300050511 Bacteria 5631
1318 nmdc:mga08y16_336582_c1 3300050511 Bacteria 1552
1319 nmdc:mga08y16_38877_c1 3300050511 Bacteria 4994
1320 nmdc:mga08y16_555360_c1 3300050511 Bacteria 1162
1321 nmdc:mga08y16_631170_c1 3300050511 Bacteria 1077
1322 nmdc:mga08y16_98490_c1 3300050511 Unclassified 3045
1323 nmdc:mga08y16_996285_c1 3300050511 Bacteria 818
1324 nmdc:mga0n895_12437_c1 3300050512 Bacteria 7635
1325 nmdc:mga0n895_12_c1 3300050512 Bacteria 112043
1326 nmdc:mga0n895_145259_c1 3300050512 Bacteria 2401
1327 nmdc:mga0n895_247962_c1 3300050512 Bacteria 1807
1328 nmdc:mga0n895_288011_c1 3300050512 Bacteria 1665
1329 nmdc:mga0n895_4435_c1 3300050512 Bacteria 11533
1330 nmdc:mga0n895_510407_c1 3300050512 Bacteria 1210
1331 nmdc:mga0n895_63659_c1 3300050512 Bacteria 3647
1332 nmdc:mga0n895_654333_c1 3300050512 Bacteria 1049
1333 nmdc:mga0n895_8828_c1 3300050512 Bacteria 8770
1334 nmdc:mga0rr50_118071_c1 3300050513 Bacteria 2107
1335 nmdc:mga0rr50_1_c1 3300050513 Bacteria 558123
1336 nmdc:mga0rr50_223359_c1 3300050513 Bacteria 1556
1337 nmdc:mga0rr50_281767_c1 3300050513 Bacteria 1387
1338 nmdc:mga0rr50_295089_c1 3300050513 Bacteria 1355
1339 nmdc:mga0rr50_308296_c1 3300050513 Bacteria 1325
1340 nmdc:mga0rr50_323784_c1 3300050513 Bacteria 1293
1341 nmdc:mga0rr50_574225_c1 3300050513 Bacteria 961
1342 nmdc:mga0rr50_66018_c1 3300050513 Bacteria 2743
1343 nmdc:mga0rr50_7461_c1 3300050513 Bacteria 6749
1344 nmdc:mga08x19_22680_c1 3300050514 Bacteria 3888
1345 nmdc:mga08x19_337015_c1 3300050514 Bacteria 1052
1346 nmdc:mga08x19_5011_c1 3300050514 Bacteria 7832
1347 nmdc:mga08x19_75446_c1 3300050514 Bacteria 2204
1348 nmdc:mga08x19_87_c1 3300050514 Bacteria 83168
1349 nmdc:mga08x19_92542_c1 3300050514 Bacteria 1997
1350 nmdc:mga0a205_10463_c1 3300050515 Bacteria 8521
1351 nmdc:mga0a205_164732_c1 3300050515 Bacteria 2113
1352 nmdc:mga0a205_227760_c1 3300050515 Bacteria 1748
1353 nmdc:mga0a205_22854_c1 3300050515 Bacteria 5928
1354 nmdc:mga0a205_252902_c1 3300050515 Bacteria 1641
1355 nmdc:mga0a205_254885_c1 3300050515 Bacteria 1633
1356 nmdc:mga0a205_294905_c1 3300050515 Bacteria 1495
1357 nmdc:mga0a205_3604_c1 3300050515 Bacteria 13861
1358 nmdc:mga0a205_36795_c1 3300050515 Bacteria 4705
1359 nmdc:mga0a205_509225_c1 3300050515 Bacteria 1060
1360 nmdc:mga0a205_891341_c1 3300050515 Bacteria 736
1361 Ga0495601_0020965 3300053077 Bacteria 3997
1362 Ga0495601_0050288 3300053077 Bacteria 2629
1363 Ga0495601_0057797 3300053077 Bacteria 2457
1364 Ga0495601_0314710 3300053077 Bacteria 1019
1365 Ga0495595_0033869 3300053084 Bacteria 2307
1366 Ga0495595_0038969 3300053084 Bacteria 2167
1367 Ga0495595_0050067 3300053084 Bacteria 1934
1368 Ga0495595_0056124 3300053084 Bacteria 1835
1369 Ga0495595_0198951 3300053084 Bacteria 997
1370 Ga0495619_0007028 3300053085 Bacteria 7121
1371 Ga0495619_0008911 3300053085 Bacteria 6336
1372 Ga0495619_0018250 3300053085 Bacteria 4451
1373 Ga0495619_0021800 3300053085 Bacteria 4093
1374 Ga0495619_0077139 3300053085 Bacteria 2238
1375 Ga0495619_0257636 3300053085 Bacteria 1209
1376 Ga0495619_0268266 3300053085 Bacteria 1183
1377 Ga0495619_0426010 3300053085 Bacteria 915
1378 Ga0500651_0076743 3300053093 Bacteria 2075
1379 Ga0500566_0116855 3300053094 Bacteria 1443
1380 Ga0500641_0018715 3300053096 Bacteria 2609
1381 Ga0500555_000579 3300053103 Bacteria 14443
1382 Ga0500628_008063 3300053129 Bacteria 1821
1383 Ga0500658_0105383 3300053134 Bacteria 1235
1384 Ga0500616_0002575 3300053153 Bacteria 14924
1385 Ga0500599_012205 3300053736 Bacteria 1152
1386 Ga0501084_0025523 3300054114 Bacteria 4929
1387 Ga0501084_0154891 3300054114 Bacteria 1932
1388 Ga0501084_0206288 3300054114 Unclassified 1658
1389 Ga0501084_0232583 3300054114 Bacteria 1556
1390 Ga0501084_0537544 3300054114 Bacteria 988
1391 Ga0501084_0849273 3300054114 Bacteria 768
1392 Ga0590071_001479 3300059421 Bacteria 6197
1393 Ga0590074_000830 3300059423 Bacteria 4773
1394 Ga0590075_000007 3300059424 Bacteria 63273
1395 Ga0590077_000152 3300059426 Bacteria 19298
1396 Ga0501082_0080033 3300060353 Bacteria 2819
1397 Ga0501082_0155347 3300060353 Bacteria 1988
1398 Ga0501082_0200468 3300060353 Bacteria 1736
1399 Ga0501082_0258597 3300060353 Unclassified 1514
1400 Ga0501082_0366765 3300060353 Bacteria 1256
1401 Ga0501082_0605538 3300060353 Bacteria 959
1402 Ga0501082_0848031 3300060353 Bacteria 799
1403 Ga0530510_0002421 3300061734 Bacteria 12854
1404 Ga0530510_0020330 3300061734 Bacteria 4720
1405 Ga0530510_0097890 3300061734 Bacteria 2145
1406 Ga0530510_0565301 3300061734 Bacteria 864
1407 Ga0495669_0341773
1408 JGI24751J29686_10035944
1409 JGI24751J29686_10036434
1410 Ga0065704_10400019
1411 Ga0065712_10079777
1412 Ga0065712_10083302
1413 Ga0065712_10083910
1414 Ga0065712_10102548
1415 Ga0065712_10140410
1416 Ga0065712_10294925
1417 Ga0065712_10347691
1418 Ga0065715_10090427
1419 Ga0065715_10144531
1420 Ga0065715_10287272
1421 Ga0065715_10313440
1422 Ga0065707_10015181
1423 Ga0065707_10083382
1424 Ga0065707_10084811
1425 Ga0065707_10136421
1426 Ga0065707_10351160
1427 Ga0070658_10035447
1428 Ga0070676_10003399
1429 Ga0070676_10218888
1430 Ga0070683_100069581
1431 Ga0070690_100096179
1432 Ga0070690_100245765
1433 Ga0070670_100016309
1434 Ga0070670_100029512
1435 Ga0070670_100071951
1436 Ga0070670_100140509
1437 Ga0070670_100206642
1438 Ga0070670_100244299
1439 Ga0070670_100249616
1440 Ga0070670_100278514
1441 Ga0070670_100693524
1442 Ga0070677_10105942
1443 Ga0068869_100434858
1444 Ga0068869_100489708
1445 Ga0068869_100563896
1446 Ga0070666_10246587
1447 Ga0070680_100032896
1448 Ga0070680_100036260
1449 Ga0070680_100046161
1450 Ga0070680_100992755
1451 Ga0070682_100102573
1452 Ga0070682_100819560
1453 Ga0068868_100037062
1454 Ga0068868_100096669
1455 Ga0068868_100168189
1456 Ga0068868_100181332
1457 Ga0068868_100354868
1458 Ga0068868_100381479
1459 Ga0068868_100434479
1460 Ga0070660_100045684
1461 Ga0070660_100171668
1462 Ga0070660_100183323
1463 Ga0070689_100003616
1464 Ga0070689_100631674
1465 Ga0070691_10004501
1466 Ga0070687_100024974
1467 Ga0070661_100029871
1468 Ga0070661_100323926
1469 Ga0070661_100433006
1470 Ga0070668_100181719
1471 Ga0070668_101020620
1472 Ga0070669_100021889
1473 Ga0070669_100023473
1474 Ga0070669_100028044
1475 Ga0070669_100059858
1476 Ga0070669_100130421
1477 Ga0070669_100289312
1478 Ga0070675_100099272
1479 Ga0070675_100427596
1480 Ga0070675_100743601
1481 Ga0070675_100766325
1482 Ga0070671_100029088
1483 Ga0070671_100134688
1484 Ga0070671_100193481
1485 Ga0070671_100338893
1486 Ga0070671_100478686
1487 Ga0070674_100003653
1488 Ga0070674_100091329
1489 Ga0070674_100959932
1490 Ga0070673_100073982
1491 Ga0070673_100082227
1492 Ga0070673_100100727
1493 Ga0070673_100185178
1494 Ga0070673_100241177
1495 Ga0070673_100469686
1496 Ga0070688_100006203
1497 Ga0070688_100303427
1498 Ga0070659_100022632
1499 Ga0070659_100092201
1500 Ga0070659_100157913
1501 Ga0070659_100177282
1502 Ga0070659_100684569
1503 Ga0070667_100039127
1504 Ga0070667_100171840
1505 Ga0070667_100856398
1506 Ga0070667_101166236
1507 Ga0070667_101518810
1508 Ga0070703_10032786
1509 Ga0070709_10004423
1510 Ga0070709_10475434
1511 Ga0070713_100019633
1512 Ga0070713_100734370
1513 Ga0070710_10112341
1514 Ga0070701_10034839
1515 Ga0070701_10075953
1516 Ga0070701_10077824
1517 Ga0070701_10373454
1518 Ga0070711_100201229
1519 Ga0070705_100006537
1520 Ga0070700_100004115
1521 Ga0070700_100009100
1522 Ga0070700_100311112
1523 Ga0070700_100645259
1524 Ga0070694_100040793
1525 Ga0070694_100049833
1526 Ga0070694_100135006
1527 Ga0070694_101075958
1528 Ga0070708_100045479
1529 Ga0070708_100722821
1530 Ga0070708_100912049
1531 Ga0070663_100345095
1532 Ga0070678_100270773
1533 Ga0070678_100272974
1534 Ga0070678_100314231
1535 Ga0070678_100392840
1536 Ga0070678_100433126
1537 Ga0070678_100506314
1538 Ga0070662_100140784
1539 Ga0070662_100219265
1540 Ga0070662_100261526
1541 Ga0070662_100518304
1542 Ga0070662_100972101
1543 Ga0070681_10005429
1544 Ga0070681_10018679
1545 Ga0070681_10116218
1546 Ga0070681_10126419
1547 Ga0070681_10235429
1548 Ga0070681_10369485
1549 Ga0070681_10728174
1550 Ga0068867_100001221
1551 Ga0068867_100029048
1552 Ga0068867_100031411
1553 Ga0068867_100108774
1554 Ga0068867_101464357
1555 Ga0070685_10022366
1556 Ga0070685_10204946
1557 Ga0070685_10249875
1558 Ga0070685_10325560
1559 Ga0070706_100323038
1560 Ga0070706_100373246
1561 Ga0070707_100015898
1562 Ga0070707_100202303
1563 Ga0070707_100219152
1564 Ga0070707_100245881
1565 Ga0070698_100000286
1566 Ga0070698_100023457
1567 Ga0070698_100046872
1568 Ga0070698_100295429
1569 Ga0070698_100458192
1570 Ga0070698_100479511
1571 Ga0070699_100020526
1572 Ga0070699_100031548
1573 Ga0070699_100131180
1574 Ga0070699_100864447
1575 Ga0070679_100048750
1576 Ga0070679_100059849
1577 Ga0070679_100095270
1578 Ga0070679_100178842
1579 Ga0070679_100259227
1580 Ga0070684_100256855
1581 Ga0070684_100266986
1582 Ga0070684_100477894
1583 Ga0070697_100059662
1584 Ga0070697_100137885
1585 Ga0070697_100178603
1586 Ga0070697_100319550
1587 Ga0070697_100333442
1588 Ga0068853_101362669
1589 Ga0070672_100022705
1590 Ga0070672_100034198
1591 Ga0070672_100040821
1592 Ga0070672_100061635
1593 Ga0070672_100109339
1594 Ga0070672_100169198
1595 Ga0070686_100001728
1596 Ga0070686_100033860
1597 Ga0070686_100068710
1598 Ga0070686_100593243
1599 Ga0070686_100989670
1600 Ga0070695_100005860
1601 Ga0070695_100009685
1602 Ga0070695_100036685
1603 Ga0070695_100055096
1604 Ga0070695_100078084
1605 Ga0070695_100200918
1606 Ga0070695_100772318
1607 Ga0070695_100808435
1608 Ga0070696_100014970
1609 Ga0070696_101047234
1610 Ga0070693_100077886
1611 Ga0070665_100003078
1612 Ga0070665_100003293
1613 Ga0070665_100011707
1614 Ga0070665_100013030
1615 Ga0070665_100022242
1616 Ga0070665_100062216
1617 Ga0070665_100084966
1618 Ga0070665_100093236
1619 Ga0070665_100152393
1620 Ga0070665_100176775
1621 Ga0070665_100611660
1622 Ga0070665_100778361
1623 Ga0070704_100004559
1624 Ga0070704_100013909
1625 Ga0070704_100058051
1626 Ga0070704_100085004
1627 Ga0070704_100125727
1628 Ga0070704_100319177
1629 Ga0068855_100003974
1630 Ga0070664_100203212
1631 Ga0070664_100243512
1632 Ga0070664_100439380
1633 Ga0070664_100797534
1634 Ga0068857_100162896
1635 Ga0068854_100003422
1636 Ga0068854_100019066
1637 Ga0068854_100039765
1638 Ga0068854_100180875
1639 Ga0068854_100204633
1640 Ga0068854_100351133
1641 Ga0068856_100222245
1642 Ga0068856_100683768
1643 Ga0068856_101315512
1644 Ga0070702_100000436
1645 Ga0070702_100096234
1646 Ga0068852_100057705
1647 Ga0068852_100058681
1648 Ga0068852_100298108
1649 Ga0068852_100457190
1650 Ga0068852_100497770
1651 Ga0068859_100002238
1652 Ga0068859_100020915
1653 Ga0068859_100051448
1654 Ga0068859_100058422
1655 Ga0068859_100102718
1656 Ga0068859_100107786
1657 Ga0068859_100204999
1658 Ga0068859_100285203
1659 Ga0068859_100559309
1660 Ga0068859_100559690
1661 Ga0068859_100748742
1662 Ga0068864_100024024
1663 Ga0068864_100046038
1664 Ga0068864_100117092
1665 Ga0068864_100119749
1666 Ga0068864_100142622
1667 Ga0068864_100195886
1668 Ga0068864_100308707
1669 Ga0068864_100511573
1670 Ga0068866_10021572
1671 Ga0068866_10037290
1672 Ga0068866_10181022
1673 Ga0068861_100000519
1674 Ga0068861_100017344
1675 Ga0068861_100030114
1676 Ga0068861_100034075
1677 Ga0068861_100119075
1678 Ga0068861_100475558
1679 Ga0068861_100697077
1680 Ga0068851_10411643
1681 Ga0068870_10135746
1682 Ga0068870_10263398
1683 Ga0068863_100027636
1684 Ga0068863_100104043
1685 Ga0068863_100535204
1686 Ga0068858_100003288
1687 Ga0068858_100023830
1688 Ga0068858_100034564
1689 Ga0068858_100042536
1690 Ga0068858_100066043
1691 Ga0068858_100095327
1692 Ga0068858_100101002
1693 Ga0068858_100184121
1694 Ga0068858_100247700
1695 Ga0068858_100298048
1696 Ga0068858_100455052
1697 Ga0068858_101212842
1698 Ga0068860_100114722
1699 Ga0068860_100174476
1700 Ga0068860_100438825
1701 Ga0068860_100644316
1702 Ga0068862_100024390
1703 Ga0068862_100062993
1704 Ga0068862_100123238
1705 Ga0068862_100331558
1706 Ga0068862_100544371
1707 Ga0081455_10028039
1708 Ga0081455_10341382
1709 Ga0081539_10131197
1710 Ga0070717_10026372
1711 Ga0070717_10438721
1712 Ga0075365_10018889
1713 Ga0075368_10185550
1714 Ga0075363_100184943
1715 Ga0075363_100194414
1716 Ga0075364_10027132
1717 Ga0075364_10031642
1718 Ga0075364_10187642
1719 Ga0075364_10424773
1720 Ga0070715_10316188
1721 Ga0070716_100000242
1722 Ga0070716_100010837
1723 Ga0070716_100092811
1724 Ga0075367_10015725
1725 Ga0075367_10196942
1726 Ga0075367_10272125
1727 Ga0075367_10514457
1728 Ga0075366_10091736
1729 Ga0075366_10126123
1730 Ga0075366_10129199
1731 Ga0075366_10276627
1732 Ga0075366_10493237
1733 Ga0075366_10627544
1734 Ga0097621_100000434
1735 Ga0097621_100003292
1736 Ga0097621_100007485
1737 Ga0097621_100007719
1738 Ga0097621_100025477
1739 Ga0097621_100044189
1740 Ga0097621_100365617
1741 Ga0097621_100688147
1742 Ga0097621_101076451
1743 Ga0075370_10051280
1744 Ga0075370_10081271
1745 Ga0075370_10395229
1746 Ga0068871_100002048
1747 Ga0068871_100007497
1748 Ga0068871_100012838
1749 Ga0068871_100042985
1750 Ga0068871_100056262
1751 Ga0068871_100078665
1752 Ga0068871_100110687
1753 Ga0068871_100119155
1754 Ga0068871_100160767
1755 Ga0068871_100500679
1756 Ga0068871_100631992
1757 Ga0068871_100782242
1758 Ga0068871_101422530
1759 Ga0075428_100000007
1760 Ga0075428_100007009
1761 Ga0075428_100012131
1762 Ga0075428_100233355
1763 Ga0075428_100311657
1764 Ga0075428_100383847
1765 Ga0075428_100567339
1766 Ga0075428_100586396
1767 Ga0075428_100602185
1768 Ga0075428_100779289
1769 Ga0075428_100796234
1770 Ga0075430_100003874
1771 Ga0075430_100062757
1772 Ga0075430_100239940
1773 Ga0075431_100047480
1774 Ga0075431_100077943
1775 Ga0075431_100103630
1776 Ga0075431_100185714
1777 Ga0075431_100365075
1778 Ga0075431_100422011
1779 Ga0075431_100804815
1780 Ga0075433_10018321
1781 Ga0075433_10025117
1782 Ga0075433_10040585
1783 Ga0075433_10041260
1784 Ga0075433_10106536
1785 Ga0075433_10195138
1786 Ga0075433_10257903
1787 Ga0075433_10330145
1788 Ga0075433_10631101
1789 Ga0075433_10819534
1790 Ga0075434_100000264
1791 Ga0075434_100002266
1792 Ga0075434_100002447
1793 Ga0075434_100005560
1794 Ga0075434_100016375
1795 Ga0075434_100084568
1796 Ga0075434_100088026
1797 Ga0075434_100236434
1798 Ga0075434_100268332
1799 Ga0075434_101228565
1800 Ga0075429_100015513
1801 Ga0075429_100024086
1802 Ga0075429_100068388
1803 Ga0075429_100069834
1804 Ga0075429_100074853
1805 Ga0075429_100136352
1806 Ga0075429_100182264
1807 Ga0075429_100620825
1808 Ga0068865_100034959
1809 Ga0068865_100101472
1810 Ga0075436_100000694
1811 Ga0075436_100025705
1812 Ga0075436_100034245
1813 Ga0075436_100036957
1814 Ga0075436_100343547
1815 Ga0097620_100002238
1816 Ga0097620_100020915
1817 Ga0097620_100042725
1818 Ga0097620_100051445
1819 Ga0097620_100058424
1820 Ga0097620_100102720
1821 Ga0097620_100107786
1822 Ga0097620_100205018
1823 Ga0097620_100285213
1824 Ga0097620_100559289
1825 Ga0097620_100559634
1826 Ga0097620_100748776
1827 Ga0075435_100000163
1828 Ga0075435_100004567
1829 Ga0075435_100018103
1830 Ga0075435_100031814
1831 Ga0075435_100086041
1832 Ga0075435_100096673
1833 Ga0075435_100118324
1834 Ga0075435_100148516
1835 Ga0075435_100151765
1836 Ga0075435_100218728
1837 Ga0075435_100255450
1838 Ga0075435_100366913
1839 Ga0105251_10187166
1840 Ga0105240_10085713
1841 Ga0105240_10225388
1842 Ga0105240_10295845
1843 Ga0105240_10613700
1844 Ga0105240_10761255
1845 Ga0105240_11120396
1846 Ga0111539_10000009
1847 Ga0111539_10000907
1848 Ga0111539_10001003
1849 Ga0111539_10011384
1850 Ga0111539_10019714
1851 Ga0111539_10022857
1852 Ga0111539_10036581
1853 Ga0111539_10044159
1854 Ga0111539_10044373
1855 Ga0111539_10068661
1856 Ga0111539_10396920
1857 Ga0111539_10436627
1858 Ga0111539_10510542
1859 Ga0111539_10521135
1860 Ga0111539_10540274
1861 Ga0111539_10782875
1862 Ga0111539_11248889
1863 Ga0105245_10027561
1864 Ga0105245_10048807
1865 Ga0105245_10060671
1866 Ga0105245_10109887
1867 Ga0105245_10342223
1868 Ga0105245_10581937
1869 Ga0105245_10903425
1870 Ga0105245_10963435
1871 Ga0105245_11395127
1872 Ga0105247_10035422
1873 Ga0105247_10131904
1874 Ga0105247_10241621
1875 Ga0105247_10399808
1876 Ga0114129_10000833
1877 Ga0114129_10002855
1878 Ga0114129_10003232
1879 Ga0114129_10005775
1880 Ga0114129_10010422
1881 Ga0114129_10011696
1882 Ga0114129_10015399
1883 Ga0114129_10052156
1884 Ga0114129_10133129
1885 Ga0114129_10142989
1886 Ga0114129_10178848
1887 Ga0114129_10428767
1888 Ga0114129_10478973
1889 Ga0105243_10004718
1890 Ga0105243_10132516
1891 Ga0105243_10186119
1892 Ga0105243_10305157
1893 Ga0105243_10465014
1894 Ga0105243_10530139
1895 Ga0105243_10533543
1896 Ga0105243_10829064
1897 Ga0105243_10833287
1898 Ga0105241_10357553
1899 Ga0105242_10020241
1900 Ga0105242_10103916
1901 Ga0105242_10463823
1902 Ga0105242_11322478
1903 Ga0105248_10022452
1904 Ga0105248_10038706
1905 Ga0105248_10040154
1906 Ga0105248_10044083
1907 Ga0105248_10056685
1908 Ga0105248_10076842
1909 Ga0105248_10081054
1910 Ga0105248_10140887
1911 Ga0105248_11377622
1912 Ga0105248_11535787
1913 Ga0105237_11158933
1914 Ga0105238_10022115
1915 Ga0105238_10082980
1916 Ga0105238_10954758
1917 Ga0105249_10027405
1918 Ga0105249_10120533
1919 Ga0105249_10146780
1920 Ga0105249_10214664
1921 Ga0105249_10499043
1922 Ga0105249_10690085
1923 Ga0105249_10837123
1924 Ga0105249_11379848
1925 Ga0105239_10316032
1926 Ga0105246_10160678
1927 Ga0157371_10605862
1928 Ga0157370_10081038
1929 Ga0157370_10147560
1930 Ga0157369_10094426
1931 Ga0157374_10015726
1932 Ga0157378_10072346
1933 Ga0157378_10116036
1934 Ga0157378_10760022
1935 Ga0163162_10075233
1936 Ga0163162_10240479
1937 Ga0163162_10528977
1938 Ga0157372_10162441
1939 Ga0157375_10092942
1940 Ga0157375_10102918
1941 Ga0157375_10203006
1942 Ga0157375_10228546
1943 Ga0157375_10247928
1944 Ga0157375_10250062
1945 Ga0157375_10880337
1946 Ga0157375_10899969
1947 Ga0157375_11013882
1948 Ga0163163_10007504
1949 Ga0163163_10081161
1950 Ga0163163_10085519
1951 Ga0163163_10095685
1952 Ga0163163_10547931
1953 Ga0163163_10884176
1954 Ga0157380_10020088
1955 Ga0157380_10021339
1956 Ga0157380_10031867
1957 Ga0157380_10035730
1958 Ga0157380_10513131
1959 Ga0157380_10704704
1960 Ga0157380_10707499
1961 Ga0157380_10799789
1962 Ga0182008_10183773
1963 Ga0157377_10030611
1964 Ga0157377_10207049
1965 Ga0157379_10002448
1966 Ga0157379_10010798
1967 Ga0157379_10026054
1968 Ga0157379_10367180
1969 Ga0157379_10418459
1970 Ga0157379_10838398
1971 Ga0157376_10077255
1972 Ga0157376_10088018
1973 Ga0157376_10139670
1974 Ga0157376_10139889
1975 Ga0157376_10229491
1976 Ga0157376_10448802
1977 Ga0157376_10478650
1978 Ga0163161_10098443
1979 Ga0163161_10187785
1980 Ga0163161_10313556
1981 Ga0163161_10409090
1982 Ga0213876_10062987
1983 Ga0213876_10112616
1984 Ga0207666_1009507
1985 Ga0207697_10037823
1986 Ga0207656_10251705
1987 Ga0207653_10036984
1988 Ga0207682_10077733
1989 Ga0207642_10028625
1990 Ga0207642_10252236
1991 Ga0207642_10475626
1992 Ga0207710_10075897
1993 Ga0207688_10228348
1994 Ga0207688_10325480
1995 Ga0207680_10041682
1996 Ga0207685_10008444
1997 Ga0207699_10006849
1998 Ga0207699_10011472
1999 Ga0207645_10010064
2000 Ga0207645_10033811
2001 Ga0207645_10134928
2002 Ga0207645_10294149
2003 Ga0207643_10038129
2004 Ga0207643_10054655
2005 Ga0207705_10020745
2006 Ga0207684_10051808
2007 Ga0207684_10678901
2008 Ga0207684_10775642
2009 Ga0207654_10736661
2010 Ga0207707_10053710
2011 Ga0207707_10085986
2012 Ga0207707_10160980
2013 Ga0207707_10232414
2014 Ga0207695_10098667
2015 Ga0207695_10184050
2016 Ga0207695_10530225
2017 Ga0207671_10741611
2018 Ga0207660_10021516
2019 Ga0207660_10126162
2020 Ga0207660_11081784
2021 Ga0207657_10004533
2022 Ga0207649_10007249
2023 Ga0207649_10386724
2024 Ga0207649_10409713
2025 Ga0207652_10037506
2026 Ga0207652_10038002
2027 Ga0207652_10091211
2028 Ga0207652_10321355
2029 Ga0207646_10030753
2030 Ga0207681_10005649
2031 Ga0207681_10016450
2032 Ga0207681_10067536
2033 Ga0207681_10233866
2034 Ga0207681_10259851
2035 Ga0207681_10326081
2036 Ga0207694_10031624
2037 Ga0207694_10062421
2038 Ga0207694_10486545
2039 Ga0207650_10028107
2040 Ga0207650_10032978
2041 Ga0207650_10193940
2042 Ga0207650_10429141
2043 Ga0207650_10544865
2044 Ga0207659_10014455
2045 Ga0207659_10059392
2046 Ga0207659_10077607
2047 Ga0207659_10080072
2048 Ga0207659_10082550
2049 Ga0207659_10094644
2050 Ga0207659_10261575
2051 Ga0207659_10432964
2052 Ga0207687_10009331
2053 Ga0207687_10228636
2054 Ga0207687_10359752
2055 Ga0207687_10469095
2056 Ga0207687_10642225
2057 Ga0207700_10004218
2058 Ga0207700_10023052
2059 Ga0207644_10091746
2060 Ga0207644_10146921
2061 Ga0207644_10152093
2062 Ga0207690_10107110
2063 Ga0207690_10298064
2064 Ga0207690_10358983
2065 Ga0207690_10533486
2066 Ga0207706_10035600
2067 Ga0207706_10104457
2068 Ga0207706_10591687
2069 Ga0207706_10593557
2070 Ga0207686_10010294
2071 Ga0207686_10025566
2072 Ga0207686_10034059
2073 Ga0207686_10048528
2074 Ga0207686_10088924
2075 Ga0207686_10126238
2076 Ga0207686_10236728
2077 Ga0207709_10068957
2078 Ga0207709_10161569
2079 Ga0207670_10039755
2080 Ga0207670_10082760
2081 Ga0207670_10190874
2082 Ga0207670_10360412
2083 Ga0207670_10577410
2084 Ga0207669_10065201
2085 Ga0207669_10299041
2086 Ga0207669_10351134
2087 Ga0207669_10835341
2088 Ga0207704_10024735
2089 Ga0207704_10077011
2090 Ga0207704_10078370
2091 Ga0207704_10169815
2092 Ga0207704_10186769
2093 Ga0207704_10312274
2094 Ga0207665_10006221
2095 Ga0207665_10026731
2096 Ga0207665_10048061
2097 Ga0207665_10672587
2098 Ga0207691_10010360
2099 Ga0207691_10043764
2100 Ga0207691_10059084
2101 Ga0207691_10086161
2102 Ga0207691_10249516
2103 Ga0207691_10272390
2104 Ga0207691_10330576
2105 Ga0207691_10586580
2106 Ga0207711_10023512
2107 Ga0207711_10032702
2108 Ga0207711_10038401
2109 Ga0207711_10051841
2110 Ga0207711_10101872
2111 Ga0207711_10177120
2112 Ga0207711_10188398
2113 Ga0207711_10290660
2114 Ga0207711_10351099
2115 Ga0207689_10048993
2116 Ga0207689_10055233
2117 Ga0207689_10121586
2118 Ga0207689_10158998
2119 Ga0207689_10305202
2120 Ga0207689_10572619
2121 Ga0207661_10113844
2122 Ga0207661_10356271
2123 Ga0207661_10426068
2124 Ga0207661_10747471
2125 Ga0207679_10127564
2126 Ga0207679_10280108
2127 Ga0207667_10052392
2128 Ga0207667_10789342
2129 Ga0207651_10073589
2130 Ga0207651_10148068
2131 Ga0207651_10152087
2132 Ga0207651_10194052
2133 Ga0207651_10487809
2134 Ga0207712_10503045
2135 Ga0207712_10629834
2136 Ga0207712_10687555
2137 Ga0207668_10487572
2138 Ga0207668_10729933
2139 Ga0207668_10970868
2140 Ga0207640_10010072
2141 Ga0207640_10029453
2142 Ga0207640_10031620
2143 Ga0207640_10033666
2144 Ga0207640_10051754
2145 Ga0207640_10398664
2146 Ga0207658_10083082
2147 Ga0207658_10443523
2148 Ga0207658_10511652
2149 Ga0207658_10692005
2150 Ga0207677_10004306
2151 Ga0207677_10029124
2152 Ga0207677_10157599
2153 Ga0207677_10614267
2154 Ga0207703_10028142
2155 Ga0207703_10030820
2156 Ga0207703_10030964
2157 Ga0207703_10035162
2158 Ga0207703_10063728
2159 Ga0207703_10169001
2160 Ga0207703_10280717
2161 Ga0207703_10342815
2162 Ga0207703_10540314
2163 Ga0207703_10546494
2164 Ga0207703_10581672
2165 Ga0207703_10871524
2166 Ga0207639_10705004
2167 Ga0207678_10318885
2168 Ga0207708_10003903
2169 Ga0207708_10016651
2170 Ga0207708_10029836
2171 Ga0207708_10103621
2172 Ga0207708_10168359
2173 Ga0207708_11012873
2174 Ga0207702_10211334
2175 Ga0207641_10000723
2176 Ga0207641_10027030
2177 Ga0207641_10098984
2178 Ga0207641_10173210
2179 Ga0207641_10212024
2180 Ga0207641_10460406
2181 Ga0207648_10004153
2182 Ga0207648_10023751
2183 Ga0207648_10032569
2184 Ga0207648_10052969
2185 Ga0207648_10077998
2186 Ga0207648_10332227
2187 Ga0207676_10029410
2188 Ga0207676_10049921
2189 Ga0207676_10050364
2190 Ga0207676_10067402
2191 Ga0207676_10094067
2192 Ga0207676_10126498
2193 Ga0207676_10170831
2194 Ga0207676_10180818
2195 Ga0207676_10606466
2196 Ga0207676_10753891
2197 Ga0207676_11107931
2198 Ga0207674_10102207
2199 Ga0207674_10265270
2200 Ga0207674_10726433
2201 Ga0207674_10901759
2202 Ga0207675_100001546
2203 Ga0207675_100010841
2204 Ga0207675_100013818
2205 Ga0207675_100018097
2206 Ga0207675_100029257
2207 Ga0207675_100119307
2208 Ga0207675_100154793
2209 Ga0207675_100174705
2210 Ga0207675_100176566
2211 Ga0207675_100358999
2212 Ga0207675_100700450
2213 Ga0207675_100734567
2214 Ga0207675_100870848
2215 Ga0207675_100967978
2216 Ga0207683_10003587
2217 Ga0207683_10007694
2218 Ga0207683_10018503
2219 Ga0207683_10039381
2220 Ga0207683_10185915
2221 Ga0207683_10214326
2222 Ga0207683_10393063
2223 Ga0207683_10433310
2224 Ga0207683_10455150
2225 Ga0207683_10682385
2226 Ga0207683_11213484
2227 Ga0207698_10189649
2228 Ga0207698_10410296
2229 Ga0207698_10507577
2230 Ga0209588_1002109
2231 Ga0209966_1080341
2232 Ga0209813_10039753
2233 Ga0209813_10167221
2234 Ga0209974_10090329
2235 Ga0207428_10000022
2236 Ga0207428_10006808
2237 Ga0207428_10009509
2238 Ga0207428_10010908
2239 Ga0207428_10120115
2240 Ga0207428_10205714
2241 Ga0268266_10000267
2242 Ga0268266_10009913
2243 Ga0268266_10052047
2244 Ga0268266_10060779
2245 Ga0268266_10060798
2246 Ga0268266_10060998
2247 Ga0268266_10066101
2248 Ga0268266_10164055
2249 Ga0268266_10206522
2250 Ga0268266_10268363
2251 Ga0268265_10018349
2252 Ga0268265_10055077
2253 Ga0268265_10106873
2254 Ga0268265_10186538
2255 Ga0268265_10293254
2256 Ga0268265_10334851
2257 Ga0268265_10657869
2258 Ga0268265_10820976
2259 Ga0268264_10016766
2260 Ga0268264_10055653
2261 Ga0268264_10163109
2262 Ga0268264_10207876
2263 Ga0268264_10222284
2264 Ga0268264_10322315
2265 Ga0268264_10428231
2266 Ga0268264_10484128
2267 Ga0268264_10774327
2268 Ga0268264_11298336
2269 Ga0265318_10091486
2270 Ga0265332_10037411
2271 Ga0265332_10061252
2272 Ga0265331_10074527
2273 Ga0307408_100058188
2274 Ga0307408_100161906
2275 Ga0307408_100297722
2276 Ga0265314_10030128
2277 Ga0265314_10036820
2278 Ga0307405_10038834
2279 Ga0307405_10331034
2280 Ga0307413_10154131
2281 Ga0307413_10485211
2282 Ga0307413_10935430
2283 Ga0307410_10013517
2284 Ga0307410_10548212
2285 Ga0307410_10781686
2286 Ga0307406_10028931
2287 Ga0307406_10045055
2288 Ga0307406_10144860
2289 Ga0307406_10688614
2290 Ga0307406_10972691
2291 Ga0307406_11067552
2292 Ga0307407_10008924
2293 Ga0307407_10972997
2294 Ga0307412_10006752
2295 Ga0307412_10246438
2296 Ga0307412_10568325
2297 Ga0307412_11184857
2298 Ga0307409_100056255
2299 Ga0307409_100131491
2300 Ga0307409_100187592
2301 Ga0307409_100288048
2302 Ga0307409_100305293
2303 Ga0307416_100041219
2304 Ga0307416_100056454
2305 Ga0307416_100155193
2306 Ga0307416_100347843
2307 Ga0307416_100353969
2308 Ga0307416_100389486
2309 Ga0307416_100419157
2310 Ga0307416_100879117
2311 Ga0307416_100989316
2312 Ga0307416_101345498
2313 Ga0307414_10173151
2314 Ga0307411_10006424
2315 Ga0307411_10163523
2316 Ga0307411_10934608
2317 Ga0307415_100032110
2318 Ga0307415_100040169
2319 Ga0307415_100263062
2320 Ga0307415_100561253
2321 Ga0373948_0001151
2322 Ga0373950_0000305
2323 Ga0373958_0004141
2324 Ga0373959_0044786
2325 Ga0373938_0000220
2326 Ga0373929_0000281
2327 Ga0373929_0075603
2328 Ga0373934_0023655
2329 Ga0373940_0002909
2330 Ga0373944_0046282
2331 Ga0373951_0012636
2332 Ga0373952_0002395
2333 Ga0373952_0079657
2334 Ga0373923_0256096
2335 Ga0373932_0018018
2336 Ga0373932_0094042
2337 Ga0373936_0027159
2338 Ga0373939_0001341
2339 Ga0373939_0064109
2340 Ga0373941_0000459
2341 Ga0373941_0008846
2342 Ga0373941_0033592
2343 Ga0373953_0108455
2344 Ga0373953_0125586
2345 Ga0373956_0159713
2346 Ga0373957_0169527
2347 Ga0373960_0000115
2348 Ga0373943_0087358
2349 Ga0373943_0111072
2350 Ga0373943_0112643
2351 Ga0373943_0203659
2352 Ga0373955_0085317
2353 Ga0373955_0118127
2354 Ga0373955_0131384
2355 Ga0373955_0182855
2356 Ga0373955_0630348
2357 Ga0373942_0000216
2358 Ga0373961_0002594
2359 Ga0373962_0001428
2360 Ga0373962_0084401
2361 Ga0373924_0299566
2362 Ga0373931_0014367
2363 Ga0373935_0050259
2364 Ga0373935_0205759
2365 Ga0373935_0570396
2366 Ga0373933_0297753
2367 Ga0373933_0380220
2368 Ga0373933_0425033
2369 Ga0373933_0536876
2370 Ga0373947_0103362
2371 Ga0373947_0106564
2372 Ga0373947_0170869
2373 Ga0373947_0488250
2374 Ga0373937_0000908
2375 Ga0373937_0053089
2376 Ga0373937_0060901
2377 Ga0373937_0103466
2378 Ga0373937_0141498
2379 Ga0373937_0243377
2380 Ga0373937_0300835
2381 Ga0373937_1206010
2382 Ga0373925_0000407
2383 Ga0373925_0020175
2384 Ga0373925_0060722
2385 Ga0373925_0253868
2386 Ga0373925_0264101
2387 Ga0395905_0668202
2388 Ga0395905_0843029
2389 Ga0436364_0490704
2390 Ga0436365_0077351
2391 Ga0436365_0123225
2392 Ga0436363_0359495
2393 Ga0436362_0139354
2394 Ga0439453_0018331
2395 Ga0439453_0046325
2396 Ga0451853_0750283
2397 Ga0451853_2765793
2398 Ga0439433_0004248
2399 Ga0450897_012168
2400 Ga0450894_000961
2401 Ga0450896_001008
2402 Ga0450896_015326
2403 Ga0450899_018388
2404 Ga0450905_015376
2405 Ga0439446_0105100
2406 Ga0450908_011392
2407 Ga0439434_0009754
2408 Ga0439435_0008885
2409 Ga0439435_0046381
2410 Ga0439435_0066633
2411 Ga0439435_0092426
2412 Ga0439444_0019105
2413 Ga0439464_0035988
2414 Ga0439460_0012540
2415 Ga0439460_0016288
2416 Ga0451577_0412845
2417 Ga0451577_0600480
2418 Ga0451577_1317719
2419 Ga0453683_0723205
2420 Ga0466964_0148407
2421 Ga0453684_0108882
2422 Ga0451576_0005342
2423 Ga0451576_0010859
2424 Ga0451576_0791038
2425 Ga0451576_1143967
2426 Ga0466967_0075954
2427 Ga0466967_0353035
2428 Ga0466967_0473971
2429 Ga0466967_1147291
2430 Ga0495592_0037832
2431 Ga0495603_0247011
2432 Ga0495629_0209662
2433 Ga0495638_0073386
2434 Ga0495641_0106712
2435 Ga0495651_0192926
2436 Ga0495653_0062124
2437 Ga0495653_0132001
2438 Ga0495653_0271049
2439 Ga0495580_0611867
2440 Ga0495582_0461697
2441 Ga0495582_0495897
2442 Ga0495639_0071265
2443 Ga0495639_0147663
2444 Ga0495639_0496475
2445 Ga0495662_0305717
2446 Ga0495664_0226417
2447 Ga0495608_0005849
2448 Ga0495618_0160351
2449 Ga0495618_0410654
2450 Ga0495628_0023017
2451 Ga0495628_0470580
2452 Ga0495630_0027662
2453 Ga0495630_0174656
2454 Ga0495652_0439202
2455 Ga0495652_0685777
2456 Ga0495586_0278250
2457 Ga0495587_0152732
2458 Ga0495587_0268490
2459 Ga0495645_0001612
2460 Ga0495645_0043909
2461 Ga0495645_0532198
2462 Ga0495645_0538914
2463 Ga0495667_0179752
2464 Ga0495667_0227327
2465 Ga0495667_0307332
2466 Ga0495634_0171222
2467 Ga0495634_0193446
2468 Ga0495634_0197114
2469 Ga0495635_0332156
2470 Ga0495659_0145311
2471 Ga0495588_0268487
2472 Ga0495599_0186349
2473 Ga0495646_0242509
2474 Ga0495647_0081279
2475 Ga0495658_0051246
2476 Ga0495658_0140375
2477 Ga0495658_0175134
2478 Ga0495658_0194264
2479 Ga0495658_0520698
2480 Ga0495669_0089826
2481 Ga0495669_0244596
2482 Ga0495613_0013803
2483 Ga0495613_0037800
2484 Ga0495613_0233434
2485 Ga0495613_0463818
2486 Ga0495670_0274108
2487 Ga0495649_0384712
2488 Ga0495600_0027231
2489 Ga0495600_0181165
2490 Ga0495600_0450946
2491 Ga0495604_0021253
2492 Ga0495604_0181556
2493 Ga0495674_0032485
2494 Ga0495674_0325518
2495 Ga0495674_0345303
2496 Ga0495680_0187229
2497 Ga0495675_0119401
2498 Ga0495684_0018047
2499 Ga0495602_0289962
2500 Ga0496100_0000941
2501 Ga0496100_0135748
2502 Ga0496101_0001279
2503 Ga0496101_0195660
2504 Ga0496102_0162405
2505 Ga0496102_0546365
2506 Ga0496102_1066980
2507 Ga0496103_0350016
2508 Ga0496103_0485296
2509 Ga0496103_0524692
2510 Ga0496104_0039358
2511 Ga0496104_0060217
2512 Ga0496104_0103641
2513 Ga0496104_0105262
2514 Ga0496104_0370826
2515 Ga0496104_0425185
2516 Ga0496104_0829871
2517 Ga0496104_0898987
2518 Ga0496104_0942080
2519 Ga0496105_0023414
2520 Ga0496105_0054714
2521 Ga0496105_0067393
2522 Ga0496105_0245425
2523 Ga0496105_0263735
2524 Ga0496106_0055640
2525 Ga0496106_0493747
2526 Ga0496106_0687148
2527 Ga0496106_1060018
2528 Ga0496106_1071916
2529 Ga0496107_0053874
2530 Ga0496108_0001370
2531 Ga0496108_0002181
2532 Ga0496108_0249853
2533 Ga0496108_0581466
2534 Ga0496109_0013530
2535 Ga0496109_0058736
2536 Ga0496109_0768119
2537 Ga0496110_0024307
2538 Ga0496110_0049924
2539 Ga0496110_0078646
2540 Ga0496110_0254607
2541 Ga0496111_0030400
2542 Ga0496111_0325081
2543 Ga0496111_0353112
2544 Ga0496112_0097753
2545 Ga0496112_0104043
2546 Ga0496112_0126259
2547 Ga0496112_0231539
2548 Ga0496112_0365699
2549 Ga0496112_0385411
2550 Ga0496112_0577015
2551 Ga0496112_0790439
2552 Ga0496112_0972706
2553 Ga0496113_0032267
2554 Ga0496114_0031028
2555 Ga0496114_0037274
2556 Ga0496114_0099182
2557 Ga0496114_0666219
2558 Ga0496115_0054923
2559 Ga0501296_019557
2560 Ga0501031_0183627
2561 Ga0501031_0256782
2562 Ga0501033_0059314
2563 Ga0501034_0002071
2564 Ga0501034_0352348
2565 Ga0501036_0183307
2566 Ga0501036_0258035
2567 Ga0501036_0378908
2568 Ga0501037_0319680
2569 Ga0501037_0511903
2570 Ga0501038_0031634
2571 Ga0501038_0113080
2572 Ga0501038_0176067
2573 Ga0501038_0443708
2574 Ga0501039_0241817
2575 Ga0501039_0708860
2576 Ga0501040_0049676
2577 Ga0501040_0078441
2578 Ga0501040_0102072
2579 Ga0501040_0146360
2580 Ga0501040_0178312
2581 Ga0501041_0011650
2582 Ga0501041_0204470
2583 Ga0501042_0080784
2584 Ga0501042_0091915
2585 Ga0501042_0106854
2586 Ga0501042_0115811
2587 Ga0501042_0135421
2588 Ga0501046_0025123
2589 Ga0501046_0153825
2590 Ga0501046_0158281
2591 Ga0501046_0227960
2592 Ga0501047_0132079
2593 Ga0501048_0073436
2594 Ga0501048_0101789
2595 Ga0501048_0205821
2596 Ga0501048_0211599
2597 Ga0501048_0221465
2598 Ga0501048_0519921
2599 Ga0501067_0057111
2600 Ga0501067_0342450
2601 Ga0501068_0213916
2602 Ga0501069_0296493
2603 Ga0501071_0007516
2604 Ga0501071_0028258
2605 Ga0501071_0109223
2606 Ga0501071_0245244
2607 Ga0501071_0386477
2608 Ga0501072_0014651
2609 Ga0501072_0022226
2610 Ga0501072_0030792
2611 Ga0501072_0130984
2612 Ga0501072_0797676
2613 Ga0501073_0019525
2614 Ga0501073_0213661
2615 Ga0501073_0350850
2616 Ga0501074_0036974
2617 Ga0501074_0120321
2618 Ga0501074_0133844
2619 Ga0501074_0332450
2620 Ga0501074_0445808
2621 Ga0501075_0004510
2622 Ga0501075_0004708
2623 Ga0501075_0006237
2624 Ga0501075_0024124
2625 Ga0501075_0069159
2626 Ga0501075_0089446
2627 Ga0501075_0577141
2628 Ga0501076_0009464
2629 Ga0501076_0020973
2630 Ga0501076_0024736
2631 Ga0501076_0053252
2632 Ga0501076_0057067
2633 Ga0501076_0162466
2634 Ga0501076_0191511
2635 Ga0501076_0203809
2636 Ga0501076_0379105
2637 Ga0501076_0417970
2638 Ga0501076_0524153
2639 Ga0501077_0098781
2640 Ga0501077_0133386
2641 Ga0501077_0141361
2642 Ga0501079_0018386
2643 Ga0501079_0289632
2644 Ga0501079_0331756
2645 Ga0501079_0365959
2646 Ga0501080_0072326
2647 Ga0501081_0003378
2648 Ga0501081_0040623
2649 Ga0501081_0098282
2650 Ga0501081_0325776
2651 Ga0501083_0671904
2652 Ga0501035_0362772
2653 Ga0501045_0002786
2654 Ga0501045_0055020
2655 Ga0501045_0061036
2656 Ga0501045_0093604
2657 Ga0501045_0118213
2658 Ga0501045_0134160
2659 Ga0501045_0872696
2660 nmdc:mga03n38_57460_c1
2661 nmdc:mga00v17_187031_c1
2662 nmdc:mga00v17_65241_c1
2663 nmdc:mga0k408_136963_c1
2664 nmdc:mga0k408_267381_c1
2665 nmdc:mga0k408_388861_c1
2666 nmdc:mga0k408_628013_c1
2667 nmdc:mga0k408_64236_c1
2668 nmdc:mga06z11_11534_c1
2669 nmdc:mga06z11_34889_c2
2670 nmdc:mga06z11_399731_c1
2671 nmdc:mga06z11_85492_c1
2672 nmdc:mga04h51_30173_c1
2673 nmdc:mga07m45_160093_c1
2674 nmdc:mga07m45_58083_c1
2675 nmdc:mga05p37_108938_c1
2676 nmdc:mga05p37_10907_c1
2677 nmdc:mga05p37_115030_c1
2678 nmdc:mga05p37_125961_c1
2679 nmdc:mga05p37_15017_c1
2680 nmdc:mga05p37_181471_c1
2681 nmdc:mga05p37_206952_c1
2682 nmdc:mga05p37_239469_c1
2683 nmdc:mga05p37_40665_c1
2684 nmdc:mga05p37_40999_c1
2685 nmdc:mga05p37_414324_c1
2686 nmdc:mga05p37_417257_c1
2687 nmdc:mga05p37_432219_c1
2688 nmdc:mga05p37_433670_c1
2689 nmdc:mga05p37_615820_c1
2690 nmdc:mga05p37_6413_c1
2691 nmdc:mga05p37_7936_c1
2692 nmdc:mga05p37_808217_c1
2693 nmdc:mga09592_170085_c1
2694 nmdc:mga09592_185299_c1
2695 nmdc:mga09592_193574_c1
2696 nmdc:mga09592_213591_c2
2697 nmdc:mga09592_531358_c1
2698 nmdc:mga09592_54422_c1
2699 nmdc:mga09592_554307_c1
2700 nmdc:mga09592_69318_c1
2701 nmdc:mga09592_7490_c1
2702 nmdc:mga09592_92666_c1
2703 nmdc:mga0qj67_196259_c1
2704 nmdc:mga0qj67_20496_c1
2705 nmdc:mga0qj67_243549_c1
2706 nmdc:mga0qj67_31104_c1
2707 nmdc:mga06r32_141812_c1
2708 nmdc:mga06r32_24484_c1
2709 nmdc:mga06r32_31923_c1
2710 nmdc:mga06r32_481680_c1
2711 nmdc:mga06r32_53561_c1
2712 nmdc:mga06r32_59685_c1
2713 nmdc:mga06r32_66722_c1
2714 nmdc:mga06r32_713181_c1
2715 nmdc:mga06r32_72622_c1
2716 nmdc:mga06r32_815903_c1
2717 nmdc:mga08y16_1422658_c1
2718 nmdc:mga08y16_161440_c1
2719 nmdc:mga08y16_207754_c1
2720 nmdc:mga08y16_21_c1
2721 nmdc:mga08y16_2325_c1
2722 nmdc:mga08y16_2881_c1
2723 nmdc:mga08y16_30909_c1
2724 nmdc:mga08y16_336582_c1
2725 nmdc:mga08y16_38877_c1
2726 nmdc:mga08y16_555360_c1
2727 nmdc:mga08y16_631170_c1
2728 nmdc:mga08y16_98490_c1
2729 nmdc:mga08y16_996285_c1
2730 nmdc:mga0n895_12437_c1
2731 nmdc:mga0n895_12_c1
2732 nmdc:mga0n895_145259_c1
2733 nmdc:mga0n895_247962_c1
2734 nmdc:mga0n895_288011_c1
2735 nmdc:mga0n895_4435_c1
2736 nmdc:mga0n895_510407_c1
2737 nmdc:mga0n895_63659_c1
2738 nmdc:mga0n895_654333_c1
2739 nmdc:mga0n895_8828_c1
2740 nmdc:mga0rr50_118071_c1
2741 nmdc:mga0rr50_1_c1
2742 nmdc:mga0rr50_223359_c1
2743 nmdc:mga0rr50_281767_c1
2744 nmdc:mga0rr50_295089_c1
2745 nmdc:mga0rr50_308296_c1
2746 nmdc:mga0rr50_323784_c1
2747 nmdc:mga0rr50_574225_c1
2748 nmdc:mga0rr50_66018_c1
2749 nmdc:mga0rr50_7461_c1
2750 nmdc:mga08x19_22680_c1
2751 nmdc:mga08x19_337015_c1
2752 nmdc:mga08x19_5011_c1
2753 nmdc:mga08x19_75446_c1
2754 nmdc:mga08x19_87_c1
2755 nmdc:mga08x19_92542_c1
2756 nmdc:mga0a205_10463_c1
2757 nmdc:mga0a205_164732_c1
2758 nmdc:mga0a205_227760_c1
2759 nmdc:mga0a205_22854_c1
2760 nmdc:mga0a205_252902_c1
2761 nmdc:mga0a205_254885_c1
2762 nmdc:mga0a205_294905_c1
2763 nmdc:mga0a205_3604_c1
2764 nmdc:mga0a205_36795_c1
2765 nmdc:mga0a205_509225_c1
2766 nmdc:mga0a205_891341_c1
2767 Ga0495601_0020965
2768 Ga0495601_0050288
2769 Ga0495601_0057797
2770 Ga0495601_0314710
2771 Ga0495595_0033869
2772 Ga0495595_0038969
2773 Ga0495595_0050067
2774 Ga0495595_0056124
2775 Ga0495595_0198951
2776 Ga0495619_0007028
2777 Ga0495619_0008911
2778 Ga0495619_0018250
2779 Ga0495619_0021800
2780 Ga0495619_0077139
2781 Ga0495619_0257636
2782 Ga0495619_0268266
2783 Ga0495619_0426010
2784 Ga0500651_0076743
2785 Ga0500566_0116855
2786 Ga0500641_0018715
2787 Ga0500555_000579
2788 Ga0500628_008063
2789 Ga0500658_0105383
2790 Ga0500616_0002575
2791 Ga0500599_012205
2792 Ga0501084_0025523
2793 Ga0501084_0154891
2794 Ga0501084_0206288
2795 Ga0501084_0232583
2796 Ga0501084_0537544
2797 Ga0501084_0849273
2798 Ga0590071_001479
2799 Ga0590074_000830
2800 Ga0590075_000007
2801 Ga0590077_000152
2802 Ga0501082_0080033
2803 Ga0501082_0155347
2804 Ga0501082_0200468
2805 Ga0501082_0258597
2806 Ga0501082_0366765
2807 Ga0501082_0605538
2808 Ga0501082_0848031
2809 Ga0530510_0002421
2810 Ga0530510_0020330
2811 Ga0530510_0097890
2812 Ga0530510_0565301

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00475

IGPD

Imidazoleglycerol-phosphate dehydratase

57

200

1

Structural Annotation

Top 5 Hits

ID Description Score Start End
4mu0-assembly1.cif.gz_A the structure of wt a. thaliana igpd2 in complex with mn2+ and 1,2,4-triazole at 1.3 a resolution 0.9601 2 182
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9596 1 182
7oj5-assembly1.cif.gz_A cryo-em structure of medicago truncatula hisn5 protein 0.9576 1 177
2f1d-assembly1.cif.gz_D x-ray structure of imidazoleglycerol-phosphate dehydratase 0.9495 1 182
4mu4-assembly1.cif.gz_A the form b structure of an e21q catalytic mutant of a. thaliana igpd2 in complex with mn2+ and its substrate, 2r3s-igp, to 1.41 a resolution 0.9463 2 185
ID Description Score Start End Superfamily
af_P40374_113_216_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.979 91 174 3.30.230.40
af_Q58109_93_196_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.965 91 174 3.30.230.40
1rhyA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9645 91 177 3.30.230.40
2f1dA02 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.952 91 182 3.30.230.40
af_C6T988_68_169_3.30.230.40 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S5; domain 2;Imidazole glycerol phosphate dehydratase; domain 1 0.9481 2 89 3.30.230.40
ID Description Score Start End GO Terms
AF-A0A850D107-F1-model_v4 deleted 1.002 2 61
AF-A0A7X6NPR2-F1-model_v4 deleted 0.9944 2 80
AF-A0A1Z9GWE8-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9919 1 83 GO:0000105
GO:0004424
AF-A0A522GSK4-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9917 1 77 GO:0000105
GO:0004424
AF-A0A7V8WEL3-F1-model_v4 Imidazoleglycerol-phosphate dehydratase 0.9917 1 66 GO:0000105
GO:0004424

Map