F493715
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1405 | 389 | 2810 | 291 |
Family's Representative Sequence
| Representative Sequence | 3300006847|Ga0075431_100229517|Ga0075431_1002295172 |
| Length | 337 |
| Sequence | VIDGGRLDFDENLARAGLGIGNVSILENVRPAVLAKNHCFHGKPVVYPDGMTNKKDVRTIVVVGAGIMGRGIAHVSAMAGYTTVLNDVSNELLEKARGQVRRDLEKGIEIGKVTSDSMEQTLSRLTLESALXXAVSHADLIIEAVPESIELKVDLFARLDRICAQNVIFASNTSALSITEMAGATKRPQQFIGMHFFNPVHKMKLVEIIRALETNDDTFQTVDSVAKRMGKETVEVKESPGFVTTRINALIGNEAFYMLQEGIASARDIDKALKLGLNHPMGPFEMIDLVGLDTRLSILSFLHQTFGEKYRPCPLLVKYVKAGRLGKKVGKGVYEYL |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 2 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 3 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 4 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 5 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 6 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 7 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 8 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 11 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 12 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 13 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 15 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 17 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 18 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 20 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 21 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 22 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 24 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 31 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 34 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 35 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 37 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 38 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 42 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 48 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 49 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 52 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 53 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 55 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 60 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 65 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 66 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 68 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 69 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 70 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 72 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 73 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 74 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 75 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 76 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 77 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 78 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 79 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 80 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 81 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 82 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 83 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 84 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 85 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 86 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 87 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 88 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 89 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 90 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 91 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 92 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 93 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 94 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 95 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 96 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 97 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 98 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 99 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 100 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 101 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 102 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 103 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 104 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 105 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 119 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021358 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 | Metagenome | Rhizosphere |
| 140 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 141 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 142 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 143 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 144 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 145 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 211 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 216 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 217 | 3300030879 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 218 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 219 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 220 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 222 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 223 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 224 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 233 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 234 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 235 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 236 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 237 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 240 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 241 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 242 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 243 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 244 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 245 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 255 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 256 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 257 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 258 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 259 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 260 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 261 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 262 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 263 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 264 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 265 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 266 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 267 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 268 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 269 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 270 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 271 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 272 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 273 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 274 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 275 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 276 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 277 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 330 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 331 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 332 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 333 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 334 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 335 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 338 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 340 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 353 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 357 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 358 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 359 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 360 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 361 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 362 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 363 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 374 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 377 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 378 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 379 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300059503 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 383 | 3300059505 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 384 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 386 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 387 | 2857591370 | Brevibacillus sp. R-71934 | Isolate | Unclassified |
| 388 | 2936340661 | Gottfriedia acidiceleris 1-17 | Isolate | Rhizosphere |
| 389 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.93 |
| Metatranscriptomes | 0.85 |
| Isolates | 0.21 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.78 |
| Nodule | 0 |
| Rhizoplane | 2.85 |
| Rhizosphere | 94.8 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 5.98 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0075431_100229517 | 3300006847 | Bacteria | 1892 |
| 2 | LJNas_1000359 | 3300000546 | Bacteria | 7997 |
| 3 | LJNas_1003504 | 3300000546 | Bacteria | 1793 |
| 4 | JGI24751J29686_10004922 | 3300002459 | Bacteria | 2720 |
| 5 | rootL2_10191405 | 3300003322 | Bacteria | 1493 |
| 6 | Ga0065704_10202031 | 3300005289 | Bacteria | 1142 |
| 7 | Ga0065712_10089208 | 3300005290 | Bacteria | 2481 |
| 8 | Ga0065712_10162800 | 3300005290 | Bacteria | 1291 |
| 9 | Ga0065715_10028342 | 3300005293 | Bacteria | 2208 |
| 10 | Ga0065715_10324400 | 3300005293 | Bacteria | 996 |
| 11 | Ga0065707_10004536 | 3300005295 | Bacteria | 4544 |
| 12 | Ga0065707_10107322 | 3300005295 | Bacteria | 2559 |
| 13 | Ga0065707_10140512 | 3300005295 | Bacteria | 1779 |
| 14 | Ga0070658_10009208 | 3300005327 | Bacteria | 7938 |
| 15 | Ga0070676_10053202 | 3300005328 | Bacteria | 2384 |
| 16 | Ga0070676_10275058 | 3300005328 | Bacteria | 1132 |
| 17 | Ga0070683_100000991 | 3300005329 | Bacteria | 21246 |
| 18 | Ga0070683_100015092 | 3300005329 | Bacteria | 6779 |
| 19 | Ga0070683_100348113 | 3300005329 | Unclassified | 1411 |
| 20 | Ga0070683_100365672 | 3300005329 | Bacteria | 1374 |
| 21 | Ga0070690_100018513 | 3300005330 | Bacteria | 4209 |
| 22 | Ga0070690_100024970 | 3300005330 | Bacteria | 3679 |
| 23 | Ga0070690_100030342 | 3300005330 | Bacteria | 3359 |
| 24 | Ga0070690_100148702 | 3300005330 | Unclassified | 1596 |
| 25 | Ga0070690_100155991 | 3300005330 | Bacteria | 1561 |
| 26 | Ga0070670_100006846 | 3300005331 | Bacteria | 9659 |
| 27 | Ga0070670_100022824 | 3300005331 | Bacteria | 5385 |
| 28 | Ga0070670_100050190 | 3300005331 | Bacteria | 3586 |
| 29 | Ga0070670_100061905 | 3300005331 | Bacteria | 3212 |
| 30 | Ga0068869_100019550 | 3300005334 | Bacteria | 4630 |
| 31 | Ga0068869_100060637 | 3300005334 | Bacteria | 2773 |
| 32 | Ga0068869_100264234 | 3300005334 | Bacteria | 1378 |
| 33 | Ga0070666_10004150 | 3300005335 | Bacteria | 8791 |
| 34 | Ga0070666_10275774 | 3300005335 | Bacteria | 1194 |
| 35 | Ga0070680_100077227 | 3300005336 | Bacteria | 2743 |
| 36 | Ga0070680_100166647 | 3300005336 | Bacteria | 1853 |
| 37 | Ga0070680_100265384 | 3300005336 | Bacteria | 1453 |
| 38 | Ga0070680_100384731 | 3300005336 | Bacteria | 1195 |
| 39 | Ga0070680_100587047 | 3300005336 | Bacteria | 956 |
| 40 | Ga0068868_100003935 | 3300005338 | Bacteria | 10378 |
| 41 | Ga0068868_100007730 | 3300005338 | Bacteria | 7672 |
| 42 | Ga0068868_100010214 | 3300005338 | Bacteria | 6786 |
| 43 | Ga0068868_100352639 | 3300005338 | Bacteria | 1260 |
| 44 | Ga0070660_100050604 | 3300005339 | Bacteria | 3197 |
| 45 | Ga0070660_100079882 | 3300005339 | Bacteria | 2566 |
| 46 | Ga0070689_100000184 | 3300005340 | Bacteria | 37816 |
| 47 | Ga0070689_100006327 | 3300005340 | Bacteria | 8180 |
| 48 | Ga0070689_100011182 | 3300005340 | Bacteria | 6422 |
| 49 | Ga0070689_100013823 | 3300005340 | Bacteria | 5848 |
| 50 | Ga0070689_100026157 | 3300005340 | Bacteria | 4391 |
| 51 | Ga0070689_100028450 | 3300005340 | Bacteria | 4225 |
| 52 | Ga0070689_100201940 | 3300005340 | Bacteria | 1624 |
| 53 | Ga0070691_10074743 | 3300005341 | Bacteria | 1649 |
| 54 | Ga0070687_100006124 | 3300005343 | Bacteria | 4913 |
| 55 | Ga0070687_100009510 | 3300005343 | Bacteria | 4169 |
| 56 | Ga0070661_100020154 | 3300005344 | Bacteria | 4754 |
| 57 | Ga0070661_100187054 | 3300005344 | Unclassified | 1578 |
| 58 | Ga0070692_10024271 | 3300005345 | Bacteria | 2979 |
| 59 | Ga0070668_100034746 | 3300005347 | Bacteria | 3842 |
| 60 | Ga0070669_100005158 | 3300005353 | Bacteria | 9449 |
| 61 | Ga0070669_100104320 | 3300005353 | Bacteria | 2143 |
| 62 | Ga0070675_100007816 | 3300005354 | Bacteria | 8286 |
| 63 | Ga0070675_100032017 | 3300005354 | Bacteria | 4253 |
| 64 | Ga0070675_100077530 | 3300005354 | Bacteria | 2766 |
| 65 | Ga0070675_100168217 | 3300005354 | Bacteria | 1889 |
| 66 | Ga0070675_100172332 | 3300005354 | Bacteria | 1867 |
| 67 | Ga0070671_100163839 | 3300005355 | Bacteria | 1879 |
| 68 | Ga0070671_100271153 | 3300005355 | Bacteria | 1442 |
| 69 | Ga0070671_100334032 | 3300005355 | Bacteria | 1292 |
| 70 | Ga0070671_100343244 | 3300005355 | Bacteria | 1274 |
| 71 | Ga0070674_100050690 | 3300005356 | Bacteria | 2858 |
| 72 | Ga0070674_100113640 | 3300005356 | Bacteria | 1992 |
| 73 | Ga0070673_100001103 | 3300005364 | Bacteria | 15474 |
| 74 | Ga0070673_100002331 | 3300005364 | Bacteria | 11533 |
| 75 | Ga0070673_100003082 | 3300005364 | Bacteria | 10316 |
| 76 | Ga0070673_100106401 | 3300005364 | Bacteria | 2319 |
| 77 | Ga0070673_100652145 | 3300005364 | Bacteria | 964 |
| 78 | Ga0070688_100002168 | 3300005365 | Bacteria | 9900 |
| 79 | Ga0070688_100004760 | 3300005365 | Bacteria | 7093 |
| 80 | Ga0070688_100005527 | 3300005365 | Bacteria | 6669 |
| 81 | Ga0070688_100021976 | 3300005365 | Bacteria | 3732 |
| 82 | Ga0070688_100048318 | 3300005365 | Bacteria | 2643 |
| 83 | Ga0070688_100071536 | 3300005365 | Bacteria | 2221 |
| 84 | Ga0070688_100113887 | 3300005365 | Bacteria | 1802 |
| 85 | Ga0070659_100095009 | 3300005366 | Bacteria | 2394 |
| 86 | Ga0070659_100152418 | 3300005366 | Bacteria | 1886 |
| 87 | Ga0070667_100061735 | 3300005367 | Bacteria | 3174 |
| 88 | Ga0070667_100150767 | 3300005367 | Bacteria | 2042 |
| 89 | Ga0070667_100330070 | 3300005367 | Bacteria | 1378 |
| 90 | Ga0070703_10018480 | 3300005406 | Bacteria | 2016 |
| 91 | Ga0070709_10000138 | 3300005434 | Bacteria | 48893 |
| 92 | Ga0070709_10000284 | 3300005434 | Bacteria | 32219 |
| 93 | Ga0070709_10006463 | 3300005434 | Bacteria | 6392 |
| 94 | Ga0070709_10008313 | 3300005434 | Bacteria | 5697 |
| 95 | Ga0070709_10094447 | 3300005434 | Unclassified | 1979 |
| 96 | Ga0070709_10103900 | 3300005434 | Bacteria | 1898 |
| 97 | Ga0070709_10507853 | 3300005434 | Bacteria | 917 |
| 98 | Ga0070714_100000128 | 3300005435 | Bacteria | 59542 |
| 99 | Ga0070714_100000964 | 3300005435 | Bacteria | 20546 |
| 100 | Ga0070714_100001380 | 3300005435 | Bacteria | 17574 |
| 101 | Ga0070714_100041133 | 3300005435 | Bacteria | 3899 |
| 102 | Ga0070714_100045433 | 3300005435 | Bacteria | 3723 |
| 103 | Ga0070714_100071511 | 3300005435 | Bacteria | 3000 |
| 104 | Ga0070714_100141677 | 3300005435 | Bacteria | 2159 |
| 105 | Ga0070714_100168614 | 3300005435 | Unclassified | 1985 |
| 106 | Ga0070714_100412219 | 3300005435 | Bacteria | 1279 |
| 107 | Ga0070714_100501985 | 3300005435 | Bacteria | 1157 |
| 108 | Ga0070713_100000078 | 3300005436 | Bacteria | 60357 |
| 109 | Ga0070713_100001287 | 3300005436 | Bacteria | 16026 |
| 110 | Ga0070713_100015810 | 3300005436 | Bacteria | 5654 |
| 111 | Ga0070713_100027774 | 3300005436 | Bacteria | 4461 |
| 112 | Ga0070713_100058215 | 3300005436 | Bacteria | 3222 |
| 113 | Ga0070713_100066236 | 3300005436 | Bacteria | 3037 |
| 114 | Ga0070713_100073285 | 3300005436 | Bacteria | 2898 |
| 115 | Ga0070713_100274140 | 3300005436 | Bacteria | 1546 |
| 116 | Ga0070713_100333833 | 3300005436 | Bacteria | 1403 |
| 117 | Ga0070710_10011043 | 3300005437 | Bacteria | 4452 |
| 118 | Ga0070710_10013235 | 3300005437 | Bacteria | 4125 |
| 119 | Ga0070710_10016006 | 3300005437 | Unclassified | 3807 |
| 120 | Ga0070710_10034866 | 3300005437 | Bacteria | 2740 |
| 121 | Ga0070710_10072144 | 3300005437 | Bacteria | 1993 |
| 122 | Ga0070701_10005359 | 3300005438 | Bacteria | 5288 |
| 123 | Ga0070701_10008092 | 3300005438 | Bacteria | 4525 |
| 124 | Ga0070711_100002946 | 3300005439 | Bacteria | 9813 |
| 125 | Ga0070711_100026494 | 3300005439 | Bacteria | 3799 |
| 126 | Ga0070711_100076371 | 3300005439 | Bacteria | 2375 |
| 127 | Ga0070711_100316937 | 3300005439 | Bacteria | 1245 |
| 128 | Ga0070711_100423604 | 3300005439 | Bacteria | 1085 |
| 129 | Ga0070705_100093720 | 3300005440 | Bacteria | 1878 |
| 130 | Ga0070705_100247030 | 3300005440 | Bacteria | 1250 |
| 131 | Ga0070700_100006840 | 3300005441 | Bacteria | 6118 |
| 132 | Ga0070700_100014725 | 3300005441 | Bacteria | 4420 |
| 133 | Ga0070700_100028019 | 3300005441 | Bacteria | 3347 |
| 134 | Ga0070700_100037943 | 3300005441 | Bacteria | 2933 |
| 135 | Ga0070700_100198422 | 3300005441 | Bacteria | 1408 |
| 136 | Ga0070700_100270103 | 3300005441 | Bacteria | 1228 |
| 137 | Ga0070694_100009124 | 3300005444 | Bacteria | 6084 |
| 138 | Ga0070694_100045358 | 3300005444 | Bacteria | 2946 |
| 139 | Ga0070694_100104867 | 3300005444 | Bacteria | 2005 |
| 140 | Ga0070694_100158916 | 3300005444 | Bacteria | 1657 |
| 141 | Ga0070694_100221918 | 3300005444 | Archaea | 1418 |
| 142 | Ga0070694_100370814 | 3300005444 | Bacteria | 1114 |
| 143 | Ga0070708_100000914 | 3300005445 | Bacteria | 22363 |
| 144 | Ga0070708_100001179 | 3300005445 | Bacteria | 20144 |
| 145 | Ga0070708_100003704 | 3300005445 | Bacteria | 11987 |
| 146 | Ga0070708_100005225 | 3300005445 | Bacteria | 10280 |
| 147 | Ga0070708_100007521 | 3300005445 | Bacteria | 8720 |
| 148 | Ga0070708_100089166 | 3300005445 | Bacteria | 2806 |
| 149 | Ga0070708_100093262 | 3300005445 | Unclassified | 2744 |
| 150 | Ga0070708_100155810 | 3300005445 | Bacteria | 2127 |
| 151 | Ga0070708_100229876 | 3300005445 | Bacteria | 1740 |
| 152 | Ga0070663_100052242 | 3300005455 | Bacteria | 2914 |
| 153 | Ga0070663_100053530 | 3300005455 | Bacteria | 2881 |
| 154 | Ga0070663_100177406 | 3300005455 | Bacteria | 1650 |
| 155 | Ga0070678_100025449 | 3300005456 | Bacteria | 3982 |
| 156 | Ga0070678_100087011 | 3300005456 | Bacteria | 2385 |
| 157 | Ga0070678_100142284 | 3300005456 | Bacteria | 1921 |
| 158 | Ga0070662_100013294 | 3300005457 | Bacteria | 5476 |
| 159 | Ga0070662_100110989 | 3300005457 | Bacteria | 2089 |
| 160 | Ga0070662_100151047 | 3300005457 | Bacteria | 1808 |
| 161 | Ga0070681_10000316 | 3300005458 | Bacteria | 39260 |
| 162 | Ga0070681_10019492 | 3300005458 | Bacteria | 6791 |
| 163 | Ga0070681_10024367 | 3300005458 | Bacteria | 6091 |
| 164 | Ga0070681_10063676 | 3300005458 | Bacteria | 3659 |
| 165 | Ga0070681_10108614 | 3300005458 | Bacteria | 2714 |
| 166 | Ga0070681_10161677 | 3300005458 | Unclassified | 2163 |
| 167 | Ga0070681_10192271 | 3300005458 | Bacteria | 1960 |
| 168 | Ga0070681_10367827 | 3300005458 | Bacteria | 1348 |
| 169 | Ga0070681_10386642 | 3300005458 | Bacteria | 1310 |
| 170 | Ga0068867_100028059 | 3300005459 | Bacteria | 4051 |
| 171 | Ga0068867_100028845 | 3300005459 | Bacteria | 3996 |
| 172 | Ga0068867_100118397 | 3300005459 | Unclassified | 2043 |
| 173 | Ga0070685_10000378 | 3300005466 | Bacteria | 26827 |
| 174 | Ga0070685_10066457 | 3300005466 | Bacteria | 2125 |
| 175 | Ga0070685_10169007 | 3300005466 | Unclassified | 1400 |
| 176 | Ga0070706_100007838 | 3300005467 | Bacteria | 9985 |
| 177 | Ga0070706_100037144 | 3300005467 | Bacteria | 4500 |
| 178 | Ga0070706_100059824 | 3300005467 | Bacteria | 3516 |
| 179 | Ga0070706_100066352 | 3300005467 | Unclassified | 3338 |
| 180 | Ga0070706_100080032 | 3300005467 | Bacteria | 3025 |
| 181 | Ga0070706_100128068 | 3300005467 | Unclassified | 2368 |
| 182 | Ga0070706_100129406 | 3300005467 | Bacteria | 2355 |
| 183 | Ga0070706_100154358 | 3300005467 | Bacteria | 2143 |
| 184 | Ga0070707_100004302 | 3300005468 | Bacteria | 13344 |
| 185 | Ga0070707_100004988 | 3300005468 | Bacteria | 12435 |
| 186 | Ga0070707_100031329 | 3300005468 | Bacteria | 5065 |
| 187 | Ga0070707_100038527 | 3300005468 | Bacteria | 4566 |
| 188 | Ga0070707_100066497 | 3300005468 | Unclassified | 3464 |
| 189 | Ga0070707_100088885 | 3300005468 | Unclassified | 2989 |
| 190 | Ga0070707_100102350 | 3300005468 | Unclassified | 2775 |
| 191 | Ga0070707_100148539 | 3300005468 | Bacteria | 2282 |
| 192 | Ga0070707_100184072 | 3300005468 | Bacteria | 2037 |
| 193 | Ga0070707_100350435 | 3300005468 | Bacteria | 1434 |
| 194 | Ga0070707_100389813 | 3300005468 | Bacteria | 1353 |
| 195 | Ga0070698_100001727 | 3300005471 | Bacteria | 24362 |
| 196 | Ga0070698_100009756 | 3300005471 | Bacteria | 10262 |
| 197 | Ga0070698_100010307 | 3300005471 | Bacteria | 9975 |
| 198 | Ga0070698_100038875 | 3300005471 | Bacteria | 4903 |
| 199 | Ga0070698_100077931 | 3300005471 | Bacteria | 3313 |
| 200 | Ga0070698_100093117 | 3300005471 | Bacteria | 2994 |
| 201 | Ga0070698_100216070 | 3300005471 | Bacteria | 1851 |
| 202 | Ga0070699_100000032 | 3300005518 | Bacteria | 136937 |
| 203 | Ga0070699_100003470 | 3300005518 | Bacteria | 13941 |
| 204 | Ga0070699_100049485 | 3300005518 | Bacteria | 3638 |
| 205 | Ga0070699_100290839 | 3300005518 | Bacteria | 1465 |
| 206 | Ga0070699_100424565 | 3300005518 | Bacteria | 1204 |
| 207 | Ga0070679_100013063 | 3300005530 | Bacteria | 7950 |
| 208 | Ga0070679_100022833 | 3300005530 | Bacteria | 6119 |
| 209 | Ga0070679_100055041 | 3300005530 | Bacteria | 3962 |
| 210 | Ga0070679_100061284 | 3300005530 | Bacteria | 3749 |
| 211 | Ga0070679_100123379 | 3300005530 | Bacteria | 2574 |
| 212 | Ga0070679_100213856 | 3300005530 | Bacteria | 1891 |
| 213 | Ga0070684_100166371 | 3300005535 | Bacteria | 2002 |
| 214 | Ga0070684_100204154 | 3300005535 | Bacteria | 1801 |
| 215 | Ga0070697_100000428 | 3300005536 | Bacteria | 32306 |
| 216 | Ga0070697_100000479 | 3300005536 | Bacteria | 30367 |
| 217 | Ga0070697_100001200 | 3300005536 | Bacteria | 19608 |
| 218 | Ga0070697_100002510 | 3300005536 | Bacteria | 14112 |
| 219 | Ga0070697_100003271 | 3300005536 | Bacteria | 12441 |
| 220 | Ga0070697_100004305 | 3300005536 | Bacteria | 10920 |
| 221 | Ga0070697_100004317 | 3300005536 | Bacteria | 10906 |
| 222 | Ga0070697_100062386 | 3300005536 | Bacteria | 3042 |
| 223 | Ga0070697_100076557 | 3300005536 | Bacteria | 2751 |
| 224 | Ga0070697_100166873 | 3300005536 | Bacteria | 1862 |
| 225 | Ga0070697_100171833 | 3300005536 | Bacteria | 1835 |
| 226 | Ga0070697_100276544 | 3300005536 | Bacteria | 1440 |
| 227 | Ga0068853_100004139 | 3300005539 | Bacteria | 11180 |
| 228 | Ga0068853_100057764 | 3300005539 | Bacteria | 3349 |
| 229 | Ga0068853_100256588 | 3300005539 | Bacteria | 1606 |
| 230 | Ga0070672_100021325 | 3300005543 | Bacteria | 4738 |
| 231 | Ga0070672_100056314 | 3300005543 | Bacteria | 3083 |
| 232 | Ga0070672_100124504 | 3300005543 | Bacteria | 2113 |
| 233 | Ga0070672_100623196 | 3300005543 | Bacteria | 941 |
| 234 | Ga0070686_100007438 | 3300005544 | Bacteria | 6112 |
| 235 | Ga0070686_100013723 | 3300005544 | Bacteria | 4647 |
| 236 | Ga0070686_100015353 | 3300005544 | Bacteria | 4434 |
| 237 | Ga0070686_100041957 | 3300005544 | Bacteria | 2863 |
| 238 | Ga0070695_100006597 | 3300005545 | Bacteria | 6857 |
| 239 | Ga0070695_100038397 | 3300005545 | Bacteria | 3022 |
| 240 | Ga0070695_100066418 | 3300005545 | Bacteria | 2351 |
| 241 | Ga0070695_100126961 | 3300005545 | Bacteria | 1753 |
| 242 | Ga0070695_100144769 | 3300005545 | Bacteria | 1652 |
| 243 | Ga0070695_100215928 | 3300005545 | Unclassified | 1379 |
| 244 | Ga0070696_100034145 | 3300005546 | Bacteria | 3498 |
| 245 | Ga0070696_100093054 | 3300005546 | Bacteria | 2149 |
| 246 | Ga0070696_100424811 | 3300005546 | Bacteria | 1044 |
| 247 | Ga0070693_100085459 | 3300005547 | Bacteria | 1891 |
| 248 | Ga0070693_100158117 | 3300005547 | Bacteria | 1441 |
| 249 | Ga0070693_100165662 | 3300005547 | Bacteria | 1411 |
| 250 | Ga0070665_100008875 | 3300005548 | Bacteria | 10180 |
| 251 | Ga0070665_100208839 | 3300005548 | Bacteria | 1953 |
| 252 | Ga0070665_100379949 | 3300005548 | Bacteria | 1420 |
| 253 | Ga0070665_100459018 | 3300005548 | Unclassified | 1284 |
| 254 | Ga0070704_100027044 | 3300005549 | Bacteria | 3798 |
| 255 | Ga0070704_100066641 | 3300005549 | Bacteria | 2597 |
| 256 | Ga0070704_100103796 | 3300005549 | Bacteria | 2148 |
| 257 | Ga0070704_100291910 | 3300005549 | Bacteria | 1355 |
| 258 | Ga0068855_100000903 | 3300005563 | Bacteria | 36808 |
| 259 | Ga0068855_100017182 | 3300005563 | Bacteria | 8706 |
| 260 | Ga0068855_100041333 | 3300005563 | Bacteria | 5465 |
| 261 | Ga0068855_100047134 | 3300005563 | Bacteria | 5093 |
| 262 | Ga0068855_100192496 | 3300005563 | Unclassified | 2299 |
| 263 | Ga0068855_100291299 | 3300005563 | Bacteria | 1810 |
| 264 | Ga0070664_100004347 | 3300005564 | Bacteria | 11391 |
| 265 | Ga0070664_100110920 | 3300005564 | Bacteria | 2394 |
| 266 | Ga0070664_100119683 | 3300005564 | Bacteria | 2304 |
| 267 | Ga0070664_100225971 | 3300005564 | Bacteria | 1676 |
| 268 | Ga0070664_100477855 | 3300005564 | Bacteria | 1147 |
| 269 | Ga0068857_100001669 | 3300005577 | Bacteria | 17823 |
| 270 | Ga0068857_100002037 | 3300005577 | Bacteria | 16381 |
| 271 | Ga0068857_100005829 | 3300005577 | Bacteria | 10518 |
| 272 | Ga0068857_100038279 | 3300005577 | Bacteria | 4247 |
| 273 | Ga0068857_100300639 | 3300005577 | Bacteria | 1479 |
| 274 | Ga0068854_100025404 | 3300005578 | Bacteria | 4064 |
| 275 | Ga0068854_100070415 | 3300005578 | Bacteria | 2556 |
| 276 | Ga0068854_100117898 | 3300005578 | Bacteria | 2011 |
| 277 | Ga0068854_100126733 | 3300005578 | Bacteria | 1945 |
| 278 | Ga0068854_100187955 | 3300005578 | Bacteria | 1617 |
| 279 | Ga0068856_100001036 | 3300005614 | Bacteria | 29524 |
| 280 | Ga0068856_100001068 | 3300005614 | Bacteria | 29002 |
| 281 | Ga0068856_100001357 | 3300005614 | Bacteria | 25723 |
| 282 | Ga0068856_100012625 | 3300005614 | Bacteria | 8178 |
| 283 | Ga0068856_100019468 | 3300005614 | Bacteria | 6588 |
| 284 | Ga0068856_100025885 | 3300005614 | Bacteria | 5722 |
| 285 | Ga0068856_100045193 | 3300005614 | Bacteria | 4335 |
| 286 | Ga0070702_100013317 | 3300005615 | Bacteria | 4150 |
| 287 | Ga0070702_100014022 | 3300005615 | Bacteria | 4060 |
| 288 | Ga0070702_100222012 | 3300005615 | Unclassified | 1264 |
| 289 | Ga0068852_100030169 | 3300005616 | Bacteria | 4461 |
| 290 | Ga0068859_100003538 | 3300005617 | Bacteria | 15905 |
| 291 | Ga0068859_100018857 | 3300005617 | Bacteria | 6932 |
| 292 | Ga0068859_100021411 | 3300005617 | Bacteria | 6489 |
| 293 | Ga0068859_100062847 | 3300005617 | Bacteria | 3743 |
| 294 | Ga0068859_100138415 | 3300005617 | Bacteria | 2508 |
| 295 | Ga0068859_100199275 | 3300005617 | Bacteria | 2086 |
| 296 | Ga0068859_100236779 | 3300005617 | Bacteria | 1914 |
| 297 | Ga0068859_100239035 | 3300005617 | Bacteria | 1905 |
| 298 | Ga0068859_100303399 | 3300005617 | Bacteria | 1690 |
| 299 | Ga0068864_100004582 | 3300005618 | Bacteria | 11344 |
| 300 | Ga0068864_100012500 | 3300005618 | Bacteria | 7018 |
| 301 | Ga0068864_100091337 | 3300005618 | Bacteria | 2686 |
| 302 | Ga0068864_100100596 | 3300005618 | Bacteria | 2563 |
| 303 | Ga0068864_100156145 | 3300005618 | Bacteria | 2071 |
| 304 | Ga0068864_100208715 | 3300005618 | Bacteria | 1798 |
| 305 | Ga0068864_100266991 | 3300005618 | Bacteria | 1593 |
| 306 | Ga0068866_10005122 | 3300005718 | Bacteria | 5400 |
| 307 | Ga0068866_10006386 | 3300005718 | Bacteria | 4909 |
| 308 | Ga0068866_10148649 | 3300005718 | Bacteria | 1354 |
| 309 | Ga0068861_100006187 | 3300005719 | Bacteria | 8145 |
| 310 | Ga0068861_100052119 | 3300005719 | Bacteria | 3109 |
| 311 | Ga0068861_100095984 | 3300005719 | Bacteria | 2349 |
| 312 | Ga0068861_100291103 | 3300005719 | Bacteria | 1410 |
| 313 | Ga0068861_100492082 | 3300005719 | Bacteria | 1107 |
| 314 | Ga0068851_10073749 | 3300005834 | Bacteria | 1771 |
| 315 | Ga0068851_10195981 | 3300005834 | Unclassified | 1125 |
| 316 | Ga0068870_10005374 | 3300005840 | Bacteria | 5588 |
| 317 | Ga0068870_10022812 | 3300005840 | Bacteria | 3079 |
| 318 | Ga0068863_100008428 | 3300005841 | Bacteria | 10067 |
| 319 | Ga0068863_100010732 | 3300005841 | Bacteria | 8893 |
| 320 | Ga0068863_100032630 | 3300005841 | Bacteria | 4962 |
| 321 | Ga0068863_100042988 | 3300005841 | Bacteria | 4291 |
| 322 | Ga0068863_100048556 | 3300005841 | Bacteria | 4025 |
| 323 | Ga0068863_100055256 | 3300005841 | Bacteria | 3760 |
| 324 | Ga0068863_100060795 | 3300005841 | Unclassified | 3573 |
| 325 | Ga0068863_100070541 | 3300005841 | Bacteria | 3304 |
| 326 | Ga0068863_100142658 | 3300005841 | Bacteria | 2290 |
| 327 | Ga0068863_100435118 | 3300005841 | Bacteria | 1286 |
| 328 | Ga0068863_100484517 | 3300005841 | Bacteria | 1217 |
| 329 | Ga0068858_100000863 | 3300005842 | Bacteria | 31399 |
| 330 | Ga0068858_100013745 | 3300005842 | Bacteria | 7641 |
| 331 | Ga0068858_100014686 | 3300005842 | Bacteria | 7372 |
| 332 | Ga0068858_100030709 | 3300005842 | Bacteria | 4990 |
| 333 | Ga0068858_100039269 | 3300005842 | Bacteria | 4390 |
| 334 | Ga0068858_100053226 | 3300005842 | Bacteria | 3745 |
| 335 | Ga0068858_100067270 | 3300005842 | Bacteria | 3318 |
| 336 | Ga0068858_100081587 | 3300005842 | Bacteria | 3006 |
| 337 | Ga0068858_100117911 | 3300005842 | Bacteria | 2481 |
| 338 | Ga0068858_100470988 | 3300005842 | Bacteria | 1212 |
| 339 | Ga0068860_100001845 | 3300005843 | Bacteria | 22552 |
| 340 | Ga0068860_100102787 | 3300005843 | Bacteria | 2727 |
| 341 | Ga0068860_100146864 | 3300005843 | Bacteria | 2269 |
| 342 | Ga0068860_100263395 | 3300005843 | Bacteria | 1681 |
| 343 | Ga0068860_100420973 | 3300005843 | Bacteria | 1324 |
| 344 | Ga0068860_100621445 | 3300005843 | Bacteria | 1087 |
| 345 | Ga0068862_100117465 | 3300005844 | Bacteria | 2341 |
| 346 | Ga0068862_100153161 | 3300005844 | Bacteria | 2053 |
| 347 | Ga0070717_10001077 | 3300006028 | Bacteria | 18344 |
| 348 | Ga0070717_10001266 | 3300006028 | Bacteria | 17259 |
| 349 | Ga0070717_10003483 | 3300006028 | Bacteria | 11275 |
| 350 | Ga0070717_10006090 | 3300006028 | Bacteria | 8854 |
| 351 | Ga0070717_10006698 | 3300006028 | Bacteria | 8497 |
| 352 | Ga0070717_10023366 | 3300006028 | Unclassified | 4897 |
| 353 | Ga0070717_10046031 | 3300006028 | Bacteria | 3568 |
| 354 | Ga0070717_10061714 | 3300006028 | Bacteria | 3107 |
| 355 | Ga0070717_10063108 | 3300006028 | Bacteria | 3074 |
| 356 | Ga0070717_10069440 | 3300006028 | Bacteria | 2934 |
| 357 | Ga0070717_10130057 | 3300006028 | Bacteria | 2164 |
| 358 | Ga0070717_10159781 | 3300006028 | Bacteria | 1954 |
| 359 | Ga0070717_10288595 | 3300006028 | Bacteria | 1456 |
| 360 | Ga0070717_10495451 | 3300006028 | Bacteria | 1104 |
| 361 | Ga0070717_10658407 | 3300006028 | Unclassified | 951 |
| 362 | Ga0075365_10000429 | 3300006038 | Bacteria | 15576 |
| 363 | Ga0075365_10091326 | 3300006038 | Bacteria | 2075 |
| 364 | Ga0075365_10109191 | 3300006038 | Bacteria | 1900 |
| 365 | Ga0075368_10032852 | 3300006042 | Bacteria | 2017 |
| 366 | Ga0075364_10000947 | 3300006051 | Bacteria | 15319 |
| 367 | Ga0075364_10026447 | 3300006051 | Bacteria | 3702 |
| 368 | Ga0070715_10001890 | 3300006163 | Bacteria | 6278 |
| 369 | Ga0070715_10002920 | 3300006163 | Bacteria | 5336 |
| 370 | Ga0070715_10004444 | 3300006163 | Bacteria | 4603 |
| 371 | Ga0070715_10068834 | 3300006163 | Bacteria | 1575 |
| 372 | Ga0070716_100000779 | 3300006173 | Bacteria | 13663 |
| 373 | Ga0070716_100006385 | 3300006173 | Bacteria | 5756 |
| 374 | Ga0070716_100009249 | 3300006173 | Bacteria | 4910 |
| 375 | Ga0070716_100024016 | 3300006173 | Bacteria | 3241 |
| 376 | Ga0070716_100069019 | 3300006173 | Bacteria | 2070 |
| 377 | Ga0070716_100104326 | 3300006173 | Bacteria | 1745 |
| 378 | Ga0070716_100183016 | 3300006173 | Bacteria | 1377 |
| 379 | Ga0070716_100213333 | 3300006173 | Bacteria | 1292 |
| 380 | Ga0070716_100217950 | 3300006173 | Bacteria | 1280 |
| 381 | Ga0070716_100290949 | 3300006173 | Bacteria | 1132 |
| 382 | Ga0070712_100000047 | 3300006175 | Bacteria | 65314 |
| 383 | Ga0070712_100000914 | 3300006175 | Bacteria | 17695 |
| 384 | Ga0070712_100001184 | 3300006175 | Bacteria | 15748 |
| 385 | Ga0070712_100007837 | 3300006175 | Bacteria | 6689 |
| 386 | Ga0070712_100012588 | 3300006175 | Bacteria | 5380 |
| 387 | Ga0070712_100166529 | 3300006175 | Bacteria | 1707 |
| 388 | Ga0075362_10001899 | 3300006177 | Bacteria | 6859 |
| 389 | Ga0075367_10033942 | 3300006178 | Bacteria | 2944 |
| 390 | Ga0075366_10001679 | 3300006195 | Bacteria | 11111 |
| 391 | Ga0075366_10012914 | 3300006195 | Bacteria | 4747 |
| 392 | Ga0097621_100000216 | 3300006237 | Bacteria | 38151 |
| 393 | Ga0097621_100005019 | 3300006237 | Bacteria | 9288 |
| 394 | Ga0097621_100005239 | 3300006237 | Bacteria | 9121 |
| 395 | Ga0097621_100012248 | 3300006237 | Bacteria | 6347 |
| 396 | Ga0097621_100058175 | 3300006237 | Bacteria | 3163 |
| 397 | Ga0097621_100066986 | 3300006237 | Bacteria | 2959 |
| 398 | Ga0097621_100130792 | 3300006237 | Bacteria | 2137 |
| 399 | Ga0097621_100190453 | 3300006237 | Bacteria | 1776 |
| 400 | Ga0075370_10017085 | 3300006353 | Bacteria | 3916 |
| 401 | Ga0068871_100000149 | 3300006358 | Bacteria | 46054 |
| 402 | Ga0068871_100000182 | 3300006358 | Bacteria | 42634 |
| 403 | Ga0068871_100007539 | 3300006358 | Bacteria | 7783 |
| 404 | Ga0068871_100011744 | 3300006358 | Bacteria | 6434 |
| 405 | Ga0068871_100120248 | 3300006358 | Bacteria | 2218 |
| 406 | Ga0068871_100138512 | 3300006358 | Bacteria | 2068 |
| 407 | Ga0068871_100294310 | 3300006358 | Bacteria | 1423 |
| 408 | Ga0068871_100356545 | 3300006358 | Bacteria | 1295 |
| 409 | Ga0068871_100422980 | 3300006358 | Bacteria | 1190 |
| 410 | Ga0075428_100010054 | 3300006844 | Bacteria | 10511 |
| 411 | Ga0075428_100037185 | 3300006844 | Bacteria | 5360 |
| 412 | Ga0075428_100043709 | 3300006844 | Bacteria | 4926 |
| 413 | Ga0075428_100044305 | 3300006844 | Bacteria | 4889 |
| 414 | Ga0075428_100058957 | 3300006844 | Bacteria | 4204 |
| 415 | Ga0075428_100070197 | 3300006844 | Bacteria | 3830 |
| 416 | Ga0075428_100074509 | 3300006844 | Bacteria | 3708 |
| 417 | Ga0075428_100120095 | 3300006844 | Bacteria | 2861 |
| 418 | Ga0075428_100126601 | 3300006844 | Bacteria | 2780 |
| 419 | Ga0075428_100178364 | 3300006844 | Unclassified | 2300 |
| 420 | Ga0075428_100201184 | 3300006844 | Bacteria | 2153 |
| 421 | Ga0075428_100222194 | 3300006844 | Bacteria | 2039 |
| 422 | Ga0075428_100233383 | 3300006844 | Bacteria | 1985 |
| 423 | Ga0075428_100267706 | 3300006844 | Bacteria | 1839 |
| 424 | Ga0075430_100042326 | 3300006846 | Bacteria | 3852 |
| 425 | Ga0075430_100052081 | 3300006846 | Bacteria | 3447 |
| 426 | Ga0075430_100119035 | 3300006846 | Bacteria | 2201 |
| 427 | Ga0075430_100126973 | 3300006846 | Bacteria | 2126 |
| 428 | Ga0075431_100000894 | 3300006847 | Bacteria | 26330 |
| 429 | Ga0075431_100001697 | 3300006847 | Bacteria | 20698 |
| 430 | Ga0075431_100017096 | 3300006847 | Bacteria | 7370 |
| 431 | Ga0075431_100028432 | 3300006847 | Bacteria | 5746 |
| 432 | Ga0075431_100057498 | 3300006847 | Bacteria | 4012 |
| 433 | Ga0075431_100199680 | 3300006847 | Unclassified | 2046 |
| 434 | Ga0075433_10004042 | 3300006852 | Bacteria | 11352 |
| 435 | Ga0075433_10004179 | 3300006852 | Bacteria | 11208 |
| 436 | Ga0075433_10007296 | 3300006852 | Bacteria | 8767 |
| 437 | Ga0075433_10074069 | 3300006852 | Bacteria | 2996 |
| 438 | Ga0075433_10096949 | 3300006852 | Unclassified | 2610 |
| 439 | Ga0075433_10159143 | 3300006852 | Bacteria | 2010 |
| 440 | Ga0075433_10305236 | 3300006852 | Bacteria | 1409 |
| 441 | Ga0075433_10455798 | 3300006852 | Bacteria | 1127 |
| 442 | Ga0075434_100000987 | 3300006871 | Bacteria | 23010 |
| 443 | Ga0075434_100005262 | 3300006871 | Bacteria | 11760 |
| 444 | Ga0075434_100007333 | 3300006871 | Bacteria | 10206 |
| 445 | Ga0075434_100014060 | 3300006871 | Bacteria | 7642 |
| 446 | Ga0075434_100014264 | 3300006871 | Bacteria | 7593 |
| 447 | Ga0075434_100016262 | 3300006871 | Bacteria | 7151 |
| 448 | Ga0075434_100018693 | 3300006871 | Bacteria | 6696 |
| 449 | Ga0075434_100023184 | 3300006871 | Bacteria | 6047 |
| 450 | Ga0075434_100028761 | 3300006871 | Bacteria | 5465 |
| 451 | Ga0075434_100063412 | 3300006871 | Bacteria | 3678 |
| 452 | Ga0075434_100084855 | 3300006871 | Bacteria | 3166 |
| 453 | Ga0075434_100169274 | 3300006871 | Bacteria | 2205 |
| 454 | Ga0075434_100215449 | 3300006871 | Bacteria | 1940 |
| 455 | Ga0075434_100450959 | 3300006871 | Bacteria | 1308 |
| 456 | Ga0075429_100001963 | 3300006880 | Bacteria | 17082 |
| 457 | Ga0075429_100012743 | 3300006880 | Bacteria | 7293 |
| 458 | Ga0075429_100023159 | 3300006880 | Bacteria | 5386 |
| 459 | Ga0075429_100033426 | 3300006880 | Bacteria | 4469 |
| 460 | Ga0075429_100038554 | 3300006880 | Bacteria | 4160 |
| 461 | Ga0075429_100077611 | 3300006880 | Bacteria | 2894 |
| 462 | Ga0075429_100077751 | 3300006880 | Bacteria | 2891 |
| 463 | Ga0075429_100208098 | 3300006880 | Bacteria | 1714 |
| 464 | Ga0075429_100235784 | 3300006880 | Bacteria | 1603 |
| 465 | Ga0075429_100251579 | 3300006880 | Bacteria | 1547 |
| 466 | Ga0068865_100007294 | 3300006881 | Bacteria | 6793 |
| 467 | Ga0068865_100038170 | 3300006881 | Bacteria | 3249 |
| 468 | Ga0068865_100079007 | 3300006881 | Bacteria | 2355 |
| 469 | Ga0075436_100002937 | 3300006914 | Bacteria | 11689 |
| 470 | Ga0075436_100017840 | 3300006914 | Bacteria | 4859 |
| 471 | Ga0075436_100026209 | 3300006914 | Bacteria | 4013 |
| 472 | Ga0075436_100043133 | 3300006914 | Bacteria | 3110 |
| 473 | Ga0075436_100059276 | 3300006914 | Unclassified | 2644 |
| 474 | Ga0075436_100064009 | 3300006914 | Bacteria | 2542 |
| 475 | Ga0097620_100003538 | 3300006931 | Bacteria | 15905 |
| 476 | Ga0097620_100018858 | 3300006931 | Bacteria | 6932 |
| 477 | Ga0097620_100021409 | 3300006931 | Bacteria | 6489 |
| 478 | Ga0097620_100062854 | 3300006931 | Bacteria | 3743 |
| 479 | Ga0097620_100138407 | 3300006931 | Bacteria | 2508 |
| 480 | Ga0097620_100199273 | 3300006931 | Bacteria | 2086 |
| 481 | Ga0097620_100236782 | 3300006931 | Bacteria | 1914 |
| 482 | Ga0097620_100239021 | 3300006931 | Bacteria | 1905 |
| 483 | Ga0097620_100303404 | 3300006931 | Bacteria | 1690 |
| 484 | Ga0075435_100000105 | 3300007076 | Bacteria | 45736 |
| 485 | Ga0075435_100003136 | 3300007076 | Bacteria | 11167 |
| 486 | Ga0075435_100020470 | 3300007076 | Bacteria | 5071 |
| 487 | Ga0075435_100034710 | 3300007076 | Bacteria | 3999 |
| 488 | Ga0075435_100136088 | 3300007076 | Unclassified | 2058 |
| 489 | Ga0075435_100138133 | 3300007076 | Bacteria | 2043 |
| 490 | Ga0075435_100288157 | 3300007076 | Bacteria | 1403 |
| 491 | Ga0075435_100421035 | 3300007076 | Bacteria | 1150 |
| 492 | Ga0099794_10005644 | 3300007265 | Bacteria | 5036 |
| 493 | Ga0099794_10074530 | 3300007265 | Bacteria | 1667 |
| 494 | Ga0099794_10107237 | 3300007265 | Unclassified | 1397 |
| 495 | Ga0099794_10113625 | 3300007265 | Bacteria | 1358 |
| 496 | Ga0099795_10029118 | 3300007788 | Bacteria | 1885 |
| 497 | Ga0105240_10031012 | 3300009093 | Bacteria | 6938 |
| 498 | Ga0105240_10041881 | 3300009093 | Bacteria | 5840 |
| 499 | Ga0105240_10073003 | 3300009093 | Bacteria | 4238 |
| 500 | Ga0105240_10073406 | 3300009093 | Bacteria | 4224 |
| 501 | Ga0105240_10128137 | 3300009093 | Unclassified | 3047 |
| 502 | Ga0105240_10147534 | 3300009093 | Bacteria | 2805 |
| 503 | Ga0105240_10387765 | 3300009093 | Bacteria | 1576 |
| 504 | Ga0105240_10591779 | 3300009093 | Bacteria | 1222 |
| 505 | Ga0111539_10002268 | 3300009094 | Bacteria | 25594 |
| 506 | Ga0111539_10021616 | 3300009094 | Bacteria | 7914 |
| 507 | Ga0111539_10041896 | 3300009094 | Bacteria | 5501 |
| 508 | Ga0111539_10062047 | 3300009094 | Bacteria | 4426 |
| 509 | Ga0111539_10067230 | 3300009094 | Bacteria | 4232 |
| 510 | Ga0111539_10158272 | 3300009094 | Bacteria | 2650 |
| 511 | Ga0111539_10208377 | 3300009094 | Bacteria | 2278 |
| 512 | Ga0111539_10209069 | 3300009094 | Bacteria | 2274 |
| 513 | Ga0111539_10252493 | 3300009094 | Bacteria | 2053 |
| 514 | Ga0111539_10320090 | 3300009094 | Bacteria | 1805 |
| 515 | Ga0111539_10452042 | 3300009094 | Bacteria | 1496 |
| 516 | Ga0105245_10000595 | 3300009098 | Bacteria | 32685 |
| 517 | Ga0105245_10001513 | 3300009098 | Bacteria | 21071 |
| 518 | Ga0105245_10030639 | 3300009098 | Bacteria | 4758 |
| 519 | Ga0105247_10021352 | 3300009101 | Bacteria | 3896 |
| 520 | Ga0105247_10188822 | 3300009101 | Archaea | 1379 |
| 521 | Ga0114129_10000027 | 3300009147 | Bacteria | 112969 |
| 522 | Ga0114129_10000183 | 3300009147 | Bacteria | 69906 |
| 523 | Ga0114129_10005840 | 3300009147 | Bacteria | 17432 |
| 524 | Ga0114129_10008305 | 3300009147 | Bacteria | 14814 |
| 525 | Ga0114129_10025642 | 3300009147 | Bacteria | 8352 |
| 526 | Ga0114129_10027882 | 3300009147 | Bacteria | 7997 |
| 527 | Ga0114129_10040995 | 3300009147 | Bacteria | 6525 |
| 528 | Ga0114129_10077296 | 3300009147 | Bacteria | 4630 |
| 529 | Ga0114129_10091712 | 3300009147 | Bacteria | 4208 |
| 530 | Ga0114129_10107223 | 3300009147 | Unclassified | 3859 |
| 531 | Ga0114129_10112098 | 3300009147 | Bacteria | 3762 |
| 532 | Ga0114129_10137473 | 3300009147 | Bacteria | 3352 |
| 533 | Ga0114129_10146134 | 3300009147 | Bacteria | 3239 |
| 534 | Ga0114129_10331302 | 3300009147 | Bacteria | 2021 |
| 535 | Ga0114129_10370902 | 3300009147 | Bacteria | 1892 |
| 536 | Ga0114129_10406793 | 3300009147 | Bacteria | 1793 |
| 537 | Ga0105243_10007785 | 3300009148 | Bacteria | 8238 |
| 538 | Ga0105241_10002493 | 3300009174 | Bacteria | 13835 |
| 539 | Ga0105241_10003544 | 3300009174 | Bacteria | 11615 |
| 540 | Ga0105241_10041643 | 3300009174 | Unclassified | 3472 |
| 541 | Ga0105241_10113739 | 3300009174 | Unclassified | 2170 |
| 542 | Ga0105241_10334867 | 3300009174 | Unclassified | 1309 |
| 543 | Ga0105242_10024581 | 3300009176 | Bacteria | 4759 |
| 544 | Ga0105242_10072798 | 3300009176 | Bacteria | 2855 |
| 545 | Ga0105242_10391738 | 3300009176 | Bacteria | 1294 |
| 546 | Ga0105248_10007674 | 3300009177 | Bacteria | 11857 |
| 547 | Ga0105248_10010838 | 3300009177 | Bacteria | 10065 |
| 548 | Ga0105248_10014674 | 3300009177 | Bacteria | 8622 |
| 549 | Ga0105248_10015732 | 3300009177 | Bacteria | 8338 |
| 550 | Ga0105248_10073972 | 3300009177 | Bacteria | 3830 |
| 551 | Ga0105248_10074281 | 3300009177 | Bacteria | 3821 |
| 552 | Ga0105248_10589686 | 3300009177 | Bacteria | 1254 |
| 553 | Ga0105237_10054290 | 3300009545 | Bacteria | 4015 |
| 554 | Ga0105237_10075899 | 3300009545 | Bacteria | 3352 |
| 555 | Ga0105237_10082202 | 3300009545 | Bacteria | 3212 |
| 556 | Ga0105237_10569626 | 3300009545 | Bacteria | 1139 |
| 557 | Ga0105237_10577160 | 3300009545 | Bacteria | 1131 |
| 558 | Ga0105238_10044311 | 3300009551 | Bacteria | 4498 |
| 559 | Ga0105238_10209625 | 3300009551 | Bacteria | 1924 |
| 560 | Ga0105238_10283116 | 3300009551 | Bacteria | 1639 |
| 561 | Ga0105238_10440790 | 3300009551 | Bacteria | 1299 |
| 562 | Ga0105249_10017814 | 3300009553 | Bacteria | 6311 |
| 563 | Ga0105249_10076406 | 3300009553 | Bacteria | 3104 |
| 564 | Ga0105249_10198628 | 3300009553 | Bacteria | 1962 |
| 565 | Ga0105249_10210392 | 3300009553 | Bacteria | 1908 |
| 566 | Ga0105249_10461220 | 3300009553 | Bacteria | 1311 |
| 567 | Ga0099796_10019613 | 3300010159 | Unclassified | 2053 |
| 568 | Ga0105239_10078320 | 3300010375 | Bacteria | 3637 |
| 569 | Ga0105239_10090363 | 3300010375 | Bacteria | 3378 |
| 570 | Ga0105239_10235811 | 3300010375 | Bacteria | 2053 |
| 571 | Ga0105239_10377531 | 3300010375 | Bacteria | 1602 |
| 572 | Ga0105246_10026331 | 3300011119 | Bacteria | 3798 |
| 573 | Ga0105246_10034089 | 3300011119 | Bacteria | 3388 |
| 574 | Ga0105246_10108039 | 3300011119 | Bacteria | 2039 |
| 575 | Ga0157373_10004228 | 3300013100 | Bacteria | 10836 |
| 576 | Ga0157373_10059701 | 3300013100 | Bacteria | 2702 |
| 577 | Ga0157373_10073908 | 3300013100 | Bacteria | 2405 |
| 578 | Ga0157373_10090650 | 3300013100 | Bacteria | 2153 |
| 579 | Ga0157373_10334940 | 3300013100 | Bacteria | 1078 |
| 580 | Ga0157371_10044461 | 3300013102 | Bacteria | 3162 |
| 581 | Ga0157370_10009209 | 3300013104 | Bacteria | 10585 |
| 582 | Ga0157370_10368753 | 3300013104 | Bacteria | 1323 |
| 583 | Ga0157369_10001537 | 3300013105 | Bacteria | 28258 |
| 584 | Ga0157369_10002128 | 3300013105 | Bacteria | 23882 |
| 585 | Ga0157369_10010332 | 3300013105 | Bacteria | 10645 |
| 586 | Ga0157369_10011085 | 3300013105 | Bacteria | 10256 |
| 587 | Ga0157369_10121476 | 3300013105 | Bacteria | 2771 |
| 588 | Ga0157369_10190717 | 3300013105 | Bacteria | 2154 |
| 589 | Ga0157369_10294183 | 3300013105 | Bacteria | 1690 |
| 590 | Ga0157369_10363681 | 3300013105 | Bacteria | 1502 |
| 591 | Ga0157374_10000090 | 3300013296 | Bacteria | 88789 |
| 592 | Ga0157374_10000483 | 3300013296 | Bacteria | 36023 |
| 593 | Ga0157374_10000804 | 3300013296 | Bacteria | 27523 |
| 594 | Ga0157374_10027327 | 3300013296 | Bacteria | 5144 |
| 595 | Ga0157374_10116821 | 3300013296 | Unclassified | 2571 |
| 596 | Ga0157374_10251098 | 3300013296 | Bacteria | 1741 |
| 597 | Ga0157378_10000070 | 3300013297 | Bacteria | 91609 |
| 598 | Ga0157378_10000487 | 3300013297 | Bacteria | 37522 |
| 599 | Ga0157378_10002859 | 3300013297 | Bacteria | 15406 |
| 600 | Ga0157378_10042068 | 3300013297 | Bacteria | 4054 |
| 601 | Ga0157378_10108888 | 3300013297 | Bacteria | 2537 |
| 602 | Ga0157378_10219858 | 3300013297 | Bacteria | 1805 |
| 603 | Ga0163162_10123571 | 3300013306 | Bacteria | 2694 |
| 604 | Ga0157372_10000211 | 3300013307 | Bacteria | 65258 |
| 605 | Ga0157372_10002476 | 3300013307 | Bacteria | 20009 |
| 606 | Ga0157372_10008246 | 3300013307 | Bacteria | 11076 |
| 607 | Ga0157372_10009031 | 3300013307 | Bacteria | 10594 |
| 608 | Ga0157372_10009482 | 3300013307 | Bacteria | 10352 |
| 609 | Ga0157372_10036083 | 3300013307 | Bacteria | 5447 |
| 610 | Ga0157372_10045292 | 3300013307 | Unclassified | 4879 |
| 611 | Ga0157372_10090650 | 3300013307 | Bacteria | 3476 |
| 612 | Ga0157372_10093403 | 3300013307 | Bacteria | 3424 |
| 613 | Ga0157372_10110928 | 3300013307 | Bacteria | 3142 |
| 614 | Ga0157372_10143748 | 3300013307 | Bacteria | 2751 |
| 615 | Ga0157372_10244051 | 3300013307 | Bacteria | 2084 |
| 616 | Ga0157372_10827777 | 3300013307 | Bacteria | 1075 |
| 617 | Ga0157375_10080338 | 3300013308 | Bacteria | 3299 |
| 618 | Ga0157375_10116181 | 3300013308 | Bacteria | 2780 |
| 619 | Ga0163163_10000034 | 3300014325 | Bacteria | 161820 |
| 620 | Ga0163163_10001046 | 3300014325 | Bacteria | 23422 |
| 621 | Ga0163163_10003961 | 3300014325 | Bacteria | 12643 |
| 622 | Ga0163163_10038058 | 3300014325 | Bacteria | 4684 |
| 623 | Ga0163163_10068514 | 3300014325 | Bacteria | 3531 |
| 624 | Ga0163163_10193586 | 3300014325 | Bacteria | 2081 |
| 625 | Ga0163163_10370274 | 3300014325 | Bacteria | 1490 |
| 626 | Ga0163163_10465775 | 3300014325 | Bacteria | 1324 |
| 627 | Ga0157380_10003290 | 3300014326 | Bacteria | 11079 |
| 628 | Ga0157380_10008166 | 3300014326 | Bacteria | 7457 |
| 629 | Ga0157380_10055678 | 3300014326 | Bacteria | 3142 |
| 630 | Ga0157380_10083337 | 3300014326 | Bacteria | 2619 |
| 631 | Ga0157380_10179700 | 3300014326 | Bacteria | 1858 |
| 632 | Ga0157380_10263977 | 3300014326 | Bacteria | 1566 |
| 633 | Ga0157380_10403349 | 3300014326 | Bacteria | 1298 |
| 634 | Ga0182008_10127067 | 3300014497 | Bacteria | 1270 |
| 635 | Ga0157377_10003510 | 3300014745 | Bacteria | 7093 |
| 636 | Ga0157377_10008189 | 3300014745 | Bacteria | 5086 |
| 637 | Ga0157379_10110914 | 3300014968 | Bacteria | 2464 |
| 638 | Ga0157379_10137271 | 3300014968 | Bacteria | 2204 |
| 639 | Ga0157379_10152512 | 3300014968 | Bacteria | 2084 |
| 640 | Ga0157379_10477609 | 3300014968 | Bacteria | 1153 |
| 641 | Ga0157376_10000036 | 3300014969 | Bacteria | 145496 |
| 642 | Ga0157376_10003183 | 3300014969 | Bacteria | 11281 |
| 643 | Ga0157376_10107190 | 3300014969 | Bacteria | 2452 |
| 644 | Ga0157376_10440019 | 3300014969 | Bacteria | 1269 |
| 645 | Ga0157376_10604258 | 3300014969 | Bacteria | 1092 |
| 646 | Ga0182006_1023521 | 3300015261 | Bacteria | 2551 |
| 647 | Ga0182005_1017246 | 3300015265 | Bacteria | 2000 |
| 648 | Ga0163161_10001109 | 3300017792 | Bacteria | 20362 |
| 649 | Ga0213873_10050233 | 3300021358 | Bacteria | 1102 |
| 650 | Ga0213874_10015900 | 3300021377 | Bacteria | 1992 |
| 651 | Ga0224570_101423 | 3300022730 | Bacteria | 1796 |
| 652 | Ga0224572_1003844 | 3300024225 | Bacteria | 2565 |
| 653 | Ga0228598_1000649 | 3300024227 | Bacteria | 7292 |
| 654 | Ga0228598_1001051 | 3300024227 | Bacteria | 6072 |
| 655 | Ga0228598_1001059 | 3300024227 | Bacteria | 6056 |
| 656 | Ga0228598_1004139 | 3300024227 | Bacteria | 3082 |
| 657 | Ga0209147_100154 | 3300025229 | Bacteria | 94574 |
| 658 | Ga0207697_10007679 | 3300025315 | Bacteria | 4783 |
| 659 | Ga0207697_10150018 | 3300025315 | Bacteria | 1014 |
| 660 | Ga0207656_10019653 | 3300025321 | Bacteria | 2674 |
| 661 | Ga0207656_10057292 | 3300025321 | Bacteria | 1700 |
| 662 | Ga0207653_10004964 | 3300025885 | Bacteria | 4155 |
| 663 | Ga0207653_10040715 | 3300025885 | Bacteria | 1524 |
| 664 | Ga0207692_10007523 | 3300025898 | Bacteria | 4465 |
| 665 | Ga0207692_10021238 | 3300025898 | Bacteria | 2968 |
| 666 | Ga0207692_10044340 | 3300025898 | Unclassified | 2219 |
| 667 | Ga0207642_10001445 | 3300025899 | Bacteria | 7369 |
| 668 | Ga0207642_10023424 | 3300025899 | Bacteria | 2466 |
| 669 | Ga0207642_10097699 | 3300025899 | Bacteria | 1466 |
| 670 | Ga0207688_10064623 | 3300025901 | Bacteria | 2067 |
| 671 | Ga0207680_10036807 | 3300025903 | Bacteria | 2820 |
| 672 | Ga0207680_10126764 | 3300025903 | Bacteria | 1677 |
| 673 | Ga0207647_10000762 | 3300025904 | Bacteria | 25198 |
| 674 | Ga0207647_10006360 | 3300025904 | Bacteria | 8589 |
| 675 | Ga0207647_10009306 | 3300025904 | Bacteria | 6984 |
| 676 | Ga0207685_10000326 | 3300025905 | Bacteria | 7692 |
| 677 | Ga0207685_10015400 | 3300025905 | Bacteria | 2421 |
| 678 | Ga0207685_10083622 | 3300025905 | Bacteria | 1327 |
| 679 | Ga0207685_10102571 | 3300025905 | Bacteria | 1226 |
| 680 | Ga0207685_10118870 | 3300025905 | Bacteria | 1157 |
| 681 | Ga0207699_10000086 | 3300025906 | Bacteria | 70145 |
| 682 | Ga0207699_10027348 | 3300025906 | Bacteria | 3157 |
| 683 | Ga0207699_10068991 | 3300025906 | Bacteria | 2154 |
| 684 | Ga0207699_10109593 | 3300025906 | Bacteria | 1767 |
| 685 | Ga0207699_10245144 | 3300025906 | Bacteria | 1233 |
| 686 | Ga0207699_10267058 | 3300025906 | Bacteria | 1184 |
| 687 | Ga0207699_10295263 | 3300025906 | Unclassified | 1130 |
| 688 | Ga0207645_10000019 | 3300025907 | Bacteria | 110182 |
| 689 | Ga0207645_10011521 | 3300025907 | Bacteria | 6033 |
| 690 | Ga0207645_10026140 | 3300025907 | Bacteria | 3774 |
| 691 | Ga0207643_10000432 | 3300025908 | Bacteria | 27650 |
| 692 | Ga0207643_10062787 | 3300025908 | Bacteria | 2123 |
| 693 | Ga0207684_10000238 | 3300025910 | Bacteria | 83165 |
| 694 | Ga0207684_10001476 | 3300025910 | Bacteria | 25302 |
| 695 | Ga0207684_10012964 | 3300025910 | Bacteria | 7217 |
| 696 | Ga0207684_10024595 | 3300025910 | Bacteria | 5134 |
| 697 | Ga0207684_10064397 | 3300025910 | Bacteria | 3112 |
| 698 | Ga0207684_10067679 | 3300025910 | Bacteria | 3035 |
| 699 | Ga0207684_10097810 | 3300025910 | Bacteria | 2506 |
| 700 | Ga0207654_10031354 | 3300025911 | Bacteria | 2926 |
| 701 | Ga0207654_10050556 | 3300025911 | Bacteria | 2389 |
| 702 | Ga0207654_10200501 | 3300025911 | Unclassified | 1313 |
| 703 | Ga0207707_10006534 | 3300025912 | Bacteria | 10174 |
| 704 | Ga0207707_10031794 | 3300025912 | Bacteria | 4620 |
| 705 | Ga0207707_10169048 | 3300025912 | Bacteria | 1911 |
| 706 | Ga0207707_10237536 | 3300025912 | Unclassified | 1585 |
| 707 | Ga0207707_10314554 | 3300025912 | Bacteria | 1353 |
| 708 | Ga0207707_10326590 | 3300025912 | Bacteria | 1324 |
| 709 | Ga0207695_10027677 | 3300025913 | Bacteria | 6309 |
| 710 | Ga0207695_10031749 | 3300025913 | Bacteria | 5787 |
| 711 | Ga0207695_10042363 | 3300025913 | Bacteria | 4864 |
| 712 | Ga0207695_10062388 | 3300025913 | Bacteria | 3848 |
| 713 | Ga0207695_10086813 | 3300025913 | Unclassified | 3154 |
| 714 | Ga0207695_10371531 | 3300025913 | Bacteria | 1316 |
| 715 | Ga0207671_10048960 | 3300025914 | Bacteria | 3128 |
| 716 | Ga0207671_10114372 | 3300025914 | Bacteria | 2056 |
| 717 | Ga0207671_10125992 | 3300025914 | Bacteria | 1962 |
| 718 | Ga0207671_10154248 | 3300025914 | Bacteria | 1776 |
| 719 | Ga0207693_10000044 | 3300025915 | Bacteria | 103362 |
| 720 | Ga0207693_10000546 | 3300025915 | Bacteria | 34039 |
| 721 | Ga0207693_10027913 | 3300025915 | Bacteria | 4461 |
| 722 | Ga0207693_10033092 | 3300025915 | Bacteria | 4080 |
| 723 | Ga0207693_10055195 | 3300025915 | Bacteria | 3117 |
| 724 | Ga0207693_10112115 | 3300025915 | Bacteria | 2139 |
| 725 | Ga0207693_10147372 | 3300025915 | Bacteria | 1851 |
| 726 | Ga0207693_10240265 | 3300025915 | Bacteria | 1422 |
| 727 | Ga0207693_10353098 | 3300025915 | Bacteria | 1150 |
| 728 | Ga0207663_10000745 | 3300025916 | Bacteria | 14525 |
| 729 | Ga0207663_10050357 | 3300025916 | Bacteria | 2588 |
| 730 | Ga0207663_10073401 | 3300025916 | Bacteria | 2214 |
| 731 | Ga0207663_10226252 | 3300025916 | Bacteria | 1364 |
| 732 | Ga0207663_10324988 | 3300025916 | Bacteria | 1157 |
| 733 | Ga0207660_10061432 | 3300025917 | Bacteria | 2704 |
| 734 | Ga0207660_10121961 | 3300025917 | Bacteria | 1975 |
| 735 | Ga0207660_10125457 | 3300025917 | Bacteria | 1949 |
| 736 | Ga0207660_10282655 | 3300025917 | Bacteria | 1317 |
| 737 | Ga0207660_10519789 | 3300025917 | Bacteria | 967 |
| 738 | Ga0207662_10001347 | 3300025918 | Bacteria | 11854 |
| 739 | Ga0207662_10008827 | 3300025918 | Bacteria | 5531 |
| 740 | Ga0207662_10010238 | 3300025918 | Bacteria | 5173 |
| 741 | Ga0207657_10014641 | 3300025919 | Bacteria | 7642 |
| 742 | Ga0207657_10015652 | 3300025919 | Bacteria | 7337 |
| 743 | Ga0207649_10000188 | 3300025920 | Bacteria | 50655 |
| 744 | Ga0207649_10140980 | 3300025920 | Unclassified | 1649 |
| 745 | Ga0207652_10016502 | 3300025921 | Bacteria | 6031 |
| 746 | Ga0207652_10018680 | 3300025921 | Bacteria | 5688 |
| 747 | Ga0207652_10062271 | 3300025921 | Bacteria | 3224 |
| 748 | Ga0207652_10064820 | 3300025921 | Bacteria | 3162 |
| 749 | Ga0207652_10287692 | 3300025921 | Bacteria | 1483 |
| 750 | Ga0207652_10561437 | 3300025921 | Bacteria | 1025 |
| 751 | Ga0207646_10000073 | 3300025922 | Bacteria | 140267 |
| 752 | Ga0207646_10000404 | 3300025922 | Bacteria | 57874 |
| 753 | Ga0207646_10000549 | 3300025922 | Bacteria | 49403 |
| 754 | Ga0207646_10000901 | 3300025922 | Bacteria | 38302 |
| 755 | Ga0207646_10021264 | 3300025922 | Bacteria | 5997 |
| 756 | Ga0207646_10051234 | 3300025922 | Bacteria | 3694 |
| 757 | Ga0207646_10060879 | 3300025922 | Bacteria | 3371 |
| 758 | Ga0207646_10061042 | 3300025922 | Bacteria | 3365 |
| 759 | Ga0207646_10121735 | 3300025922 | Bacteria | 2344 |
| 760 | Ga0207646_10168414 | 3300025922 | Unclassified | 1978 |
| 761 | Ga0207646_10298421 | 3300025922 | Bacteria | 1456 |
| 762 | Ga0207646_10332503 | 3300025922 | Bacteria | 1373 |
| 763 | Ga0207646_10350425 | 3300025922 | Bacteria | 1334 |
| 764 | Ga0207681_10050607 | 3300025923 | Bacteria | 2812 |
| 765 | Ga0207681_10096609 | 3300025923 | Bacteria | 2121 |
| 766 | Ga0207681_10184689 | 3300025923 | Bacteria | 1591 |
| 767 | Ga0207694_10002864 | 3300025924 | Bacteria | 13898 |
| 768 | Ga0207694_10129212 | 3300025924 | Bacteria | 2024 |
| 769 | Ga0207694_10153520 | 3300025924 | Bacteria | 1856 |
| 770 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 771 | Ga0207650_10014362 | 3300025925 | Bacteria | 5505 |
| 772 | Ga0207650_10016981 | 3300025925 | Bacteria | 5092 |
| 773 | Ga0207650_10048919 | 3300025925 | Bacteria | 3120 |
| 774 | Ga0207659_10120442 | 3300025926 | Bacteria | 2010 |
| 775 | Ga0207687_10020670 | 3300025927 | Bacteria | 4369 |
| 776 | Ga0207687_10042288 | 3300025927 | Bacteria | 3134 |
| 777 | Ga0207687_10118379 | 3300025927 | Bacteria | 1977 |
| 778 | Ga0207700_10000090 | 3300025928 | Bacteria | 55960 |
| 779 | Ga0207700_10000101 | 3300025928 | Bacteria | 52726 |
| 780 | Ga0207700_10003111 | 3300025928 | Bacteria | 9587 |
| 781 | Ga0207700_10015567 | 3300025928 | Bacteria | 5021 |
| 782 | Ga0207700_10018678 | 3300025928 | Bacteria | 4665 |
| 783 | Ga0207700_10049934 | 3300025928 | Bacteria | 3114 |
| 784 | Ga0207700_10056721 | 3300025928 | Bacteria | 2950 |
| 785 | Ga0207700_10059747 | 3300025928 | Bacteria | 2884 |
| 786 | Ga0207700_10094477 | 3300025928 | Bacteria | 2369 |
| 787 | Ga0207700_10125422 | 3300025928 | Bacteria | 2088 |
| 788 | Ga0207700_10137766 | 3300025928 | Bacteria | 2001 |
| 789 | Ga0207700_10321120 | 3300025928 | Unclassified | 1342 |
| 790 | Ga0207700_10359946 | 3300025928 | Bacteria | 1268 |
| 791 | Ga0207664_10000033 | 3300025929 | Bacteria | 176549 |
| 792 | Ga0207664_10003224 | 3300025929 | Bacteria | 10844 |
| 793 | Ga0207664_10026443 | 3300025929 | Bacteria | 4387 |
| 794 | Ga0207664_10034850 | 3300025929 | Bacteria | 3879 |
| 795 | Ga0207664_10047673 | 3300025929 | Bacteria | 3367 |
| 796 | Ga0207664_10048728 | 3300025929 | Bacteria | 3333 |
| 797 | Ga0207664_10109197 | 3300025929 | Bacteria | 2298 |
| 798 | Ga0207664_10165614 | 3300025929 | Unclassified | 1888 |
| 799 | Ga0207664_10490768 | 3300025929 | Bacteria | 1099 |
| 800 | Ga0207644_10080909 | 3300025931 | Bacteria | 2399 |
| 801 | Ga0207644_10300817 | 3300025931 | Bacteria | 1293 |
| 802 | Ga0207690_10190626 | 3300025932 | Bacteria | 1550 |
| 803 | Ga0207706_10000912 | 3300025933 | Bacteria | 30372 |
| 804 | Ga0207706_10018727 | 3300025933 | Bacteria | 6228 |
| 805 | Ga0207706_10097325 | 3300025933 | Bacteria | 2588 |
| 806 | Ga0207706_10106514 | 3300025933 | Bacteria | 2467 |
| 807 | Ga0207686_10069502 | 3300025934 | Bacteria | 2260 |
| 808 | Ga0207709_10023571 | 3300025935 | Bacteria | 3505 |
| 809 | Ga0207670_10000141 | 3300025936 | Bacteria | 47492 |
| 810 | Ga0207670_10015668 | 3300025936 | Bacteria | 4535 |
| 811 | Ga0207670_10033997 | 3300025936 | Bacteria | 3290 |
| 812 | Ga0207670_10034780 | 3300025936 | Bacteria | 3260 |
| 813 | Ga0207670_10088630 | 3300025936 | Bacteria | 2182 |
| 814 | Ga0207669_10052866 | 3300025937 | Bacteria | 2443 |
| 815 | Ga0207669_10087772 | 3300025937 | Bacteria | 2015 |
| 816 | Ga0207704_10039453 | 3300025938 | Bacteria | 2750 |
| 817 | Ga0207704_10048675 | 3300025938 | Bacteria | 2543 |
| 818 | Ga0207704_10129925 | 3300025938 | Bacteria | 1742 |
| 819 | Ga0207704_10201320 | 3300025938 | Bacteria | 1457 |
| 820 | Ga0207665_10000119 | 3300025939 | Bacteria | 51930 |
| 821 | Ga0207665_10000189 | 3300025939 | Bacteria | 41548 |
| 822 | Ga0207665_10002959 | 3300025939 | Bacteria | 11384 |
| 823 | Ga0207665_10003250 | 3300025939 | Bacteria | 10880 |
| 824 | Ga0207665_10011641 | 3300025939 | Bacteria | 5780 |
| 825 | Ga0207665_10016061 | 3300025939 | Bacteria | 4917 |
| 826 | Ga0207665_10063549 | 3300025939 | Bacteria | 2507 |
| 827 | Ga0207665_10262538 | 3300025939 | Bacteria | 1280 |
| 828 | Ga0207665_10298159 | 3300025939 | Bacteria | 1204 |
| 829 | Ga0207691_10004229 | 3300025940 | Bacteria | 13944 |
| 830 | Ga0207691_10030878 | 3300025940 | Bacteria | 5003 |
| 831 | Ga0207691_10313776 | 3300025940 | Bacteria | 1345 |
| 832 | Ga0207711_10018665 | 3300025941 | Bacteria | 5767 |
| 833 | Ga0207711_10025149 | 3300025941 | Bacteria | 4996 |
| 834 | Ga0207711_10036791 | 3300025941 | Bacteria | 4154 |
| 835 | Ga0207711_10103474 | 3300025941 | Bacteria | 2521 |
| 836 | Ga0207711_10108426 | 3300025941 | Bacteria | 2467 |
| 837 | Ga0207711_10258700 | 3300025941 | Bacteria | 1599 |
| 838 | Ga0207711_10436321 | 3300025941 | Bacteria | 1219 |
| 839 | Ga0207711_10616574 | 3300025941 | Bacteria | 1012 |
| 840 | Ga0207711_10625560 | 3300025941 | Bacteria | 1004 |
| 841 | Ga0207689_10000078 | 3300025942 | Bacteria | 79810 |
| 842 | Ga0207689_10001992 | 3300025942 | Bacteria | 19297 |
| 843 | Ga0207689_10061265 | 3300025942 | Bacteria | 3094 |
| 844 | Ga0207689_10094678 | 3300025942 | Bacteria | 2453 |
| 845 | Ga0207689_10106543 | 3300025942 | Bacteria | 2303 |
| 846 | Ga0207661_10000067 | 3300025944 | Bacteria | 72201 |
| 847 | Ga0207661_10034875 | 3300025944 | Bacteria | 3917 |
| 848 | Ga0207661_10097469 | 3300025944 | Bacteria | 2462 |
| 849 | Ga0207661_10171334 | 3300025944 | Bacteria | 1890 |
| 850 | Ga0207661_10216238 | 3300025944 | Bacteria | 1692 |
| 851 | Ga0207661_10281170 | 3300025944 | Unclassified | 1487 |
| 852 | Ga0207679_10000055 | 3300025945 | Bacteria | 108728 |
| 853 | Ga0207679_10237117 | 3300025945 | Unclassified | 1543 |
| 854 | Ga0207679_10336599 | 3300025945 | Bacteria | 1311 |
| 855 | Ga0207667_10000170 | 3300025949 | Bacteria | 95740 |
| 856 | Ga0207667_10012321 | 3300025949 | Bacteria | 9862 |
| 857 | Ga0207667_10051637 | 3300025949 | Bacteria | 4333 |
| 858 | Ga0207667_10467898 | 3300025949 | Bacteria | 1280 |
| 859 | Ga0207667_10548774 | 3300025949 | Bacteria | 1169 |
| 860 | Ga0207667_10696269 | 3300025949 | Bacteria | 1019 |
| 861 | Ga0207651_10021937 | 3300025960 | Bacteria | 3892 |
| 862 | Ga0207651_10029315 | 3300025960 | Bacteria | 3485 |
| 863 | Ga0207651_10131212 | 3300025960 | Bacteria | 1918 |
| 864 | Ga0207651_10281693 | 3300025960 | Bacteria | 1374 |
| 865 | Ga0207712_10166892 | 3300025961 | Bacteria | 1717 |
| 866 | Ga0207712_10177116 | 3300025961 | Bacteria | 1672 |
| 867 | Ga0207712_10412996 | 3300025961 | Bacteria | 1137 |
| 868 | Ga0207640_10189232 | 3300025981 | Bacteria | 1550 |
| 869 | Ga0207640_10393175 | 3300025981 | Bacteria | 1127 |
| 870 | Ga0207658_10016816 | 3300025986 | Bacteria | 5033 |
| 871 | Ga0207658_10068741 | 3300025986 | Bacteria | 2674 |
| 872 | Ga0207677_10004744 | 3300026023 | Bacteria | 7330 |
| 873 | Ga0207677_10006247 | 3300026023 | Bacteria | 6515 |
| 874 | Ga0207677_10046574 | 3300026023 | Bacteria | 2905 |
| 875 | Ga0207677_10116961 | 3300026023 | Bacteria | 1997 |
| 876 | Ga0207677_10258727 | 3300026023 | Bacteria | 1418 |
| 877 | Ga0207703_10001408 | 3300026035 | Bacteria | 21917 |
| 878 | Ga0207703_10002734 | 3300026035 | Bacteria | 15109 |
| 879 | Ga0207703_10012584 | 3300026035 | Bacteria | 6595 |
| 880 | Ga0207703_10056476 | 3300026035 | Bacteria | 3198 |
| 881 | Ga0207703_10064537 | 3300026035 | Bacteria | 3006 |
| 882 | Ga0207703_10068712 | 3300026035 | Bacteria | 2920 |
| 883 | Ga0207703_10137271 | 3300026035 | Bacteria | 2118 |
| 884 | Ga0207703_10445242 | 3300026035 | Bacteria | 1209 |
| 885 | Ga0207639_10002287 | 3300026041 | Bacteria | 12868 |
| 886 | Ga0207639_10147401 | 3300026041 | Bacteria | 1967 |
| 887 | Ga0207639_10328425 | 3300026041 | Bacteria | 1360 |
| 888 | Ga0207678_10001331 | 3300026067 | Bacteria | 22808 |
| 889 | Ga0207678_10016835 | 3300026067 | Bacteria | 6419 |
| 890 | Ga0207678_10040295 | 3300026067 | Bacteria | 4052 |
| 891 | Ga0207708_10002845 | 3300026075 | Bacteria | 12730 |
| 892 | Ga0207708_10022762 | 3300026075 | Bacteria | 4732 |
| 893 | Ga0207708_10055446 | 3300026075 | Bacteria | 3022 |
| 894 | Ga0207708_10057688 | 3300026075 | Bacteria | 2962 |
| 895 | Ga0207708_10176109 | 3300026075 | Unclassified | 1696 |
| 896 | Ga0207708_10201559 | 3300026075 | Bacteria | 1588 |
| 897 | Ga0207702_10001597 | 3300026078 | Bacteria | 22421 |
| 898 | Ga0207702_10006327 | 3300026078 | Bacteria | 10229 |
| 899 | Ga0207702_10012220 | 3300026078 | Bacteria | 7144 |
| 900 | Ga0207702_10306649 | 3300026078 | Bacteria | 1508 |
| 901 | Ga0207702_10465181 | 3300026078 | Unclassified | 1229 |
| 902 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 903 | Ga0207641_10008766 | 3300026088 | Bacteria | 8353 |
| 904 | Ga0207641_10009428 | 3300026088 | Bacteria | 8043 |
| 905 | Ga0207641_10012702 | 3300026088 | Bacteria | 6905 |
| 906 | Ga0207641_10052353 | 3300026088 | Bacteria | 3457 |
| 907 | Ga0207641_10083664 | 3300026088 | Bacteria | 2776 |
| 908 | Ga0207641_10135955 | 3300026088 | Bacteria | 2212 |
| 909 | Ga0207641_10160978 | 3300026088 | Bacteria | 2041 |
| 910 | Ga0207648_10000031 | 3300026089 | Bacteria | 129124 |
| 911 | Ga0207648_10001943 | 3300026089 | Bacteria | 22611 |
| 912 | Ga0207648_10039856 | 3300026089 | Bacteria | 4129 |
| 913 | Ga0207676_10000915 | 3300026095 | Bacteria | 22842 |
| 914 | Ga0207676_10033311 | 3300026095 | Bacteria | 3891 |
| 915 | Ga0207676_10037233 | 3300026095 | Bacteria | 3706 |
| 916 | Ga0207676_10083058 | 3300026095 | Bacteria | 2607 |
| 917 | Ga0207676_10134395 | 3300026095 | Bacteria | 2108 |
| 918 | Ga0207676_10245686 | 3300026095 | Bacteria | 1608 |
| 919 | Ga0207676_10416817 | 3300026095 | Unclassified | 1258 |
| 920 | Ga0207674_10000618 | 3300026116 | Bacteria | 46623 |
| 921 | Ga0207674_10002087 | 3300026116 | Bacteria | 25284 |
| 922 | Ga0207674_10002424 | 3300026116 | Bacteria | 23553 |
| 923 | Ga0207674_10009625 | 3300026116 | Bacteria | 11023 |
| 924 | Ga0207674_10048473 | 3300026116 | Bacteria | 4348 |
| 925 | Ga0207674_10056136 | 3300026116 | Bacteria | 4000 |
| 926 | Ga0207675_100009496 | 3300026118 | Bacteria | 9104 |
| 927 | Ga0207675_100032163 | 3300026118 | Bacteria | 4887 |
| 928 | Ga0207675_100063435 | 3300026118 | Bacteria | 3452 |
| 929 | Ga0207675_100203600 | 3300026118 | Bacteria | 1901 |
| 930 | Ga0207675_100239928 | 3300026118 | Bacteria | 1751 |
| 931 | Ga0207675_100358070 | 3300026118 | Bacteria | 1431 |
| 932 | Ga0207675_100431560 | 3300026118 | Bacteria | 1303 |
| 933 | Ga0207683_10005417 | 3300026121 | Bacteria | 10932 |
| 934 | Ga0207683_10207205 | 3300026121 | Bacteria | 1784 |
| 935 | Ga0207698_10075494 | 3300026142 | Bacteria | 2694 |
| 936 | Ga0207698_10136086 | 3300026142 | Bacteria | 2108 |
| 937 | Ga0207698_10280262 | 3300026142 | Bacteria | 1541 |
| 938 | Ga0209588_1002596 | 3300027671 | Bacteria | 4915 |
| 939 | Ga0209588_1025474 | 3300027671 | Bacteria | 1873 |
| 940 | Ga0209588_1029634 | 3300027671 | Bacteria | 1746 |
| 941 | Ga0209588_1034262 | 3300027671 | Unclassified | 1630 |
| 942 | Ga0207428_10001654 | 3300027907 | Bacteria | 23163 |
| 943 | Ga0207428_10016548 | 3300027907 | Bacteria | 6339 |
| 944 | Ga0207428_10031295 | 3300027907 | Bacteria | 4392 |
| 945 | Ga0207428_10103863 | 3300027907 | Bacteria | 2193 |
| 946 | Ga0207428_10431962 | 3300027907 | Bacteria | 962 |
| 947 | Ga0265354_1004808 | 3300028016 | Bacteria | 1397 |
| 948 | Ga0268266_10000267 | 3300028379 | Bacteria | 86736 |
| 949 | Ga0268266_10034893 | 3300028379 | Bacteria | 4278 |
| 950 | Ga0268265_10039533 | 3300028380 | Bacteria | 3478 |
| 951 | Ga0268265_10153074 | 3300028380 | Bacteria | 1947 |
| 952 | Ga0268265_10207647 | 3300028380 | Bacteria | 1704 |
| 953 | Ga0268265_10380205 | 3300028380 | Bacteria | 1299 |
| 954 | Ga0268264_10002804 | 3300028381 | Bacteria | 15217 |
| 955 | Ga0268264_10031874 | 3300028381 | Bacteria | 4324 |
| 956 | Ga0268264_10074418 | 3300028381 | Bacteria | 2885 |
| 957 | Ga0268264_10110236 | 3300028381 | Bacteria | 2410 |
| 958 | Ga0268264_10166635 | 3300028381 | Bacteria | 1990 |
| 959 | Ga0268264_10185711 | 3300028381 | Bacteria | 1891 |
| 960 | Ga0268264_10547041 | 3300028381 | Bacteria | 1135 |
| 961 | Ga0265338_10007491 | 3300028800 | Bacteria | 13522 |
| 962 | Ga0265338_10011560 | 3300028800 | Bacteria | 10178 |
| 963 | Ga0265338_10014474 | 3300028800 | Bacteria | 8778 |
| 964 | Ga0265338_10070199 | 3300028800 | Bacteria | 3005 |
| 965 | Ga0265338_10131633 | 3300028800 | Bacteria | 1973 |
| 966 | Ga0265338_10170857 | 3300028800 | Bacteria | 1668 |
| 967 | Ga0265338_10193154 | 3300028800 | Bacteria | 1541 |
| 968 | Ga0265338_10204382 | 3300028800 | Unclassified | 1487 |
| 969 | Ga0265762_1000146 | 3300030760 | Bacteria | 10917 |
| 970 | Ga0265762_1001607 | 3300030760 | Bacteria | 4116 |
| 971 | Ga0265765_1003037 | 3300030879 | Bacteria | 1663 |
| 972 | Ga0265765_1004376 | 3300030879 | Bacteria | 1451 |
| 973 | Ga0265760_10000033 | 3300031090 | Bacteria | 48732 |
| 974 | Ga0265760_10000516 | 3300031090 | Bacteria | 10808 |
| 975 | Ga0265760_10000551 | 3300031090 | Bacteria | 10599 |
| 976 | Ga0265760_10007507 | 3300031090 | Unclassified | 3114 |
| 977 | Ga0265760_10017032 | 3300031090 | Bacteria | 2087 |
| 978 | Ga0265325_10003889 | 3300031241 | Bacteria | 9584 |
| 979 | Ga0265325_10089462 | 3300031241 | Bacteria | 1520 |
| 980 | Ga0265339_10013118 | 3300031249 | Bacteria | 5033 |
| 981 | Ga0265339_10021085 | 3300031249 | Bacteria | 3798 |
| 982 | Ga0265339_10070869 | 3300031249 | Bacteria | 1858 |
| 983 | Ga0265339_10212035 | 3300031249 | Bacteria | 951 |
| 984 | Ga0265316_10004100 | 3300031344 | Bacteria | 14593 |
| 985 | Ga0265316_10014092 | 3300031344 | Bacteria | 7056 |
| 986 | Ga0265316_10167267 | 3300031344 | Bacteria | 1642 |
| 987 | Ga0265316_10362333 | 3300031344 | Bacteria | 1048 |
| 988 | Ga0307408_100078226 | 3300031548 | Bacteria | 2465 |
| 989 | Ga0265313_10076717 | 3300031595 | Bacteria | 1527 |
| 990 | Ga0307508_10023956 | 3300031616 | Bacteria | 5540 |
| 991 | Ga0265314_10001876 | 3300031711 | Bacteria | 22540 |
| 992 | Ga0265314_10034143 | 3300031711 | Bacteria | 3721 |
| 993 | Ga0265342_10057898 | 3300031712 | Bacteria | 2292 |
| 994 | Ga0307405_10050076 | 3300031731 | Bacteria | 2585 |
| 995 | Ga0307413_10080006 | 3300031824 | Bacteria | 2091 |
| 996 | Ga0307413_10174722 | 3300031824 | Bacteria | 1525 |
| 997 | Ga0307410_10006425 | 3300031852 | Bacteria | 6340 |
| 998 | Ga0307410_10034902 | 3300031852 | Bacteria | 3262 |
| 999 | Ga0307406_10052850 | 3300031901 | Bacteria | 2586 |
| 1000 | Ga0307406_10060013 | 3300031901 | Bacteria | 2451 |
| 1001 | Ga0307407_10022500 | 3300031903 | Bacteria | 3272 |
| 1002 | Ga0307407_10047661 | 3300031903 | Bacteria | 2434 |
| 1003 | Ga0307407_10155317 | 3300031903 | Bacteria | 1491 |
| 1004 | Ga0307409_100020464 | 3300031995 | Bacteria | 4511 |
| 1005 | Ga0307409_100035032 | 3300031995 | Bacteria | 3674 |
| 1006 | Ga0307409_100182172 | 3300031995 | Bacteria | 1861 |
| 1007 | Ga0307416_100077169 | 3300032002 | Bacteria | 2797 |
| 1008 | Ga0307416_100188528 | 3300032002 | Bacteria | 1942 |
| 1009 | Ga0307416_100229040 | 3300032002 | Bacteria | 1790 |
| 1010 | Ga0307416_100709093 | 3300032002 | Bacteria | 1096 |
| 1011 | Ga0307414_10100879 | 3300032004 | Bacteria | 2172 |
| 1012 | Ga0307414_10345737 | 3300032004 | Bacteria | 1275 |
| 1013 | Ga0307411_10004555 | 3300032005 | Bacteria | 6661 |
| 1014 | Ga0307411_10038177 | 3300032005 | Bacteria | 3027 |
| 1015 | Ga0307411_10114283 | 3300032005 | Bacteria | 1939 |
| 1016 | Ga0307411_10128059 | 3300032005 | Bacteria | 1850 |
| 1017 | Ga0307415_100045220 | 3300032126 | Bacteria | 2950 |
| 1018 | Ga0307415_100155311 | 3300032126 | Bacteria | 1766 |
| 1019 | Ga0307415_100161482 | 3300032126 | Bacteria | 1737 |
| 1020 | Ga0373934_0003000 | 3300035086 | Bacteria | 6163 |
| 1021 | Ga0373944_0014543 | 3300035089 | Bacteria | 2198 |
| 1022 | Ga0373951_0000953 | 3300035091 | Bacteria | 7785 |
| 1023 | Ga0373923_0008355 | 3300035111 | Bacteria | 3687 |
| 1024 | Ga0373923_0028510 | 3300035111 | Bacteria | 2234 |
| 1025 | Ga0373923_0088320 | 3300035111 | Bacteria | 1353 |
| 1026 | Ga0373936_0005678 | 3300035113 | Bacteria | 4705 |
| 1027 | Ga0373936_0007148 | 3300035113 | Bacteria | 4202 |
| 1028 | Ga0373936_0054779 | 3300035113 | Unclassified | 1618 |
| 1029 | Ga0373936_0072816 | 3300035113 | Bacteria | 1419 |
| 1030 | Ga0373945_0015970 | 3300035116 | Bacteria | 2530 |
| 1031 | Ga0373953_0001820 | 3300035117 | Bacteria | 6294 |
| 1032 | Ga0373953_0106335 | 3300035117 | Bacteria | 1184 |
| 1033 | Ga0373954_0074066 | 3300035118 | Unclassified | 1621 |
| 1034 | Ga0373954_0076884 | 3300035118 | Bacteria | 1591 |
| 1035 | Ga0373954_0136552 | 3300035118 | Bacteria | 1195 |
| 1036 | Ga0373956_0005290 | 3300035119 | Bacteria | 5167 |
| 1037 | Ga0373956_0010381 | 3300035119 | Bacteria | 3817 |
| 1038 | Ga0373957_0000526 | 3300035120 | Bacteria | 9629 |
| 1039 | Ga0373957_0003118 | 3300035120 | Bacteria | 4842 |
| 1040 | Ga0373957_0003458 | 3300035120 | Bacteria | 4667 |
| 1041 | Ga0373943_0045043 | 3300035170 | Unclassified | 2148 |
| 1042 | Ga0373943_0090335 | 3300035170 | Bacteria | 1585 |
| 1043 | Ga0373943_0111554 | 3300035170 | Bacteria | 1443 |
| 1044 | Ga0373943_0280346 | 3300035170 | Bacteria | 942 |
| 1045 | Ga0373946_0006023 | 3300035171 | Bacteria | 4400 |
| 1046 | Ga0373946_0043794 | 3300035171 | Bacteria | 1845 |
| 1047 | Ga0373955_0011254 | 3300035172 | Bacteria | 4255 |
| 1048 | Ga0373955_0053465 | 3300035172 | Bacteria | 2205 |
| 1049 | Ga0373955_0058755 | 3300035172 | Bacteria | 2116 |
| 1050 | Ga0373942_0069561 | 3300035207 | Bacteria | 1025 |
| 1051 | Ga0316574_0018911 | 3300035398 | Bacteria | 4057 |
| 1052 | Ga0316574_0128147 | 3300035398 | Bacteria | 1632 |
| 1053 | Ga0373924_0006841 | 3300035410 | Bacteria | 4097 |
| 1054 | Ga0373931_0069579 | 3300035691 | Bacteria | 1918 |
| 1055 | Ga0373931_0092278 | 3300035691 | Unclassified | 1689 |
| 1056 | Ga0373931_0226660 | 3300035691 | Bacteria | 1127 |
| 1057 | Ga0373935_0003601 | 3300035692 | Bacteria | 9031 |
| 1058 | Ga0373935_0003897 | 3300035692 | Bacteria | 8704 |
| 1059 | Ga0373935_0006473 | 3300035692 | Bacteria | 6995 |
| 1060 | Ga0373927_0000123 | 3300035695 | Bacteria | 58803 |
| 1061 | Ga0373927_0001591 | 3300035695 | Bacteria | 17025 |
| 1062 | Ga0373927_0024226 | 3300035695 | Bacteria | 3970 |
| 1063 | Ga0373927_0044465 | 3300035695 | Unclassified | 2873 |
| 1064 | Ga0373927_0113353 | 3300035695 | Unclassified | 1767 |
| 1065 | Ga0373927_0206819 | 3300035695 | Bacteria | 1289 |
| 1066 | Ga0373933_0002466 | 3300035724 | Bacteria | 10406 |
| 1067 | Ga0373933_0003709 | 3300035724 | Bacteria | 8448 |
| 1068 | Ga0373933_0031159 | 3300035724 | Unclassified | 3093 |
| 1069 | Ga0373933_0101316 | 3300035724 | Bacteria | 1787 |
| 1070 | Ga0373947_0002769 | 3300035725 | Bacteria | 10489 |
| 1071 | Ga0373947_0005381 | 3300035725 | Bacteria | 7468 |
| 1072 | Ga0373947_0018368 | 3300035725 | Unclassified | 4024 |
| 1073 | Ga0373947_0038591 | 3300035725 | Bacteria | 2838 |
| 1074 | Ga0373947_0071076 | 3300035725 | Bacteria | 2134 |
| 1075 | Ga0373947_0153156 | 3300035725 | Bacteria | 1486 |
| 1076 | Ga0373947_0361784 | 3300035725 | Bacteria | 975 |
| 1077 | Ga0373937_0000037 | 3300036401 | Bacteria | 111413 |
| 1078 | Ga0373937_0242775 | 3300036401 | Bacteria | 1697 |
| 1079 | Ga0373925_0000915 | 3300037068 | Bacteria | 26942 |
| 1080 | Ga0373925_0003137 | 3300037068 | Bacteria | 12981 |
| 1081 | Ga0373925_0005438 | 3300037068 | Bacteria | 9486 |
| 1082 | Ga0373925_0007608 | 3300037068 | Bacteria | 7891 |
| 1083 | Ga0373925_0096314 | 3300037068 | Bacteria | 2268 |
| 1084 | Ga0373925_0124257 | 3300037068 | Bacteria | 2006 |
| 1085 | Ga0395905_0010608 | 3300037471 | Bacteria | 8944 |
| 1086 | Ga0395905_0041369 | 3300037471 | Bacteria | 4325 |
| 1087 | Ga0395905_0119476 | 3300037471 | Bacteria | 2477 |
| 1088 | Ga0436364_1286351 | 3300037853 | Bacteria | 4374 |
| 1089 | Ga0436365_0558586 | 3300039437 | Bacteria | 1419 |
| 1090 | Ga0436363_0148938 | 3300039450 | Bacteria | 2602 |
| 1091 | Ga0436363_1051196 | 3300039450 | Bacteria | 2983 |
| 1092 | Ga0436362_0425579 | 3300039453 | Bacteria | 2574 |
| 1093 | Ga0436362_1154172 | 3300039453 | Bacteria | 2602 |
| 1094 | Ga0439431_0060432 | 3300041997 | Bacteria | 996 |
| 1095 | Ga0439462_0033105 | 3300042015 | Bacteria | 1370 |
| 1096 | Ga0439446_0010019 | 3300042156 | Bacteria | 2546 |
| 1097 | Ga0439446_0018794 | 3300042156 | Bacteria | 1940 |
| 1098 | Ga0439434_0018301 | 3300042435 | Bacteria | 2096 |
| 1099 | Ga0439459_0029808 | 3300042438 | Bacteria | 1103 |
| 1100 | Ga0451577_0000390 | 3300042876 | Bacteria | 81287 |
| 1101 | Ga0451577_0020501 | 3300042876 | Bacteria | 6066 |
| 1102 | Ga0451577_0188476 | 3300042876 | Bacteria | 1860 |
| 1103 | Ga0453683_0002477 | 3300044673 | Bacteria | 14275 |
| 1104 | Ga0453683_0003673 | 3300044673 | Bacteria | 11243 |
| 1105 | Ga0453683_0024798 | 3300044673 | Bacteria | 3814 |
| 1106 | Ga0466963_0021213 | 3300044694 | Bacteria | 4095 |
| 1107 | Ga0466963_0075292 | 3300044694 | Bacteria | 2278 |
| 1108 | Ga0466964_0024512 | 3300044706 | Bacteria | 2352 |
| 1109 | Ga0453684_0000686 | 3300044712 | Bacteria | 120659 |
| 1110 | Ga0453684_0254328 | 3300044712 | Bacteria | 2016 |
| 1111 | Ga0453684_0405792 | 3300044712 | Bacteria | 1525 |
| 1112 | Ga0451576_0006359 | 3300045051 | Bacteria | 14504 |
| 1113 | Ga0451576_0040972 | 3300045051 | Bacteria | 4897 |
| 1114 | Ga0451576_0043177 | 3300045051 | Bacteria | 4757 |
| 1115 | Ga0451576_0064398 | 3300045051 | Bacteria | 3819 |
| 1116 | Ga0451576_0717877 | 3300045051 | Bacteria | 1050 |
| 1117 | Ga0466967_0013623 | 3300045976 | Bacteria | 6293 |
| 1118 | Ga0466967_0016966 | 3300045976 | Bacteria | 5761 |
| 1119 | Ga0466967_0067424 | 3300045976 | Bacteria | 3192 |
| 1120 | Ga0466967_0087331 | 3300045976 | Unclassified | 2827 |
| 1121 | Ga0466967_0149802 | 3300045976 | Bacteria | 2179 |
| 1122 | Ga0495592_0062395 | 3300046454 | Bacteria | 2736 |
| 1123 | Ga0495603_0179046 | 3300046455 | Bacteria | 1227 |
| 1124 | Ga0495629_0038676 | 3300046459 | Unclassified | 3359 |
| 1125 | Ga0495629_0171227 | 3300046459 | Bacteria | 1507 |
| 1126 | Ga0495641_0147193 | 3300046461 | Unclassified | 1052 |
| 1127 | Ga0495651_0026393 | 3300046462 | Bacteria | 4524 |
| 1128 | Ga0495653_0031817 | 3300046463 | Bacteria | 4192 |
| 1129 | Ga0495653_0038953 | 3300046463 | Bacteria | 3727 |
| 1130 | Ga0495653_0213132 | 3300046463 | Bacteria | 1303 |
| 1131 | Ga0495580_0000163 | 3300046472 | Bacteria | 49180 |
| 1132 | Ga0495580_0000505 | 3300046472 | Bacteria | 32817 |
| 1133 | Ga0495580_0000909 | 3300046472 | Bacteria | 25811 |
| 1134 | Ga0495580_0007429 | 3300046472 | Bacteria | 8809 |
| 1135 | Ga0495580_0017832 | 3300046472 | Bacteria | 5296 |
| 1136 | Ga0495580_0023516 | 3300046472 | Bacteria | 4523 |
| 1137 | Ga0495580_0036953 | 3300046472 | Bacteria | 3506 |
| 1138 | Ga0495580_0046576 | 3300046472 | Bacteria | 3076 |
| 1139 | Ga0495580_0074389 | 3300046472 | Bacteria | 2371 |
| 1140 | Ga0495580_0144937 | 3300046472 | Bacteria | 1646 |
| 1141 | Ga0495580_0184212 | 3300046472 | Bacteria | 1441 |
| 1142 | Ga0495580_0188420 | 3300046472 | Bacteria | 1423 |
| 1143 | Ga0495582_0003168 | 3300046473 | Bacteria | 9237 |
| 1144 | Ga0495582_0004127 | 3300046473 | Bacteria | 8167 |
| 1145 | Ga0495639_0001941 | 3300046475 | Bacteria | 9181 |
| 1146 | Ga0495639_0015376 | 3300046475 | Unclassified | 3319 |
| 1147 | Ga0495639_0029191 | 3300046475 | Bacteria | 2448 |
| 1148 | Ga0495662_0046988 | 3300046476 | Bacteria | 2084 |
| 1149 | Ga0495664_0035291 | 3300046477 | Unclassified | 2944 |
| 1150 | Ga0495664_0133473 | 3300046477 | Bacteria | 1504 |
| 1151 | Ga0495594_0023211 | 3300046499 | Bacteria | 3322 |
| 1152 | Ga0495594_0090804 | 3300046499 | Bacteria | 1711 |
| 1153 | Ga0495608_0199649 | 3300046511 | Bacteria | 1260 |
| 1154 | Ga0495618_0126830 | 3300046514 | Bacteria | 1634 |
| 1155 | Ga0495628_0042316 | 3300046516 | Bacteria | 3633 |
| 1156 | Ga0495628_0055659 | 3300046516 | Bacteria | 3115 |
| 1157 | Ga0495628_0063095 | 3300046516 | Bacteria | 2903 |
| 1158 | Ga0495628_0134925 | 3300046516 | Bacteria | 1887 |
| 1159 | Ga0495630_0004055 | 3300046517 | Bacteria | 10254 |
| 1160 | Ga0495630_0081294 | 3300046517 | Bacteria | 2445 |
| 1161 | Ga0495630_0145481 | 3300046517 | Bacteria | 1802 |
| 1162 | Ga0495666_0127213 | 3300046526 | Bacteria | 1191 |
| 1163 | Ga0495665_0012718 | 3300046531 | Unclassified | 4554 |
| 1164 | Ga0495665_0036475 | 3300046531 | Bacteria | 2625 |
| 1165 | Ga0495640_0003469 | 3300046533 | Bacteria | 12696 |
| 1166 | Ga0495586_0010706 | 3300046535 | Bacteria | 4880 |
| 1167 | Ga0495587_0054794 | 3300046536 | Bacteria | 2349 |
| 1168 | Ga0495587_0111953 | 3300046536 | Bacteria | 1567 |
| 1169 | Ga0495645_0054740 | 3300046543 | Unclassified | 2898 |
| 1170 | Ga0495622_0136101 | 3300046557 | Unclassified | 1117 |
| 1171 | Ga0495667_0068887 | 3300046559 | Bacteria | 2309 |
| 1172 | Ga0495667_0262666 | 3300046559 | Bacteria | 1098 |
| 1173 | Ga0495635_0167910 | 3300046663 | Bacteria | 1493 |
| 1174 | Ga0495588_0105757 | 3300046674 | Bacteria | 1481 |
| 1175 | Ga0495588_0147158 | 3300046674 | Bacteria | 1245 |
| 1176 | Ga0495599_0230595 | 3300046678 | Bacteria | 1130 |
| 1177 | Ga0495599_0300786 | 3300046678 | Bacteria | 968 |
| 1178 | Ga0495623_0025710 | 3300046679 | Bacteria | 3792 |
| 1179 | Ga0495623_0045468 | 3300046679 | Unclassified | 2789 |
| 1180 | Ga0495647_0001388 | 3300046681 | Bacteria | 7471 |
| 1181 | Ga0495658_0091905 | 3300046683 | Unclassified | 1798 |
| 1182 | Ga0495658_0093209 | 3300046683 | Bacteria | 1787 |
| 1183 | Ga0495669_0081817 | 3300046684 | Bacteria | 1483 |
| 1184 | Ga0495613_0047059 | 3300046689 | Unclassified | 3186 |
| 1185 | Ga0495624_0030071 | 3300046690 | Bacteria | 3540 |
| 1186 | Ga0495600_0010458 | 3300046809 | Bacteria | 5761 |
| 1187 | Ga0495600_0081482 | 3300046809 | Bacteria | 2112 |
| 1188 | Ga0495581_0010040 | 3300047315 | Bacteria | 5477 |
| 1189 | Ga0495581_0027020 | 3300047315 | Unclassified | 3328 |
| 1190 | Ga0495674_0012576 | 3300047319 | Bacteria | 7973 |
| 1191 | Ga0495674_0022407 | 3300047319 | Bacteria | 5826 |
| 1192 | Ga0495674_0028103 | 3300047319 | Bacteria | 5134 |
| 1193 | Ga0495674_0152521 | 3300047319 | Unclassified | 1937 |
| 1194 | Ga0495674_0391016 | 3300047319 | Bacteria | 1124 |
| 1195 | Ga0495672_0002834 | 3300047320 | Bacteria | 15421 |
| 1196 | Ga0495676_0036950 | 3300047321 | Unclassified | 4072 |
| 1197 | Ga0495676_0110212 | 3300047321 | Bacteria | 2021 |
| 1198 | Ga0495680_0018273 | 3300047322 | Bacteria | 5958 |
| 1199 | Ga0495680_0152354 | 3300047322 | Bacteria | 1684 |
| 1200 | Ga0495675_0001743 | 3300047444 | Bacteria | 13020 |
| 1201 | Ga0495675_0003075 | 3300047444 | Bacteria | 10030 |
| 1202 | Ga0495684_0167879 | 3300047471 | Bacteria | 1634 |
| 1203 | Ga0495684_0288789 | 3300047471 | Bacteria | 1181 |
| 1204 | Ga0495593_0164365 | 3300047673 | Unclassified | 1120 |
| 1205 | Ga0495602_0260910 | 3300048088 | Unclassified | 1285 |
| 1206 | Ga0495602_0402893 | 3300048088 | Bacteria | 975 |
| 1207 | Ga0495614_0013730 | 3300048089 | Unclassified | 3552 |
| 1208 | Ga0495615_0008576 | 3300048090 | Bacteria | 1982 |
| 1209 | Ga0496100_0056132 | 3300048903 | Bacteria | 2576 |
| 1210 | Ga0496100_0065379 | 3300048903 | Bacteria | 2410 |
| 1211 | Ga0496102_0157282 | 3300048905 | Bacteria | 2137 |
| 1212 | Ga0496104_0119297 | 3300048907 | Bacteria | 2533 |
| 1213 | Ga0496104_0250358 | 3300048907 | Bacteria | 1684 |
| 1214 | Ga0496104_0275417 | 3300048907 | Bacteria | 1596 |
| 1215 | Ga0496104_0295010 | 3300048907 | Unclassified | 1534 |
| 1216 | Ga0496105_0019985 | 3300048908 | Bacteria | 5405 |
| 1217 | Ga0496106_0114799 | 3300048909 | Bacteria | 2100 |
| 1218 | Ga0496108_0002333 | 3300048911 | Bacteria | 15200 |
| 1219 | Ga0496108_0070661 | 3300048911 | Bacteria | 2946 |
| 1220 | Ga0496108_0336491 | 3300048911 | Bacteria | 1317 |
| 1221 | Ga0496109_0000941 | 3300048912 | Bacteria | 24099 |
| 1222 | Ga0496109_0125666 | 3300048912 | Bacteria | 2391 |
| 1223 | Ga0496109_0345784 | 3300048912 | Bacteria | 1404 |
| 1224 | Ga0496110_0028543 | 3300048913 | Bacteria | 4794 |
| 1225 | Ga0496110_0115180 | 3300048913 | Bacteria | 2419 |
| 1226 | Ga0496110_0118010 | 3300048913 | Bacteria | 2389 |
| 1227 | Ga0496110_0280285 | 3300048913 | Bacteria | 1518 |
| 1228 | Ga0496111_0051663 | 3300048914 | Bacteria | 2967 |
| 1229 | Ga0496112_0001276 | 3300048915 | Bacteria | 19093 |
| 1230 | Ga0496112_0019630 | 3300048915 | Bacteria | 6383 |
| 1231 | Ga0496112_0031605 | 3300048915 | Bacteria | 5136 |
| 1232 | Ga0496112_0032286 | 3300048915 | Bacteria | 5083 |
| 1233 | Ga0496112_0071615 | 3300048915 | Bacteria | 3426 |
| 1234 | Ga0496112_0088484 | 3300048915 | Bacteria | 3065 |
| 1235 | Ga0496112_0090315 | 3300048915 | Bacteria | 3032 |
| 1236 | Ga0496112_0277141 | 3300048915 | Bacteria | 1625 |
| 1237 | Ga0496112_0387903 | 3300048915 | Bacteria | 1337 |
| 1238 | Ga0496113_0000236 | 3300048916 | Bacteria | 26009 |
| 1239 | Ga0496113_0026940 | 3300048916 | Bacteria | 4115 |
| 1240 | Ga0496113_0062731 | 3300048916 | Bacteria | 2807 |
| 1241 | Ga0496113_0524904 | 3300048916 | Bacteria | 950 |
| 1242 | Ga0496114_0008108 | 3300048917 | Bacteria | 8321 |
| 1243 | Ga0496114_0281601 | 3300048917 | Bacteria | 1466 |
| 1244 | Ga0496115_0002794 | 3300048918 | Bacteria | 12544 |
| 1245 | Ga0496115_0021677 | 3300048918 | Bacteria | 4966 |
| 1246 | Ga0496115_0072679 | 3300048918 | Bacteria | 2791 |
| 1247 | Ga0496115_0072703 | 3300048918 | Bacteria | 2790 |
| 1248 | Ga0496115_0352143 | 3300048918 | Bacteria | 1201 |
| 1249 | Ga0501298_000137 | 3300049521 | Bacteria | 8810 |
| 1250 | Ga0501031_0195662 | 3300049568 | Bacteria | 1320 |
| 1251 | Ga0501034_0053936 | 3300049571 | Bacteria | 4047 |
| 1252 | Ga0501034_0142090 | 3300049571 | Bacteria | 2379 |
| 1253 | Ga0501036_0428772 | 3300049572 | Bacteria | 1102 |
| 1254 | Ga0501039_0105096 | 3300049575 | Bacteria | 2205 |
| 1255 | Ga0501040_0421233 | 3300049576 | Bacteria | 960 |
| 1256 | Ga0501041_0077082 | 3300049577 | Bacteria | 2051 |
| 1257 | Ga0501042_0108256 | 3300049578 | Bacteria | 2001 |
| 1258 | Ga0501048_0092399 | 3300049582 | Bacteria | 2134 |
| 1259 | Ga0501068_0049321 | 3300049584 | Bacteria | 2542 |
| 1260 | Ga0501071_0004724 | 3300049587 | Bacteria | 8663 |
| 1261 | Ga0501071_0007541 | 3300049587 | Bacteria | 7159 |
| 1262 | Ga0501071_0285509 | 3300049587 | Bacteria | 1249 |
| 1263 | Ga0501072_0021337 | 3300049588 | Bacteria | 5024 |
| 1264 | Ga0501072_0098455 | 3300049588 | Bacteria | 2325 |
| 1265 | Ga0501072_0184872 | 3300049588 | Bacteria | 1663 |
| 1266 | Ga0501072_0279864 | 3300049588 | Bacteria | 1327 |
| 1267 | Ga0501073_0003912 | 3300049589 | Bacteria | 11182 |
| 1268 | Ga0501073_0067763 | 3300049589 | Bacteria | 2488 |
| 1269 | Ga0501074_0165643 | 3300049590 | Bacteria | 1578 |
| 1270 | Ga0501074_0334326 | 3300049590 | Bacteria | 1075 |
| 1271 | Ga0501075_0016991 | 3300049591 | Bacteria | 5249 |
| 1272 | Ga0501075_0018228 | 3300049591 | Bacteria | 5077 |
| 1273 | Ga0501075_0019078 | 3300049591 | Bacteria | 4973 |
| 1274 | Ga0501075_0102830 | 3300049591 | Bacteria | 2170 |
| 1275 | Ga0501075_0297963 | 3300049591 | Bacteria | 1229 |
| 1276 | Ga0501076_0048261 | 3300049592 | Bacteria | 3366 |
| 1277 | Ga0501076_0182270 | 3300049592 | Bacteria | 1712 |
| 1278 | Ga0501076_0235636 | 3300049592 | Bacteria | 1497 |
| 1279 | Ga0501077_0000043 | 3300049593 | Bacteria | 64691 |
| 1280 | Ga0501245_010190 | 3300049708 | Bacteria | 1357 |
| 1281 | Ga0501079_0195458 | 3300049741 | Bacteria | 1579 |
| 1282 | Ga0501080_0021064 | 3300049742 | Bacteria | 6034 |
| 1283 | Ga0501081_0019340 | 3300049743 | Bacteria | 4536 |
| 1284 | Ga0501081_0110974 | 3300049743 | Bacteria | 1946 |
| 1285 | Ga0501081_0323217 | 3300049743 | Bacteria | 1134 |
| 1286 | Ga0501081_0393524 | 3300049743 | Bacteria | 1025 |
| 1287 | Ga0501083_0000344 | 3300049744 | Bacteria | 29353 |
| 1288 | Ga0501045_0041721 | 3300049824 | Bacteria | 3339 |
| 1289 | Ga0501045_0042553 | 3300049824 | Bacteria | 3306 |
| 1290 | Ga0501045_0136460 | 3300049824 | Bacteria | 1824 |
| 1291 | Ga0501045_0182038 | 3300049824 | Bacteria | 1566 |
| 1292 | Ga0501045_0222547 | 3300049824 | Bacteria | 1405 |
| 1293 | Ga0501045_0223295 | 3300049824 | Bacteria | 1402 |
| 1294 | nmdc:mga03n38_85892_c1 | 3300050490 | Bacteria | 1488 |
| 1295 | nmdc:mga00v17_19135_c1 | 3300050491 | Bacteria | 3904 |
| 1296 | nmdc:mga00v17_25589_c1 | 3300050491 | Bacteria | 3431 |
| 1297 | nmdc:mga0yw44_18799_c1 | 3300050492 | Bacteria | 3795 |
| 1298 | nmdc:mga0yw44_229433_c1 | 3300050492 | Bacteria | 1232 |
| 1299 | nmdc:mga0yw44_9584_c1 | 3300050492 | Bacteria | 4908 |
| 1300 | nmdc:mga0k408_13637_c1 | 3300050493 | Bacteria | 4462 |
| 1301 | nmdc:mga0k408_1841_c1 | 3300050493 | Bacteria | 11388 |
| 1302 | nmdc:mga0k408_8832_c1 | 3300050493 | Bacteria | 5422 |
| 1303 | nmdc:mga06z11_28023_c1 | 3300050494 | Bacteria | 2699 |
| 1304 | nmdc:mga07m45_82862_c1 | 3300050496 | Bacteria | 1832 |
| 1305 | nmdc:mga05p37_164323_c1 | 3300050507 | Bacteria | 2710 |
| 1306 | nmdc:mga05p37_169992_c1 | 3300050507 | Bacteria | 2659 |
| 1307 | nmdc:mga05p37_225945_c1 | 3300050507 | Bacteria | 2257 |
| 1308 | nmdc:mga05p37_236598_c1 | 3300050507 | Bacteria | 2198 |
| 1309 | nmdc:mga05p37_312137_c1 | 3300050507 | Bacteria | 1863 |
| 1310 | nmdc:mga05p37_343140_c1 | 3300050507 | Bacteria | 1760 |
| 1311 | nmdc:mga05p37_3554_c1 | 3300050507 | Bacteria | 18203 |
| 1312 | nmdc:mga05p37_390622_c1 | 3300050507 | Bacteria | 1627 |
| 1313 | nmdc:mga05p37_39_c1 | 3300050507 | Bacteria | 108676 |
| 1314 | nmdc:mga05p37_524555_c1 | 3300050507 | Bacteria | 1354 |
| 1315 | nmdc:mga05p37_614844_c1 | 3300050507 | Bacteria | 1224 |
| 1316 | nmdc:mga05p37_6916_c1 | 3300050507 | Bacteria | 13371 |
| 1317 | nmdc:mga05p37_799295_c1 | 3300050507 | Bacteria | 1032 |
| 1318 | nmdc:mga05p37_858020_c1 | 3300050507 | Bacteria | 985 |
| 1319 | nmdc:mga09592_10763_c1 | 3300050508 | Bacteria | 7437 |
| 1320 | nmdc:mga09592_1460_c1 | 3300050508 | Bacteria | 18977 |
| 1321 | nmdc:mga09592_180203_c1 | 3300050508 | Bacteria | 1828 |
| 1322 | nmdc:mga09592_222067_c1 | 3300050508 | Bacteria | 1637 |
| 1323 | nmdc:mga09592_330212_c1 | 3300050508 | Bacteria | 1320 |
| 1324 | nmdc:mga09592_434775_c1 | 3300050508 | Unclassified | 1133 |
| 1325 | nmdc:mga09592_52342_c1 | 3300050508 | Bacteria | 3446 |
| 1326 | nmdc:mga0qj67_138887_c1 | 3300050509 | Bacteria | 1970 |
| 1327 | nmdc:mga0qj67_140030_c1 | 3300050509 | Bacteria | 1961 |
| 1328 | nmdc:mga0qj67_20299_c1 | 3300050509 | Bacteria | 5085 |
| 1329 | nmdc:mga0qj67_42389_c1 | 3300050509 | Bacteria | 3582 |
| 1330 | nmdc:mga06r32_150735_c1 | 3300050510 | Bacteria | 2304 |
| 1331 | nmdc:mga06r32_162913_c1 | 3300050510 | Bacteria | 2212 |
| 1332 | nmdc:mga06r32_255429_c1 | 3300050510 | Bacteria | 1740 |
| 1333 | nmdc:mga06r32_478831_c1 | 3300050510 | Bacteria | 1223 |
| 1334 | nmdc:mga06r32_5019_c1 | 3300050510 | Bacteria | 11914 |
| 1335 | nmdc:mga06r32_660704_c1 | 3300050510 | Bacteria | 1013 |
| 1336 | nmdc:mga08y16_129143_c1 | 3300050511 | Bacteria | 2629 |
| 1337 | nmdc:mga08y16_133487_c1 | 3300050511 | Bacteria | 2580 |
| 1338 | nmdc:mga08y16_273278_c1 | 3300050511 | Bacteria | 1744 |
| 1339 | nmdc:mga08y16_37415_c1 | 3300050511 | Bacteria | 5097 |
| 1340 | nmdc:mga08y16_44631_c1 | 3300050511 | Bacteria | 4644 |
| 1341 | nmdc:mga08y16_657702_c1 | 3300050511 | Bacteria | 1051 |
| 1342 | nmdc:mga08y16_80036_c1 | 3300050511 | Bacteria | 3406 |
| 1343 | nmdc:mga0n895_105171_c1 | 3300050512 | Bacteria | 2835 |
| 1344 | nmdc:mga0n895_105329_c1 | 3300050512 | Bacteria | 2833 |
| 1345 | nmdc:mga0n895_12769_c1 | 3300050512 | Bacteria | 7543 |
| 1346 | nmdc:mga0n895_19562_c1 | 3300050512 | Bacteria | 6296 |
| 1347 | nmdc:mga0n895_375584_c1 | 3300050512 | Bacteria | 1439 |
| 1348 | nmdc:mga0n895_37707_c1 | 3300050512 | Bacteria | 4678 |
| 1349 | nmdc:mga0n895_46680_c1 | 3300050512 | Bacteria | 4232 |
| 1350 | nmdc:mga0n895_47_c1 | 3300050512 | Bacteria | 73703 |
| 1351 | nmdc:mga0n895_596743_c1 | 3300050512 | Bacteria | 1107 |
| 1352 | nmdc:mga0n895_6363_c1 | 3300050512 | Bacteria | 10020 |
| 1353 | nmdc:mga0n895_6399_c1 | 3300050512 | Bacteria | 9994 |
| 1354 | nmdc:mga0n895_76648_c1 | 3300050512 | Bacteria | 3325 |
| 1355 | nmdc:mga0rr50_102413_c1 | 3300050513 | Unclassified | 2252 |
| 1356 | nmdc:mga0rr50_129766_c1 | 3300050513 | Bacteria | 2017 |
| 1357 | nmdc:mga0rr50_156206_c1 | 3300050513 | Bacteria | 1848 |
| 1358 | nmdc:mga0rr50_29389_c1 | 3300050513 | Bacteria | 3876 |
| 1359 | nmdc:mga0rr50_298861_c1 | 3300050513 | Bacteria | 1346 |
| 1360 | nmdc:mga0rr50_421_c1 | 3300050513 | Bacteria | 22898 |
| 1361 | nmdc:mga0rr50_7615_c1 | 3300050513 | Bacteria | 6695 |
| 1362 | nmdc:mga08x19_15719_c2 | 3300050514 | Bacteria | 3271 |
| 1363 | nmdc:mga08x19_159_c1 | 3300050514 | Bacteria | 55753 |
| 1364 | nmdc:mga08x19_313964_c1 | 3300050514 | Bacteria | 1090 |
| 1365 | nmdc:mga08x19_3951_c1 | 3300050514 | Bacteria | 8828 |
| 1366 | nmdc:mga08x19_6000_c1 | 3300050514 | Bacteria | 3245 |
| 1367 | nmdc:mga08x19_9447_c1 | 3300050514 | Bacteria | 5839 |
| 1368 | nmdc:mga08x19_94831_c1 | 3300050514 | Bacteria | 1973 |
| 1369 | nmdc:mga0a205_114246_c2 | 3300050515 | Bacteria | 2309 |
| 1370 | nmdc:mga0a205_17697_c1 | 3300050515 | Bacteria | 6688 |
| 1371 | nmdc:mga0a205_208831_c1 | 3300050515 | Bacteria | 1841 |
| 1372 | nmdc:mga0a205_293900_c1 | 3300050515 | Archaea | 1499 |
| 1373 | nmdc:mga0a205_306308_c1 | 3300050515 | Bacteria | 1461 |
| 1374 | nmdc:mga0a205_378_c1 | 3300050515 | Bacteria | 33792 |
| 1375 | nmdc:mga0a205_40587_c1 | 3300050515 | Bacteria | 4481 |
| 1376 | nmdc:mga0a205_507156_c1 | 3300050515 | Unclassified | 1063 |
| 1377 | nmdc:mga0a205_5281_c1 | 3300050515 | Bacteria | 11632 |
| 1378 | nmdc:mga0a205_5870_c1 | 3300050515 | Bacteria | 11055 |
| 1379 | nmdc:mga0a205_618923_c1 | 3300050515 | Bacteria | 935 |
| 1380 | nmdc:mga0a205_73981_c1 | 3300050515 | Bacteria | 3291 |
| 1381 | nmdc:mga0a205_9834_c1 | 3300050515 | Bacteria | 8774 |
| 1382 | nmdc:mga0sz30_133768_c1 | 3300050516 | Bacteria | 1093 |
| 1383 | Ga0495601_0038608 | 3300053077 | Bacteria | 2987 |
| 1384 | Ga0495619_0013765 | 3300053085 | Bacteria | 5103 |
| 1385 | Ga0495619_0083881 | 3300053085 | Unclassified | 2150 |
| 1386 | Ga0500555_005659 | 3300053103 | Bacteria | 3543 |
| 1387 | Ga0501084_0132330 | 3300054114 | Bacteria | 2100 |
| 1388 | Ga0501084_0411300 | 3300054114 | Bacteria | 1143 |
| 1389 | Ga0590071_003929 | 3300059421 | Bacteria | 3637 |
| 1390 | Ga0590074_026271 | 3300059423 | Bacteria | 1017 |
| 1391 | Ga0590075_005479 | 3300059424 | Bacteria | 2996 |
| 1392 | Ga0590077_000183 | 3300059426 | Bacteria | 17882 |
| 1393 | Ga0587080_014860 | 3300059503 | Bacteria | 1209 |
| 1394 | Ga0587083_0019086 | 3300059505 | Bacteria | 1248 |
| 1395 | Ga0587071_020531 | 3300060344 | Bacteria | 1205 |
| 1396 | Ga0501082_0000791 | 3300060353 | Bacteria | 27835 |
| 1397 | Ga0501082_0164048 | 3300060353 | Bacteria | 1931 |
| 1398 | Ga0501082_0177173 | 3300060353 | Bacteria | 1854 |
| 1399 | Ga0501082_0269779 | 3300060353 | Bacteria | 1481 |
| 1400 | Ga0530510_0014030 | 3300061734 | Bacteria | 5648 |
| 1401 | Ga0530510_0139478 | 3300061734 | Bacteria | 1786 |
| 1402 | Ga0530510_0289323 | 3300061734 | Bacteria | 1225 |
| 1403 | 2857597099 | 2857591370 | Bacteria | 6569758 |
| 1404 | 2936340756 | 2936340661 | Bacteria | 5139038 |
| 1405 | 3006973539 | 3006969106 | Bacteria | 4739423 |
| 1406 | Ga0075431_100229517 | |||
| 1407 | LJNas_1000359 | |||
| 1408 | LJNas_1003504 | |||
| 1409 | JGI24751J29686_10004922 | |||
| 1410 | rootL2_10191405 | |||
| 1411 | Ga0065704_10202031 | |||
| 1412 | Ga0065712_10089208 | |||
| 1413 | Ga0065712_10162800 | |||
| 1414 | Ga0065715_10028342 | |||
| 1415 | Ga0065715_10324400 | |||
| 1416 | Ga0065707_10004536 | |||
| 1417 | Ga0065707_10107322 | |||
| 1418 | Ga0065707_10140512 | |||
| 1419 | Ga0070658_10009208 | |||
| 1420 | Ga0070676_10053202 | |||
| 1421 | Ga0070676_10275058 | |||
| 1422 | Ga0070683_100000991 | |||
| 1423 | Ga0070683_100015092 | |||
| 1424 | Ga0070683_100348113 | |||
| 1425 | Ga0070683_100365672 | |||
| 1426 | Ga0070690_100018513 | |||
| 1427 | Ga0070690_100024970 | |||
| 1428 | Ga0070690_100030342 | |||
| 1429 | Ga0070690_100148702 | |||
| 1430 | Ga0070690_100155991 | |||
| 1431 | Ga0070670_100006846 | |||
| 1432 | Ga0070670_100022824 | |||
| 1433 | Ga0070670_100050190 | |||
| 1434 | Ga0070670_100061905 | |||
| 1435 | Ga0068869_100019550 | |||
| 1436 | Ga0068869_100060637 | |||
| 1437 | Ga0068869_100264234 | |||
| 1438 | Ga0070666_10004150 | |||
| 1439 | Ga0070666_10275774 | |||
| 1440 | Ga0070680_100077227 | |||
| 1441 | Ga0070680_100166647 | |||
| 1442 | Ga0070680_100265384 | |||
| 1443 | Ga0070680_100384731 | |||
| 1444 | Ga0070680_100587047 | |||
| 1445 | Ga0068868_100003935 | |||
| 1446 | Ga0068868_100007730 | |||
| 1447 | Ga0068868_100010214 | |||
| 1448 | Ga0068868_100352639 | |||
| 1449 | Ga0070660_100050604 | |||
| 1450 | Ga0070660_100079882 | |||
| 1451 | Ga0070689_100000184 | |||
| 1452 | Ga0070689_100006327 | |||
| 1453 | Ga0070689_100011182 | |||
| 1454 | Ga0070689_100013823 | |||
| 1455 | Ga0070689_100026157 | |||
| 1456 | Ga0070689_100028450 | |||
| 1457 | Ga0070689_100201940 | |||
| 1458 | Ga0070691_10074743 | |||
| 1459 | Ga0070687_100006124 | |||
| 1460 | Ga0070687_100009510 | |||
| 1461 | Ga0070661_100020154 | |||
| 1462 | Ga0070661_100187054 | |||
| 1463 | Ga0070692_10024271 | |||
| 1464 | Ga0070668_100034746 | |||
| 1465 | Ga0070669_100005158 | |||
| 1466 | Ga0070669_100104320 | |||
| 1467 | Ga0070675_100007816 | |||
| 1468 | Ga0070675_100032017 | |||
| 1469 | Ga0070675_100077530 | |||
| 1470 | Ga0070675_100168217 | |||
| 1471 | Ga0070675_100172332 | |||
| 1472 | Ga0070671_100163839 | |||
| 1473 | Ga0070671_100271153 | |||
| 1474 | Ga0070671_100334032 | |||
| 1475 | Ga0070671_100343244 | |||
| 1476 | Ga0070674_100050690 | |||
| 1477 | Ga0070674_100113640 | |||
| 1478 | Ga0070673_100001103 | |||
| 1479 | Ga0070673_100002331 | |||
| 1480 | Ga0070673_100003082 | |||
| 1481 | Ga0070673_100106401 | |||
| 1482 | Ga0070673_100652145 | |||
| 1483 | Ga0070688_100002168 | |||
| 1484 | Ga0070688_100004760 | |||
| 1485 | Ga0070688_100005527 | |||
| 1486 | Ga0070688_100021976 | |||
| 1487 | Ga0070688_100048318 | |||
| 1488 | Ga0070688_100071536 | |||
| 1489 | Ga0070688_100113887 | |||
| 1490 | Ga0070659_100095009 | |||
| 1491 | Ga0070659_100152418 | |||
| 1492 | Ga0070667_100061735 | |||
| 1493 | Ga0070667_100150767 | |||
| 1494 | Ga0070667_100330070 | |||
| 1495 | Ga0070703_10018480 | |||
| 1496 | Ga0070709_10000138 | |||
| 1497 | Ga0070709_10000284 | |||
| 1498 | Ga0070709_10006463 | |||
| 1499 | Ga0070709_10008313 | |||
| 1500 | Ga0070709_10094447 | |||
| 1501 | Ga0070709_10103900 | |||
| 1502 | Ga0070709_10507853 | |||
| 1503 | Ga0070714_100000128 | |||
| 1504 | Ga0070714_100000964 | |||
| 1505 | Ga0070714_100001380 | |||
| 1506 | Ga0070714_100041133 | |||
| 1507 | Ga0070714_100045433 | |||
| 1508 | Ga0070714_100071511 | |||
| 1509 | Ga0070714_100141677 | |||
| 1510 | Ga0070714_100168614 | |||
| 1511 | Ga0070714_100412219 | |||
| 1512 | Ga0070714_100501985 | |||
| 1513 | Ga0070713_100000078 | |||
| 1514 | Ga0070713_100001287 | |||
| 1515 | Ga0070713_100015810 | |||
| 1516 | Ga0070713_100027774 | |||
| 1517 | Ga0070713_100058215 | |||
| 1518 | Ga0070713_100066236 | |||
| 1519 | Ga0070713_100073285 | |||
| 1520 | Ga0070713_100274140 | |||
| 1521 | Ga0070713_100333833 | |||
| 1522 | Ga0070710_10011043 | |||
| 1523 | Ga0070710_10013235 | |||
| 1524 | Ga0070710_10016006 | |||
| 1525 | Ga0070710_10034866 | |||
| 1526 | Ga0070710_10072144 | |||
| 1527 | Ga0070701_10005359 | |||
| 1528 | Ga0070701_10008092 | |||
| 1529 | Ga0070711_100002946 | |||
| 1530 | Ga0070711_100026494 | |||
| 1531 | Ga0070711_100076371 | |||
| 1532 | Ga0070711_100316937 | |||
| 1533 | Ga0070711_100423604 | |||
| 1534 | Ga0070705_100093720 | |||
| 1535 | Ga0070705_100247030 | |||
| 1536 | Ga0070700_100006840 | |||
| 1537 | Ga0070700_100014725 | |||
| 1538 | Ga0070700_100028019 | |||
| 1539 | Ga0070700_100037943 | |||
| 1540 | Ga0070700_100198422 | |||
| 1541 | Ga0070700_100270103 | |||
| 1542 | Ga0070694_100009124 | |||
| 1543 | Ga0070694_100045358 | |||
| 1544 | Ga0070694_100104867 | |||
| 1545 | Ga0070694_100158916 | |||
| 1546 | Ga0070694_100221918 | |||
| 1547 | Ga0070694_100370814 | |||
| 1548 | Ga0070708_100000914 | |||
| 1549 | Ga0070708_100001179 | |||
| 1550 | Ga0070708_100003704 | |||
| 1551 | Ga0070708_100005225 | |||
| 1552 | Ga0070708_100007521 | |||
| 1553 | Ga0070708_100089166 | |||
| 1554 | Ga0070708_100093262 | |||
| 1555 | Ga0070708_100155810 | |||
| 1556 | Ga0070708_100229876 | |||
| 1557 | Ga0070663_100052242 | |||
| 1558 | Ga0070663_100053530 | |||
| 1559 | Ga0070663_100177406 | |||
| 1560 | Ga0070678_100025449 | |||
| 1561 | Ga0070678_100087011 | |||
| 1562 | Ga0070678_100142284 | |||
| 1563 | Ga0070662_100013294 | |||
| 1564 | Ga0070662_100110989 | |||
| 1565 | Ga0070662_100151047 | |||
| 1566 | Ga0070681_10000316 | |||
| 1567 | Ga0070681_10019492 | |||
| 1568 | Ga0070681_10024367 | |||
| 1569 | Ga0070681_10063676 | |||
| 1570 | Ga0070681_10108614 | |||
| 1571 | Ga0070681_10161677 | |||
| 1572 | Ga0070681_10192271 | |||
| 1573 | Ga0070681_10367827 | |||
| 1574 | Ga0070681_10386642 | |||
| 1575 | Ga0068867_100028059 | |||
| 1576 | Ga0068867_100028845 | |||
| 1577 | Ga0068867_100118397 | |||
| 1578 | Ga0070685_10000378 | |||
| 1579 | Ga0070685_10066457 | |||
| 1580 | Ga0070685_10169007 | |||
| 1581 | Ga0070706_100007838 | |||
| 1582 | Ga0070706_100037144 | |||
| 1583 | Ga0070706_100059824 | |||
| 1584 | Ga0070706_100066352 | |||
| 1585 | Ga0070706_100080032 | |||
| 1586 | Ga0070706_100128068 | |||
| 1587 | Ga0070706_100129406 | |||
| 1588 | Ga0070706_100154358 | |||
| 1589 | Ga0070707_100004302 | |||
| 1590 | Ga0070707_100004988 | |||
| 1591 | Ga0070707_100031329 | |||
| 1592 | Ga0070707_100038527 | |||
| 1593 | Ga0070707_100066497 | |||
| 1594 | Ga0070707_100088885 | |||
| 1595 | Ga0070707_100102350 | |||
| 1596 | Ga0070707_100148539 | |||
| 1597 | Ga0070707_100184072 | |||
| 1598 | Ga0070707_100350435 | |||
| 1599 | Ga0070707_100389813 | |||
| 1600 | Ga0070698_100001727 | |||
| 1601 | Ga0070698_100009756 | |||
| 1602 | Ga0070698_100010307 | |||
| 1603 | Ga0070698_100038875 | |||
| 1604 | Ga0070698_100077931 | |||
| 1605 | Ga0070698_100093117 | |||
| 1606 | Ga0070698_100216070 | |||
| 1607 | Ga0070699_100000032 | |||
| 1608 | Ga0070699_100003470 | |||
| 1609 | Ga0070699_100049485 | |||
| 1610 | Ga0070699_100290839 | |||
| 1611 | Ga0070699_100424565 | |||
| 1612 | Ga0070679_100013063 | |||
| 1613 | Ga0070679_100022833 | |||
| 1614 | Ga0070679_100055041 | |||
| 1615 | Ga0070679_100061284 | |||
| 1616 | Ga0070679_100123379 | |||
| 1617 | Ga0070679_100213856 | |||
| 1618 | Ga0070684_100166371 | |||
| 1619 | Ga0070684_100204154 | |||
| 1620 | Ga0070697_100000428 | |||
| 1621 | Ga0070697_100000479 | |||
| 1622 | Ga0070697_100001200 | |||
| 1623 | Ga0070697_100002510 | |||
| 1624 | Ga0070697_100003271 | |||
| 1625 | Ga0070697_100004305 | |||
| 1626 | Ga0070697_100004317 | |||
| 1627 | Ga0070697_100062386 | |||
| 1628 | Ga0070697_100076557 | |||
| 1629 | Ga0070697_100166873 | |||
| 1630 | Ga0070697_100171833 | |||
| 1631 | Ga0070697_100276544 | |||
| 1632 | Ga0068853_100004139 | |||
| 1633 | Ga0068853_100057764 | |||
| 1634 | Ga0068853_100256588 | |||
| 1635 | Ga0070672_100021325 | |||
| 1636 | Ga0070672_100056314 | |||
| 1637 | Ga0070672_100124504 | |||
| 1638 | Ga0070672_100623196 | |||
| 1639 | Ga0070686_100007438 | |||
| 1640 | Ga0070686_100013723 | |||
| 1641 | Ga0070686_100015353 | |||
| 1642 | Ga0070686_100041957 | |||
| 1643 | Ga0070695_100006597 | |||
| 1644 | Ga0070695_100038397 | |||
| 1645 | Ga0070695_100066418 | |||
| 1646 | Ga0070695_100126961 | |||
| 1647 | Ga0070695_100144769 | |||
| 1648 | Ga0070695_100215928 | |||
| 1649 | Ga0070696_100034145 | |||
| 1650 | Ga0070696_100093054 | |||
| 1651 | Ga0070696_100424811 | |||
| 1652 | Ga0070693_100085459 | |||
| 1653 | Ga0070693_100158117 | |||
| 1654 | Ga0070693_100165662 | |||
| 1655 | Ga0070665_100008875 | |||
| 1656 | Ga0070665_100208839 | |||
| 1657 | Ga0070665_100379949 | |||
| 1658 | Ga0070665_100459018 | |||
| 1659 | Ga0070704_100027044 | |||
| 1660 | Ga0070704_100066641 | |||
| 1661 | Ga0070704_100103796 | |||
| 1662 | Ga0070704_100291910 | |||
| 1663 | Ga0068855_100000903 | |||
| 1664 | Ga0068855_100017182 | |||
| 1665 | Ga0068855_100041333 | |||
| 1666 | Ga0068855_100047134 | |||
| 1667 | Ga0068855_100192496 | |||
| 1668 | Ga0068855_100291299 | |||
| 1669 | Ga0070664_100004347 | |||
| 1670 | Ga0070664_100110920 | |||
| 1671 | Ga0070664_100119683 | |||
| 1672 | Ga0070664_100225971 | |||
| 1673 | Ga0070664_100477855 | |||
| 1674 | Ga0068857_100001669 | |||
| 1675 | Ga0068857_100002037 | |||
| 1676 | Ga0068857_100005829 | |||
| 1677 | Ga0068857_100038279 | |||
| 1678 | Ga0068857_100300639 | |||
| 1679 | Ga0068854_100025404 | |||
| 1680 | Ga0068854_100070415 | |||
| 1681 | Ga0068854_100117898 | |||
| 1682 | Ga0068854_100126733 | |||
| 1683 | Ga0068854_100187955 | |||
| 1684 | Ga0068856_100001036 | |||
| 1685 | Ga0068856_100001068 | |||
| 1686 | Ga0068856_100001357 | |||
| 1687 | Ga0068856_100012625 | |||
| 1688 | Ga0068856_100019468 | |||
| 1689 | Ga0068856_100025885 | |||
| 1690 | Ga0068856_100045193 | |||
| 1691 | Ga0070702_100013317 | |||
| 1692 | Ga0070702_100014022 | |||
| 1693 | Ga0070702_100222012 | |||
| 1694 | Ga0068852_100030169 | |||
| 1695 | Ga0068859_100003538 | |||
| 1696 | Ga0068859_100018857 | |||
| 1697 | Ga0068859_100021411 | |||
| 1698 | Ga0068859_100062847 | |||
| 1699 | Ga0068859_100138415 | |||
| 1700 | Ga0068859_100199275 | |||
| 1701 | Ga0068859_100236779 | |||
| 1702 | Ga0068859_100239035 | |||
| 1703 | Ga0068859_100303399 | |||
| 1704 | Ga0068864_100004582 | |||
| 1705 | Ga0068864_100012500 | |||
| 1706 | Ga0068864_100091337 | |||
| 1707 | Ga0068864_100100596 | |||
| 1708 | Ga0068864_100156145 | |||
| 1709 | Ga0068864_100208715 | |||
| 1710 | Ga0068864_100266991 | |||
| 1711 | Ga0068866_10005122 | |||
| 1712 | Ga0068866_10006386 | |||
| 1713 | Ga0068866_10148649 | |||
| 1714 | Ga0068861_100006187 | |||
| 1715 | Ga0068861_100052119 | |||
| 1716 | Ga0068861_100095984 | |||
| 1717 | Ga0068861_100291103 | |||
| 1718 | Ga0068861_100492082 | |||
| 1719 | Ga0068851_10073749 | |||
| 1720 | Ga0068851_10195981 | |||
| 1721 | Ga0068870_10005374 | |||
| 1722 | Ga0068870_10022812 | |||
| 1723 | Ga0068863_100008428 | |||
| 1724 | Ga0068863_100010732 | |||
| 1725 | Ga0068863_100032630 | |||
| 1726 | Ga0068863_100042988 | |||
| 1727 | Ga0068863_100048556 | |||
| 1728 | Ga0068863_100055256 | |||
| 1729 | Ga0068863_100060795 | |||
| 1730 | Ga0068863_100070541 | |||
| 1731 | Ga0068863_100142658 | |||
| 1732 | Ga0068863_100435118 | |||
| 1733 | Ga0068863_100484517 | |||
| 1734 | Ga0068858_100000863 | |||
| 1735 | Ga0068858_100013745 | |||
| 1736 | Ga0068858_100014686 | |||
| 1737 | Ga0068858_100030709 | |||
| 1738 | Ga0068858_100039269 | |||
| 1739 | Ga0068858_100053226 | |||
| 1740 | Ga0068858_100067270 | |||
| 1741 | Ga0068858_100081587 | |||
| 1742 | Ga0068858_100117911 | |||
| 1743 | Ga0068858_100470988 | |||
| 1744 | Ga0068860_100001845 | |||
| 1745 | Ga0068860_100102787 | |||
| 1746 | Ga0068860_100146864 | |||
| 1747 | Ga0068860_100263395 | |||
| 1748 | Ga0068860_100420973 | |||
| 1749 | Ga0068860_100621445 | |||
| 1750 | Ga0068862_100117465 | |||
| 1751 | Ga0068862_100153161 | |||
| 1752 | Ga0070717_10001077 | |||
| 1753 | Ga0070717_10001266 | |||
| 1754 | Ga0070717_10003483 | |||
| 1755 | Ga0070717_10006090 | |||
| 1756 | Ga0070717_10006698 | |||
| 1757 | Ga0070717_10023366 | |||
| 1758 | Ga0070717_10046031 | |||
| 1759 | Ga0070717_10061714 | |||
| 1760 | Ga0070717_10063108 | |||
| 1761 | Ga0070717_10069440 | |||
| 1762 | Ga0070717_10130057 | |||
| 1763 | Ga0070717_10159781 | |||
| 1764 | Ga0070717_10288595 | |||
| 1765 | Ga0070717_10495451 | |||
| 1766 | Ga0070717_10658407 | |||
| 1767 | Ga0075365_10000429 | |||
| 1768 | Ga0075365_10091326 | |||
| 1769 | Ga0075365_10109191 | |||
| 1770 | Ga0075368_10032852 | |||
| 1771 | Ga0075364_10000947 | |||
| 1772 | Ga0075364_10026447 | |||
| 1773 | Ga0070715_10001890 | |||
| 1774 | Ga0070715_10002920 | |||
| 1775 | Ga0070715_10004444 | |||
| 1776 | Ga0070715_10068834 | |||
| 1777 | Ga0070716_100000779 | |||
| 1778 | Ga0070716_100006385 | |||
| 1779 | Ga0070716_100009249 | |||
| 1780 | Ga0070716_100024016 | |||
| 1781 | Ga0070716_100069019 | |||
| 1782 | Ga0070716_100104326 | |||
| 1783 | Ga0070716_100183016 | |||
| 1784 | Ga0070716_100213333 | |||
| 1785 | Ga0070716_100217950 | |||
| 1786 | Ga0070716_100290949 | |||
| 1787 | Ga0070712_100000047 | |||
| 1788 | Ga0070712_100000914 | |||
| 1789 | Ga0070712_100001184 | |||
| 1790 | Ga0070712_100007837 | |||
| 1791 | Ga0070712_100012588 | |||
| 1792 | Ga0070712_100166529 | |||
| 1793 | Ga0075362_10001899 | |||
| 1794 | Ga0075367_10033942 | |||
| 1795 | Ga0075366_10001679 | |||
| 1796 | Ga0075366_10012914 | |||
| 1797 | Ga0097621_100000216 | |||
| 1798 | Ga0097621_100005019 | |||
| 1799 | Ga0097621_100005239 | |||
| 1800 | Ga0097621_100012248 | |||
| 1801 | Ga0097621_100058175 | |||
| 1802 | Ga0097621_100066986 | |||
| 1803 | Ga0097621_100130792 | |||
| 1804 | Ga0097621_100190453 | |||
| 1805 | Ga0075370_10017085 | |||
| 1806 | Ga0068871_100000149 | |||
| 1807 | Ga0068871_100000182 | |||
| 1808 | Ga0068871_100007539 | |||
| 1809 | Ga0068871_100011744 | |||
| 1810 | Ga0068871_100120248 | |||
| 1811 | Ga0068871_100138512 | |||
| 1812 | Ga0068871_100294310 | |||
| 1813 | Ga0068871_100356545 | |||
| 1814 | Ga0068871_100422980 | |||
| 1815 | Ga0075428_100010054 | |||
| 1816 | Ga0075428_100037185 | |||
| 1817 | Ga0075428_100043709 | |||
| 1818 | Ga0075428_100044305 | |||
| 1819 | Ga0075428_100058957 | |||
| 1820 | Ga0075428_100070197 | |||
| 1821 | Ga0075428_100074509 | |||
| 1822 | Ga0075428_100120095 | |||
| 1823 | Ga0075428_100126601 | |||
| 1824 | Ga0075428_100178364 | |||
| 1825 | Ga0075428_100201184 | |||
| 1826 | Ga0075428_100222194 | |||
| 1827 | Ga0075428_100233383 | |||
| 1828 | Ga0075428_100267706 | |||
| 1829 | Ga0075430_100042326 | |||
| 1830 | Ga0075430_100052081 | |||
| 1831 | Ga0075430_100119035 | |||
| 1832 | Ga0075430_100126973 | |||
| 1833 | Ga0075431_100000894 | |||
| 1834 | Ga0075431_100001697 | |||
| 1835 | Ga0075431_100017096 | |||
| 1836 | Ga0075431_100028432 | |||
| 1837 | Ga0075431_100057498 | |||
| 1838 | Ga0075431_100199680 | |||
| 1839 | Ga0075433_10004042 | |||
| 1840 | Ga0075433_10004179 | |||
| 1841 | Ga0075433_10007296 | |||
| 1842 | Ga0075433_10074069 | |||
| 1843 | Ga0075433_10096949 | |||
| 1844 | Ga0075433_10159143 | |||
| 1845 | Ga0075433_10305236 | |||
| 1846 | Ga0075433_10455798 | |||
| 1847 | Ga0075434_100000987 | |||
| 1848 | Ga0075434_100005262 | |||
| 1849 | Ga0075434_100007333 | |||
| 1850 | Ga0075434_100014060 | |||
| 1851 | Ga0075434_100014264 | |||
| 1852 | Ga0075434_100016262 | |||
| 1853 | Ga0075434_100018693 | |||
| 1854 | Ga0075434_100023184 | |||
| 1855 | Ga0075434_100028761 | |||
| 1856 | Ga0075434_100063412 | |||
| 1857 | Ga0075434_100084855 | |||
| 1858 | Ga0075434_100169274 | |||
| 1859 | Ga0075434_100215449 | |||
| 1860 | Ga0075434_100450959 | |||
| 1861 | Ga0075429_100001963 | |||
| 1862 | Ga0075429_100012743 | |||
| 1863 | Ga0075429_100023159 | |||
| 1864 | Ga0075429_100033426 | |||
| 1865 | Ga0075429_100038554 | |||
| 1866 | Ga0075429_100077611 | |||
| 1867 | Ga0075429_100077751 | |||
| 1868 | Ga0075429_100208098 | |||
| 1869 | Ga0075429_100235784 | |||
| 1870 | Ga0075429_100251579 | |||
| 1871 | Ga0068865_100007294 | |||
| 1872 | Ga0068865_100038170 | |||
| 1873 | Ga0068865_100079007 | |||
| 1874 | Ga0075436_100002937 | |||
| 1875 | Ga0075436_100017840 | |||
| 1876 | Ga0075436_100026209 | |||
| 1877 | Ga0075436_100043133 | |||
| 1878 | Ga0075436_100059276 | |||
| 1879 | Ga0075436_100064009 | |||
| 1880 | Ga0097620_100003538 | |||
| 1881 | Ga0097620_100018858 | |||
| 1882 | Ga0097620_100021409 | |||
| 1883 | Ga0097620_100062854 | |||
| 1884 | Ga0097620_100138407 | |||
| 1885 | Ga0097620_100199273 | |||
| 1886 | Ga0097620_100236782 | |||
| 1887 | Ga0097620_100239021 | |||
| 1888 | Ga0097620_100303404 | |||
| 1889 | Ga0075435_100000105 | |||
| 1890 | Ga0075435_100003136 | |||
| 1891 | Ga0075435_100020470 | |||
| 1892 | Ga0075435_100034710 | |||
| 1893 | Ga0075435_100136088 | |||
| 1894 | Ga0075435_100138133 | |||
| 1895 | Ga0075435_100288157 | |||
| 1896 | Ga0075435_100421035 | |||
| 1897 | Ga0099794_10005644 | |||
| 1898 | Ga0099794_10074530 | |||
| 1899 | Ga0099794_10107237 | |||
| 1900 | Ga0099794_10113625 | |||
| 1901 | Ga0099795_10029118 | |||
| 1902 | Ga0105240_10031012 | |||
| 1903 | Ga0105240_10041881 | |||
| 1904 | Ga0105240_10073003 | |||
| 1905 | Ga0105240_10073406 | |||
| 1906 | Ga0105240_10128137 | |||
| 1907 | Ga0105240_10147534 | |||
| 1908 | Ga0105240_10387765 | |||
| 1909 | Ga0105240_10591779 | |||
| 1910 | Ga0111539_10002268 | |||
| 1911 | Ga0111539_10021616 | |||
| 1912 | Ga0111539_10041896 | |||
| 1913 | Ga0111539_10062047 | |||
| 1914 | Ga0111539_10067230 | |||
| 1915 | Ga0111539_10158272 | |||
| 1916 | Ga0111539_10208377 | |||
| 1917 | Ga0111539_10209069 | |||
| 1918 | Ga0111539_10252493 | |||
| 1919 | Ga0111539_10320090 | |||
| 1920 | Ga0111539_10452042 | |||
| 1921 | Ga0105245_10000595 | |||
| 1922 | Ga0105245_10001513 | |||
| 1923 | Ga0105245_10030639 | |||
| 1924 | Ga0105247_10021352 | |||
| 1925 | Ga0105247_10188822 | |||
| 1926 | Ga0114129_10000027 | |||
| 1927 | Ga0114129_10000183 | |||
| 1928 | Ga0114129_10005840 | |||
| 1929 | Ga0114129_10008305 | |||
| 1930 | Ga0114129_10025642 | |||
| 1931 | Ga0114129_10027882 | |||
| 1932 | Ga0114129_10040995 | |||
| 1933 | Ga0114129_10077296 | |||
| 1934 | Ga0114129_10091712 | |||
| 1935 | Ga0114129_10107223 | |||
| 1936 | Ga0114129_10112098 | |||
| 1937 | Ga0114129_10137473 | |||
| 1938 | Ga0114129_10146134 | |||
| 1939 | Ga0114129_10331302 | |||
| 1940 | Ga0114129_10370902 | |||
| 1941 | Ga0114129_10406793 | |||
| 1942 | Ga0105243_10007785 | |||
| 1943 | Ga0105241_10002493 | |||
| 1944 | Ga0105241_10003544 | |||
| 1945 | Ga0105241_10041643 | |||
| 1946 | Ga0105241_10113739 | |||
| 1947 | Ga0105241_10334867 | |||
| 1948 | Ga0105242_10024581 | |||
| 1949 | Ga0105242_10072798 | |||
| 1950 | Ga0105242_10391738 | |||
| 1951 | Ga0105248_10007674 | |||
| 1952 | Ga0105248_10010838 | |||
| 1953 | Ga0105248_10014674 | |||
| 1954 | Ga0105248_10015732 | |||
| 1955 | Ga0105248_10073972 | |||
| 1956 | Ga0105248_10074281 | |||
| 1957 | Ga0105248_10589686 | |||
| 1958 | Ga0105237_10054290 | |||
| 1959 | Ga0105237_10075899 | |||
| 1960 | Ga0105237_10082202 | |||
| 1961 | Ga0105237_10569626 | |||
| 1962 | Ga0105237_10577160 | |||
| 1963 | Ga0105238_10044311 | |||
| 1964 | Ga0105238_10209625 | |||
| 1965 | Ga0105238_10283116 | |||
| 1966 | Ga0105238_10440790 | |||
| 1967 | Ga0105249_10017814 | |||
| 1968 | Ga0105249_10076406 | |||
| 1969 | Ga0105249_10198628 | |||
| 1970 | Ga0105249_10210392 | |||
| 1971 | Ga0105249_10461220 | |||
| 1972 | Ga0099796_10019613 | |||
| 1973 | Ga0105239_10078320 | |||
| 1974 | Ga0105239_10090363 | |||
| 1975 | Ga0105239_10235811 | |||
| 1976 | Ga0105239_10377531 | |||
| 1977 | Ga0105246_10026331 | |||
| 1978 | Ga0105246_10034089 | |||
| 1979 | Ga0105246_10108039 | |||
| 1980 | Ga0157373_10004228 | |||
| 1981 | Ga0157373_10059701 | |||
| 1982 | Ga0157373_10073908 | |||
| 1983 | Ga0157373_10090650 | |||
| 1984 | Ga0157373_10334940 | |||
| 1985 | Ga0157371_10044461 | |||
| 1986 | Ga0157370_10009209 | |||
| 1987 | Ga0157370_10368753 | |||
| 1988 | Ga0157369_10001537 | |||
| 1989 | Ga0157369_10002128 | |||
| 1990 | Ga0157369_10010332 | |||
| 1991 | Ga0157369_10011085 | |||
| 1992 | Ga0157369_10121476 | |||
| 1993 | Ga0157369_10190717 | |||
| 1994 | Ga0157369_10294183 | |||
| 1995 | Ga0157369_10363681 | |||
| 1996 | Ga0157374_10000090 | |||
| 1997 | Ga0157374_10000483 | |||
| 1998 | Ga0157374_10000804 | |||
| 1999 | Ga0157374_10027327 | |||
| 2000 | Ga0157374_10116821 | |||
| 2001 | Ga0157374_10251098 | |||
| 2002 | Ga0157378_10000070 | |||
| 2003 | Ga0157378_10000487 | |||
| 2004 | Ga0157378_10002859 | |||
| 2005 | Ga0157378_10042068 | |||
| 2006 | Ga0157378_10108888 | |||
| 2007 | Ga0157378_10219858 | |||
| 2008 | Ga0163162_10123571 | |||
| 2009 | Ga0157372_10000211 | |||
| 2010 | Ga0157372_10002476 | |||
| 2011 | Ga0157372_10008246 | |||
| 2012 | Ga0157372_10009031 | |||
| 2013 | Ga0157372_10009482 | |||
| 2014 | Ga0157372_10036083 | |||
| 2015 | Ga0157372_10045292 | |||
| 2016 | Ga0157372_10090650 | |||
| 2017 | Ga0157372_10093403 | |||
| 2018 | Ga0157372_10110928 | |||
| 2019 | Ga0157372_10143748 | |||
| 2020 | Ga0157372_10244051 | |||
| 2021 | Ga0157372_10827777 | |||
| 2022 | Ga0157375_10080338 | |||
| 2023 | Ga0157375_10116181 | |||
| 2024 | Ga0163163_10000034 | |||
| 2025 | Ga0163163_10001046 | |||
| 2026 | Ga0163163_10003961 | |||
| 2027 | Ga0163163_10038058 | |||
| 2028 | Ga0163163_10068514 | |||
| 2029 | Ga0163163_10193586 | |||
| 2030 | Ga0163163_10370274 | |||
| 2031 | Ga0163163_10465775 | |||
| 2032 | Ga0157380_10003290 | |||
| 2033 | Ga0157380_10008166 | |||
| 2034 | Ga0157380_10055678 | |||
| 2035 | Ga0157380_10083337 | |||
| 2036 | Ga0157380_10179700 | |||
| 2037 | Ga0157380_10263977 | |||
| 2038 | Ga0157380_10403349 | |||
| 2039 | Ga0182008_10127067 | |||
| 2040 | Ga0157377_10003510 | |||
| 2041 | Ga0157377_10008189 | |||
| 2042 | Ga0157379_10110914 | |||
| 2043 | Ga0157379_10137271 | |||
| 2044 | Ga0157379_10152512 | |||
| 2045 | Ga0157379_10477609 | |||
| 2046 | Ga0157376_10000036 | |||
| 2047 | Ga0157376_10003183 | |||
| 2048 | Ga0157376_10107190 | |||
| 2049 | Ga0157376_10440019 | |||
| 2050 | Ga0157376_10604258 | |||
| 2051 | Ga0182006_1023521 | |||
| 2052 | Ga0182005_1017246 | |||
| 2053 | Ga0163161_10001109 | |||
| 2054 | Ga0213873_10050233 | |||
| 2055 | Ga0213874_10015900 | |||
| 2056 | Ga0224570_101423 | |||
| 2057 | Ga0224572_1003844 | |||
| 2058 | Ga0228598_1000649 | |||
| 2059 | Ga0228598_1001051 | |||
| 2060 | Ga0228598_1001059 | |||
| 2061 | Ga0228598_1004139 | |||
| 2062 | Ga0209147_100154 | |||
| 2063 | Ga0207697_10007679 | |||
| 2064 | Ga0207697_10150018 | |||
| 2065 | Ga0207656_10019653 | |||
| 2066 | Ga0207656_10057292 | |||
| 2067 | Ga0207653_10004964 | |||
| 2068 | Ga0207653_10040715 | |||
| 2069 | Ga0207692_10007523 | |||
| 2070 | Ga0207692_10021238 | |||
| 2071 | Ga0207692_10044340 | |||
| 2072 | Ga0207642_10001445 | |||
| 2073 | Ga0207642_10023424 | |||
| 2074 | Ga0207642_10097699 | |||
| 2075 | Ga0207688_10064623 | |||
| 2076 | Ga0207680_10036807 | |||
| 2077 | Ga0207680_10126764 | |||
| 2078 | Ga0207647_10000762 | |||
| 2079 | Ga0207647_10006360 | |||
| 2080 | Ga0207647_10009306 | |||
| 2081 | Ga0207685_10000326 | |||
| 2082 | Ga0207685_10015400 | |||
| 2083 | Ga0207685_10083622 | |||
| 2084 | Ga0207685_10102571 | |||
| 2085 | Ga0207685_10118870 | |||
| 2086 | Ga0207699_10000086 | |||
| 2087 | Ga0207699_10027348 | |||
| 2088 | Ga0207699_10068991 | |||
| 2089 | Ga0207699_10109593 | |||
| 2090 | Ga0207699_10245144 | |||
| 2091 | Ga0207699_10267058 | |||
| 2092 | Ga0207699_10295263 | |||
| 2093 | Ga0207645_10000019 | |||
| 2094 | Ga0207645_10011521 | |||
| 2095 | Ga0207645_10026140 | |||
| 2096 | Ga0207643_10000432 | |||
| 2097 | Ga0207643_10062787 | |||
| 2098 | Ga0207684_10000238 | |||
| 2099 | Ga0207684_10001476 | |||
| 2100 | Ga0207684_10012964 | |||
| 2101 | Ga0207684_10024595 | |||
| 2102 | Ga0207684_10064397 | |||
| 2103 | Ga0207684_10067679 | |||
| 2104 | Ga0207684_10097810 | |||
| 2105 | Ga0207654_10031354 | |||
| 2106 | Ga0207654_10050556 | |||
| 2107 | Ga0207654_10200501 | |||
| 2108 | Ga0207707_10006534 | |||
| 2109 | Ga0207707_10031794 | |||
| 2110 | Ga0207707_10169048 | |||
| 2111 | Ga0207707_10237536 | |||
| 2112 | Ga0207707_10314554 | |||
| 2113 | Ga0207707_10326590 | |||
| 2114 | Ga0207695_10027677 | |||
| 2115 | Ga0207695_10031749 | |||
| 2116 | Ga0207695_10042363 | |||
| 2117 | Ga0207695_10062388 | |||
| 2118 | Ga0207695_10086813 | |||
| 2119 | Ga0207695_10371531 | |||
| 2120 | Ga0207671_10048960 | |||
| 2121 | Ga0207671_10114372 | |||
| 2122 | Ga0207671_10125992 | |||
| 2123 | Ga0207671_10154248 | |||
| 2124 | Ga0207693_10000044 | |||
| 2125 | Ga0207693_10000546 | |||
| 2126 | Ga0207693_10027913 | |||
| 2127 | Ga0207693_10033092 | |||
| 2128 | Ga0207693_10055195 | |||
| 2129 | Ga0207693_10112115 | |||
| 2130 | Ga0207693_10147372 | |||
| 2131 | Ga0207693_10240265 | |||
| 2132 | Ga0207693_10353098 | |||
| 2133 | Ga0207663_10000745 | |||
| 2134 | Ga0207663_10050357 | |||
| 2135 | Ga0207663_10073401 | |||
| 2136 | Ga0207663_10226252 | |||
| 2137 | Ga0207663_10324988 | |||
| 2138 | Ga0207660_10061432 | |||
| 2139 | Ga0207660_10121961 | |||
| 2140 | Ga0207660_10125457 | |||
| 2141 | Ga0207660_10282655 | |||
| 2142 | Ga0207660_10519789 | |||
| 2143 | Ga0207662_10001347 | |||
| 2144 | Ga0207662_10008827 | |||
| 2145 | Ga0207662_10010238 | |||
| 2146 | Ga0207657_10014641 | |||
| 2147 | Ga0207657_10015652 | |||
| 2148 | Ga0207649_10000188 | |||
| 2149 | Ga0207649_10140980 | |||
| 2150 | Ga0207652_10016502 | |||
| 2151 | Ga0207652_10018680 | |||
| 2152 | Ga0207652_10062271 | |||
| 2153 | Ga0207652_10064820 | |||
| 2154 | Ga0207652_10287692 | |||
| 2155 | Ga0207652_10561437 | |||
| 2156 | Ga0207646_10000073 | |||
| 2157 | Ga0207646_10000404 | |||
| 2158 | Ga0207646_10000549 | |||
| 2159 | Ga0207646_10000901 | |||
| 2160 | Ga0207646_10021264 | |||
| 2161 | Ga0207646_10051234 | |||
| 2162 | Ga0207646_10060879 | |||
| 2163 | Ga0207646_10061042 | |||
| 2164 | Ga0207646_10121735 | |||
| 2165 | Ga0207646_10168414 | |||
| 2166 | Ga0207646_10298421 | |||
| 2167 | Ga0207646_10332503 | |||
| 2168 | Ga0207646_10350425 | |||
| 2169 | Ga0207681_10050607 | |||
| 2170 | Ga0207681_10096609 | |||
| 2171 | Ga0207681_10184689 | |||
| 2172 | Ga0207694_10002864 | |||
| 2173 | Ga0207694_10129212 | |||
| 2174 | Ga0207694_10153520 | |||
| 2175 | Ga0207650_10000024 | |||
| 2176 | Ga0207650_10014362 | |||
| 2177 | Ga0207650_10016981 | |||
| 2178 | Ga0207650_10048919 | |||
| 2179 | Ga0207659_10120442 | |||
| 2180 | Ga0207687_10020670 | |||
| 2181 | Ga0207687_10042288 | |||
| 2182 | Ga0207687_10118379 | |||
| 2183 | Ga0207700_10000090 | |||
| 2184 | Ga0207700_10000101 | |||
| 2185 | Ga0207700_10003111 | |||
| 2186 | Ga0207700_10015567 | |||
| 2187 | Ga0207700_10018678 | |||
| 2188 | Ga0207700_10049934 | |||
| 2189 | Ga0207700_10056721 | |||
| 2190 | Ga0207700_10059747 | |||
| 2191 | Ga0207700_10094477 | |||
| 2192 | Ga0207700_10125422 | |||
| 2193 | Ga0207700_10137766 | |||
| 2194 | Ga0207700_10321120 | |||
| 2195 | Ga0207700_10359946 | |||
| 2196 | Ga0207664_10000033 | |||
| 2197 | Ga0207664_10003224 | |||
| 2198 | Ga0207664_10026443 | |||
| 2199 | Ga0207664_10034850 | |||
| 2200 | Ga0207664_10047673 | |||
| 2201 | Ga0207664_10048728 | |||
| 2202 | Ga0207664_10109197 | |||
| 2203 | Ga0207664_10165614 | |||
| 2204 | Ga0207664_10490768 | |||
| 2205 | Ga0207644_10080909 | |||
| 2206 | Ga0207644_10300817 | |||
| 2207 | Ga0207690_10190626 | |||
| 2208 | Ga0207706_10000912 | |||
| 2209 | Ga0207706_10018727 | |||
| 2210 | Ga0207706_10097325 | |||
| 2211 | Ga0207706_10106514 | |||
| 2212 | Ga0207686_10069502 | |||
| 2213 | Ga0207709_10023571 | |||
| 2214 | Ga0207670_10000141 | |||
| 2215 | Ga0207670_10015668 | |||
| 2216 | Ga0207670_10033997 | |||
| 2217 | Ga0207670_10034780 | |||
| 2218 | Ga0207670_10088630 | |||
| 2219 | Ga0207669_10052866 | |||
| 2220 | Ga0207669_10087772 | |||
| 2221 | Ga0207704_10039453 | |||
| 2222 | Ga0207704_10048675 | |||
| 2223 | Ga0207704_10129925 | |||
| 2224 | Ga0207704_10201320 | |||
| 2225 | Ga0207665_10000119 | |||
| 2226 | Ga0207665_10000189 | |||
| 2227 | Ga0207665_10002959 | |||
| 2228 | Ga0207665_10003250 | |||
| 2229 | Ga0207665_10011641 | |||
| 2230 | Ga0207665_10016061 | |||
| 2231 | Ga0207665_10063549 | |||
| 2232 | Ga0207665_10262538 | |||
| 2233 | Ga0207665_10298159 | |||
| 2234 | Ga0207691_10004229 | |||
| 2235 | Ga0207691_10030878 | |||
| 2236 | Ga0207691_10313776 | |||
| 2237 | Ga0207711_10018665 | |||
| 2238 | Ga0207711_10025149 | |||
| 2239 | Ga0207711_10036791 | |||
| 2240 | Ga0207711_10103474 | |||
| 2241 | Ga0207711_10108426 | |||
| 2242 | Ga0207711_10258700 | |||
| 2243 | Ga0207711_10436321 | |||
| 2244 | Ga0207711_10616574 | |||
| 2245 | Ga0207711_10625560 | |||
| 2246 | Ga0207689_10000078 | |||
| 2247 | Ga0207689_10001992 | |||
| 2248 | Ga0207689_10061265 | |||
| 2249 | Ga0207689_10094678 | |||
| 2250 | Ga0207689_10106543 | |||
| 2251 | Ga0207661_10000067 | |||
| 2252 | Ga0207661_10034875 | |||
| 2253 | Ga0207661_10097469 | |||
| 2254 | Ga0207661_10171334 | |||
| 2255 | Ga0207661_10216238 | |||
| 2256 | Ga0207661_10281170 | |||
| 2257 | Ga0207679_10000055 | |||
| 2258 | Ga0207679_10237117 | |||
| 2259 | Ga0207679_10336599 | |||
| 2260 | Ga0207667_10000170 | |||
| 2261 | Ga0207667_10012321 | |||
| 2262 | Ga0207667_10051637 | |||
| 2263 | Ga0207667_10467898 | |||
| 2264 | Ga0207667_10548774 | |||
| 2265 | Ga0207667_10696269 | |||
| 2266 | Ga0207651_10021937 | |||
| 2267 | Ga0207651_10029315 | |||
| 2268 | Ga0207651_10131212 | |||
| 2269 | Ga0207651_10281693 | |||
| 2270 | Ga0207712_10166892 | |||
| 2271 | Ga0207712_10177116 | |||
| 2272 | Ga0207712_10412996 | |||
| 2273 | Ga0207640_10189232 | |||
| 2274 | Ga0207640_10393175 | |||
| 2275 | Ga0207658_10016816 | |||
| 2276 | Ga0207658_10068741 | |||
| 2277 | Ga0207677_10004744 | |||
| 2278 | Ga0207677_10006247 | |||
| 2279 | Ga0207677_10046574 | |||
| 2280 | Ga0207677_10116961 | |||
| 2281 | Ga0207677_10258727 | |||
| 2282 | Ga0207703_10001408 | |||
| 2283 | Ga0207703_10002734 | |||
| 2284 | Ga0207703_10012584 | |||
| 2285 | Ga0207703_10056476 | |||
| 2286 | Ga0207703_10064537 | |||
| 2287 | Ga0207703_10068712 | |||
| 2288 | Ga0207703_10137271 | |||
| 2289 | Ga0207703_10445242 | |||
| 2290 | Ga0207639_10002287 | |||
| 2291 | Ga0207639_10147401 | |||
| 2292 | Ga0207639_10328425 | |||
| 2293 | Ga0207678_10001331 | |||
| 2294 | Ga0207678_10016835 | |||
| 2295 | Ga0207678_10040295 | |||
| 2296 | Ga0207708_10002845 | |||
| 2297 | Ga0207708_10022762 | |||
| 2298 | Ga0207708_10055446 | |||
| 2299 | Ga0207708_10057688 | |||
| 2300 | Ga0207708_10176109 | |||
| 2301 | Ga0207708_10201559 | |||
| 2302 | Ga0207702_10001597 | |||
| 2303 | Ga0207702_10006327 | |||
| 2304 | Ga0207702_10012220 | |||
| 2305 | Ga0207702_10306649 | |||
| 2306 | Ga0207702_10465181 | |||
| 2307 | Ga0207641_10000030 | |||
| 2308 | Ga0207641_10008766 | |||
| 2309 | Ga0207641_10009428 | |||
| 2310 | Ga0207641_10012702 | |||
| 2311 | Ga0207641_10052353 | |||
| 2312 | Ga0207641_10083664 | |||
| 2313 | Ga0207641_10135955 | |||
| 2314 | Ga0207641_10160978 | |||
| 2315 | Ga0207648_10000031 | |||
| 2316 | Ga0207648_10001943 | |||
| 2317 | Ga0207648_10039856 | |||
| 2318 | Ga0207676_10000915 | |||
| 2319 | Ga0207676_10033311 | |||
| 2320 | Ga0207676_10037233 | |||
| 2321 | Ga0207676_10083058 | |||
| 2322 | Ga0207676_10134395 | |||
| 2323 | Ga0207676_10245686 | |||
| 2324 | Ga0207676_10416817 | |||
| 2325 | Ga0207674_10000618 | |||
| 2326 | Ga0207674_10002087 | |||
| 2327 | Ga0207674_10002424 | |||
| 2328 | Ga0207674_10009625 | |||
| 2329 | Ga0207674_10048473 | |||
| 2330 | Ga0207674_10056136 | |||
| 2331 | Ga0207675_100009496 | |||
| 2332 | Ga0207675_100032163 | |||
| 2333 | Ga0207675_100063435 | |||
| 2334 | Ga0207675_100203600 | |||
| 2335 | Ga0207675_100239928 | |||
| 2336 | Ga0207675_100358070 | |||
| 2337 | Ga0207675_100431560 | |||
| 2338 | Ga0207683_10005417 | |||
| 2339 | Ga0207683_10207205 | |||
| 2340 | Ga0207698_10075494 | |||
| 2341 | Ga0207698_10136086 | |||
| 2342 | Ga0207698_10280262 | |||
| 2343 | Ga0209588_1002596 | |||
| 2344 | Ga0209588_1025474 | |||
| 2345 | Ga0209588_1029634 | |||
| 2346 | Ga0209588_1034262 | |||
| 2347 | Ga0207428_10001654 | |||
| 2348 | Ga0207428_10016548 | |||
| 2349 | Ga0207428_10031295 | |||
| 2350 | Ga0207428_10103863 | |||
| 2351 | Ga0207428_10431962 | |||
| 2352 | Ga0265354_1004808 | |||
| 2353 | Ga0268266_10000267 | |||
| 2354 | Ga0268266_10034893 | |||
| 2355 | Ga0268265_10039533 | |||
| 2356 | Ga0268265_10153074 | |||
| 2357 | Ga0268265_10207647 | |||
| 2358 | Ga0268265_10380205 | |||
| 2359 | Ga0268264_10002804 | |||
| 2360 | Ga0268264_10031874 | |||
| 2361 | Ga0268264_10074418 | |||
| 2362 | Ga0268264_10110236 | |||
| 2363 | Ga0268264_10166635 | |||
| 2364 | Ga0268264_10185711 | |||
| 2365 | Ga0268264_10547041 | |||
| 2366 | Ga0265338_10007491 | |||
| 2367 | Ga0265338_10011560 | |||
| 2368 | Ga0265338_10014474 | |||
| 2369 | Ga0265338_10070199 | |||
| 2370 | Ga0265338_10131633 | |||
| 2371 | Ga0265338_10170857 | |||
| 2372 | Ga0265338_10193154 | |||
| 2373 | Ga0265338_10204382 | |||
| 2374 | Ga0265762_1000146 | |||
| 2375 | Ga0265762_1001607 | |||
| 2376 | Ga0265765_1003037 | |||
| 2377 | Ga0265765_1004376 | |||
| 2378 | Ga0265760_10000033 | |||
| 2379 | Ga0265760_10000516 | |||
| 2380 | Ga0265760_10000551 | |||
| 2381 | Ga0265760_10007507 | |||
| 2382 | Ga0265760_10017032 | |||
| 2383 | Ga0265325_10003889 | |||
| 2384 | Ga0265325_10089462 | |||
| 2385 | Ga0265339_10013118 | |||
| 2386 | Ga0265339_10021085 | |||
| 2387 | Ga0265339_10070869 | |||
| 2388 | Ga0265339_10212035 | |||
| 2389 | Ga0265316_10004100 | |||
| 2390 | Ga0265316_10014092 | |||
| 2391 | Ga0265316_10167267 | |||
| 2392 | Ga0265316_10362333 | |||
| 2393 | Ga0307408_100078226 | |||
| 2394 | Ga0265313_10076717 | |||
| 2395 | Ga0307508_10023956 | |||
| 2396 | Ga0265314_10001876 | |||
| 2397 | Ga0265314_10034143 | |||
| 2398 | Ga0265342_10057898 | |||
| 2399 | Ga0307405_10050076 | |||
| 2400 | Ga0307413_10080006 | |||
| 2401 | Ga0307413_10174722 | |||
| 2402 | Ga0307410_10006425 | |||
| 2403 | Ga0307410_10034902 | |||
| 2404 | Ga0307406_10052850 | |||
| 2405 | Ga0307406_10060013 | |||
| 2406 | Ga0307407_10022500 | |||
| 2407 | Ga0307407_10047661 | |||
| 2408 | Ga0307407_10155317 | |||
| 2409 | Ga0307409_100020464 | |||
| 2410 | Ga0307409_100035032 | |||
| 2411 | Ga0307409_100182172 | |||
| 2412 | Ga0307416_100077169 | |||
| 2413 | Ga0307416_100188528 | |||
| 2414 | Ga0307416_100229040 | |||
| 2415 | Ga0307416_100709093 | |||
| 2416 | Ga0307414_10100879 | |||
| 2417 | Ga0307414_10345737 | |||
| 2418 | Ga0307411_10004555 | |||
| 2419 | Ga0307411_10038177 | |||
| 2420 | Ga0307411_10114283 | |||
| 2421 | Ga0307411_10128059 | |||
| 2422 | Ga0307415_100045220 | |||
| 2423 | Ga0307415_100155311 | |||
| 2424 | Ga0307415_100161482 | |||
| 2425 | Ga0373934_0003000 | |||
| 2426 | Ga0373944_0014543 | |||
| 2427 | Ga0373951_0000953 | |||
| 2428 | Ga0373923_0008355 | |||
| 2429 | Ga0373923_0028510 | |||
| 2430 | Ga0373923_0088320 | |||
| 2431 | Ga0373936_0005678 | |||
| 2432 | Ga0373936_0007148 | |||
| 2433 | Ga0373936_0054779 | |||
| 2434 | Ga0373936_0072816 | |||
| 2435 | Ga0373945_0015970 | |||
| 2436 | Ga0373953_0001820 | |||
| 2437 | Ga0373953_0106335 | |||
| 2438 | Ga0373954_0074066 | |||
| 2439 | Ga0373954_0076884 | |||
| 2440 | Ga0373954_0136552 | |||
| 2441 | Ga0373956_0005290 | |||
| 2442 | Ga0373956_0010381 | |||
| 2443 | Ga0373957_0000526 | |||
| 2444 | Ga0373957_0003118 | |||
| 2445 | Ga0373957_0003458 | |||
| 2446 | Ga0373943_0045043 | |||
| 2447 | Ga0373943_0090335 | |||
| 2448 | Ga0373943_0111554 | |||
| 2449 | Ga0373943_0280346 | |||
| 2450 | Ga0373946_0006023 | |||
| 2451 | Ga0373946_0043794 | |||
| 2452 | Ga0373955_0011254 | |||
| 2453 | Ga0373955_0053465 | |||
| 2454 | Ga0373955_0058755 | |||
| 2455 | Ga0373942_0069561 | |||
| 2456 | Ga0316574_0018911 | |||
| 2457 | Ga0316574_0128147 | |||
| 2458 | Ga0373924_0006841 | |||
| 2459 | Ga0373931_0069579 | |||
| 2460 | Ga0373931_0092278 | |||
| 2461 | Ga0373931_0226660 | |||
| 2462 | Ga0373935_0003601 | |||
| 2463 | Ga0373935_0003897 | |||
| 2464 | Ga0373935_0006473 | |||
| 2465 | Ga0373927_0000123 | |||
| 2466 | Ga0373927_0001591 | |||
| 2467 | Ga0373927_0024226 | |||
| 2468 | Ga0373927_0044465 | |||
| 2469 | Ga0373927_0113353 | |||
| 2470 | Ga0373927_0206819 | |||
| 2471 | Ga0373933_0002466 | |||
| 2472 | Ga0373933_0003709 | |||
| 2473 | Ga0373933_0031159 | |||
| 2474 | Ga0373933_0101316 | |||
| 2475 | Ga0373947_0002769 | |||
| 2476 | Ga0373947_0005381 | |||
| 2477 | Ga0373947_0018368 | |||
| 2478 | Ga0373947_0038591 | |||
| 2479 | Ga0373947_0071076 | |||
| 2480 | Ga0373947_0153156 | |||
| 2481 | Ga0373947_0361784 | |||
| 2482 | Ga0373937_0000037 | |||
| 2483 | Ga0373937_0242775 | |||
| 2484 | Ga0373925_0000915 | |||
| 2485 | Ga0373925_0003137 | |||
| 2486 | Ga0373925_0005438 | |||
| 2487 | Ga0373925_0007608 | |||
| 2488 | Ga0373925_0096314 | |||
| 2489 | Ga0373925_0124257 | |||
| 2490 | Ga0395905_0010608 | |||
| 2491 | Ga0395905_0041369 | |||
| 2492 | Ga0395905_0119476 | |||
| 2493 | Ga0436364_1286351 | |||
| 2494 | Ga0436365_0558586 | |||
| 2495 | Ga0436363_0148938 | |||
| 2496 | Ga0436363_1051196 | |||
| 2497 | Ga0436362_0425579 | |||
| 2498 | Ga0436362_1154172 | |||
| 2499 | Ga0439431_0060432 | |||
| 2500 | Ga0439462_0033105 | |||
| 2501 | Ga0439446_0010019 | |||
| 2502 | Ga0439446_0018794 | |||
| 2503 | Ga0439434_0018301 | |||
| 2504 | Ga0439459_0029808 | |||
| 2505 | Ga0451577_0000390 | |||
| 2506 | Ga0451577_0020501 | |||
| 2507 | Ga0451577_0188476 | |||
| 2508 | Ga0453683_0002477 | |||
| 2509 | Ga0453683_0003673 | |||
| 2510 | Ga0453683_0024798 | |||
| 2511 | Ga0466963_0021213 | |||
| 2512 | Ga0466963_0075292 | |||
| 2513 | Ga0466964_0024512 | |||
| 2514 | Ga0453684_0000686 | |||
| 2515 | Ga0453684_0254328 | |||
| 2516 | Ga0453684_0405792 | |||
| 2517 | Ga0451576_0006359 | |||
| 2518 | Ga0451576_0040972 | |||
| 2519 | Ga0451576_0043177 | |||
| 2520 | Ga0451576_0064398 | |||
| 2521 | Ga0451576_0717877 | |||
| 2522 | Ga0466967_0013623 | |||
| 2523 | Ga0466967_0016966 | |||
| 2524 | Ga0466967_0067424 | |||
| 2525 | Ga0466967_0087331 | |||
| 2526 | Ga0466967_0149802 | |||
| 2527 | Ga0495592_0062395 | |||
| 2528 | Ga0495603_0179046 | |||
| 2529 | Ga0495629_0038676 | |||
| 2530 | Ga0495629_0171227 | |||
| 2531 | Ga0495641_0147193 | |||
| 2532 | Ga0495651_0026393 | |||
| 2533 | Ga0495653_0031817 | |||
| 2534 | Ga0495653_0038953 | |||
| 2535 | Ga0495653_0213132 | |||
| 2536 | Ga0495580_0000163 | |||
| 2537 | Ga0495580_0000505 | |||
| 2538 | Ga0495580_0000909 | |||
| 2539 | Ga0495580_0007429 | |||
| 2540 | Ga0495580_0017832 | |||
| 2541 | Ga0495580_0023516 | |||
| 2542 | Ga0495580_0036953 | |||
| 2543 | Ga0495580_0046576 | |||
| 2544 | Ga0495580_0074389 | |||
| 2545 | Ga0495580_0144937 | |||
| 2546 | Ga0495580_0184212 | |||
| 2547 | Ga0495580_0188420 | |||
| 2548 | Ga0495582_0003168 | |||
| 2549 | Ga0495582_0004127 | |||
| 2550 | Ga0495639_0001941 | |||
| 2551 | Ga0495639_0015376 | |||
| 2552 | Ga0495639_0029191 | |||
| 2553 | Ga0495662_0046988 | |||
| 2554 | Ga0495664_0035291 | |||
| 2555 | Ga0495664_0133473 | |||
| 2556 | Ga0495594_0023211 | |||
| 2557 | Ga0495594_0090804 | |||
| 2558 | Ga0495608_0199649 | |||
| 2559 | Ga0495618_0126830 | |||
| 2560 | Ga0495628_0042316 | |||
| 2561 | Ga0495628_0055659 | |||
| 2562 | Ga0495628_0063095 | |||
| 2563 | Ga0495628_0134925 | |||
| 2564 | Ga0495630_0004055 | |||
| 2565 | Ga0495630_0081294 | |||
| 2566 | Ga0495630_0145481 | |||
| 2567 | Ga0495666_0127213 | |||
| 2568 | Ga0495665_0012718 | |||
| 2569 | Ga0495665_0036475 | |||
| 2570 | Ga0495640_0003469 | |||
| 2571 | Ga0495586_0010706 | |||
| 2572 | Ga0495587_0054794 | |||
| 2573 | Ga0495587_0111953 | |||
| 2574 | Ga0495645_0054740 | |||
| 2575 | Ga0495622_0136101 | |||
| 2576 | Ga0495667_0068887 | |||
| 2577 | Ga0495667_0262666 | |||
| 2578 | Ga0495635_0167910 | |||
| 2579 | Ga0495588_0105757 | |||
| 2580 | Ga0495588_0147158 | |||
| 2581 | Ga0495599_0230595 | |||
| 2582 | Ga0495599_0300786 | |||
| 2583 | Ga0495623_0025710 | |||
| 2584 | Ga0495623_0045468 | |||
| 2585 | Ga0495647_0001388 | |||
| 2586 | Ga0495658_0091905 | |||
| 2587 | Ga0495658_0093209 | |||
| 2588 | Ga0495669_0081817 | |||
| 2589 | Ga0495613_0047059 | |||
| 2590 | Ga0495624_0030071 | |||
| 2591 | Ga0495600_0010458 | |||
| 2592 | Ga0495600_0081482 | |||
| 2593 | Ga0495581_0010040 | |||
| 2594 | Ga0495581_0027020 | |||
| 2595 | Ga0495674_0012576 | |||
| 2596 | Ga0495674_0022407 | |||
| 2597 | Ga0495674_0028103 | |||
| 2598 | Ga0495674_0152521 | |||
| 2599 | Ga0495674_0391016 | |||
| 2600 | Ga0495672_0002834 | |||
| 2601 | Ga0495676_0036950 | |||
| 2602 | Ga0495676_0110212 | |||
| 2603 | Ga0495680_0018273 | |||
| 2604 | Ga0495680_0152354 | |||
| 2605 | Ga0495675_0001743 | |||
| 2606 | Ga0495675_0003075 | |||
| 2607 | Ga0495684_0167879 | |||
| 2608 | Ga0495684_0288789 | |||
| 2609 | Ga0495593_0164365 | |||
| 2610 | Ga0495602_0260910 | |||
| 2611 | Ga0495602_0402893 | |||
| 2612 | Ga0495614_0013730 | |||
| 2613 | Ga0495615_0008576 | |||
| 2614 | Ga0496100_0056132 | |||
| 2615 | Ga0496100_0065379 | |||
| 2616 | Ga0496102_0157282 | |||
| 2617 | Ga0496104_0119297 | |||
| 2618 | Ga0496104_0250358 | |||
| 2619 | Ga0496104_0275417 | |||
| 2620 | Ga0496104_0295010 | |||
| 2621 | Ga0496105_0019985 | |||
| 2622 | Ga0496106_0114799 | |||
| 2623 | Ga0496108_0002333 | |||
| 2624 | Ga0496108_0070661 | |||
| 2625 | Ga0496108_0336491 | |||
| 2626 | Ga0496109_0000941 | |||
| 2627 | Ga0496109_0125666 | |||
| 2628 | Ga0496109_0345784 | |||
| 2629 | Ga0496110_0028543 | |||
| 2630 | Ga0496110_0115180 | |||
| 2631 | Ga0496110_0118010 | |||
| 2632 | Ga0496110_0280285 | |||
| 2633 | Ga0496111_0051663 | |||
| 2634 | Ga0496112_0001276 | |||
| 2635 | Ga0496112_0019630 | |||
| 2636 | Ga0496112_0031605 | |||
| 2637 | Ga0496112_0032286 | |||
| 2638 | Ga0496112_0071615 | |||
| 2639 | Ga0496112_0088484 | |||
| 2640 | Ga0496112_0090315 | |||
| 2641 | Ga0496112_0277141 | |||
| 2642 | Ga0496112_0387903 | |||
| 2643 | Ga0496113_0000236 | |||
| 2644 | Ga0496113_0026940 | |||
| 2645 | Ga0496113_0062731 | |||
| 2646 | Ga0496113_0524904 | |||
| 2647 | Ga0496114_0008108 | |||
| 2648 | Ga0496114_0281601 | |||
| 2649 | Ga0496115_0002794 | |||
| 2650 | Ga0496115_0021677 | |||
| 2651 | Ga0496115_0072679 | |||
| 2652 | Ga0496115_0072703 | |||
| 2653 | Ga0496115_0352143 | |||
| 2654 | Ga0501298_000137 | |||
| 2655 | Ga0501031_0195662 | |||
| 2656 | Ga0501034_0053936 | |||
| 2657 | Ga0501034_0142090 | |||
| 2658 | Ga0501036_0428772 | |||
| 2659 | Ga0501039_0105096 | |||
| 2660 | Ga0501040_0421233 | |||
| 2661 | Ga0501041_0077082 | |||
| 2662 | Ga0501042_0108256 | |||
| 2663 | Ga0501048_0092399 | |||
| 2664 | Ga0501068_0049321 | |||
| 2665 | Ga0501071_0004724 | |||
| 2666 | Ga0501071_0007541 | |||
| 2667 | Ga0501071_0285509 | |||
| 2668 | Ga0501072_0021337 | |||
| 2669 | Ga0501072_0098455 | |||
| 2670 | Ga0501072_0184872 | |||
| 2671 | Ga0501072_0279864 | |||
| 2672 | Ga0501073_0003912 | |||
| 2673 | Ga0501073_0067763 | |||
| 2674 | Ga0501074_0165643 | |||
| 2675 | Ga0501074_0334326 | |||
| 2676 | Ga0501075_0016991 | |||
| 2677 | Ga0501075_0018228 | |||
| 2678 | Ga0501075_0019078 | |||
| 2679 | Ga0501075_0102830 | |||
| 2680 | Ga0501075_0297963 | |||
| 2681 | Ga0501076_0048261 | |||
| 2682 | Ga0501076_0182270 | |||
| 2683 | Ga0501076_0235636 | |||
| 2684 | Ga0501077_0000043 | |||
| 2685 | Ga0501245_010190 | |||
| 2686 | Ga0501079_0195458 | |||
| 2687 | Ga0501080_0021064 | |||
| 2688 | Ga0501081_0019340 | |||
| 2689 | Ga0501081_0110974 | |||
| 2690 | Ga0501081_0323217 | |||
| 2691 | Ga0501081_0393524 | |||
| 2692 | Ga0501083_0000344 | |||
| 2693 | Ga0501045_0041721 | |||
| 2694 | Ga0501045_0042553 | |||
| 2695 | Ga0501045_0136460 | |||
| 2696 | Ga0501045_0182038 | |||
| 2697 | Ga0501045_0222547 | |||
| 2698 | Ga0501045_0223295 | |||
| 2699 | nmdc:mga03n38_85892_c1 | |||
| 2700 | nmdc:mga00v17_19135_c1 | |||
| 2701 | nmdc:mga00v17_25589_c1 | |||
| 2702 | nmdc:mga0yw44_18799_c1 | |||
| 2703 | nmdc:mga0yw44_229433_c1 | |||
| 2704 | nmdc:mga0yw44_9584_c1 | |||
| 2705 | nmdc:mga0k408_13637_c1 | |||
| 2706 | nmdc:mga0k408_1841_c1 | |||
| 2707 | nmdc:mga0k408_8832_c1 | |||
| 2708 | nmdc:mga06z11_28023_c1 | |||
| 2709 | nmdc:mga07m45_82862_c1 | |||
| 2710 | nmdc:mga05p37_164323_c1 | |||
| 2711 | nmdc:mga05p37_169992_c1 | |||
| 2712 | nmdc:mga05p37_225945_c1 | |||
| 2713 | nmdc:mga05p37_236598_c1 | |||
| 2714 | nmdc:mga05p37_312137_c1 | |||
| 2715 | nmdc:mga05p37_343140_c1 | |||
| 2716 | nmdc:mga05p37_3554_c1 | |||
| 2717 | nmdc:mga05p37_390622_c1 | |||
| 2718 | nmdc:mga05p37_39_c1 | |||
| 2719 | nmdc:mga05p37_524555_c1 | |||
| 2720 | nmdc:mga05p37_614844_c1 | |||
| 2721 | nmdc:mga05p37_6916_c1 | |||
| 2722 | nmdc:mga05p37_799295_c1 | |||
| 2723 | nmdc:mga05p37_858020_c1 | |||
| 2724 | nmdc:mga09592_10763_c1 | |||
| 2725 | nmdc:mga09592_1460_c1 | |||
| 2726 | nmdc:mga09592_180203_c1 | |||
| 2727 | nmdc:mga09592_222067_c1 | |||
| 2728 | nmdc:mga09592_330212_c1 | |||
| 2729 | nmdc:mga09592_434775_c1 | |||
| 2730 | nmdc:mga09592_52342_c1 | |||
| 2731 | nmdc:mga0qj67_138887_c1 | |||
| 2732 | nmdc:mga0qj67_140030_c1 | |||
| 2733 | nmdc:mga0qj67_20299_c1 | |||
| 2734 | nmdc:mga0qj67_42389_c1 | |||
| 2735 | nmdc:mga06r32_150735_c1 | |||
| 2736 | nmdc:mga06r32_162913_c1 | |||
| 2737 | nmdc:mga06r32_255429_c1 | |||
| 2738 | nmdc:mga06r32_478831_c1 | |||
| 2739 | nmdc:mga06r32_5019_c1 | |||
| 2740 | nmdc:mga06r32_660704_c1 | |||
| 2741 | nmdc:mga08y16_129143_c1 | |||
| 2742 | nmdc:mga08y16_133487_c1 | |||
| 2743 | nmdc:mga08y16_273278_c1 | |||
| 2744 | nmdc:mga08y16_37415_c1 | |||
| 2745 | nmdc:mga08y16_44631_c1 | |||
| 2746 | nmdc:mga08y16_657702_c1 | |||
| 2747 | nmdc:mga08y16_80036_c1 | |||
| 2748 | nmdc:mga0n895_105171_c1 | |||
| 2749 | nmdc:mga0n895_105329_c1 | |||
| 2750 | nmdc:mga0n895_12769_c1 | |||
| 2751 | nmdc:mga0n895_19562_c1 | |||
| 2752 | nmdc:mga0n895_375584_c1 | |||
| 2753 | nmdc:mga0n895_37707_c1 | |||
| 2754 | nmdc:mga0n895_46680_c1 | |||
| 2755 | nmdc:mga0n895_47_c1 | |||
| 2756 | nmdc:mga0n895_596743_c1 | |||
| 2757 | nmdc:mga0n895_6363_c1 | |||
| 2758 | nmdc:mga0n895_6399_c1 | |||
| 2759 | nmdc:mga0n895_76648_c1 | |||
| 2760 | nmdc:mga0rr50_102413_c1 | |||
| 2761 | nmdc:mga0rr50_129766_c1 | |||
| 2762 | nmdc:mga0rr50_156206_c1 | |||
| 2763 | nmdc:mga0rr50_29389_c1 | |||
| 2764 | nmdc:mga0rr50_298861_c1 | |||
| 2765 | nmdc:mga0rr50_421_c1 | |||
| 2766 | nmdc:mga0rr50_7615_c1 | |||
| 2767 | nmdc:mga08x19_15719_c2 | |||
| 2768 | nmdc:mga08x19_159_c1 | |||
| 2769 | nmdc:mga08x19_313964_c1 | |||
| 2770 | nmdc:mga08x19_3951_c1 | |||
| 2771 | nmdc:mga08x19_6000_c1 | |||
| 2772 | nmdc:mga08x19_9447_c1 | |||
| 2773 | nmdc:mga08x19_94831_c1 | |||
| 2774 | nmdc:mga0a205_114246_c2 | |||
| 2775 | nmdc:mga0a205_17697_c1 | |||
| 2776 | nmdc:mga0a205_208831_c1 | |||
| 2777 | nmdc:mga0a205_293900_c1 | |||
| 2778 | nmdc:mga0a205_306308_c1 | |||
| 2779 | nmdc:mga0a205_378_c1 | |||
| 2780 | nmdc:mga0a205_40587_c1 | |||
| 2781 | nmdc:mga0a205_507156_c1 | |||
| 2782 | nmdc:mga0a205_5281_c1 | |||
| 2783 | nmdc:mga0a205_5870_c1 | |||
| 2784 | nmdc:mga0a205_618923_c1 | |||
| 2785 | nmdc:mga0a205_73981_c1 | |||
| 2786 | nmdc:mga0a205_9834_c1 | |||
| 2787 | nmdc:mga0sz30_133768_c1 | |||
| 2788 | Ga0495601_0038608 | |||
| 2789 | Ga0495619_0013765 | |||
| 2790 | Ga0495619_0083881 | |||
| 2791 | Ga0500555_005659 | |||
| 2792 | Ga0501084_0132330 | |||
| 2793 | Ga0501084_0411300 | |||
| 2794 | Ga0590071_003929 | |||
| 2795 | Ga0590074_026271 | |||
| 2796 | Ga0590075_005479 | |||
| 2797 | Ga0590077_000183 | |||
| 2798 | Ga0587080_014860 | |||
| 2799 | Ga0587083_0019086 | |||
| 2800 | Ga0587071_020531 | |||
| 2801 | Ga0501082_0000791 | |||
| 2802 | Ga0501082_0164048 | |||
| 2803 | Ga0501082_0177173 | |||
| 2804 | Ga0501082_0269779 | |||
| 2805 | Ga0530510_0014030 | |||
| 2806 | Ga0530510_0139478 | |||
| 2807 | Ga0530510_0289323 | |||
| 2808 | 2857597099 | |||
| 2809 | 2936340756 | |||
| 2810 | 3006973539 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4j31-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase (kmo-396prot) | 0.9984 | 5 | 35 |
| 4j36-assembly2.cif.gz_B | cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) | 0.9895 | 5 | 37 |
| 4j34-assembly1.cif.gz_A | crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. | 0.9879 | 5 | 37 |
| 6lkd-assembly1.cif.gz_A | in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor | 0.9849 | 5 | 35 |
| 4j33-assembly2.cif.gz_B | crystal structure of kynurenine 3-monooxygenase (kmo-394) | 0.9848 | 5 | 37 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4j36B00 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9895 | 5 | 37 | 3.50.50.60 |
| af_I1MHA5_112_472_3.50.50.60 | Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain | 0.9837 | 6 | 33 | 3.50.50.60 |
| 6acqA02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9821 | 196 | 279 | 1.10.1040.10 |
| 4kueB02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9799 | 196 | 279 | 1.10.1040.10 |
| 4kuhF02 | Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 | 0.9791 | 196 | 279 | 1.10.1040.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9HV30-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.9891 | 1 | 103 |
GO:0006631
GO:0008691 GO:0070403 |
| AF-A0A7C4HZB3-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase | 0.9803 | 4 | 75 |
GO:0006631
GO:0016491 GO:0070403 |
| AF-X1REX1-F1-model_v4 | 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein | 0.9799 | 3 | 80 |
GO:0006631
GO:0016491 GO:0070403 |
| AF-A0A1A7XAH6-F1-model_v4 | Enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase | 0.9793 | 85 | 194 |
GO:0003857
GO:0005777 GO:0006635 GO:0016829 GO:0016853 GO:0070403 |
| AF-A0A356QJG1-F1-model_v4 | 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) | 0.9787 | 5 | 163 |
GO:0006631
GO:0008691 GO:0070403 |