F493715

General Info

Members Datasets Scaffolds Average Seq Length
1405 389 2810 291

Family's Representative Sequence

Representative Sequence 3300006847|Ga0075431_100229517|Ga0075431_1002295172
Length 337
Sequence VIDGGRLDFDENLARAGLGIGNVSILENVRPAVLAKNHCFHGKPVVYPDGMTNKKDVRTIVVVGAGIMGRGIAHVSAMAGYTTVLNDVSNELLEKARGQVRRDLEKGIEIGKVTSDSMEQTLSRLTLESALXXAVSHADLIIEAVPESIELKVDLFARLDRICAQNVIFASNTSALSITEMAGATKRPQQFIGMHFFNPVHKMKLVEIIRALETNDDTFQTVDSVAKRMGKETVEVKESPGFVTTRINALIGNEAFYMLQEGIASARDIDKALKLGLNHPMGPFEMIDLVGLDTRLSILSFLHQTFGEKYRPCPLLVKYVKAGRLGKKVGKGVYEYL

Samples

Sample ID Description Type Environment
1 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
2 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
3 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
4 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
5 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
6 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
7 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
8 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
18 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
19 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
20 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
21 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
22 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
23 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005406 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG Metagenome Rhizosphere
34 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
35 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
36 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
37 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
38 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
39 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
40 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
41 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
42 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
43 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
44 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
45 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
46 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
47 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
48 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
49 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
50 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
51 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
52 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
53 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
54 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
55 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
60 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
61 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
62 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
63 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
64 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
65 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
66 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
67 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
68 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
69 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
70 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
71 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
72 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
73 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
74 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
75 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
76 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
77 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
78 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
79 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
80 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
81 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
82 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
83 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
84 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
85 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
86 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
87 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
88 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
89 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
90 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
94 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
95 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
96 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
119 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
120 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
140 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
141 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
142 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
143 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
144 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
145 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
211 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
216 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
217 3300030879 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZU1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
220 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
221 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
222 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
223 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
233 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
234 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
235 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
236 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
237 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
240 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
241 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
242 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
243 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
244 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
245 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
255 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
256 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
257 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
258 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
259 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
260 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
261 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
262 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
263 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
264 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
265 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
266 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
267 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
268 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
269 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
270 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
271 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
272 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
273 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
274 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
275 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
276 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
277 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
278 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
279 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
280 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
281 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
282 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
283 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
284 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
285 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
286 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
287 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
288 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
289 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
290 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
291 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
292 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
293 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
294 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
295 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
296 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
297 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
298 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
299 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
300 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
301 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
302 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
303 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
304 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
305 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
306 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
307 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
308 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
309 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
310 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
311 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
312 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
313 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
314 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
315 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
316 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
317 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
318 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
319 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
320 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
321 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
322 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
323 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
324 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
325 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
326 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
327 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
328 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
329 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
330 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
331 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
332 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
333 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
334 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
335 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
336 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
338 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
340 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
346 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
347 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
348 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
349 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
350 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
351 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
352 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
353 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
354 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
355 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
356 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
357 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
358 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
359 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
360 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
361 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
362 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
363 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
374 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
375 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
376 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
377 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
378 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
379 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300059503 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 21R_SD_T1_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300059505 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 24R_SD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
384 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
386 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
387 2857591370 Brevibacillus sp. R-71934 Isolate Unclassified
388 2936340661 Gottfriedia acidiceleris 1-17 Isolate Rhizosphere
389 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.93
Metatranscriptomes 0.85
Isolates 0.21

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.78
Nodule 0
Rhizoplane 2.85
Rhizosphere 94.8
Stem 0
Stem Tuber 0
Unclassified 5.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0075431_100229517 3300006847 Bacteria 1892
2 LJNas_1000359 3300000546 Bacteria 7997
3 LJNas_1003504 3300000546 Bacteria 1793
4 JGI24751J29686_10004922 3300002459 Bacteria 2720
5 rootL2_10191405 3300003322 Bacteria 1493
6 Ga0065704_10202031 3300005289 Bacteria 1142
7 Ga0065712_10089208 3300005290 Bacteria 2481
8 Ga0065712_10162800 3300005290 Bacteria 1291
9 Ga0065715_10028342 3300005293 Bacteria 2208
10 Ga0065715_10324400 3300005293 Bacteria 996
11 Ga0065707_10004536 3300005295 Bacteria 4544
12 Ga0065707_10107322 3300005295 Bacteria 2559
13 Ga0065707_10140512 3300005295 Bacteria 1779
14 Ga0070658_10009208 3300005327 Bacteria 7938
15 Ga0070676_10053202 3300005328 Bacteria 2384
16 Ga0070676_10275058 3300005328 Bacteria 1132
17 Ga0070683_100000991 3300005329 Bacteria 21246
18 Ga0070683_100015092 3300005329 Bacteria 6779
19 Ga0070683_100348113 3300005329 Unclassified 1411
20 Ga0070683_100365672 3300005329 Bacteria 1374
21 Ga0070690_100018513 3300005330 Bacteria 4209
22 Ga0070690_100024970 3300005330 Bacteria 3679
23 Ga0070690_100030342 3300005330 Bacteria 3359
24 Ga0070690_100148702 3300005330 Unclassified 1596
25 Ga0070690_100155991 3300005330 Bacteria 1561
26 Ga0070670_100006846 3300005331 Bacteria 9659
27 Ga0070670_100022824 3300005331 Bacteria 5385
28 Ga0070670_100050190 3300005331 Bacteria 3586
29 Ga0070670_100061905 3300005331 Bacteria 3212
30 Ga0068869_100019550 3300005334 Bacteria 4630
31 Ga0068869_100060637 3300005334 Bacteria 2773
32 Ga0068869_100264234 3300005334 Bacteria 1378
33 Ga0070666_10004150 3300005335 Bacteria 8791
34 Ga0070666_10275774 3300005335 Bacteria 1194
35 Ga0070680_100077227 3300005336 Bacteria 2743
36 Ga0070680_100166647 3300005336 Bacteria 1853
37 Ga0070680_100265384 3300005336 Bacteria 1453
38 Ga0070680_100384731 3300005336 Bacteria 1195
39 Ga0070680_100587047 3300005336 Bacteria 956
40 Ga0068868_100003935 3300005338 Bacteria 10378
41 Ga0068868_100007730 3300005338 Bacteria 7672
42 Ga0068868_100010214 3300005338 Bacteria 6786
43 Ga0068868_100352639 3300005338 Bacteria 1260
44 Ga0070660_100050604 3300005339 Bacteria 3197
45 Ga0070660_100079882 3300005339 Bacteria 2566
46 Ga0070689_100000184 3300005340 Bacteria 37816
47 Ga0070689_100006327 3300005340 Bacteria 8180
48 Ga0070689_100011182 3300005340 Bacteria 6422
49 Ga0070689_100013823 3300005340 Bacteria 5848
50 Ga0070689_100026157 3300005340 Bacteria 4391
51 Ga0070689_100028450 3300005340 Bacteria 4225
52 Ga0070689_100201940 3300005340 Bacteria 1624
53 Ga0070691_10074743 3300005341 Bacteria 1649
54 Ga0070687_100006124 3300005343 Bacteria 4913
55 Ga0070687_100009510 3300005343 Bacteria 4169
56 Ga0070661_100020154 3300005344 Bacteria 4754
57 Ga0070661_100187054 3300005344 Unclassified 1578
58 Ga0070692_10024271 3300005345 Bacteria 2979
59 Ga0070668_100034746 3300005347 Bacteria 3842
60 Ga0070669_100005158 3300005353 Bacteria 9449
61 Ga0070669_100104320 3300005353 Bacteria 2143
62 Ga0070675_100007816 3300005354 Bacteria 8286
63 Ga0070675_100032017 3300005354 Bacteria 4253
64 Ga0070675_100077530 3300005354 Bacteria 2766
65 Ga0070675_100168217 3300005354 Bacteria 1889
66 Ga0070675_100172332 3300005354 Bacteria 1867
67 Ga0070671_100163839 3300005355 Bacteria 1879
68 Ga0070671_100271153 3300005355 Bacteria 1442
69 Ga0070671_100334032 3300005355 Bacteria 1292
70 Ga0070671_100343244 3300005355 Bacteria 1274
71 Ga0070674_100050690 3300005356 Bacteria 2858
72 Ga0070674_100113640 3300005356 Bacteria 1992
73 Ga0070673_100001103 3300005364 Bacteria 15474
74 Ga0070673_100002331 3300005364 Bacteria 11533
75 Ga0070673_100003082 3300005364 Bacteria 10316
76 Ga0070673_100106401 3300005364 Bacteria 2319
77 Ga0070673_100652145 3300005364 Bacteria 964
78 Ga0070688_100002168 3300005365 Bacteria 9900
79 Ga0070688_100004760 3300005365 Bacteria 7093
80 Ga0070688_100005527 3300005365 Bacteria 6669
81 Ga0070688_100021976 3300005365 Bacteria 3732
82 Ga0070688_100048318 3300005365 Bacteria 2643
83 Ga0070688_100071536 3300005365 Bacteria 2221
84 Ga0070688_100113887 3300005365 Bacteria 1802
85 Ga0070659_100095009 3300005366 Bacteria 2394
86 Ga0070659_100152418 3300005366 Bacteria 1886
87 Ga0070667_100061735 3300005367 Bacteria 3174
88 Ga0070667_100150767 3300005367 Bacteria 2042
89 Ga0070667_100330070 3300005367 Bacteria 1378
90 Ga0070703_10018480 3300005406 Bacteria 2016
91 Ga0070709_10000138 3300005434 Bacteria 48893
92 Ga0070709_10000284 3300005434 Bacteria 32219
93 Ga0070709_10006463 3300005434 Bacteria 6392
94 Ga0070709_10008313 3300005434 Bacteria 5697
95 Ga0070709_10094447 3300005434 Unclassified 1979
96 Ga0070709_10103900 3300005434 Bacteria 1898
97 Ga0070709_10507853 3300005434 Bacteria 917
98 Ga0070714_100000128 3300005435 Bacteria 59542
99 Ga0070714_100000964 3300005435 Bacteria 20546
100 Ga0070714_100001380 3300005435 Bacteria 17574
101 Ga0070714_100041133 3300005435 Bacteria 3899
102 Ga0070714_100045433 3300005435 Bacteria 3723
103 Ga0070714_100071511 3300005435 Bacteria 3000
104 Ga0070714_100141677 3300005435 Bacteria 2159
105 Ga0070714_100168614 3300005435 Unclassified 1985
106 Ga0070714_100412219 3300005435 Bacteria 1279
107 Ga0070714_100501985 3300005435 Bacteria 1157
108 Ga0070713_100000078 3300005436 Bacteria 60357
109 Ga0070713_100001287 3300005436 Bacteria 16026
110 Ga0070713_100015810 3300005436 Bacteria 5654
111 Ga0070713_100027774 3300005436 Bacteria 4461
112 Ga0070713_100058215 3300005436 Bacteria 3222
113 Ga0070713_100066236 3300005436 Bacteria 3037
114 Ga0070713_100073285 3300005436 Bacteria 2898
115 Ga0070713_100274140 3300005436 Bacteria 1546
116 Ga0070713_100333833 3300005436 Bacteria 1403
117 Ga0070710_10011043 3300005437 Bacteria 4452
118 Ga0070710_10013235 3300005437 Bacteria 4125
119 Ga0070710_10016006 3300005437 Unclassified 3807
120 Ga0070710_10034866 3300005437 Bacteria 2740
121 Ga0070710_10072144 3300005437 Bacteria 1993
122 Ga0070701_10005359 3300005438 Bacteria 5288
123 Ga0070701_10008092 3300005438 Bacteria 4525
124 Ga0070711_100002946 3300005439 Bacteria 9813
125 Ga0070711_100026494 3300005439 Bacteria 3799
126 Ga0070711_100076371 3300005439 Bacteria 2375
127 Ga0070711_100316937 3300005439 Bacteria 1245
128 Ga0070711_100423604 3300005439 Bacteria 1085
129 Ga0070705_100093720 3300005440 Bacteria 1878
130 Ga0070705_100247030 3300005440 Bacteria 1250
131 Ga0070700_100006840 3300005441 Bacteria 6118
132 Ga0070700_100014725 3300005441 Bacteria 4420
133 Ga0070700_100028019 3300005441 Bacteria 3347
134 Ga0070700_100037943 3300005441 Bacteria 2933
135 Ga0070700_100198422 3300005441 Bacteria 1408
136 Ga0070700_100270103 3300005441 Bacteria 1228
137 Ga0070694_100009124 3300005444 Bacteria 6084
138 Ga0070694_100045358 3300005444 Bacteria 2946
139 Ga0070694_100104867 3300005444 Bacteria 2005
140 Ga0070694_100158916 3300005444 Bacteria 1657
141 Ga0070694_100221918 3300005444 Archaea 1418
142 Ga0070694_100370814 3300005444 Bacteria 1114
143 Ga0070708_100000914 3300005445 Bacteria 22363
144 Ga0070708_100001179 3300005445 Bacteria 20144
145 Ga0070708_100003704 3300005445 Bacteria 11987
146 Ga0070708_100005225 3300005445 Bacteria 10280
147 Ga0070708_100007521 3300005445 Bacteria 8720
148 Ga0070708_100089166 3300005445 Bacteria 2806
149 Ga0070708_100093262 3300005445 Unclassified 2744
150 Ga0070708_100155810 3300005445 Bacteria 2127
151 Ga0070708_100229876 3300005445 Bacteria 1740
152 Ga0070663_100052242 3300005455 Bacteria 2914
153 Ga0070663_100053530 3300005455 Bacteria 2881
154 Ga0070663_100177406 3300005455 Bacteria 1650
155 Ga0070678_100025449 3300005456 Bacteria 3982
156 Ga0070678_100087011 3300005456 Bacteria 2385
157 Ga0070678_100142284 3300005456 Bacteria 1921
158 Ga0070662_100013294 3300005457 Bacteria 5476
159 Ga0070662_100110989 3300005457 Bacteria 2089
160 Ga0070662_100151047 3300005457 Bacteria 1808
161 Ga0070681_10000316 3300005458 Bacteria 39260
162 Ga0070681_10019492 3300005458 Bacteria 6791
163 Ga0070681_10024367 3300005458 Bacteria 6091
164 Ga0070681_10063676 3300005458 Bacteria 3659
165 Ga0070681_10108614 3300005458 Bacteria 2714
166 Ga0070681_10161677 3300005458 Unclassified 2163
167 Ga0070681_10192271 3300005458 Bacteria 1960
168 Ga0070681_10367827 3300005458 Bacteria 1348
169 Ga0070681_10386642 3300005458 Bacteria 1310
170 Ga0068867_100028059 3300005459 Bacteria 4051
171 Ga0068867_100028845 3300005459 Bacteria 3996
172 Ga0068867_100118397 3300005459 Unclassified 2043
173 Ga0070685_10000378 3300005466 Bacteria 26827
174 Ga0070685_10066457 3300005466 Bacteria 2125
175 Ga0070685_10169007 3300005466 Unclassified 1400
176 Ga0070706_100007838 3300005467 Bacteria 9985
177 Ga0070706_100037144 3300005467 Bacteria 4500
178 Ga0070706_100059824 3300005467 Bacteria 3516
179 Ga0070706_100066352 3300005467 Unclassified 3338
180 Ga0070706_100080032 3300005467 Bacteria 3025
181 Ga0070706_100128068 3300005467 Unclassified 2368
182 Ga0070706_100129406 3300005467 Bacteria 2355
183 Ga0070706_100154358 3300005467 Bacteria 2143
184 Ga0070707_100004302 3300005468 Bacteria 13344
185 Ga0070707_100004988 3300005468 Bacteria 12435
186 Ga0070707_100031329 3300005468 Bacteria 5065
187 Ga0070707_100038527 3300005468 Bacteria 4566
188 Ga0070707_100066497 3300005468 Unclassified 3464
189 Ga0070707_100088885 3300005468 Unclassified 2989
190 Ga0070707_100102350 3300005468 Unclassified 2775
191 Ga0070707_100148539 3300005468 Bacteria 2282
192 Ga0070707_100184072 3300005468 Bacteria 2037
193 Ga0070707_100350435 3300005468 Bacteria 1434
194 Ga0070707_100389813 3300005468 Bacteria 1353
195 Ga0070698_100001727 3300005471 Bacteria 24362
196 Ga0070698_100009756 3300005471 Bacteria 10262
197 Ga0070698_100010307 3300005471 Bacteria 9975
198 Ga0070698_100038875 3300005471 Bacteria 4903
199 Ga0070698_100077931 3300005471 Bacteria 3313
200 Ga0070698_100093117 3300005471 Bacteria 2994
201 Ga0070698_100216070 3300005471 Bacteria 1851
202 Ga0070699_100000032 3300005518 Bacteria 136937
203 Ga0070699_100003470 3300005518 Bacteria 13941
204 Ga0070699_100049485 3300005518 Bacteria 3638
205 Ga0070699_100290839 3300005518 Bacteria 1465
206 Ga0070699_100424565 3300005518 Bacteria 1204
207 Ga0070679_100013063 3300005530 Bacteria 7950
208 Ga0070679_100022833 3300005530 Bacteria 6119
209 Ga0070679_100055041 3300005530 Bacteria 3962
210 Ga0070679_100061284 3300005530 Bacteria 3749
211 Ga0070679_100123379 3300005530 Bacteria 2574
212 Ga0070679_100213856 3300005530 Bacteria 1891
213 Ga0070684_100166371 3300005535 Bacteria 2002
214 Ga0070684_100204154 3300005535 Bacteria 1801
215 Ga0070697_100000428 3300005536 Bacteria 32306
216 Ga0070697_100000479 3300005536 Bacteria 30367
217 Ga0070697_100001200 3300005536 Bacteria 19608
218 Ga0070697_100002510 3300005536 Bacteria 14112
219 Ga0070697_100003271 3300005536 Bacteria 12441
220 Ga0070697_100004305 3300005536 Bacteria 10920
221 Ga0070697_100004317 3300005536 Bacteria 10906
222 Ga0070697_100062386 3300005536 Bacteria 3042
223 Ga0070697_100076557 3300005536 Bacteria 2751
224 Ga0070697_100166873 3300005536 Bacteria 1862
225 Ga0070697_100171833 3300005536 Bacteria 1835
226 Ga0070697_100276544 3300005536 Bacteria 1440
227 Ga0068853_100004139 3300005539 Bacteria 11180
228 Ga0068853_100057764 3300005539 Bacteria 3349
229 Ga0068853_100256588 3300005539 Bacteria 1606
230 Ga0070672_100021325 3300005543 Bacteria 4738
231 Ga0070672_100056314 3300005543 Bacteria 3083
232 Ga0070672_100124504 3300005543 Bacteria 2113
233 Ga0070672_100623196 3300005543 Bacteria 941
234 Ga0070686_100007438 3300005544 Bacteria 6112
235 Ga0070686_100013723 3300005544 Bacteria 4647
236 Ga0070686_100015353 3300005544 Bacteria 4434
237 Ga0070686_100041957 3300005544 Bacteria 2863
238 Ga0070695_100006597 3300005545 Bacteria 6857
239 Ga0070695_100038397 3300005545 Bacteria 3022
240 Ga0070695_100066418 3300005545 Bacteria 2351
241 Ga0070695_100126961 3300005545 Bacteria 1753
242 Ga0070695_100144769 3300005545 Bacteria 1652
243 Ga0070695_100215928 3300005545 Unclassified 1379
244 Ga0070696_100034145 3300005546 Bacteria 3498
245 Ga0070696_100093054 3300005546 Bacteria 2149
246 Ga0070696_100424811 3300005546 Bacteria 1044
247 Ga0070693_100085459 3300005547 Bacteria 1891
248 Ga0070693_100158117 3300005547 Bacteria 1441
249 Ga0070693_100165662 3300005547 Bacteria 1411
250 Ga0070665_100008875 3300005548 Bacteria 10180
251 Ga0070665_100208839 3300005548 Bacteria 1953
252 Ga0070665_100379949 3300005548 Bacteria 1420
253 Ga0070665_100459018 3300005548 Unclassified 1284
254 Ga0070704_100027044 3300005549 Bacteria 3798
255 Ga0070704_100066641 3300005549 Bacteria 2597
256 Ga0070704_100103796 3300005549 Bacteria 2148
257 Ga0070704_100291910 3300005549 Bacteria 1355
258 Ga0068855_100000903 3300005563 Bacteria 36808
259 Ga0068855_100017182 3300005563 Bacteria 8706
260 Ga0068855_100041333 3300005563 Bacteria 5465
261 Ga0068855_100047134 3300005563 Bacteria 5093
262 Ga0068855_100192496 3300005563 Unclassified 2299
263 Ga0068855_100291299 3300005563 Bacteria 1810
264 Ga0070664_100004347 3300005564 Bacteria 11391
265 Ga0070664_100110920 3300005564 Bacteria 2394
266 Ga0070664_100119683 3300005564 Bacteria 2304
267 Ga0070664_100225971 3300005564 Bacteria 1676
268 Ga0070664_100477855 3300005564 Bacteria 1147
269 Ga0068857_100001669 3300005577 Bacteria 17823
270 Ga0068857_100002037 3300005577 Bacteria 16381
271 Ga0068857_100005829 3300005577 Bacteria 10518
272 Ga0068857_100038279 3300005577 Bacteria 4247
273 Ga0068857_100300639 3300005577 Bacteria 1479
274 Ga0068854_100025404 3300005578 Bacteria 4064
275 Ga0068854_100070415 3300005578 Bacteria 2556
276 Ga0068854_100117898 3300005578 Bacteria 2011
277 Ga0068854_100126733 3300005578 Bacteria 1945
278 Ga0068854_100187955 3300005578 Bacteria 1617
279 Ga0068856_100001036 3300005614 Bacteria 29524
280 Ga0068856_100001068 3300005614 Bacteria 29002
281 Ga0068856_100001357 3300005614 Bacteria 25723
282 Ga0068856_100012625 3300005614 Bacteria 8178
283 Ga0068856_100019468 3300005614 Bacteria 6588
284 Ga0068856_100025885 3300005614 Bacteria 5722
285 Ga0068856_100045193 3300005614 Bacteria 4335
286 Ga0070702_100013317 3300005615 Bacteria 4150
287 Ga0070702_100014022 3300005615 Bacteria 4060
288 Ga0070702_100222012 3300005615 Unclassified 1264
289 Ga0068852_100030169 3300005616 Bacteria 4461
290 Ga0068859_100003538 3300005617 Bacteria 15905
291 Ga0068859_100018857 3300005617 Bacteria 6932
292 Ga0068859_100021411 3300005617 Bacteria 6489
293 Ga0068859_100062847 3300005617 Bacteria 3743
294 Ga0068859_100138415 3300005617 Bacteria 2508
295 Ga0068859_100199275 3300005617 Bacteria 2086
296 Ga0068859_100236779 3300005617 Bacteria 1914
297 Ga0068859_100239035 3300005617 Bacteria 1905
298 Ga0068859_100303399 3300005617 Bacteria 1690
299 Ga0068864_100004582 3300005618 Bacteria 11344
300 Ga0068864_100012500 3300005618 Bacteria 7018
301 Ga0068864_100091337 3300005618 Bacteria 2686
302 Ga0068864_100100596 3300005618 Bacteria 2563
303 Ga0068864_100156145 3300005618 Bacteria 2071
304 Ga0068864_100208715 3300005618 Bacteria 1798
305 Ga0068864_100266991 3300005618 Bacteria 1593
306 Ga0068866_10005122 3300005718 Bacteria 5400
307 Ga0068866_10006386 3300005718 Bacteria 4909
308 Ga0068866_10148649 3300005718 Bacteria 1354
309 Ga0068861_100006187 3300005719 Bacteria 8145
310 Ga0068861_100052119 3300005719 Bacteria 3109
311 Ga0068861_100095984 3300005719 Bacteria 2349
312 Ga0068861_100291103 3300005719 Bacteria 1410
313 Ga0068861_100492082 3300005719 Bacteria 1107
314 Ga0068851_10073749 3300005834 Bacteria 1771
315 Ga0068851_10195981 3300005834 Unclassified 1125
316 Ga0068870_10005374 3300005840 Bacteria 5588
317 Ga0068870_10022812 3300005840 Bacteria 3079
318 Ga0068863_100008428 3300005841 Bacteria 10067
319 Ga0068863_100010732 3300005841 Bacteria 8893
320 Ga0068863_100032630 3300005841 Bacteria 4962
321 Ga0068863_100042988 3300005841 Bacteria 4291
322 Ga0068863_100048556 3300005841 Bacteria 4025
323 Ga0068863_100055256 3300005841 Bacteria 3760
324 Ga0068863_100060795 3300005841 Unclassified 3573
325 Ga0068863_100070541 3300005841 Bacteria 3304
326 Ga0068863_100142658 3300005841 Bacteria 2290
327 Ga0068863_100435118 3300005841 Bacteria 1286
328 Ga0068863_100484517 3300005841 Bacteria 1217
329 Ga0068858_100000863 3300005842 Bacteria 31399
330 Ga0068858_100013745 3300005842 Bacteria 7641
331 Ga0068858_100014686 3300005842 Bacteria 7372
332 Ga0068858_100030709 3300005842 Bacteria 4990
333 Ga0068858_100039269 3300005842 Bacteria 4390
334 Ga0068858_100053226 3300005842 Bacteria 3745
335 Ga0068858_100067270 3300005842 Bacteria 3318
336 Ga0068858_100081587 3300005842 Bacteria 3006
337 Ga0068858_100117911 3300005842 Bacteria 2481
338 Ga0068858_100470988 3300005842 Bacteria 1212
339 Ga0068860_100001845 3300005843 Bacteria 22552
340 Ga0068860_100102787 3300005843 Bacteria 2727
341 Ga0068860_100146864 3300005843 Bacteria 2269
342 Ga0068860_100263395 3300005843 Bacteria 1681
343 Ga0068860_100420973 3300005843 Bacteria 1324
344 Ga0068860_100621445 3300005843 Bacteria 1087
345 Ga0068862_100117465 3300005844 Bacteria 2341
346 Ga0068862_100153161 3300005844 Bacteria 2053
347 Ga0070717_10001077 3300006028 Bacteria 18344
348 Ga0070717_10001266 3300006028 Bacteria 17259
349 Ga0070717_10003483 3300006028 Bacteria 11275
350 Ga0070717_10006090 3300006028 Bacteria 8854
351 Ga0070717_10006698 3300006028 Bacteria 8497
352 Ga0070717_10023366 3300006028 Unclassified 4897
353 Ga0070717_10046031 3300006028 Bacteria 3568
354 Ga0070717_10061714 3300006028 Bacteria 3107
355 Ga0070717_10063108 3300006028 Bacteria 3074
356 Ga0070717_10069440 3300006028 Bacteria 2934
357 Ga0070717_10130057 3300006028 Bacteria 2164
358 Ga0070717_10159781 3300006028 Bacteria 1954
359 Ga0070717_10288595 3300006028 Bacteria 1456
360 Ga0070717_10495451 3300006028 Bacteria 1104
361 Ga0070717_10658407 3300006028 Unclassified 951
362 Ga0075365_10000429 3300006038 Bacteria 15576
363 Ga0075365_10091326 3300006038 Bacteria 2075
364 Ga0075365_10109191 3300006038 Bacteria 1900
365 Ga0075368_10032852 3300006042 Bacteria 2017
366 Ga0075364_10000947 3300006051 Bacteria 15319
367 Ga0075364_10026447 3300006051 Bacteria 3702
368 Ga0070715_10001890 3300006163 Bacteria 6278
369 Ga0070715_10002920 3300006163 Bacteria 5336
370 Ga0070715_10004444 3300006163 Bacteria 4603
371 Ga0070715_10068834 3300006163 Bacteria 1575
372 Ga0070716_100000779 3300006173 Bacteria 13663
373 Ga0070716_100006385 3300006173 Bacteria 5756
374 Ga0070716_100009249 3300006173 Bacteria 4910
375 Ga0070716_100024016 3300006173 Bacteria 3241
376 Ga0070716_100069019 3300006173 Bacteria 2070
377 Ga0070716_100104326 3300006173 Bacteria 1745
378 Ga0070716_100183016 3300006173 Bacteria 1377
379 Ga0070716_100213333 3300006173 Bacteria 1292
380 Ga0070716_100217950 3300006173 Bacteria 1280
381 Ga0070716_100290949 3300006173 Bacteria 1132
382 Ga0070712_100000047 3300006175 Bacteria 65314
383 Ga0070712_100000914 3300006175 Bacteria 17695
384 Ga0070712_100001184 3300006175 Bacteria 15748
385 Ga0070712_100007837 3300006175 Bacteria 6689
386 Ga0070712_100012588 3300006175 Bacteria 5380
387 Ga0070712_100166529 3300006175 Bacteria 1707
388 Ga0075362_10001899 3300006177 Bacteria 6859
389 Ga0075367_10033942 3300006178 Bacteria 2944
390 Ga0075366_10001679 3300006195 Bacteria 11111
391 Ga0075366_10012914 3300006195 Bacteria 4747
392 Ga0097621_100000216 3300006237 Bacteria 38151
393 Ga0097621_100005019 3300006237 Bacteria 9288
394 Ga0097621_100005239 3300006237 Bacteria 9121
395 Ga0097621_100012248 3300006237 Bacteria 6347
396 Ga0097621_100058175 3300006237 Bacteria 3163
397 Ga0097621_100066986 3300006237 Bacteria 2959
398 Ga0097621_100130792 3300006237 Bacteria 2137
399 Ga0097621_100190453 3300006237 Bacteria 1776
400 Ga0075370_10017085 3300006353 Bacteria 3916
401 Ga0068871_100000149 3300006358 Bacteria 46054
402 Ga0068871_100000182 3300006358 Bacteria 42634
403 Ga0068871_100007539 3300006358 Bacteria 7783
404 Ga0068871_100011744 3300006358 Bacteria 6434
405 Ga0068871_100120248 3300006358 Bacteria 2218
406 Ga0068871_100138512 3300006358 Bacteria 2068
407 Ga0068871_100294310 3300006358 Bacteria 1423
408 Ga0068871_100356545 3300006358 Bacteria 1295
409 Ga0068871_100422980 3300006358 Bacteria 1190
410 Ga0075428_100010054 3300006844 Bacteria 10511
411 Ga0075428_100037185 3300006844 Bacteria 5360
412 Ga0075428_100043709 3300006844 Bacteria 4926
413 Ga0075428_100044305 3300006844 Bacteria 4889
414 Ga0075428_100058957 3300006844 Bacteria 4204
415 Ga0075428_100070197 3300006844 Bacteria 3830
416 Ga0075428_100074509 3300006844 Bacteria 3708
417 Ga0075428_100120095 3300006844 Bacteria 2861
418 Ga0075428_100126601 3300006844 Bacteria 2780
419 Ga0075428_100178364 3300006844 Unclassified 2300
420 Ga0075428_100201184 3300006844 Bacteria 2153
421 Ga0075428_100222194 3300006844 Bacteria 2039
422 Ga0075428_100233383 3300006844 Bacteria 1985
423 Ga0075428_100267706 3300006844 Bacteria 1839
424 Ga0075430_100042326 3300006846 Bacteria 3852
425 Ga0075430_100052081 3300006846 Bacteria 3447
426 Ga0075430_100119035 3300006846 Bacteria 2201
427 Ga0075430_100126973 3300006846 Bacteria 2126
428 Ga0075431_100000894 3300006847 Bacteria 26330
429 Ga0075431_100001697 3300006847 Bacteria 20698
430 Ga0075431_100017096 3300006847 Bacteria 7370
431 Ga0075431_100028432 3300006847 Bacteria 5746
432 Ga0075431_100057498 3300006847 Bacteria 4012
433 Ga0075431_100199680 3300006847 Unclassified 2046
434 Ga0075433_10004042 3300006852 Bacteria 11352
435 Ga0075433_10004179 3300006852 Bacteria 11208
436 Ga0075433_10007296 3300006852 Bacteria 8767
437 Ga0075433_10074069 3300006852 Bacteria 2996
438 Ga0075433_10096949 3300006852 Unclassified 2610
439 Ga0075433_10159143 3300006852 Bacteria 2010
440 Ga0075433_10305236 3300006852 Bacteria 1409
441 Ga0075433_10455798 3300006852 Bacteria 1127
442 Ga0075434_100000987 3300006871 Bacteria 23010
443 Ga0075434_100005262 3300006871 Bacteria 11760
444 Ga0075434_100007333 3300006871 Bacteria 10206
445 Ga0075434_100014060 3300006871 Bacteria 7642
446 Ga0075434_100014264 3300006871 Bacteria 7593
447 Ga0075434_100016262 3300006871 Bacteria 7151
448 Ga0075434_100018693 3300006871 Bacteria 6696
449 Ga0075434_100023184 3300006871 Bacteria 6047
450 Ga0075434_100028761 3300006871 Bacteria 5465
451 Ga0075434_100063412 3300006871 Bacteria 3678
452 Ga0075434_100084855 3300006871 Bacteria 3166
453 Ga0075434_100169274 3300006871 Bacteria 2205
454 Ga0075434_100215449 3300006871 Bacteria 1940
455 Ga0075434_100450959 3300006871 Bacteria 1308
456 Ga0075429_100001963 3300006880 Bacteria 17082
457 Ga0075429_100012743 3300006880 Bacteria 7293
458 Ga0075429_100023159 3300006880 Bacteria 5386
459 Ga0075429_100033426 3300006880 Bacteria 4469
460 Ga0075429_100038554 3300006880 Bacteria 4160
461 Ga0075429_100077611 3300006880 Bacteria 2894
462 Ga0075429_100077751 3300006880 Bacteria 2891
463 Ga0075429_100208098 3300006880 Bacteria 1714
464 Ga0075429_100235784 3300006880 Bacteria 1603
465 Ga0075429_100251579 3300006880 Bacteria 1547
466 Ga0068865_100007294 3300006881 Bacteria 6793
467 Ga0068865_100038170 3300006881 Bacteria 3249
468 Ga0068865_100079007 3300006881 Bacteria 2355
469 Ga0075436_100002937 3300006914 Bacteria 11689
470 Ga0075436_100017840 3300006914 Bacteria 4859
471 Ga0075436_100026209 3300006914 Bacteria 4013
472 Ga0075436_100043133 3300006914 Bacteria 3110
473 Ga0075436_100059276 3300006914 Unclassified 2644
474 Ga0075436_100064009 3300006914 Bacteria 2542
475 Ga0097620_100003538 3300006931 Bacteria 15905
476 Ga0097620_100018858 3300006931 Bacteria 6932
477 Ga0097620_100021409 3300006931 Bacteria 6489
478 Ga0097620_100062854 3300006931 Bacteria 3743
479 Ga0097620_100138407 3300006931 Bacteria 2508
480 Ga0097620_100199273 3300006931 Bacteria 2086
481 Ga0097620_100236782 3300006931 Bacteria 1914
482 Ga0097620_100239021 3300006931 Bacteria 1905
483 Ga0097620_100303404 3300006931 Bacteria 1690
484 Ga0075435_100000105 3300007076 Bacteria 45736
485 Ga0075435_100003136 3300007076 Bacteria 11167
486 Ga0075435_100020470 3300007076 Bacteria 5071
487 Ga0075435_100034710 3300007076 Bacteria 3999
488 Ga0075435_100136088 3300007076 Unclassified 2058
489 Ga0075435_100138133 3300007076 Bacteria 2043
490 Ga0075435_100288157 3300007076 Bacteria 1403
491 Ga0075435_100421035 3300007076 Bacteria 1150
492 Ga0099794_10005644 3300007265 Bacteria 5036
493 Ga0099794_10074530 3300007265 Bacteria 1667
494 Ga0099794_10107237 3300007265 Unclassified 1397
495 Ga0099794_10113625 3300007265 Bacteria 1358
496 Ga0099795_10029118 3300007788 Bacteria 1885
497 Ga0105240_10031012 3300009093 Bacteria 6938
498 Ga0105240_10041881 3300009093 Bacteria 5840
499 Ga0105240_10073003 3300009093 Bacteria 4238
500 Ga0105240_10073406 3300009093 Bacteria 4224
501 Ga0105240_10128137 3300009093 Unclassified 3047
502 Ga0105240_10147534 3300009093 Bacteria 2805
503 Ga0105240_10387765 3300009093 Bacteria 1576
504 Ga0105240_10591779 3300009093 Bacteria 1222
505 Ga0111539_10002268 3300009094 Bacteria 25594
506 Ga0111539_10021616 3300009094 Bacteria 7914
507 Ga0111539_10041896 3300009094 Bacteria 5501
508 Ga0111539_10062047 3300009094 Bacteria 4426
509 Ga0111539_10067230 3300009094 Bacteria 4232
510 Ga0111539_10158272 3300009094 Bacteria 2650
511 Ga0111539_10208377 3300009094 Bacteria 2278
512 Ga0111539_10209069 3300009094 Bacteria 2274
513 Ga0111539_10252493 3300009094 Bacteria 2053
514 Ga0111539_10320090 3300009094 Bacteria 1805
515 Ga0111539_10452042 3300009094 Bacteria 1496
516 Ga0105245_10000595 3300009098 Bacteria 32685
517 Ga0105245_10001513 3300009098 Bacteria 21071
518 Ga0105245_10030639 3300009098 Bacteria 4758
519 Ga0105247_10021352 3300009101 Bacteria 3896
520 Ga0105247_10188822 3300009101 Archaea 1379
521 Ga0114129_10000027 3300009147 Bacteria 112969
522 Ga0114129_10000183 3300009147 Bacteria 69906
523 Ga0114129_10005840 3300009147 Bacteria 17432
524 Ga0114129_10008305 3300009147 Bacteria 14814
525 Ga0114129_10025642 3300009147 Bacteria 8352
526 Ga0114129_10027882 3300009147 Bacteria 7997
527 Ga0114129_10040995 3300009147 Bacteria 6525
528 Ga0114129_10077296 3300009147 Bacteria 4630
529 Ga0114129_10091712 3300009147 Bacteria 4208
530 Ga0114129_10107223 3300009147 Unclassified 3859
531 Ga0114129_10112098 3300009147 Bacteria 3762
532 Ga0114129_10137473 3300009147 Bacteria 3352
533 Ga0114129_10146134 3300009147 Bacteria 3239
534 Ga0114129_10331302 3300009147 Bacteria 2021
535 Ga0114129_10370902 3300009147 Bacteria 1892
536 Ga0114129_10406793 3300009147 Bacteria 1793
537 Ga0105243_10007785 3300009148 Bacteria 8238
538 Ga0105241_10002493 3300009174 Bacteria 13835
539 Ga0105241_10003544 3300009174 Bacteria 11615
540 Ga0105241_10041643 3300009174 Unclassified 3472
541 Ga0105241_10113739 3300009174 Unclassified 2170
542 Ga0105241_10334867 3300009174 Unclassified 1309
543 Ga0105242_10024581 3300009176 Bacteria 4759
544 Ga0105242_10072798 3300009176 Bacteria 2855
545 Ga0105242_10391738 3300009176 Bacteria 1294
546 Ga0105248_10007674 3300009177 Bacteria 11857
547 Ga0105248_10010838 3300009177 Bacteria 10065
548 Ga0105248_10014674 3300009177 Bacteria 8622
549 Ga0105248_10015732 3300009177 Bacteria 8338
550 Ga0105248_10073972 3300009177 Bacteria 3830
551 Ga0105248_10074281 3300009177 Bacteria 3821
552 Ga0105248_10589686 3300009177 Bacteria 1254
553 Ga0105237_10054290 3300009545 Bacteria 4015
554 Ga0105237_10075899 3300009545 Bacteria 3352
555 Ga0105237_10082202 3300009545 Bacteria 3212
556 Ga0105237_10569626 3300009545 Bacteria 1139
557 Ga0105237_10577160 3300009545 Bacteria 1131
558 Ga0105238_10044311 3300009551 Bacteria 4498
559 Ga0105238_10209625 3300009551 Bacteria 1924
560 Ga0105238_10283116 3300009551 Bacteria 1639
561 Ga0105238_10440790 3300009551 Bacteria 1299
562 Ga0105249_10017814 3300009553 Bacteria 6311
563 Ga0105249_10076406 3300009553 Bacteria 3104
564 Ga0105249_10198628 3300009553 Bacteria 1962
565 Ga0105249_10210392 3300009553 Bacteria 1908
566 Ga0105249_10461220 3300009553 Bacteria 1311
567 Ga0099796_10019613 3300010159 Unclassified 2053
568 Ga0105239_10078320 3300010375 Bacteria 3637
569 Ga0105239_10090363 3300010375 Bacteria 3378
570 Ga0105239_10235811 3300010375 Bacteria 2053
571 Ga0105239_10377531 3300010375 Bacteria 1602
572 Ga0105246_10026331 3300011119 Bacteria 3798
573 Ga0105246_10034089 3300011119 Bacteria 3388
574 Ga0105246_10108039 3300011119 Bacteria 2039
575 Ga0157373_10004228 3300013100 Bacteria 10836
576 Ga0157373_10059701 3300013100 Bacteria 2702
577 Ga0157373_10073908 3300013100 Bacteria 2405
578 Ga0157373_10090650 3300013100 Bacteria 2153
579 Ga0157373_10334940 3300013100 Bacteria 1078
580 Ga0157371_10044461 3300013102 Bacteria 3162
581 Ga0157370_10009209 3300013104 Bacteria 10585
582 Ga0157370_10368753 3300013104 Bacteria 1323
583 Ga0157369_10001537 3300013105 Bacteria 28258
584 Ga0157369_10002128 3300013105 Bacteria 23882
585 Ga0157369_10010332 3300013105 Bacteria 10645
586 Ga0157369_10011085 3300013105 Bacteria 10256
587 Ga0157369_10121476 3300013105 Bacteria 2771
588 Ga0157369_10190717 3300013105 Bacteria 2154
589 Ga0157369_10294183 3300013105 Bacteria 1690
590 Ga0157369_10363681 3300013105 Bacteria 1502
591 Ga0157374_10000090 3300013296 Bacteria 88789
592 Ga0157374_10000483 3300013296 Bacteria 36023
593 Ga0157374_10000804 3300013296 Bacteria 27523
594 Ga0157374_10027327 3300013296 Bacteria 5144
595 Ga0157374_10116821 3300013296 Unclassified 2571
596 Ga0157374_10251098 3300013296 Bacteria 1741
597 Ga0157378_10000070 3300013297 Bacteria 91609
598 Ga0157378_10000487 3300013297 Bacteria 37522
599 Ga0157378_10002859 3300013297 Bacteria 15406
600 Ga0157378_10042068 3300013297 Bacteria 4054
601 Ga0157378_10108888 3300013297 Bacteria 2537
602 Ga0157378_10219858 3300013297 Bacteria 1805
603 Ga0163162_10123571 3300013306 Bacteria 2694
604 Ga0157372_10000211 3300013307 Bacteria 65258
605 Ga0157372_10002476 3300013307 Bacteria 20009
606 Ga0157372_10008246 3300013307 Bacteria 11076
607 Ga0157372_10009031 3300013307 Bacteria 10594
608 Ga0157372_10009482 3300013307 Bacteria 10352
609 Ga0157372_10036083 3300013307 Bacteria 5447
610 Ga0157372_10045292 3300013307 Unclassified 4879
611 Ga0157372_10090650 3300013307 Bacteria 3476
612 Ga0157372_10093403 3300013307 Bacteria 3424
613 Ga0157372_10110928 3300013307 Bacteria 3142
614 Ga0157372_10143748 3300013307 Bacteria 2751
615 Ga0157372_10244051 3300013307 Bacteria 2084
616 Ga0157372_10827777 3300013307 Bacteria 1075
617 Ga0157375_10080338 3300013308 Bacteria 3299
618 Ga0157375_10116181 3300013308 Bacteria 2780
619 Ga0163163_10000034 3300014325 Bacteria 161820
620 Ga0163163_10001046 3300014325 Bacteria 23422
621 Ga0163163_10003961 3300014325 Bacteria 12643
622 Ga0163163_10038058 3300014325 Bacteria 4684
623 Ga0163163_10068514 3300014325 Bacteria 3531
624 Ga0163163_10193586 3300014325 Bacteria 2081
625 Ga0163163_10370274 3300014325 Bacteria 1490
626 Ga0163163_10465775 3300014325 Bacteria 1324
627 Ga0157380_10003290 3300014326 Bacteria 11079
628 Ga0157380_10008166 3300014326 Bacteria 7457
629 Ga0157380_10055678 3300014326 Bacteria 3142
630 Ga0157380_10083337 3300014326 Bacteria 2619
631 Ga0157380_10179700 3300014326 Bacteria 1858
632 Ga0157380_10263977 3300014326 Bacteria 1566
633 Ga0157380_10403349 3300014326 Bacteria 1298
634 Ga0182008_10127067 3300014497 Bacteria 1270
635 Ga0157377_10003510 3300014745 Bacteria 7093
636 Ga0157377_10008189 3300014745 Bacteria 5086
637 Ga0157379_10110914 3300014968 Bacteria 2464
638 Ga0157379_10137271 3300014968 Bacteria 2204
639 Ga0157379_10152512 3300014968 Bacteria 2084
640 Ga0157379_10477609 3300014968 Bacteria 1153
641 Ga0157376_10000036 3300014969 Bacteria 145496
642 Ga0157376_10003183 3300014969 Bacteria 11281
643 Ga0157376_10107190 3300014969 Bacteria 2452
644 Ga0157376_10440019 3300014969 Bacteria 1269
645 Ga0157376_10604258 3300014969 Bacteria 1092
646 Ga0182006_1023521 3300015261 Bacteria 2551
647 Ga0182005_1017246 3300015265 Bacteria 2000
648 Ga0163161_10001109 3300017792 Bacteria 20362
649 Ga0213873_10050233 3300021358 Bacteria 1102
650 Ga0213874_10015900 3300021377 Bacteria 1992
651 Ga0224570_101423 3300022730 Bacteria 1796
652 Ga0224572_1003844 3300024225 Bacteria 2565
653 Ga0228598_1000649 3300024227 Bacteria 7292
654 Ga0228598_1001051 3300024227 Bacteria 6072
655 Ga0228598_1001059 3300024227 Bacteria 6056
656 Ga0228598_1004139 3300024227 Bacteria 3082
657 Ga0209147_100154 3300025229 Bacteria 94574
658 Ga0207697_10007679 3300025315 Bacteria 4783
659 Ga0207697_10150018 3300025315 Bacteria 1014
660 Ga0207656_10019653 3300025321 Bacteria 2674
661 Ga0207656_10057292 3300025321 Bacteria 1700
662 Ga0207653_10004964 3300025885 Bacteria 4155
663 Ga0207653_10040715 3300025885 Bacteria 1524
664 Ga0207692_10007523 3300025898 Bacteria 4465
665 Ga0207692_10021238 3300025898 Bacteria 2968
666 Ga0207692_10044340 3300025898 Unclassified 2219
667 Ga0207642_10001445 3300025899 Bacteria 7369
668 Ga0207642_10023424 3300025899 Bacteria 2466
669 Ga0207642_10097699 3300025899 Bacteria 1466
670 Ga0207688_10064623 3300025901 Bacteria 2067
671 Ga0207680_10036807 3300025903 Bacteria 2820
672 Ga0207680_10126764 3300025903 Bacteria 1677
673 Ga0207647_10000762 3300025904 Bacteria 25198
674 Ga0207647_10006360 3300025904 Bacteria 8589
675 Ga0207647_10009306 3300025904 Bacteria 6984
676 Ga0207685_10000326 3300025905 Bacteria 7692
677 Ga0207685_10015400 3300025905 Bacteria 2421
678 Ga0207685_10083622 3300025905 Bacteria 1327
679 Ga0207685_10102571 3300025905 Bacteria 1226
680 Ga0207685_10118870 3300025905 Bacteria 1157
681 Ga0207699_10000086 3300025906 Bacteria 70145
682 Ga0207699_10027348 3300025906 Bacteria 3157
683 Ga0207699_10068991 3300025906 Bacteria 2154
684 Ga0207699_10109593 3300025906 Bacteria 1767
685 Ga0207699_10245144 3300025906 Bacteria 1233
686 Ga0207699_10267058 3300025906 Bacteria 1184
687 Ga0207699_10295263 3300025906 Unclassified 1130
688 Ga0207645_10000019 3300025907 Bacteria 110182
689 Ga0207645_10011521 3300025907 Bacteria 6033
690 Ga0207645_10026140 3300025907 Bacteria 3774
691 Ga0207643_10000432 3300025908 Bacteria 27650
692 Ga0207643_10062787 3300025908 Bacteria 2123
693 Ga0207684_10000238 3300025910 Bacteria 83165
694 Ga0207684_10001476 3300025910 Bacteria 25302
695 Ga0207684_10012964 3300025910 Bacteria 7217
696 Ga0207684_10024595 3300025910 Bacteria 5134
697 Ga0207684_10064397 3300025910 Bacteria 3112
698 Ga0207684_10067679 3300025910 Bacteria 3035
699 Ga0207684_10097810 3300025910 Bacteria 2506
700 Ga0207654_10031354 3300025911 Bacteria 2926
701 Ga0207654_10050556 3300025911 Bacteria 2389
702 Ga0207654_10200501 3300025911 Unclassified 1313
703 Ga0207707_10006534 3300025912 Bacteria 10174
704 Ga0207707_10031794 3300025912 Bacteria 4620
705 Ga0207707_10169048 3300025912 Bacteria 1911
706 Ga0207707_10237536 3300025912 Unclassified 1585
707 Ga0207707_10314554 3300025912 Bacteria 1353
708 Ga0207707_10326590 3300025912 Bacteria 1324
709 Ga0207695_10027677 3300025913 Bacteria 6309
710 Ga0207695_10031749 3300025913 Bacteria 5787
711 Ga0207695_10042363 3300025913 Bacteria 4864
712 Ga0207695_10062388 3300025913 Bacteria 3848
713 Ga0207695_10086813 3300025913 Unclassified 3154
714 Ga0207695_10371531 3300025913 Bacteria 1316
715 Ga0207671_10048960 3300025914 Bacteria 3128
716 Ga0207671_10114372 3300025914 Bacteria 2056
717 Ga0207671_10125992 3300025914 Bacteria 1962
718 Ga0207671_10154248 3300025914 Bacteria 1776
719 Ga0207693_10000044 3300025915 Bacteria 103362
720 Ga0207693_10000546 3300025915 Bacteria 34039
721 Ga0207693_10027913 3300025915 Bacteria 4461
722 Ga0207693_10033092 3300025915 Bacteria 4080
723 Ga0207693_10055195 3300025915 Bacteria 3117
724 Ga0207693_10112115 3300025915 Bacteria 2139
725 Ga0207693_10147372 3300025915 Bacteria 1851
726 Ga0207693_10240265 3300025915 Bacteria 1422
727 Ga0207693_10353098 3300025915 Bacteria 1150
728 Ga0207663_10000745 3300025916 Bacteria 14525
729 Ga0207663_10050357 3300025916 Bacteria 2588
730 Ga0207663_10073401 3300025916 Bacteria 2214
731 Ga0207663_10226252 3300025916 Bacteria 1364
732 Ga0207663_10324988 3300025916 Bacteria 1157
733 Ga0207660_10061432 3300025917 Bacteria 2704
734 Ga0207660_10121961 3300025917 Bacteria 1975
735 Ga0207660_10125457 3300025917 Bacteria 1949
736 Ga0207660_10282655 3300025917 Bacteria 1317
737 Ga0207660_10519789 3300025917 Bacteria 967
738 Ga0207662_10001347 3300025918 Bacteria 11854
739 Ga0207662_10008827 3300025918 Bacteria 5531
740 Ga0207662_10010238 3300025918 Bacteria 5173
741 Ga0207657_10014641 3300025919 Bacteria 7642
742 Ga0207657_10015652 3300025919 Bacteria 7337
743 Ga0207649_10000188 3300025920 Bacteria 50655
744 Ga0207649_10140980 3300025920 Unclassified 1649
745 Ga0207652_10016502 3300025921 Bacteria 6031
746 Ga0207652_10018680 3300025921 Bacteria 5688
747 Ga0207652_10062271 3300025921 Bacteria 3224
748 Ga0207652_10064820 3300025921 Bacteria 3162
749 Ga0207652_10287692 3300025921 Bacteria 1483
750 Ga0207652_10561437 3300025921 Bacteria 1025
751 Ga0207646_10000073 3300025922 Bacteria 140267
752 Ga0207646_10000404 3300025922 Bacteria 57874
753 Ga0207646_10000549 3300025922 Bacteria 49403
754 Ga0207646_10000901 3300025922 Bacteria 38302
755 Ga0207646_10021264 3300025922 Bacteria 5997
756 Ga0207646_10051234 3300025922 Bacteria 3694
757 Ga0207646_10060879 3300025922 Bacteria 3371
758 Ga0207646_10061042 3300025922 Bacteria 3365
759 Ga0207646_10121735 3300025922 Bacteria 2344
760 Ga0207646_10168414 3300025922 Unclassified 1978
761 Ga0207646_10298421 3300025922 Bacteria 1456
762 Ga0207646_10332503 3300025922 Bacteria 1373
763 Ga0207646_10350425 3300025922 Bacteria 1334
764 Ga0207681_10050607 3300025923 Bacteria 2812
765 Ga0207681_10096609 3300025923 Bacteria 2121
766 Ga0207681_10184689 3300025923 Bacteria 1591
767 Ga0207694_10002864 3300025924 Bacteria 13898
768 Ga0207694_10129212 3300025924 Bacteria 2024
769 Ga0207694_10153520 3300025924 Bacteria 1856
770 Ga0207650_10000024 3300025925 Bacteria 299184
771 Ga0207650_10014362 3300025925 Bacteria 5505
772 Ga0207650_10016981 3300025925 Bacteria 5092
773 Ga0207650_10048919 3300025925 Bacteria 3120
774 Ga0207659_10120442 3300025926 Bacteria 2010
775 Ga0207687_10020670 3300025927 Bacteria 4369
776 Ga0207687_10042288 3300025927 Bacteria 3134
777 Ga0207687_10118379 3300025927 Bacteria 1977
778 Ga0207700_10000090 3300025928 Bacteria 55960
779 Ga0207700_10000101 3300025928 Bacteria 52726
780 Ga0207700_10003111 3300025928 Bacteria 9587
781 Ga0207700_10015567 3300025928 Bacteria 5021
782 Ga0207700_10018678 3300025928 Bacteria 4665
783 Ga0207700_10049934 3300025928 Bacteria 3114
784 Ga0207700_10056721 3300025928 Bacteria 2950
785 Ga0207700_10059747 3300025928 Bacteria 2884
786 Ga0207700_10094477 3300025928 Bacteria 2369
787 Ga0207700_10125422 3300025928 Bacteria 2088
788 Ga0207700_10137766 3300025928 Bacteria 2001
789 Ga0207700_10321120 3300025928 Unclassified 1342
790 Ga0207700_10359946 3300025928 Bacteria 1268
791 Ga0207664_10000033 3300025929 Bacteria 176549
792 Ga0207664_10003224 3300025929 Bacteria 10844
793 Ga0207664_10026443 3300025929 Bacteria 4387
794 Ga0207664_10034850 3300025929 Bacteria 3879
795 Ga0207664_10047673 3300025929 Bacteria 3367
796 Ga0207664_10048728 3300025929 Bacteria 3333
797 Ga0207664_10109197 3300025929 Bacteria 2298
798 Ga0207664_10165614 3300025929 Unclassified 1888
799 Ga0207664_10490768 3300025929 Bacteria 1099
800 Ga0207644_10080909 3300025931 Bacteria 2399
801 Ga0207644_10300817 3300025931 Bacteria 1293
802 Ga0207690_10190626 3300025932 Bacteria 1550
803 Ga0207706_10000912 3300025933 Bacteria 30372
804 Ga0207706_10018727 3300025933 Bacteria 6228
805 Ga0207706_10097325 3300025933 Bacteria 2588
806 Ga0207706_10106514 3300025933 Bacteria 2467
807 Ga0207686_10069502 3300025934 Bacteria 2260
808 Ga0207709_10023571 3300025935 Bacteria 3505
809 Ga0207670_10000141 3300025936 Bacteria 47492
810 Ga0207670_10015668 3300025936 Bacteria 4535
811 Ga0207670_10033997 3300025936 Bacteria 3290
812 Ga0207670_10034780 3300025936 Bacteria 3260
813 Ga0207670_10088630 3300025936 Bacteria 2182
814 Ga0207669_10052866 3300025937 Bacteria 2443
815 Ga0207669_10087772 3300025937 Bacteria 2015
816 Ga0207704_10039453 3300025938 Bacteria 2750
817 Ga0207704_10048675 3300025938 Bacteria 2543
818 Ga0207704_10129925 3300025938 Bacteria 1742
819 Ga0207704_10201320 3300025938 Bacteria 1457
820 Ga0207665_10000119 3300025939 Bacteria 51930
821 Ga0207665_10000189 3300025939 Bacteria 41548
822 Ga0207665_10002959 3300025939 Bacteria 11384
823 Ga0207665_10003250 3300025939 Bacteria 10880
824 Ga0207665_10011641 3300025939 Bacteria 5780
825 Ga0207665_10016061 3300025939 Bacteria 4917
826 Ga0207665_10063549 3300025939 Bacteria 2507
827 Ga0207665_10262538 3300025939 Bacteria 1280
828 Ga0207665_10298159 3300025939 Bacteria 1204
829 Ga0207691_10004229 3300025940 Bacteria 13944
830 Ga0207691_10030878 3300025940 Bacteria 5003
831 Ga0207691_10313776 3300025940 Bacteria 1345
832 Ga0207711_10018665 3300025941 Bacteria 5767
833 Ga0207711_10025149 3300025941 Bacteria 4996
834 Ga0207711_10036791 3300025941 Bacteria 4154
835 Ga0207711_10103474 3300025941 Bacteria 2521
836 Ga0207711_10108426 3300025941 Bacteria 2467
837 Ga0207711_10258700 3300025941 Bacteria 1599
838 Ga0207711_10436321 3300025941 Bacteria 1219
839 Ga0207711_10616574 3300025941 Bacteria 1012
840 Ga0207711_10625560 3300025941 Bacteria 1004
841 Ga0207689_10000078 3300025942 Bacteria 79810
842 Ga0207689_10001992 3300025942 Bacteria 19297
843 Ga0207689_10061265 3300025942 Bacteria 3094
844 Ga0207689_10094678 3300025942 Bacteria 2453
845 Ga0207689_10106543 3300025942 Bacteria 2303
846 Ga0207661_10000067 3300025944 Bacteria 72201
847 Ga0207661_10034875 3300025944 Bacteria 3917
848 Ga0207661_10097469 3300025944 Bacteria 2462
849 Ga0207661_10171334 3300025944 Bacteria 1890
850 Ga0207661_10216238 3300025944 Bacteria 1692
851 Ga0207661_10281170 3300025944 Unclassified 1487
852 Ga0207679_10000055 3300025945 Bacteria 108728
853 Ga0207679_10237117 3300025945 Unclassified 1543
854 Ga0207679_10336599 3300025945 Bacteria 1311
855 Ga0207667_10000170 3300025949 Bacteria 95740
856 Ga0207667_10012321 3300025949 Bacteria 9862
857 Ga0207667_10051637 3300025949 Bacteria 4333
858 Ga0207667_10467898 3300025949 Bacteria 1280
859 Ga0207667_10548774 3300025949 Bacteria 1169
860 Ga0207667_10696269 3300025949 Bacteria 1019
861 Ga0207651_10021937 3300025960 Bacteria 3892
862 Ga0207651_10029315 3300025960 Bacteria 3485
863 Ga0207651_10131212 3300025960 Bacteria 1918
864 Ga0207651_10281693 3300025960 Bacteria 1374
865 Ga0207712_10166892 3300025961 Bacteria 1717
866 Ga0207712_10177116 3300025961 Bacteria 1672
867 Ga0207712_10412996 3300025961 Bacteria 1137
868 Ga0207640_10189232 3300025981 Bacteria 1550
869 Ga0207640_10393175 3300025981 Bacteria 1127
870 Ga0207658_10016816 3300025986 Bacteria 5033
871 Ga0207658_10068741 3300025986 Bacteria 2674
872 Ga0207677_10004744 3300026023 Bacteria 7330
873 Ga0207677_10006247 3300026023 Bacteria 6515
874 Ga0207677_10046574 3300026023 Bacteria 2905
875 Ga0207677_10116961 3300026023 Bacteria 1997
876 Ga0207677_10258727 3300026023 Bacteria 1418
877 Ga0207703_10001408 3300026035 Bacteria 21917
878 Ga0207703_10002734 3300026035 Bacteria 15109
879 Ga0207703_10012584 3300026035 Bacteria 6595
880 Ga0207703_10056476 3300026035 Bacteria 3198
881 Ga0207703_10064537 3300026035 Bacteria 3006
882 Ga0207703_10068712 3300026035 Bacteria 2920
883 Ga0207703_10137271 3300026035 Bacteria 2118
884 Ga0207703_10445242 3300026035 Bacteria 1209
885 Ga0207639_10002287 3300026041 Bacteria 12868
886 Ga0207639_10147401 3300026041 Bacteria 1967
887 Ga0207639_10328425 3300026041 Bacteria 1360
888 Ga0207678_10001331 3300026067 Bacteria 22808
889 Ga0207678_10016835 3300026067 Bacteria 6419
890 Ga0207678_10040295 3300026067 Bacteria 4052
891 Ga0207708_10002845 3300026075 Bacteria 12730
892 Ga0207708_10022762 3300026075 Bacteria 4732
893 Ga0207708_10055446 3300026075 Bacteria 3022
894 Ga0207708_10057688 3300026075 Bacteria 2962
895 Ga0207708_10176109 3300026075 Unclassified 1696
896 Ga0207708_10201559 3300026075 Bacteria 1588
897 Ga0207702_10001597 3300026078 Bacteria 22421
898 Ga0207702_10006327 3300026078 Bacteria 10229
899 Ga0207702_10012220 3300026078 Bacteria 7144
900 Ga0207702_10306649 3300026078 Bacteria 1508
901 Ga0207702_10465181 3300026078 Unclassified 1229
902 Ga0207641_10000030 3300026088 Bacteria 224468
903 Ga0207641_10008766 3300026088 Bacteria 8353
904 Ga0207641_10009428 3300026088 Bacteria 8043
905 Ga0207641_10012702 3300026088 Bacteria 6905
906 Ga0207641_10052353 3300026088 Bacteria 3457
907 Ga0207641_10083664 3300026088 Bacteria 2776
908 Ga0207641_10135955 3300026088 Bacteria 2212
909 Ga0207641_10160978 3300026088 Bacteria 2041
910 Ga0207648_10000031 3300026089 Bacteria 129124
911 Ga0207648_10001943 3300026089 Bacteria 22611
912 Ga0207648_10039856 3300026089 Bacteria 4129
913 Ga0207676_10000915 3300026095 Bacteria 22842
914 Ga0207676_10033311 3300026095 Bacteria 3891
915 Ga0207676_10037233 3300026095 Bacteria 3706
916 Ga0207676_10083058 3300026095 Bacteria 2607
917 Ga0207676_10134395 3300026095 Bacteria 2108
918 Ga0207676_10245686 3300026095 Bacteria 1608
919 Ga0207676_10416817 3300026095 Unclassified 1258
920 Ga0207674_10000618 3300026116 Bacteria 46623
921 Ga0207674_10002087 3300026116 Bacteria 25284
922 Ga0207674_10002424 3300026116 Bacteria 23553
923 Ga0207674_10009625 3300026116 Bacteria 11023
924 Ga0207674_10048473 3300026116 Bacteria 4348
925 Ga0207674_10056136 3300026116 Bacteria 4000
926 Ga0207675_100009496 3300026118 Bacteria 9104
927 Ga0207675_100032163 3300026118 Bacteria 4887
928 Ga0207675_100063435 3300026118 Bacteria 3452
929 Ga0207675_100203600 3300026118 Bacteria 1901
930 Ga0207675_100239928 3300026118 Bacteria 1751
931 Ga0207675_100358070 3300026118 Bacteria 1431
932 Ga0207675_100431560 3300026118 Bacteria 1303
933 Ga0207683_10005417 3300026121 Bacteria 10932
934 Ga0207683_10207205 3300026121 Bacteria 1784
935 Ga0207698_10075494 3300026142 Bacteria 2694
936 Ga0207698_10136086 3300026142 Bacteria 2108
937 Ga0207698_10280262 3300026142 Bacteria 1541
938 Ga0209588_1002596 3300027671 Bacteria 4915
939 Ga0209588_1025474 3300027671 Bacteria 1873
940 Ga0209588_1029634 3300027671 Bacteria 1746
941 Ga0209588_1034262 3300027671 Unclassified 1630
942 Ga0207428_10001654 3300027907 Bacteria 23163
943 Ga0207428_10016548 3300027907 Bacteria 6339
944 Ga0207428_10031295 3300027907 Bacteria 4392
945 Ga0207428_10103863 3300027907 Bacteria 2193
946 Ga0207428_10431962 3300027907 Bacteria 962
947 Ga0265354_1004808 3300028016 Bacteria 1397
948 Ga0268266_10000267 3300028379 Bacteria 86736
949 Ga0268266_10034893 3300028379 Bacteria 4278
950 Ga0268265_10039533 3300028380 Bacteria 3478
951 Ga0268265_10153074 3300028380 Bacteria 1947
952 Ga0268265_10207647 3300028380 Bacteria 1704
953 Ga0268265_10380205 3300028380 Bacteria 1299
954 Ga0268264_10002804 3300028381 Bacteria 15217
955 Ga0268264_10031874 3300028381 Bacteria 4324
956 Ga0268264_10074418 3300028381 Bacteria 2885
957 Ga0268264_10110236 3300028381 Bacteria 2410
958 Ga0268264_10166635 3300028381 Bacteria 1990
959 Ga0268264_10185711 3300028381 Bacteria 1891
960 Ga0268264_10547041 3300028381 Bacteria 1135
961 Ga0265338_10007491 3300028800 Bacteria 13522
962 Ga0265338_10011560 3300028800 Bacteria 10178
963 Ga0265338_10014474 3300028800 Bacteria 8778
964 Ga0265338_10070199 3300028800 Bacteria 3005
965 Ga0265338_10131633 3300028800 Bacteria 1973
966 Ga0265338_10170857 3300028800 Bacteria 1668
967 Ga0265338_10193154 3300028800 Bacteria 1541
968 Ga0265338_10204382 3300028800 Unclassified 1487
969 Ga0265762_1000146 3300030760 Bacteria 10917
970 Ga0265762_1001607 3300030760 Bacteria 4116
971 Ga0265765_1003037 3300030879 Bacteria 1663
972 Ga0265765_1004376 3300030879 Bacteria 1451
973 Ga0265760_10000033 3300031090 Bacteria 48732
974 Ga0265760_10000516 3300031090 Bacteria 10808
975 Ga0265760_10000551 3300031090 Bacteria 10599
976 Ga0265760_10007507 3300031090 Unclassified 3114
977 Ga0265760_10017032 3300031090 Bacteria 2087
978 Ga0265325_10003889 3300031241 Bacteria 9584
979 Ga0265325_10089462 3300031241 Bacteria 1520
980 Ga0265339_10013118 3300031249 Bacteria 5033
981 Ga0265339_10021085 3300031249 Bacteria 3798
982 Ga0265339_10070869 3300031249 Bacteria 1858
983 Ga0265339_10212035 3300031249 Bacteria 951
984 Ga0265316_10004100 3300031344 Bacteria 14593
985 Ga0265316_10014092 3300031344 Bacteria 7056
986 Ga0265316_10167267 3300031344 Bacteria 1642
987 Ga0265316_10362333 3300031344 Bacteria 1048
988 Ga0307408_100078226 3300031548 Bacteria 2465
989 Ga0265313_10076717 3300031595 Bacteria 1527
990 Ga0307508_10023956 3300031616 Bacteria 5540
991 Ga0265314_10001876 3300031711 Bacteria 22540
992 Ga0265314_10034143 3300031711 Bacteria 3721
993 Ga0265342_10057898 3300031712 Bacteria 2292
994 Ga0307405_10050076 3300031731 Bacteria 2585
995 Ga0307413_10080006 3300031824 Bacteria 2091
996 Ga0307413_10174722 3300031824 Bacteria 1525
997 Ga0307410_10006425 3300031852 Bacteria 6340
998 Ga0307410_10034902 3300031852 Bacteria 3262
999 Ga0307406_10052850 3300031901 Bacteria 2586
1000 Ga0307406_10060013 3300031901 Bacteria 2451
1001 Ga0307407_10022500 3300031903 Bacteria 3272
1002 Ga0307407_10047661 3300031903 Bacteria 2434
1003 Ga0307407_10155317 3300031903 Bacteria 1491
1004 Ga0307409_100020464 3300031995 Bacteria 4511
1005 Ga0307409_100035032 3300031995 Bacteria 3674
1006 Ga0307409_100182172 3300031995 Bacteria 1861
1007 Ga0307416_100077169 3300032002 Bacteria 2797
1008 Ga0307416_100188528 3300032002 Bacteria 1942
1009 Ga0307416_100229040 3300032002 Bacteria 1790
1010 Ga0307416_100709093 3300032002 Bacteria 1096
1011 Ga0307414_10100879 3300032004 Bacteria 2172
1012 Ga0307414_10345737 3300032004 Bacteria 1275
1013 Ga0307411_10004555 3300032005 Bacteria 6661
1014 Ga0307411_10038177 3300032005 Bacteria 3027
1015 Ga0307411_10114283 3300032005 Bacteria 1939
1016 Ga0307411_10128059 3300032005 Bacteria 1850
1017 Ga0307415_100045220 3300032126 Bacteria 2950
1018 Ga0307415_100155311 3300032126 Bacteria 1766
1019 Ga0307415_100161482 3300032126 Bacteria 1737
1020 Ga0373934_0003000 3300035086 Bacteria 6163
1021 Ga0373944_0014543 3300035089 Bacteria 2198
1022 Ga0373951_0000953 3300035091 Bacteria 7785
1023 Ga0373923_0008355 3300035111 Bacteria 3687
1024 Ga0373923_0028510 3300035111 Bacteria 2234
1025 Ga0373923_0088320 3300035111 Bacteria 1353
1026 Ga0373936_0005678 3300035113 Bacteria 4705
1027 Ga0373936_0007148 3300035113 Bacteria 4202
1028 Ga0373936_0054779 3300035113 Unclassified 1618
1029 Ga0373936_0072816 3300035113 Bacteria 1419
1030 Ga0373945_0015970 3300035116 Bacteria 2530
1031 Ga0373953_0001820 3300035117 Bacteria 6294
1032 Ga0373953_0106335 3300035117 Bacteria 1184
1033 Ga0373954_0074066 3300035118 Unclassified 1621
1034 Ga0373954_0076884 3300035118 Bacteria 1591
1035 Ga0373954_0136552 3300035118 Bacteria 1195
1036 Ga0373956_0005290 3300035119 Bacteria 5167
1037 Ga0373956_0010381 3300035119 Bacteria 3817
1038 Ga0373957_0000526 3300035120 Bacteria 9629
1039 Ga0373957_0003118 3300035120 Bacteria 4842
1040 Ga0373957_0003458 3300035120 Bacteria 4667
1041 Ga0373943_0045043 3300035170 Unclassified 2148
1042 Ga0373943_0090335 3300035170 Bacteria 1585
1043 Ga0373943_0111554 3300035170 Bacteria 1443
1044 Ga0373943_0280346 3300035170 Bacteria 942
1045 Ga0373946_0006023 3300035171 Bacteria 4400
1046 Ga0373946_0043794 3300035171 Bacteria 1845
1047 Ga0373955_0011254 3300035172 Bacteria 4255
1048 Ga0373955_0053465 3300035172 Bacteria 2205
1049 Ga0373955_0058755 3300035172 Bacteria 2116
1050 Ga0373942_0069561 3300035207 Bacteria 1025
1051 Ga0316574_0018911 3300035398 Bacteria 4057
1052 Ga0316574_0128147 3300035398 Bacteria 1632
1053 Ga0373924_0006841 3300035410 Bacteria 4097
1054 Ga0373931_0069579 3300035691 Bacteria 1918
1055 Ga0373931_0092278 3300035691 Unclassified 1689
1056 Ga0373931_0226660 3300035691 Bacteria 1127
1057 Ga0373935_0003601 3300035692 Bacteria 9031
1058 Ga0373935_0003897 3300035692 Bacteria 8704
1059 Ga0373935_0006473 3300035692 Bacteria 6995
1060 Ga0373927_0000123 3300035695 Bacteria 58803
1061 Ga0373927_0001591 3300035695 Bacteria 17025
1062 Ga0373927_0024226 3300035695 Bacteria 3970
1063 Ga0373927_0044465 3300035695 Unclassified 2873
1064 Ga0373927_0113353 3300035695 Unclassified 1767
1065 Ga0373927_0206819 3300035695 Bacteria 1289
1066 Ga0373933_0002466 3300035724 Bacteria 10406
1067 Ga0373933_0003709 3300035724 Bacteria 8448
1068 Ga0373933_0031159 3300035724 Unclassified 3093
1069 Ga0373933_0101316 3300035724 Bacteria 1787
1070 Ga0373947_0002769 3300035725 Bacteria 10489
1071 Ga0373947_0005381 3300035725 Bacteria 7468
1072 Ga0373947_0018368 3300035725 Unclassified 4024
1073 Ga0373947_0038591 3300035725 Bacteria 2838
1074 Ga0373947_0071076 3300035725 Bacteria 2134
1075 Ga0373947_0153156 3300035725 Bacteria 1486
1076 Ga0373947_0361784 3300035725 Bacteria 975
1077 Ga0373937_0000037 3300036401 Bacteria 111413
1078 Ga0373937_0242775 3300036401 Bacteria 1697
1079 Ga0373925_0000915 3300037068 Bacteria 26942
1080 Ga0373925_0003137 3300037068 Bacteria 12981
1081 Ga0373925_0005438 3300037068 Bacteria 9486
1082 Ga0373925_0007608 3300037068 Bacteria 7891
1083 Ga0373925_0096314 3300037068 Bacteria 2268
1084 Ga0373925_0124257 3300037068 Bacteria 2006
1085 Ga0395905_0010608 3300037471 Bacteria 8944
1086 Ga0395905_0041369 3300037471 Bacteria 4325
1087 Ga0395905_0119476 3300037471 Bacteria 2477
1088 Ga0436364_1286351 3300037853 Bacteria 4374
1089 Ga0436365_0558586 3300039437 Bacteria 1419
1090 Ga0436363_0148938 3300039450 Bacteria 2602
1091 Ga0436363_1051196 3300039450 Bacteria 2983
1092 Ga0436362_0425579 3300039453 Bacteria 2574
1093 Ga0436362_1154172 3300039453 Bacteria 2602
1094 Ga0439431_0060432 3300041997 Bacteria 996
1095 Ga0439462_0033105 3300042015 Bacteria 1370
1096 Ga0439446_0010019 3300042156 Bacteria 2546
1097 Ga0439446_0018794 3300042156 Bacteria 1940
1098 Ga0439434_0018301 3300042435 Bacteria 2096
1099 Ga0439459_0029808 3300042438 Bacteria 1103
1100 Ga0451577_0000390 3300042876 Bacteria 81287
1101 Ga0451577_0020501 3300042876 Bacteria 6066
1102 Ga0451577_0188476 3300042876 Bacteria 1860
1103 Ga0453683_0002477 3300044673 Bacteria 14275
1104 Ga0453683_0003673 3300044673 Bacteria 11243
1105 Ga0453683_0024798 3300044673 Bacteria 3814
1106 Ga0466963_0021213 3300044694 Bacteria 4095
1107 Ga0466963_0075292 3300044694 Bacteria 2278
1108 Ga0466964_0024512 3300044706 Bacteria 2352
1109 Ga0453684_0000686 3300044712 Bacteria 120659
1110 Ga0453684_0254328 3300044712 Bacteria 2016
1111 Ga0453684_0405792 3300044712 Bacteria 1525
1112 Ga0451576_0006359 3300045051 Bacteria 14504
1113 Ga0451576_0040972 3300045051 Bacteria 4897
1114 Ga0451576_0043177 3300045051 Bacteria 4757
1115 Ga0451576_0064398 3300045051 Bacteria 3819
1116 Ga0451576_0717877 3300045051 Bacteria 1050
1117 Ga0466967_0013623 3300045976 Bacteria 6293
1118 Ga0466967_0016966 3300045976 Bacteria 5761
1119 Ga0466967_0067424 3300045976 Bacteria 3192
1120 Ga0466967_0087331 3300045976 Unclassified 2827
1121 Ga0466967_0149802 3300045976 Bacteria 2179
1122 Ga0495592_0062395 3300046454 Bacteria 2736
1123 Ga0495603_0179046 3300046455 Bacteria 1227
1124 Ga0495629_0038676 3300046459 Unclassified 3359
1125 Ga0495629_0171227 3300046459 Bacteria 1507
1126 Ga0495641_0147193 3300046461 Unclassified 1052
1127 Ga0495651_0026393 3300046462 Bacteria 4524
1128 Ga0495653_0031817 3300046463 Bacteria 4192
1129 Ga0495653_0038953 3300046463 Bacteria 3727
1130 Ga0495653_0213132 3300046463 Bacteria 1303
1131 Ga0495580_0000163 3300046472 Bacteria 49180
1132 Ga0495580_0000505 3300046472 Bacteria 32817
1133 Ga0495580_0000909 3300046472 Bacteria 25811
1134 Ga0495580_0007429 3300046472 Bacteria 8809
1135 Ga0495580_0017832 3300046472 Bacteria 5296
1136 Ga0495580_0023516 3300046472 Bacteria 4523
1137 Ga0495580_0036953 3300046472 Bacteria 3506
1138 Ga0495580_0046576 3300046472 Bacteria 3076
1139 Ga0495580_0074389 3300046472 Bacteria 2371
1140 Ga0495580_0144937 3300046472 Bacteria 1646
1141 Ga0495580_0184212 3300046472 Bacteria 1441
1142 Ga0495580_0188420 3300046472 Bacteria 1423
1143 Ga0495582_0003168 3300046473 Bacteria 9237
1144 Ga0495582_0004127 3300046473 Bacteria 8167
1145 Ga0495639_0001941 3300046475 Bacteria 9181
1146 Ga0495639_0015376 3300046475 Unclassified 3319
1147 Ga0495639_0029191 3300046475 Bacteria 2448
1148 Ga0495662_0046988 3300046476 Bacteria 2084
1149 Ga0495664_0035291 3300046477 Unclassified 2944
1150 Ga0495664_0133473 3300046477 Bacteria 1504
1151 Ga0495594_0023211 3300046499 Bacteria 3322
1152 Ga0495594_0090804 3300046499 Bacteria 1711
1153 Ga0495608_0199649 3300046511 Bacteria 1260
1154 Ga0495618_0126830 3300046514 Bacteria 1634
1155 Ga0495628_0042316 3300046516 Bacteria 3633
1156 Ga0495628_0055659 3300046516 Bacteria 3115
1157 Ga0495628_0063095 3300046516 Bacteria 2903
1158 Ga0495628_0134925 3300046516 Bacteria 1887
1159 Ga0495630_0004055 3300046517 Bacteria 10254
1160 Ga0495630_0081294 3300046517 Bacteria 2445
1161 Ga0495630_0145481 3300046517 Bacteria 1802
1162 Ga0495666_0127213 3300046526 Bacteria 1191
1163 Ga0495665_0012718 3300046531 Unclassified 4554
1164 Ga0495665_0036475 3300046531 Bacteria 2625
1165 Ga0495640_0003469 3300046533 Bacteria 12696
1166 Ga0495586_0010706 3300046535 Bacteria 4880
1167 Ga0495587_0054794 3300046536 Bacteria 2349
1168 Ga0495587_0111953 3300046536 Bacteria 1567
1169 Ga0495645_0054740 3300046543 Unclassified 2898
1170 Ga0495622_0136101 3300046557 Unclassified 1117
1171 Ga0495667_0068887 3300046559 Bacteria 2309
1172 Ga0495667_0262666 3300046559 Bacteria 1098
1173 Ga0495635_0167910 3300046663 Bacteria 1493
1174 Ga0495588_0105757 3300046674 Bacteria 1481
1175 Ga0495588_0147158 3300046674 Bacteria 1245
1176 Ga0495599_0230595 3300046678 Bacteria 1130
1177 Ga0495599_0300786 3300046678 Bacteria 968
1178 Ga0495623_0025710 3300046679 Bacteria 3792
1179 Ga0495623_0045468 3300046679 Unclassified 2789
1180 Ga0495647_0001388 3300046681 Bacteria 7471
1181 Ga0495658_0091905 3300046683 Unclassified 1798
1182 Ga0495658_0093209 3300046683 Bacteria 1787
1183 Ga0495669_0081817 3300046684 Bacteria 1483
1184 Ga0495613_0047059 3300046689 Unclassified 3186
1185 Ga0495624_0030071 3300046690 Bacteria 3540
1186 Ga0495600_0010458 3300046809 Bacteria 5761
1187 Ga0495600_0081482 3300046809 Bacteria 2112
1188 Ga0495581_0010040 3300047315 Bacteria 5477
1189 Ga0495581_0027020 3300047315 Unclassified 3328
1190 Ga0495674_0012576 3300047319 Bacteria 7973
1191 Ga0495674_0022407 3300047319 Bacteria 5826
1192 Ga0495674_0028103 3300047319 Bacteria 5134
1193 Ga0495674_0152521 3300047319 Unclassified 1937
1194 Ga0495674_0391016 3300047319 Bacteria 1124
1195 Ga0495672_0002834 3300047320 Bacteria 15421
1196 Ga0495676_0036950 3300047321 Unclassified 4072
1197 Ga0495676_0110212 3300047321 Bacteria 2021
1198 Ga0495680_0018273 3300047322 Bacteria 5958
1199 Ga0495680_0152354 3300047322 Bacteria 1684
1200 Ga0495675_0001743 3300047444 Bacteria 13020
1201 Ga0495675_0003075 3300047444 Bacteria 10030
1202 Ga0495684_0167879 3300047471 Bacteria 1634
1203 Ga0495684_0288789 3300047471 Bacteria 1181
1204 Ga0495593_0164365 3300047673 Unclassified 1120
1205 Ga0495602_0260910 3300048088 Unclassified 1285
1206 Ga0495602_0402893 3300048088 Bacteria 975
1207 Ga0495614_0013730 3300048089 Unclassified 3552
1208 Ga0495615_0008576 3300048090 Bacteria 1982
1209 Ga0496100_0056132 3300048903 Bacteria 2576
1210 Ga0496100_0065379 3300048903 Bacteria 2410
1211 Ga0496102_0157282 3300048905 Bacteria 2137
1212 Ga0496104_0119297 3300048907 Bacteria 2533
1213 Ga0496104_0250358 3300048907 Bacteria 1684
1214 Ga0496104_0275417 3300048907 Bacteria 1596
1215 Ga0496104_0295010 3300048907 Unclassified 1534
1216 Ga0496105_0019985 3300048908 Bacteria 5405
1217 Ga0496106_0114799 3300048909 Bacteria 2100
1218 Ga0496108_0002333 3300048911 Bacteria 15200
1219 Ga0496108_0070661 3300048911 Bacteria 2946
1220 Ga0496108_0336491 3300048911 Bacteria 1317
1221 Ga0496109_0000941 3300048912 Bacteria 24099
1222 Ga0496109_0125666 3300048912 Bacteria 2391
1223 Ga0496109_0345784 3300048912 Bacteria 1404
1224 Ga0496110_0028543 3300048913 Bacteria 4794
1225 Ga0496110_0115180 3300048913 Bacteria 2419
1226 Ga0496110_0118010 3300048913 Bacteria 2389
1227 Ga0496110_0280285 3300048913 Bacteria 1518
1228 Ga0496111_0051663 3300048914 Bacteria 2967
1229 Ga0496112_0001276 3300048915 Bacteria 19093
1230 Ga0496112_0019630 3300048915 Bacteria 6383
1231 Ga0496112_0031605 3300048915 Bacteria 5136
1232 Ga0496112_0032286 3300048915 Bacteria 5083
1233 Ga0496112_0071615 3300048915 Bacteria 3426
1234 Ga0496112_0088484 3300048915 Bacteria 3065
1235 Ga0496112_0090315 3300048915 Bacteria 3032
1236 Ga0496112_0277141 3300048915 Bacteria 1625
1237 Ga0496112_0387903 3300048915 Bacteria 1337
1238 Ga0496113_0000236 3300048916 Bacteria 26009
1239 Ga0496113_0026940 3300048916 Bacteria 4115
1240 Ga0496113_0062731 3300048916 Bacteria 2807
1241 Ga0496113_0524904 3300048916 Bacteria 950
1242 Ga0496114_0008108 3300048917 Bacteria 8321
1243 Ga0496114_0281601 3300048917 Bacteria 1466
1244 Ga0496115_0002794 3300048918 Bacteria 12544
1245 Ga0496115_0021677 3300048918 Bacteria 4966
1246 Ga0496115_0072679 3300048918 Bacteria 2791
1247 Ga0496115_0072703 3300048918 Bacteria 2790
1248 Ga0496115_0352143 3300048918 Bacteria 1201
1249 Ga0501298_000137 3300049521 Bacteria 8810
1250 Ga0501031_0195662 3300049568 Bacteria 1320
1251 Ga0501034_0053936 3300049571 Bacteria 4047
1252 Ga0501034_0142090 3300049571 Bacteria 2379
1253 Ga0501036_0428772 3300049572 Bacteria 1102
1254 Ga0501039_0105096 3300049575 Bacteria 2205
1255 Ga0501040_0421233 3300049576 Bacteria 960
1256 Ga0501041_0077082 3300049577 Bacteria 2051
1257 Ga0501042_0108256 3300049578 Bacteria 2001
1258 Ga0501048_0092399 3300049582 Bacteria 2134
1259 Ga0501068_0049321 3300049584 Bacteria 2542
1260 Ga0501071_0004724 3300049587 Bacteria 8663
1261 Ga0501071_0007541 3300049587 Bacteria 7159
1262 Ga0501071_0285509 3300049587 Bacteria 1249
1263 Ga0501072_0021337 3300049588 Bacteria 5024
1264 Ga0501072_0098455 3300049588 Bacteria 2325
1265 Ga0501072_0184872 3300049588 Bacteria 1663
1266 Ga0501072_0279864 3300049588 Bacteria 1327
1267 Ga0501073_0003912 3300049589 Bacteria 11182
1268 Ga0501073_0067763 3300049589 Bacteria 2488
1269 Ga0501074_0165643 3300049590 Bacteria 1578
1270 Ga0501074_0334326 3300049590 Bacteria 1075
1271 Ga0501075_0016991 3300049591 Bacteria 5249
1272 Ga0501075_0018228 3300049591 Bacteria 5077
1273 Ga0501075_0019078 3300049591 Bacteria 4973
1274 Ga0501075_0102830 3300049591 Bacteria 2170
1275 Ga0501075_0297963 3300049591 Bacteria 1229
1276 Ga0501076_0048261 3300049592 Bacteria 3366
1277 Ga0501076_0182270 3300049592 Bacteria 1712
1278 Ga0501076_0235636 3300049592 Bacteria 1497
1279 Ga0501077_0000043 3300049593 Bacteria 64691
1280 Ga0501245_010190 3300049708 Bacteria 1357
1281 Ga0501079_0195458 3300049741 Bacteria 1579
1282 Ga0501080_0021064 3300049742 Bacteria 6034
1283 Ga0501081_0019340 3300049743 Bacteria 4536
1284 Ga0501081_0110974 3300049743 Bacteria 1946
1285 Ga0501081_0323217 3300049743 Bacteria 1134
1286 Ga0501081_0393524 3300049743 Bacteria 1025
1287 Ga0501083_0000344 3300049744 Bacteria 29353
1288 Ga0501045_0041721 3300049824 Bacteria 3339
1289 Ga0501045_0042553 3300049824 Bacteria 3306
1290 Ga0501045_0136460 3300049824 Bacteria 1824
1291 Ga0501045_0182038 3300049824 Bacteria 1566
1292 Ga0501045_0222547 3300049824 Bacteria 1405
1293 Ga0501045_0223295 3300049824 Bacteria 1402
1294 nmdc:mga03n38_85892_c1 3300050490 Bacteria 1488
1295 nmdc:mga00v17_19135_c1 3300050491 Bacteria 3904
1296 nmdc:mga00v17_25589_c1 3300050491 Bacteria 3431
1297 nmdc:mga0yw44_18799_c1 3300050492 Bacteria 3795
1298 nmdc:mga0yw44_229433_c1 3300050492 Bacteria 1232
1299 nmdc:mga0yw44_9584_c1 3300050492 Bacteria 4908
1300 nmdc:mga0k408_13637_c1 3300050493 Bacteria 4462
1301 nmdc:mga0k408_1841_c1 3300050493 Bacteria 11388
1302 nmdc:mga0k408_8832_c1 3300050493 Bacteria 5422
1303 nmdc:mga06z11_28023_c1 3300050494 Bacteria 2699
1304 nmdc:mga07m45_82862_c1 3300050496 Bacteria 1832
1305 nmdc:mga05p37_164323_c1 3300050507 Bacteria 2710
1306 nmdc:mga05p37_169992_c1 3300050507 Bacteria 2659
1307 nmdc:mga05p37_225945_c1 3300050507 Bacteria 2257
1308 nmdc:mga05p37_236598_c1 3300050507 Bacteria 2198
1309 nmdc:mga05p37_312137_c1 3300050507 Bacteria 1863
1310 nmdc:mga05p37_343140_c1 3300050507 Bacteria 1760
1311 nmdc:mga05p37_3554_c1 3300050507 Bacteria 18203
1312 nmdc:mga05p37_390622_c1 3300050507 Bacteria 1627
1313 nmdc:mga05p37_39_c1 3300050507 Bacteria 108676
1314 nmdc:mga05p37_524555_c1 3300050507 Bacteria 1354
1315 nmdc:mga05p37_614844_c1 3300050507 Bacteria 1224
1316 nmdc:mga05p37_6916_c1 3300050507 Bacteria 13371
1317 nmdc:mga05p37_799295_c1 3300050507 Bacteria 1032
1318 nmdc:mga05p37_858020_c1 3300050507 Bacteria 985
1319 nmdc:mga09592_10763_c1 3300050508 Bacteria 7437
1320 nmdc:mga09592_1460_c1 3300050508 Bacteria 18977
1321 nmdc:mga09592_180203_c1 3300050508 Bacteria 1828
1322 nmdc:mga09592_222067_c1 3300050508 Bacteria 1637
1323 nmdc:mga09592_330212_c1 3300050508 Bacteria 1320
1324 nmdc:mga09592_434775_c1 3300050508 Unclassified 1133
1325 nmdc:mga09592_52342_c1 3300050508 Bacteria 3446
1326 nmdc:mga0qj67_138887_c1 3300050509 Bacteria 1970
1327 nmdc:mga0qj67_140030_c1 3300050509 Bacteria 1961
1328 nmdc:mga0qj67_20299_c1 3300050509 Bacteria 5085
1329 nmdc:mga0qj67_42389_c1 3300050509 Bacteria 3582
1330 nmdc:mga06r32_150735_c1 3300050510 Bacteria 2304
1331 nmdc:mga06r32_162913_c1 3300050510 Bacteria 2212
1332 nmdc:mga06r32_255429_c1 3300050510 Bacteria 1740
1333 nmdc:mga06r32_478831_c1 3300050510 Bacteria 1223
1334 nmdc:mga06r32_5019_c1 3300050510 Bacteria 11914
1335 nmdc:mga06r32_660704_c1 3300050510 Bacteria 1013
1336 nmdc:mga08y16_129143_c1 3300050511 Bacteria 2629
1337 nmdc:mga08y16_133487_c1 3300050511 Bacteria 2580
1338 nmdc:mga08y16_273278_c1 3300050511 Bacteria 1744
1339 nmdc:mga08y16_37415_c1 3300050511 Bacteria 5097
1340 nmdc:mga08y16_44631_c1 3300050511 Bacteria 4644
1341 nmdc:mga08y16_657702_c1 3300050511 Bacteria 1051
1342 nmdc:mga08y16_80036_c1 3300050511 Bacteria 3406
1343 nmdc:mga0n895_105171_c1 3300050512 Bacteria 2835
1344 nmdc:mga0n895_105329_c1 3300050512 Bacteria 2833
1345 nmdc:mga0n895_12769_c1 3300050512 Bacteria 7543
1346 nmdc:mga0n895_19562_c1 3300050512 Bacteria 6296
1347 nmdc:mga0n895_375584_c1 3300050512 Bacteria 1439
1348 nmdc:mga0n895_37707_c1 3300050512 Bacteria 4678
1349 nmdc:mga0n895_46680_c1 3300050512 Bacteria 4232
1350 nmdc:mga0n895_47_c1 3300050512 Bacteria 73703
1351 nmdc:mga0n895_596743_c1 3300050512 Bacteria 1107
1352 nmdc:mga0n895_6363_c1 3300050512 Bacteria 10020
1353 nmdc:mga0n895_6399_c1 3300050512 Bacteria 9994
1354 nmdc:mga0n895_76648_c1 3300050512 Bacteria 3325
1355 nmdc:mga0rr50_102413_c1 3300050513 Unclassified 2252
1356 nmdc:mga0rr50_129766_c1 3300050513 Bacteria 2017
1357 nmdc:mga0rr50_156206_c1 3300050513 Bacteria 1848
1358 nmdc:mga0rr50_29389_c1 3300050513 Bacteria 3876
1359 nmdc:mga0rr50_298861_c1 3300050513 Bacteria 1346
1360 nmdc:mga0rr50_421_c1 3300050513 Bacteria 22898
1361 nmdc:mga0rr50_7615_c1 3300050513 Bacteria 6695
1362 nmdc:mga08x19_15719_c2 3300050514 Bacteria 3271
1363 nmdc:mga08x19_159_c1 3300050514 Bacteria 55753
1364 nmdc:mga08x19_313964_c1 3300050514 Bacteria 1090
1365 nmdc:mga08x19_3951_c1 3300050514 Bacteria 8828
1366 nmdc:mga08x19_6000_c1 3300050514 Bacteria 3245
1367 nmdc:mga08x19_9447_c1 3300050514 Bacteria 5839
1368 nmdc:mga08x19_94831_c1 3300050514 Bacteria 1973
1369 nmdc:mga0a205_114246_c2 3300050515 Bacteria 2309
1370 nmdc:mga0a205_17697_c1 3300050515 Bacteria 6688
1371 nmdc:mga0a205_208831_c1 3300050515 Bacteria 1841
1372 nmdc:mga0a205_293900_c1 3300050515 Archaea 1499
1373 nmdc:mga0a205_306308_c1 3300050515 Bacteria 1461
1374 nmdc:mga0a205_378_c1 3300050515 Bacteria 33792
1375 nmdc:mga0a205_40587_c1 3300050515 Bacteria 4481
1376 nmdc:mga0a205_507156_c1 3300050515 Unclassified 1063
1377 nmdc:mga0a205_5281_c1 3300050515 Bacteria 11632
1378 nmdc:mga0a205_5870_c1 3300050515 Bacteria 11055
1379 nmdc:mga0a205_618923_c1 3300050515 Bacteria 935
1380 nmdc:mga0a205_73981_c1 3300050515 Bacteria 3291
1381 nmdc:mga0a205_9834_c1 3300050515 Bacteria 8774
1382 nmdc:mga0sz30_133768_c1 3300050516 Bacteria 1093
1383 Ga0495601_0038608 3300053077 Bacteria 2987
1384 Ga0495619_0013765 3300053085 Bacteria 5103
1385 Ga0495619_0083881 3300053085 Unclassified 2150
1386 Ga0500555_005659 3300053103 Bacteria 3543
1387 Ga0501084_0132330 3300054114 Bacteria 2100
1388 Ga0501084_0411300 3300054114 Bacteria 1143
1389 Ga0590071_003929 3300059421 Bacteria 3637
1390 Ga0590074_026271 3300059423 Bacteria 1017
1391 Ga0590075_005479 3300059424 Bacteria 2996
1392 Ga0590077_000183 3300059426 Bacteria 17882
1393 Ga0587080_014860 3300059503 Bacteria 1209
1394 Ga0587083_0019086 3300059505 Bacteria 1248
1395 Ga0587071_020531 3300060344 Bacteria 1205
1396 Ga0501082_0000791 3300060353 Bacteria 27835
1397 Ga0501082_0164048 3300060353 Bacteria 1931
1398 Ga0501082_0177173 3300060353 Bacteria 1854
1399 Ga0501082_0269779 3300060353 Bacteria 1481
1400 Ga0530510_0014030 3300061734 Bacteria 5648
1401 Ga0530510_0139478 3300061734 Bacteria 1786
1402 Ga0530510_0289323 3300061734 Bacteria 1225
1403 2857597099 2857591370 Bacteria 6569758
1404 2936340756 2936340661 Bacteria 5139038
1405 3006973539 3006969106 Bacteria 4739423
1406 Ga0075431_100229517
1407 LJNas_1000359
1408 LJNas_1003504
1409 JGI24751J29686_10004922
1410 rootL2_10191405
1411 Ga0065704_10202031
1412 Ga0065712_10089208
1413 Ga0065712_10162800
1414 Ga0065715_10028342
1415 Ga0065715_10324400
1416 Ga0065707_10004536
1417 Ga0065707_10107322
1418 Ga0065707_10140512
1419 Ga0070658_10009208
1420 Ga0070676_10053202
1421 Ga0070676_10275058
1422 Ga0070683_100000991
1423 Ga0070683_100015092
1424 Ga0070683_100348113
1425 Ga0070683_100365672
1426 Ga0070690_100018513
1427 Ga0070690_100024970
1428 Ga0070690_100030342
1429 Ga0070690_100148702
1430 Ga0070690_100155991
1431 Ga0070670_100006846
1432 Ga0070670_100022824
1433 Ga0070670_100050190
1434 Ga0070670_100061905
1435 Ga0068869_100019550
1436 Ga0068869_100060637
1437 Ga0068869_100264234
1438 Ga0070666_10004150
1439 Ga0070666_10275774
1440 Ga0070680_100077227
1441 Ga0070680_100166647
1442 Ga0070680_100265384
1443 Ga0070680_100384731
1444 Ga0070680_100587047
1445 Ga0068868_100003935
1446 Ga0068868_100007730
1447 Ga0068868_100010214
1448 Ga0068868_100352639
1449 Ga0070660_100050604
1450 Ga0070660_100079882
1451 Ga0070689_100000184
1452 Ga0070689_100006327
1453 Ga0070689_100011182
1454 Ga0070689_100013823
1455 Ga0070689_100026157
1456 Ga0070689_100028450
1457 Ga0070689_100201940
1458 Ga0070691_10074743
1459 Ga0070687_100006124
1460 Ga0070687_100009510
1461 Ga0070661_100020154
1462 Ga0070661_100187054
1463 Ga0070692_10024271
1464 Ga0070668_100034746
1465 Ga0070669_100005158
1466 Ga0070669_100104320
1467 Ga0070675_100007816
1468 Ga0070675_100032017
1469 Ga0070675_100077530
1470 Ga0070675_100168217
1471 Ga0070675_100172332
1472 Ga0070671_100163839
1473 Ga0070671_100271153
1474 Ga0070671_100334032
1475 Ga0070671_100343244
1476 Ga0070674_100050690
1477 Ga0070674_100113640
1478 Ga0070673_100001103
1479 Ga0070673_100002331
1480 Ga0070673_100003082
1481 Ga0070673_100106401
1482 Ga0070673_100652145
1483 Ga0070688_100002168
1484 Ga0070688_100004760
1485 Ga0070688_100005527
1486 Ga0070688_100021976
1487 Ga0070688_100048318
1488 Ga0070688_100071536
1489 Ga0070688_100113887
1490 Ga0070659_100095009
1491 Ga0070659_100152418
1492 Ga0070667_100061735
1493 Ga0070667_100150767
1494 Ga0070667_100330070
1495 Ga0070703_10018480
1496 Ga0070709_10000138
1497 Ga0070709_10000284
1498 Ga0070709_10006463
1499 Ga0070709_10008313
1500 Ga0070709_10094447
1501 Ga0070709_10103900
1502 Ga0070709_10507853
1503 Ga0070714_100000128
1504 Ga0070714_100000964
1505 Ga0070714_100001380
1506 Ga0070714_100041133
1507 Ga0070714_100045433
1508 Ga0070714_100071511
1509 Ga0070714_100141677
1510 Ga0070714_100168614
1511 Ga0070714_100412219
1512 Ga0070714_100501985
1513 Ga0070713_100000078
1514 Ga0070713_100001287
1515 Ga0070713_100015810
1516 Ga0070713_100027774
1517 Ga0070713_100058215
1518 Ga0070713_100066236
1519 Ga0070713_100073285
1520 Ga0070713_100274140
1521 Ga0070713_100333833
1522 Ga0070710_10011043
1523 Ga0070710_10013235
1524 Ga0070710_10016006
1525 Ga0070710_10034866
1526 Ga0070710_10072144
1527 Ga0070701_10005359
1528 Ga0070701_10008092
1529 Ga0070711_100002946
1530 Ga0070711_100026494
1531 Ga0070711_100076371
1532 Ga0070711_100316937
1533 Ga0070711_100423604
1534 Ga0070705_100093720
1535 Ga0070705_100247030
1536 Ga0070700_100006840
1537 Ga0070700_100014725
1538 Ga0070700_100028019
1539 Ga0070700_100037943
1540 Ga0070700_100198422
1541 Ga0070700_100270103
1542 Ga0070694_100009124
1543 Ga0070694_100045358
1544 Ga0070694_100104867
1545 Ga0070694_100158916
1546 Ga0070694_100221918
1547 Ga0070694_100370814
1548 Ga0070708_100000914
1549 Ga0070708_100001179
1550 Ga0070708_100003704
1551 Ga0070708_100005225
1552 Ga0070708_100007521
1553 Ga0070708_100089166
1554 Ga0070708_100093262
1555 Ga0070708_100155810
1556 Ga0070708_100229876
1557 Ga0070663_100052242
1558 Ga0070663_100053530
1559 Ga0070663_100177406
1560 Ga0070678_100025449
1561 Ga0070678_100087011
1562 Ga0070678_100142284
1563 Ga0070662_100013294
1564 Ga0070662_100110989
1565 Ga0070662_100151047
1566 Ga0070681_10000316
1567 Ga0070681_10019492
1568 Ga0070681_10024367
1569 Ga0070681_10063676
1570 Ga0070681_10108614
1571 Ga0070681_10161677
1572 Ga0070681_10192271
1573 Ga0070681_10367827
1574 Ga0070681_10386642
1575 Ga0068867_100028059
1576 Ga0068867_100028845
1577 Ga0068867_100118397
1578 Ga0070685_10000378
1579 Ga0070685_10066457
1580 Ga0070685_10169007
1581 Ga0070706_100007838
1582 Ga0070706_100037144
1583 Ga0070706_100059824
1584 Ga0070706_100066352
1585 Ga0070706_100080032
1586 Ga0070706_100128068
1587 Ga0070706_100129406
1588 Ga0070706_100154358
1589 Ga0070707_100004302
1590 Ga0070707_100004988
1591 Ga0070707_100031329
1592 Ga0070707_100038527
1593 Ga0070707_100066497
1594 Ga0070707_100088885
1595 Ga0070707_100102350
1596 Ga0070707_100148539
1597 Ga0070707_100184072
1598 Ga0070707_100350435
1599 Ga0070707_100389813
1600 Ga0070698_100001727
1601 Ga0070698_100009756
1602 Ga0070698_100010307
1603 Ga0070698_100038875
1604 Ga0070698_100077931
1605 Ga0070698_100093117
1606 Ga0070698_100216070
1607 Ga0070699_100000032
1608 Ga0070699_100003470
1609 Ga0070699_100049485
1610 Ga0070699_100290839
1611 Ga0070699_100424565
1612 Ga0070679_100013063
1613 Ga0070679_100022833
1614 Ga0070679_100055041
1615 Ga0070679_100061284
1616 Ga0070679_100123379
1617 Ga0070679_100213856
1618 Ga0070684_100166371
1619 Ga0070684_100204154
1620 Ga0070697_100000428
1621 Ga0070697_100000479
1622 Ga0070697_100001200
1623 Ga0070697_100002510
1624 Ga0070697_100003271
1625 Ga0070697_100004305
1626 Ga0070697_100004317
1627 Ga0070697_100062386
1628 Ga0070697_100076557
1629 Ga0070697_100166873
1630 Ga0070697_100171833
1631 Ga0070697_100276544
1632 Ga0068853_100004139
1633 Ga0068853_100057764
1634 Ga0068853_100256588
1635 Ga0070672_100021325
1636 Ga0070672_100056314
1637 Ga0070672_100124504
1638 Ga0070672_100623196
1639 Ga0070686_100007438
1640 Ga0070686_100013723
1641 Ga0070686_100015353
1642 Ga0070686_100041957
1643 Ga0070695_100006597
1644 Ga0070695_100038397
1645 Ga0070695_100066418
1646 Ga0070695_100126961
1647 Ga0070695_100144769
1648 Ga0070695_100215928
1649 Ga0070696_100034145
1650 Ga0070696_100093054
1651 Ga0070696_100424811
1652 Ga0070693_100085459
1653 Ga0070693_100158117
1654 Ga0070693_100165662
1655 Ga0070665_100008875
1656 Ga0070665_100208839
1657 Ga0070665_100379949
1658 Ga0070665_100459018
1659 Ga0070704_100027044
1660 Ga0070704_100066641
1661 Ga0070704_100103796
1662 Ga0070704_100291910
1663 Ga0068855_100000903
1664 Ga0068855_100017182
1665 Ga0068855_100041333
1666 Ga0068855_100047134
1667 Ga0068855_100192496
1668 Ga0068855_100291299
1669 Ga0070664_100004347
1670 Ga0070664_100110920
1671 Ga0070664_100119683
1672 Ga0070664_100225971
1673 Ga0070664_100477855
1674 Ga0068857_100001669
1675 Ga0068857_100002037
1676 Ga0068857_100005829
1677 Ga0068857_100038279
1678 Ga0068857_100300639
1679 Ga0068854_100025404
1680 Ga0068854_100070415
1681 Ga0068854_100117898
1682 Ga0068854_100126733
1683 Ga0068854_100187955
1684 Ga0068856_100001036
1685 Ga0068856_100001068
1686 Ga0068856_100001357
1687 Ga0068856_100012625
1688 Ga0068856_100019468
1689 Ga0068856_100025885
1690 Ga0068856_100045193
1691 Ga0070702_100013317
1692 Ga0070702_100014022
1693 Ga0070702_100222012
1694 Ga0068852_100030169
1695 Ga0068859_100003538
1696 Ga0068859_100018857
1697 Ga0068859_100021411
1698 Ga0068859_100062847
1699 Ga0068859_100138415
1700 Ga0068859_100199275
1701 Ga0068859_100236779
1702 Ga0068859_100239035
1703 Ga0068859_100303399
1704 Ga0068864_100004582
1705 Ga0068864_100012500
1706 Ga0068864_100091337
1707 Ga0068864_100100596
1708 Ga0068864_100156145
1709 Ga0068864_100208715
1710 Ga0068864_100266991
1711 Ga0068866_10005122
1712 Ga0068866_10006386
1713 Ga0068866_10148649
1714 Ga0068861_100006187
1715 Ga0068861_100052119
1716 Ga0068861_100095984
1717 Ga0068861_100291103
1718 Ga0068861_100492082
1719 Ga0068851_10073749
1720 Ga0068851_10195981
1721 Ga0068870_10005374
1722 Ga0068870_10022812
1723 Ga0068863_100008428
1724 Ga0068863_100010732
1725 Ga0068863_100032630
1726 Ga0068863_100042988
1727 Ga0068863_100048556
1728 Ga0068863_100055256
1729 Ga0068863_100060795
1730 Ga0068863_100070541
1731 Ga0068863_100142658
1732 Ga0068863_100435118
1733 Ga0068863_100484517
1734 Ga0068858_100000863
1735 Ga0068858_100013745
1736 Ga0068858_100014686
1737 Ga0068858_100030709
1738 Ga0068858_100039269
1739 Ga0068858_100053226
1740 Ga0068858_100067270
1741 Ga0068858_100081587
1742 Ga0068858_100117911
1743 Ga0068858_100470988
1744 Ga0068860_100001845
1745 Ga0068860_100102787
1746 Ga0068860_100146864
1747 Ga0068860_100263395
1748 Ga0068860_100420973
1749 Ga0068860_100621445
1750 Ga0068862_100117465
1751 Ga0068862_100153161
1752 Ga0070717_10001077
1753 Ga0070717_10001266
1754 Ga0070717_10003483
1755 Ga0070717_10006090
1756 Ga0070717_10006698
1757 Ga0070717_10023366
1758 Ga0070717_10046031
1759 Ga0070717_10061714
1760 Ga0070717_10063108
1761 Ga0070717_10069440
1762 Ga0070717_10130057
1763 Ga0070717_10159781
1764 Ga0070717_10288595
1765 Ga0070717_10495451
1766 Ga0070717_10658407
1767 Ga0075365_10000429
1768 Ga0075365_10091326
1769 Ga0075365_10109191
1770 Ga0075368_10032852
1771 Ga0075364_10000947
1772 Ga0075364_10026447
1773 Ga0070715_10001890
1774 Ga0070715_10002920
1775 Ga0070715_10004444
1776 Ga0070715_10068834
1777 Ga0070716_100000779
1778 Ga0070716_100006385
1779 Ga0070716_100009249
1780 Ga0070716_100024016
1781 Ga0070716_100069019
1782 Ga0070716_100104326
1783 Ga0070716_100183016
1784 Ga0070716_100213333
1785 Ga0070716_100217950
1786 Ga0070716_100290949
1787 Ga0070712_100000047
1788 Ga0070712_100000914
1789 Ga0070712_100001184
1790 Ga0070712_100007837
1791 Ga0070712_100012588
1792 Ga0070712_100166529
1793 Ga0075362_10001899
1794 Ga0075367_10033942
1795 Ga0075366_10001679
1796 Ga0075366_10012914
1797 Ga0097621_100000216
1798 Ga0097621_100005019
1799 Ga0097621_100005239
1800 Ga0097621_100012248
1801 Ga0097621_100058175
1802 Ga0097621_100066986
1803 Ga0097621_100130792
1804 Ga0097621_100190453
1805 Ga0075370_10017085
1806 Ga0068871_100000149
1807 Ga0068871_100000182
1808 Ga0068871_100007539
1809 Ga0068871_100011744
1810 Ga0068871_100120248
1811 Ga0068871_100138512
1812 Ga0068871_100294310
1813 Ga0068871_100356545
1814 Ga0068871_100422980
1815 Ga0075428_100010054
1816 Ga0075428_100037185
1817 Ga0075428_100043709
1818 Ga0075428_100044305
1819 Ga0075428_100058957
1820 Ga0075428_100070197
1821 Ga0075428_100074509
1822 Ga0075428_100120095
1823 Ga0075428_100126601
1824 Ga0075428_100178364
1825 Ga0075428_100201184
1826 Ga0075428_100222194
1827 Ga0075428_100233383
1828 Ga0075428_100267706
1829 Ga0075430_100042326
1830 Ga0075430_100052081
1831 Ga0075430_100119035
1832 Ga0075430_100126973
1833 Ga0075431_100000894
1834 Ga0075431_100001697
1835 Ga0075431_100017096
1836 Ga0075431_100028432
1837 Ga0075431_100057498
1838 Ga0075431_100199680
1839 Ga0075433_10004042
1840 Ga0075433_10004179
1841 Ga0075433_10007296
1842 Ga0075433_10074069
1843 Ga0075433_10096949
1844 Ga0075433_10159143
1845 Ga0075433_10305236
1846 Ga0075433_10455798
1847 Ga0075434_100000987
1848 Ga0075434_100005262
1849 Ga0075434_100007333
1850 Ga0075434_100014060
1851 Ga0075434_100014264
1852 Ga0075434_100016262
1853 Ga0075434_100018693
1854 Ga0075434_100023184
1855 Ga0075434_100028761
1856 Ga0075434_100063412
1857 Ga0075434_100084855
1858 Ga0075434_100169274
1859 Ga0075434_100215449
1860 Ga0075434_100450959
1861 Ga0075429_100001963
1862 Ga0075429_100012743
1863 Ga0075429_100023159
1864 Ga0075429_100033426
1865 Ga0075429_100038554
1866 Ga0075429_100077611
1867 Ga0075429_100077751
1868 Ga0075429_100208098
1869 Ga0075429_100235784
1870 Ga0075429_100251579
1871 Ga0068865_100007294
1872 Ga0068865_100038170
1873 Ga0068865_100079007
1874 Ga0075436_100002937
1875 Ga0075436_100017840
1876 Ga0075436_100026209
1877 Ga0075436_100043133
1878 Ga0075436_100059276
1879 Ga0075436_100064009
1880 Ga0097620_100003538
1881 Ga0097620_100018858
1882 Ga0097620_100021409
1883 Ga0097620_100062854
1884 Ga0097620_100138407
1885 Ga0097620_100199273
1886 Ga0097620_100236782
1887 Ga0097620_100239021
1888 Ga0097620_100303404
1889 Ga0075435_100000105
1890 Ga0075435_100003136
1891 Ga0075435_100020470
1892 Ga0075435_100034710
1893 Ga0075435_100136088
1894 Ga0075435_100138133
1895 Ga0075435_100288157
1896 Ga0075435_100421035
1897 Ga0099794_10005644
1898 Ga0099794_10074530
1899 Ga0099794_10107237
1900 Ga0099794_10113625
1901 Ga0099795_10029118
1902 Ga0105240_10031012
1903 Ga0105240_10041881
1904 Ga0105240_10073003
1905 Ga0105240_10073406
1906 Ga0105240_10128137
1907 Ga0105240_10147534
1908 Ga0105240_10387765
1909 Ga0105240_10591779
1910 Ga0111539_10002268
1911 Ga0111539_10021616
1912 Ga0111539_10041896
1913 Ga0111539_10062047
1914 Ga0111539_10067230
1915 Ga0111539_10158272
1916 Ga0111539_10208377
1917 Ga0111539_10209069
1918 Ga0111539_10252493
1919 Ga0111539_10320090
1920 Ga0111539_10452042
1921 Ga0105245_10000595
1922 Ga0105245_10001513
1923 Ga0105245_10030639
1924 Ga0105247_10021352
1925 Ga0105247_10188822
1926 Ga0114129_10000027
1927 Ga0114129_10000183
1928 Ga0114129_10005840
1929 Ga0114129_10008305
1930 Ga0114129_10025642
1931 Ga0114129_10027882
1932 Ga0114129_10040995
1933 Ga0114129_10077296
1934 Ga0114129_10091712
1935 Ga0114129_10107223
1936 Ga0114129_10112098
1937 Ga0114129_10137473
1938 Ga0114129_10146134
1939 Ga0114129_10331302
1940 Ga0114129_10370902
1941 Ga0114129_10406793
1942 Ga0105243_10007785
1943 Ga0105241_10002493
1944 Ga0105241_10003544
1945 Ga0105241_10041643
1946 Ga0105241_10113739
1947 Ga0105241_10334867
1948 Ga0105242_10024581
1949 Ga0105242_10072798
1950 Ga0105242_10391738
1951 Ga0105248_10007674
1952 Ga0105248_10010838
1953 Ga0105248_10014674
1954 Ga0105248_10015732
1955 Ga0105248_10073972
1956 Ga0105248_10074281
1957 Ga0105248_10589686
1958 Ga0105237_10054290
1959 Ga0105237_10075899
1960 Ga0105237_10082202
1961 Ga0105237_10569626
1962 Ga0105237_10577160
1963 Ga0105238_10044311
1964 Ga0105238_10209625
1965 Ga0105238_10283116
1966 Ga0105238_10440790
1967 Ga0105249_10017814
1968 Ga0105249_10076406
1969 Ga0105249_10198628
1970 Ga0105249_10210392
1971 Ga0105249_10461220
1972 Ga0099796_10019613
1973 Ga0105239_10078320
1974 Ga0105239_10090363
1975 Ga0105239_10235811
1976 Ga0105239_10377531
1977 Ga0105246_10026331
1978 Ga0105246_10034089
1979 Ga0105246_10108039
1980 Ga0157373_10004228
1981 Ga0157373_10059701
1982 Ga0157373_10073908
1983 Ga0157373_10090650
1984 Ga0157373_10334940
1985 Ga0157371_10044461
1986 Ga0157370_10009209
1987 Ga0157370_10368753
1988 Ga0157369_10001537
1989 Ga0157369_10002128
1990 Ga0157369_10010332
1991 Ga0157369_10011085
1992 Ga0157369_10121476
1993 Ga0157369_10190717
1994 Ga0157369_10294183
1995 Ga0157369_10363681
1996 Ga0157374_10000090
1997 Ga0157374_10000483
1998 Ga0157374_10000804
1999 Ga0157374_10027327
2000 Ga0157374_10116821
2001 Ga0157374_10251098
2002 Ga0157378_10000070
2003 Ga0157378_10000487
2004 Ga0157378_10002859
2005 Ga0157378_10042068
2006 Ga0157378_10108888
2007 Ga0157378_10219858
2008 Ga0163162_10123571
2009 Ga0157372_10000211
2010 Ga0157372_10002476
2011 Ga0157372_10008246
2012 Ga0157372_10009031
2013 Ga0157372_10009482
2014 Ga0157372_10036083
2015 Ga0157372_10045292
2016 Ga0157372_10090650
2017 Ga0157372_10093403
2018 Ga0157372_10110928
2019 Ga0157372_10143748
2020 Ga0157372_10244051
2021 Ga0157372_10827777
2022 Ga0157375_10080338
2023 Ga0157375_10116181
2024 Ga0163163_10000034
2025 Ga0163163_10001046
2026 Ga0163163_10003961
2027 Ga0163163_10038058
2028 Ga0163163_10068514
2029 Ga0163163_10193586
2030 Ga0163163_10370274
2031 Ga0163163_10465775
2032 Ga0157380_10003290
2033 Ga0157380_10008166
2034 Ga0157380_10055678
2035 Ga0157380_10083337
2036 Ga0157380_10179700
2037 Ga0157380_10263977
2038 Ga0157380_10403349
2039 Ga0182008_10127067
2040 Ga0157377_10003510
2041 Ga0157377_10008189
2042 Ga0157379_10110914
2043 Ga0157379_10137271
2044 Ga0157379_10152512
2045 Ga0157379_10477609
2046 Ga0157376_10000036
2047 Ga0157376_10003183
2048 Ga0157376_10107190
2049 Ga0157376_10440019
2050 Ga0157376_10604258
2051 Ga0182006_1023521
2052 Ga0182005_1017246
2053 Ga0163161_10001109
2054 Ga0213873_10050233
2055 Ga0213874_10015900
2056 Ga0224570_101423
2057 Ga0224572_1003844
2058 Ga0228598_1000649
2059 Ga0228598_1001051
2060 Ga0228598_1001059
2061 Ga0228598_1004139
2062 Ga0209147_100154
2063 Ga0207697_10007679
2064 Ga0207697_10150018
2065 Ga0207656_10019653
2066 Ga0207656_10057292
2067 Ga0207653_10004964
2068 Ga0207653_10040715
2069 Ga0207692_10007523
2070 Ga0207692_10021238
2071 Ga0207692_10044340
2072 Ga0207642_10001445
2073 Ga0207642_10023424
2074 Ga0207642_10097699
2075 Ga0207688_10064623
2076 Ga0207680_10036807
2077 Ga0207680_10126764
2078 Ga0207647_10000762
2079 Ga0207647_10006360
2080 Ga0207647_10009306
2081 Ga0207685_10000326
2082 Ga0207685_10015400
2083 Ga0207685_10083622
2084 Ga0207685_10102571
2085 Ga0207685_10118870
2086 Ga0207699_10000086
2087 Ga0207699_10027348
2088 Ga0207699_10068991
2089 Ga0207699_10109593
2090 Ga0207699_10245144
2091 Ga0207699_10267058
2092 Ga0207699_10295263
2093 Ga0207645_10000019
2094 Ga0207645_10011521
2095 Ga0207645_10026140
2096 Ga0207643_10000432
2097 Ga0207643_10062787
2098 Ga0207684_10000238
2099 Ga0207684_10001476
2100 Ga0207684_10012964
2101 Ga0207684_10024595
2102 Ga0207684_10064397
2103 Ga0207684_10067679
2104 Ga0207684_10097810
2105 Ga0207654_10031354
2106 Ga0207654_10050556
2107 Ga0207654_10200501
2108 Ga0207707_10006534
2109 Ga0207707_10031794
2110 Ga0207707_10169048
2111 Ga0207707_10237536
2112 Ga0207707_10314554
2113 Ga0207707_10326590
2114 Ga0207695_10027677
2115 Ga0207695_10031749
2116 Ga0207695_10042363
2117 Ga0207695_10062388
2118 Ga0207695_10086813
2119 Ga0207695_10371531
2120 Ga0207671_10048960
2121 Ga0207671_10114372
2122 Ga0207671_10125992
2123 Ga0207671_10154248
2124 Ga0207693_10000044
2125 Ga0207693_10000546
2126 Ga0207693_10027913
2127 Ga0207693_10033092
2128 Ga0207693_10055195
2129 Ga0207693_10112115
2130 Ga0207693_10147372
2131 Ga0207693_10240265
2132 Ga0207693_10353098
2133 Ga0207663_10000745
2134 Ga0207663_10050357
2135 Ga0207663_10073401
2136 Ga0207663_10226252
2137 Ga0207663_10324988
2138 Ga0207660_10061432
2139 Ga0207660_10121961
2140 Ga0207660_10125457
2141 Ga0207660_10282655
2142 Ga0207660_10519789
2143 Ga0207662_10001347
2144 Ga0207662_10008827
2145 Ga0207662_10010238
2146 Ga0207657_10014641
2147 Ga0207657_10015652
2148 Ga0207649_10000188
2149 Ga0207649_10140980
2150 Ga0207652_10016502
2151 Ga0207652_10018680
2152 Ga0207652_10062271
2153 Ga0207652_10064820
2154 Ga0207652_10287692
2155 Ga0207652_10561437
2156 Ga0207646_10000073
2157 Ga0207646_10000404
2158 Ga0207646_10000549
2159 Ga0207646_10000901
2160 Ga0207646_10021264
2161 Ga0207646_10051234
2162 Ga0207646_10060879
2163 Ga0207646_10061042
2164 Ga0207646_10121735
2165 Ga0207646_10168414
2166 Ga0207646_10298421
2167 Ga0207646_10332503
2168 Ga0207646_10350425
2169 Ga0207681_10050607
2170 Ga0207681_10096609
2171 Ga0207681_10184689
2172 Ga0207694_10002864
2173 Ga0207694_10129212
2174 Ga0207694_10153520
2175 Ga0207650_10000024
2176 Ga0207650_10014362
2177 Ga0207650_10016981
2178 Ga0207650_10048919
2179 Ga0207659_10120442
2180 Ga0207687_10020670
2181 Ga0207687_10042288
2182 Ga0207687_10118379
2183 Ga0207700_10000090
2184 Ga0207700_10000101
2185 Ga0207700_10003111
2186 Ga0207700_10015567
2187 Ga0207700_10018678
2188 Ga0207700_10049934
2189 Ga0207700_10056721
2190 Ga0207700_10059747
2191 Ga0207700_10094477
2192 Ga0207700_10125422
2193 Ga0207700_10137766
2194 Ga0207700_10321120
2195 Ga0207700_10359946
2196 Ga0207664_10000033
2197 Ga0207664_10003224
2198 Ga0207664_10026443
2199 Ga0207664_10034850
2200 Ga0207664_10047673
2201 Ga0207664_10048728
2202 Ga0207664_10109197
2203 Ga0207664_10165614
2204 Ga0207664_10490768
2205 Ga0207644_10080909
2206 Ga0207644_10300817
2207 Ga0207690_10190626
2208 Ga0207706_10000912
2209 Ga0207706_10018727
2210 Ga0207706_10097325
2211 Ga0207706_10106514
2212 Ga0207686_10069502
2213 Ga0207709_10023571
2214 Ga0207670_10000141
2215 Ga0207670_10015668
2216 Ga0207670_10033997
2217 Ga0207670_10034780
2218 Ga0207670_10088630
2219 Ga0207669_10052866
2220 Ga0207669_10087772
2221 Ga0207704_10039453
2222 Ga0207704_10048675
2223 Ga0207704_10129925
2224 Ga0207704_10201320
2225 Ga0207665_10000119
2226 Ga0207665_10000189
2227 Ga0207665_10002959
2228 Ga0207665_10003250
2229 Ga0207665_10011641
2230 Ga0207665_10016061
2231 Ga0207665_10063549
2232 Ga0207665_10262538
2233 Ga0207665_10298159
2234 Ga0207691_10004229
2235 Ga0207691_10030878
2236 Ga0207691_10313776
2237 Ga0207711_10018665
2238 Ga0207711_10025149
2239 Ga0207711_10036791
2240 Ga0207711_10103474
2241 Ga0207711_10108426
2242 Ga0207711_10258700
2243 Ga0207711_10436321
2244 Ga0207711_10616574
2245 Ga0207711_10625560
2246 Ga0207689_10000078
2247 Ga0207689_10001992
2248 Ga0207689_10061265
2249 Ga0207689_10094678
2250 Ga0207689_10106543
2251 Ga0207661_10000067
2252 Ga0207661_10034875
2253 Ga0207661_10097469
2254 Ga0207661_10171334
2255 Ga0207661_10216238
2256 Ga0207661_10281170
2257 Ga0207679_10000055
2258 Ga0207679_10237117
2259 Ga0207679_10336599
2260 Ga0207667_10000170
2261 Ga0207667_10012321
2262 Ga0207667_10051637
2263 Ga0207667_10467898
2264 Ga0207667_10548774
2265 Ga0207667_10696269
2266 Ga0207651_10021937
2267 Ga0207651_10029315
2268 Ga0207651_10131212
2269 Ga0207651_10281693
2270 Ga0207712_10166892
2271 Ga0207712_10177116
2272 Ga0207712_10412996
2273 Ga0207640_10189232
2274 Ga0207640_10393175
2275 Ga0207658_10016816
2276 Ga0207658_10068741
2277 Ga0207677_10004744
2278 Ga0207677_10006247
2279 Ga0207677_10046574
2280 Ga0207677_10116961
2281 Ga0207677_10258727
2282 Ga0207703_10001408
2283 Ga0207703_10002734
2284 Ga0207703_10012584
2285 Ga0207703_10056476
2286 Ga0207703_10064537
2287 Ga0207703_10068712
2288 Ga0207703_10137271
2289 Ga0207703_10445242
2290 Ga0207639_10002287
2291 Ga0207639_10147401
2292 Ga0207639_10328425
2293 Ga0207678_10001331
2294 Ga0207678_10016835
2295 Ga0207678_10040295
2296 Ga0207708_10002845
2297 Ga0207708_10022762
2298 Ga0207708_10055446
2299 Ga0207708_10057688
2300 Ga0207708_10176109
2301 Ga0207708_10201559
2302 Ga0207702_10001597
2303 Ga0207702_10006327
2304 Ga0207702_10012220
2305 Ga0207702_10306649
2306 Ga0207702_10465181
2307 Ga0207641_10000030
2308 Ga0207641_10008766
2309 Ga0207641_10009428
2310 Ga0207641_10012702
2311 Ga0207641_10052353
2312 Ga0207641_10083664
2313 Ga0207641_10135955
2314 Ga0207641_10160978
2315 Ga0207648_10000031
2316 Ga0207648_10001943
2317 Ga0207648_10039856
2318 Ga0207676_10000915
2319 Ga0207676_10033311
2320 Ga0207676_10037233
2321 Ga0207676_10083058
2322 Ga0207676_10134395
2323 Ga0207676_10245686
2324 Ga0207676_10416817
2325 Ga0207674_10000618
2326 Ga0207674_10002087
2327 Ga0207674_10002424
2328 Ga0207674_10009625
2329 Ga0207674_10048473
2330 Ga0207674_10056136
2331 Ga0207675_100009496
2332 Ga0207675_100032163
2333 Ga0207675_100063435
2334 Ga0207675_100203600
2335 Ga0207675_100239928
2336 Ga0207675_100358070
2337 Ga0207675_100431560
2338 Ga0207683_10005417
2339 Ga0207683_10207205
2340 Ga0207698_10075494
2341 Ga0207698_10136086
2342 Ga0207698_10280262
2343 Ga0209588_1002596
2344 Ga0209588_1025474
2345 Ga0209588_1029634
2346 Ga0209588_1034262
2347 Ga0207428_10001654
2348 Ga0207428_10016548
2349 Ga0207428_10031295
2350 Ga0207428_10103863
2351 Ga0207428_10431962
2352 Ga0265354_1004808
2353 Ga0268266_10000267
2354 Ga0268266_10034893
2355 Ga0268265_10039533
2356 Ga0268265_10153074
2357 Ga0268265_10207647
2358 Ga0268265_10380205
2359 Ga0268264_10002804
2360 Ga0268264_10031874
2361 Ga0268264_10074418
2362 Ga0268264_10110236
2363 Ga0268264_10166635
2364 Ga0268264_10185711
2365 Ga0268264_10547041
2366 Ga0265338_10007491
2367 Ga0265338_10011560
2368 Ga0265338_10014474
2369 Ga0265338_10070199
2370 Ga0265338_10131633
2371 Ga0265338_10170857
2372 Ga0265338_10193154
2373 Ga0265338_10204382
2374 Ga0265762_1000146
2375 Ga0265762_1001607
2376 Ga0265765_1003037
2377 Ga0265765_1004376
2378 Ga0265760_10000033
2379 Ga0265760_10000516
2380 Ga0265760_10000551
2381 Ga0265760_10007507
2382 Ga0265760_10017032
2383 Ga0265325_10003889
2384 Ga0265325_10089462
2385 Ga0265339_10013118
2386 Ga0265339_10021085
2387 Ga0265339_10070869
2388 Ga0265339_10212035
2389 Ga0265316_10004100
2390 Ga0265316_10014092
2391 Ga0265316_10167267
2392 Ga0265316_10362333
2393 Ga0307408_100078226
2394 Ga0265313_10076717
2395 Ga0307508_10023956
2396 Ga0265314_10001876
2397 Ga0265314_10034143
2398 Ga0265342_10057898
2399 Ga0307405_10050076
2400 Ga0307413_10080006
2401 Ga0307413_10174722
2402 Ga0307410_10006425
2403 Ga0307410_10034902
2404 Ga0307406_10052850
2405 Ga0307406_10060013
2406 Ga0307407_10022500
2407 Ga0307407_10047661
2408 Ga0307407_10155317
2409 Ga0307409_100020464
2410 Ga0307409_100035032
2411 Ga0307409_100182172
2412 Ga0307416_100077169
2413 Ga0307416_100188528
2414 Ga0307416_100229040
2415 Ga0307416_100709093
2416 Ga0307414_10100879
2417 Ga0307414_10345737
2418 Ga0307411_10004555
2419 Ga0307411_10038177
2420 Ga0307411_10114283
2421 Ga0307411_10128059
2422 Ga0307415_100045220
2423 Ga0307415_100155311
2424 Ga0307415_100161482
2425 Ga0373934_0003000
2426 Ga0373944_0014543
2427 Ga0373951_0000953
2428 Ga0373923_0008355
2429 Ga0373923_0028510
2430 Ga0373923_0088320
2431 Ga0373936_0005678
2432 Ga0373936_0007148
2433 Ga0373936_0054779
2434 Ga0373936_0072816
2435 Ga0373945_0015970
2436 Ga0373953_0001820
2437 Ga0373953_0106335
2438 Ga0373954_0074066
2439 Ga0373954_0076884
2440 Ga0373954_0136552
2441 Ga0373956_0005290
2442 Ga0373956_0010381
2443 Ga0373957_0000526
2444 Ga0373957_0003118
2445 Ga0373957_0003458
2446 Ga0373943_0045043
2447 Ga0373943_0090335
2448 Ga0373943_0111554
2449 Ga0373943_0280346
2450 Ga0373946_0006023
2451 Ga0373946_0043794
2452 Ga0373955_0011254
2453 Ga0373955_0053465
2454 Ga0373955_0058755
2455 Ga0373942_0069561
2456 Ga0316574_0018911
2457 Ga0316574_0128147
2458 Ga0373924_0006841
2459 Ga0373931_0069579
2460 Ga0373931_0092278
2461 Ga0373931_0226660
2462 Ga0373935_0003601
2463 Ga0373935_0003897
2464 Ga0373935_0006473
2465 Ga0373927_0000123
2466 Ga0373927_0001591
2467 Ga0373927_0024226
2468 Ga0373927_0044465
2469 Ga0373927_0113353
2470 Ga0373927_0206819
2471 Ga0373933_0002466
2472 Ga0373933_0003709
2473 Ga0373933_0031159
2474 Ga0373933_0101316
2475 Ga0373947_0002769
2476 Ga0373947_0005381
2477 Ga0373947_0018368
2478 Ga0373947_0038591
2479 Ga0373947_0071076
2480 Ga0373947_0153156
2481 Ga0373947_0361784
2482 Ga0373937_0000037
2483 Ga0373937_0242775
2484 Ga0373925_0000915
2485 Ga0373925_0003137
2486 Ga0373925_0005438
2487 Ga0373925_0007608
2488 Ga0373925_0096314
2489 Ga0373925_0124257
2490 Ga0395905_0010608
2491 Ga0395905_0041369
2492 Ga0395905_0119476
2493 Ga0436364_1286351
2494 Ga0436365_0558586
2495 Ga0436363_0148938
2496 Ga0436363_1051196
2497 Ga0436362_0425579
2498 Ga0436362_1154172
2499 Ga0439431_0060432
2500 Ga0439462_0033105
2501 Ga0439446_0010019
2502 Ga0439446_0018794
2503 Ga0439434_0018301
2504 Ga0439459_0029808
2505 Ga0451577_0000390
2506 Ga0451577_0020501
2507 Ga0451577_0188476
2508 Ga0453683_0002477
2509 Ga0453683_0003673
2510 Ga0453683_0024798
2511 Ga0466963_0021213
2512 Ga0466963_0075292
2513 Ga0466964_0024512
2514 Ga0453684_0000686
2515 Ga0453684_0254328
2516 Ga0453684_0405792
2517 Ga0451576_0006359
2518 Ga0451576_0040972
2519 Ga0451576_0043177
2520 Ga0451576_0064398
2521 Ga0451576_0717877
2522 Ga0466967_0013623
2523 Ga0466967_0016966
2524 Ga0466967_0067424
2525 Ga0466967_0087331
2526 Ga0466967_0149802
2527 Ga0495592_0062395
2528 Ga0495603_0179046
2529 Ga0495629_0038676
2530 Ga0495629_0171227
2531 Ga0495641_0147193
2532 Ga0495651_0026393
2533 Ga0495653_0031817
2534 Ga0495653_0038953
2535 Ga0495653_0213132
2536 Ga0495580_0000163
2537 Ga0495580_0000505
2538 Ga0495580_0000909
2539 Ga0495580_0007429
2540 Ga0495580_0017832
2541 Ga0495580_0023516
2542 Ga0495580_0036953
2543 Ga0495580_0046576
2544 Ga0495580_0074389
2545 Ga0495580_0144937
2546 Ga0495580_0184212
2547 Ga0495580_0188420
2548 Ga0495582_0003168
2549 Ga0495582_0004127
2550 Ga0495639_0001941
2551 Ga0495639_0015376
2552 Ga0495639_0029191
2553 Ga0495662_0046988
2554 Ga0495664_0035291
2555 Ga0495664_0133473
2556 Ga0495594_0023211
2557 Ga0495594_0090804
2558 Ga0495608_0199649
2559 Ga0495618_0126830
2560 Ga0495628_0042316
2561 Ga0495628_0055659
2562 Ga0495628_0063095
2563 Ga0495628_0134925
2564 Ga0495630_0004055
2565 Ga0495630_0081294
2566 Ga0495630_0145481
2567 Ga0495666_0127213
2568 Ga0495665_0012718
2569 Ga0495665_0036475
2570 Ga0495640_0003469
2571 Ga0495586_0010706
2572 Ga0495587_0054794
2573 Ga0495587_0111953
2574 Ga0495645_0054740
2575 Ga0495622_0136101
2576 Ga0495667_0068887
2577 Ga0495667_0262666
2578 Ga0495635_0167910
2579 Ga0495588_0105757
2580 Ga0495588_0147158
2581 Ga0495599_0230595
2582 Ga0495599_0300786
2583 Ga0495623_0025710
2584 Ga0495623_0045468
2585 Ga0495647_0001388
2586 Ga0495658_0091905
2587 Ga0495658_0093209
2588 Ga0495669_0081817
2589 Ga0495613_0047059
2590 Ga0495624_0030071
2591 Ga0495600_0010458
2592 Ga0495600_0081482
2593 Ga0495581_0010040
2594 Ga0495581_0027020
2595 Ga0495674_0012576
2596 Ga0495674_0022407
2597 Ga0495674_0028103
2598 Ga0495674_0152521
2599 Ga0495674_0391016
2600 Ga0495672_0002834
2601 Ga0495676_0036950
2602 Ga0495676_0110212
2603 Ga0495680_0018273
2604 Ga0495680_0152354
2605 Ga0495675_0001743
2606 Ga0495675_0003075
2607 Ga0495684_0167879
2608 Ga0495684_0288789
2609 Ga0495593_0164365
2610 Ga0495602_0260910
2611 Ga0495602_0402893
2612 Ga0495614_0013730
2613 Ga0495615_0008576
2614 Ga0496100_0056132
2615 Ga0496100_0065379
2616 Ga0496102_0157282
2617 Ga0496104_0119297
2618 Ga0496104_0250358
2619 Ga0496104_0275417
2620 Ga0496104_0295010
2621 Ga0496105_0019985
2622 Ga0496106_0114799
2623 Ga0496108_0002333
2624 Ga0496108_0070661
2625 Ga0496108_0336491
2626 Ga0496109_0000941
2627 Ga0496109_0125666
2628 Ga0496109_0345784
2629 Ga0496110_0028543
2630 Ga0496110_0115180
2631 Ga0496110_0118010
2632 Ga0496110_0280285
2633 Ga0496111_0051663
2634 Ga0496112_0001276
2635 Ga0496112_0019630
2636 Ga0496112_0031605
2637 Ga0496112_0032286
2638 Ga0496112_0071615
2639 Ga0496112_0088484
2640 Ga0496112_0090315
2641 Ga0496112_0277141
2642 Ga0496112_0387903
2643 Ga0496113_0000236
2644 Ga0496113_0026940
2645 Ga0496113_0062731
2646 Ga0496113_0524904
2647 Ga0496114_0008108
2648 Ga0496114_0281601
2649 Ga0496115_0002794
2650 Ga0496115_0021677
2651 Ga0496115_0072679
2652 Ga0496115_0072703
2653 Ga0496115_0352143
2654 Ga0501298_000137
2655 Ga0501031_0195662
2656 Ga0501034_0053936
2657 Ga0501034_0142090
2658 Ga0501036_0428772
2659 Ga0501039_0105096
2660 Ga0501040_0421233
2661 Ga0501041_0077082
2662 Ga0501042_0108256
2663 Ga0501048_0092399
2664 Ga0501068_0049321
2665 Ga0501071_0004724
2666 Ga0501071_0007541
2667 Ga0501071_0285509
2668 Ga0501072_0021337
2669 Ga0501072_0098455
2670 Ga0501072_0184872
2671 Ga0501072_0279864
2672 Ga0501073_0003912
2673 Ga0501073_0067763
2674 Ga0501074_0165643
2675 Ga0501074_0334326
2676 Ga0501075_0016991
2677 Ga0501075_0018228
2678 Ga0501075_0019078
2679 Ga0501075_0102830
2680 Ga0501075_0297963
2681 Ga0501076_0048261
2682 Ga0501076_0182270
2683 Ga0501076_0235636
2684 Ga0501077_0000043
2685 Ga0501245_010190
2686 Ga0501079_0195458
2687 Ga0501080_0021064
2688 Ga0501081_0019340
2689 Ga0501081_0110974
2690 Ga0501081_0323217
2691 Ga0501081_0393524
2692 Ga0501083_0000344
2693 Ga0501045_0041721
2694 Ga0501045_0042553
2695 Ga0501045_0136460
2696 Ga0501045_0182038
2697 Ga0501045_0222547
2698 Ga0501045_0223295
2699 nmdc:mga03n38_85892_c1
2700 nmdc:mga00v17_19135_c1
2701 nmdc:mga00v17_25589_c1
2702 nmdc:mga0yw44_18799_c1
2703 nmdc:mga0yw44_229433_c1
2704 nmdc:mga0yw44_9584_c1
2705 nmdc:mga0k408_13637_c1
2706 nmdc:mga0k408_1841_c1
2707 nmdc:mga0k408_8832_c1
2708 nmdc:mga06z11_28023_c1
2709 nmdc:mga07m45_82862_c1
2710 nmdc:mga05p37_164323_c1
2711 nmdc:mga05p37_169992_c1
2712 nmdc:mga05p37_225945_c1
2713 nmdc:mga05p37_236598_c1
2714 nmdc:mga05p37_312137_c1
2715 nmdc:mga05p37_343140_c1
2716 nmdc:mga05p37_3554_c1
2717 nmdc:mga05p37_390622_c1
2718 nmdc:mga05p37_39_c1
2719 nmdc:mga05p37_524555_c1
2720 nmdc:mga05p37_614844_c1
2721 nmdc:mga05p37_6916_c1
2722 nmdc:mga05p37_799295_c1
2723 nmdc:mga05p37_858020_c1
2724 nmdc:mga09592_10763_c1
2725 nmdc:mga09592_1460_c1
2726 nmdc:mga09592_180203_c1
2727 nmdc:mga09592_222067_c1
2728 nmdc:mga09592_330212_c1
2729 nmdc:mga09592_434775_c1
2730 nmdc:mga09592_52342_c1
2731 nmdc:mga0qj67_138887_c1
2732 nmdc:mga0qj67_140030_c1
2733 nmdc:mga0qj67_20299_c1
2734 nmdc:mga0qj67_42389_c1
2735 nmdc:mga06r32_150735_c1
2736 nmdc:mga06r32_162913_c1
2737 nmdc:mga06r32_255429_c1
2738 nmdc:mga06r32_478831_c1
2739 nmdc:mga06r32_5019_c1
2740 nmdc:mga06r32_660704_c1
2741 nmdc:mga08y16_129143_c1
2742 nmdc:mga08y16_133487_c1
2743 nmdc:mga08y16_273278_c1
2744 nmdc:mga08y16_37415_c1
2745 nmdc:mga08y16_44631_c1
2746 nmdc:mga08y16_657702_c1
2747 nmdc:mga08y16_80036_c1
2748 nmdc:mga0n895_105171_c1
2749 nmdc:mga0n895_105329_c1
2750 nmdc:mga0n895_12769_c1
2751 nmdc:mga0n895_19562_c1
2752 nmdc:mga0n895_375584_c1
2753 nmdc:mga0n895_37707_c1
2754 nmdc:mga0n895_46680_c1
2755 nmdc:mga0n895_47_c1
2756 nmdc:mga0n895_596743_c1
2757 nmdc:mga0n895_6363_c1
2758 nmdc:mga0n895_6399_c1
2759 nmdc:mga0n895_76648_c1
2760 nmdc:mga0rr50_102413_c1
2761 nmdc:mga0rr50_129766_c1
2762 nmdc:mga0rr50_156206_c1
2763 nmdc:mga0rr50_29389_c1
2764 nmdc:mga0rr50_298861_c1
2765 nmdc:mga0rr50_421_c1
2766 nmdc:mga0rr50_7615_c1
2767 nmdc:mga08x19_15719_c2
2768 nmdc:mga08x19_159_c1
2769 nmdc:mga08x19_313964_c1
2770 nmdc:mga08x19_3951_c1
2771 nmdc:mga08x19_6000_c1
2772 nmdc:mga08x19_9447_c1
2773 nmdc:mga08x19_94831_c1
2774 nmdc:mga0a205_114246_c2
2775 nmdc:mga0a205_17697_c1
2776 nmdc:mga0a205_208831_c1
2777 nmdc:mga0a205_293900_c1
2778 nmdc:mga0a205_306308_c1
2779 nmdc:mga0a205_378_c1
2780 nmdc:mga0a205_40587_c1
2781 nmdc:mga0a205_507156_c1
2782 nmdc:mga0a205_5281_c1
2783 nmdc:mga0a205_5870_c1
2784 nmdc:mga0a205_618923_c1
2785 nmdc:mga0a205_73981_c1
2786 nmdc:mga0a205_9834_c1
2787 nmdc:mga0sz30_133768_c1
2788 Ga0495601_0038608
2789 Ga0495619_0013765
2790 Ga0495619_0083881
2791 Ga0500555_005659
2792 Ga0501084_0132330
2793 Ga0501084_0411300
2794 Ga0590071_003929
2795 Ga0590074_026271
2796 Ga0590075_005479
2797 Ga0590077_000183
2798 Ga0587080_014860
2799 Ga0587083_0019086
2800 Ga0587071_020531
2801 Ga0501082_0000791
2802 Ga0501082_0164048
2803 Ga0501082_0177173
2804 Ga0501082_0269779
2805 Ga0530510_0014030
2806 Ga0530510_0139478
2807 Ga0530510_0289323
2808 2857597099
2809 2936340756
2810 3006973539

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00725

3HCDH

3-hydroxyacyl-CoA dehydrogenase, C-terminal domain

241

336

0.99

PF02737

3HCDH_N

3-hydroxyacyl-CoA dehydrogenase, NAD binding domain

59

239

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
4j31-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase (kmo-396prot) 0.9984 5 35
4j36-assembly2.cif.gz_B cocrystal structure of kynurenine 3-monooxygenase in complex with upf 648 inhibitor(kmo-394upf) 0.9895 5 37
4j34-assembly1.cif.gz_A crystal structure of kynurenine 3-monooxygenase - truncated at position 394 plus his tag cleaved. 0.9879 5 37
6lkd-assembly1.cif.gz_A in meso full-length rat kmo in complex with a pyrazoyl benzoic acid inhibitor 0.9849 5 35
4j33-assembly2.cif.gz_B crystal structure of kynurenine 3-monooxygenase (kmo-394) 0.9848 5 37
ID Description Score Start End Superfamily
4j36B00 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9895 5 37 3.50.50.60
af_I1MHA5_112_472_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9837 6 33 3.50.50.60
6acqA02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9821 196 279 1.10.1040.10
4kueB02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9799 196 279 1.10.1040.10
4kuhF02 Mainly Alpha;Orthogonal Bundle;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2;N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 0.9791 196 279 1.10.1040.10
ID Description Score Start End GO Terms
AF-A0A2V9HV30-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9891 1 103 GO:0006631
GO:0008691
GO:0070403
AF-A0A7C4HZB3-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase 0.9803 4 75 GO:0006631
GO:0016491
GO:0070403
AF-X1REX1-F1-model_v4 3-hydroxyacyl-CoA dehydrogenase NAD binding domain-containing protein 0.9799 3 80 GO:0006631
GO:0016491
GO:0070403
AF-A0A1A7XAH6-F1-model_v4 Enoyl-Coenzyme A, hydratase/3-hydroxyacyl Coenzyme A dehydrogenase 0.9793 85 194 GO:0003857
GO:0005777
GO:0006635
GO:0016829
GO:0016853
GO:0070403
AF-A0A356QJG1-F1-model_v4 3-hydroxybutyryl-CoA dehydrogenase (EC 1.1.1.157) 0.9787 5 163 GO:0006631
GO:0008691
GO:0070403

Map