F493571

General Info

Members Datasets Scaffolds Average Seq Length
1388 525 2777 217

Family's Representative Sequence

Representative Sequence 3300053156|Ga0500622_0009139|Ga0500622_0009139_671_1417
Length 248
Sequence VSASALALTGAAPRGLRPRRVMAACTIAAMRLLLVEDDLMIGEQLLELLRAEGYAVDWVRDGEIADTALQSQTYDLVILDLGLPKRDGMSVLQALRGRKQAVPVLIATARDATAQRVAGLDAGADDYVLKPFELDELLARIRALLRRAAGRAEPVYEHMGVSINPATREVTAHGHPVTLSQREWAVLEPLLARPGMVLSRQQLEEKLYGWKDEISSNAVEVYIHGLRKKLGAELIQNVRGVGYRVPKE

Samples

Sample ID Description Type Environment
1 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
2 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
3 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
4 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
5 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
6 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
7 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
8 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
9 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
10 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
11 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
12 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
13 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
14 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
15 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
16 3300003544 Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
17 3300003574 Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
18 3300003578 Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Unclassified
19 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
20 3300003761 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 Metagenome Endosphere
21 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
22 3300003763 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 Metagenome Endosphere
23 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
24 3300003773 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 Metagenome Endosphere
25 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
26 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
27 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
28 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
29 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
30 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
31 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
32 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
33 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
34 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
35 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
36 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
37 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
38 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
39 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
40 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
41 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
42 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
43 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
44 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
45 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
46 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
47 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
48 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
49 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
50 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
51 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
52 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
53 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
56 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
57 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
58 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
59 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
60 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
66 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
67 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
68 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
69 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
70 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
71 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
72 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
73 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
74 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
75 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
76 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
77 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
78 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
79 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
80 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
81 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
82 3300006944 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW Metagenome Nodule
83 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
84 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
85 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
86 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
87 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
88 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
89 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
90 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
91 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
92 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
93 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
94 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
95 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
96 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
97 3300012497 Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 Metagenome Rhizosphere
98 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
99 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
100 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
101 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
102 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
103 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
104 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
105 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
106 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
107 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
108 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
109 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
110 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
111 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
112 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
113 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
114 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
115 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
116 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
117 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
118 3300025229 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
119 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
120 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
121 3300025242 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
122 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
123 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
124 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
125 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
126 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
127 3300025263 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) Metagenome Endosphere
128 3300025272 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
129 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
130 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
131 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
132 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
133 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
134 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
135 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
136 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
137 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
138 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
139 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
140 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
141 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025728 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
171 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
175 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300027296 Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) Metagenome Nodule
181 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
182 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
183 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
186 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
187 3300030731 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 Metagenome Rhizosphere
188 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
189 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
190 3300030736 Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 Metagenome Rhizosphere
191 3300030742 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 Metagenome Rhizosphere
192 3300030744 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 Metagenome Rhizosphere
193 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
194 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
195 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
196 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
197 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
198 3300031507 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM Metagenome Unclassified
199 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
200 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
201 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
202 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
203 3300031838 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM Metagenome Unclassified
204 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
205 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
206 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
207 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
208 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
209 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
210 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
211 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
212 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
213 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
214 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
215 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
216 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
217 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
218 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
219 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
220 3300039093 Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 Metagenome Unclassified
221 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
222 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
223 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
224 3300041407 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 Metagenome Rhizosphere
225 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
226 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
227 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
228 3300041443 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG Metagenome Rhizoplane
229 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
230 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
231 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
232 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
233 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
234 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
235 3300042006 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 Metagenome Rhizosphere
236 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
237 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
238 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
239 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
240 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
241 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
242 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
243 3300042128 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 Metagenome Rhizosphere
244 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
245 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
246 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
247 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
248 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
249 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
250 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
251 3300042185 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 Metagenome Rhizosphere
252 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
253 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
254 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
255 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
256 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
257 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
258 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
259 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
260 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
261 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
262 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
263 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
264 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
265 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
266 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
267 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
268 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
269 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
270 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
271 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
272 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
273 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
276 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
277 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
278 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046471 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere Metagenome Rhizosphere
281 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
282 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
283 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
284 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
287 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
288 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
289 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
290 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
291 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
292 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
293 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
294 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
298 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
299 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
300 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
301 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
302 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
303 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
304 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
305 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
306 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
307 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
308 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
312 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
313 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
314 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
315 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
316 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
317 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
318 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
319 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
320 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
324 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
325 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
326 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
327 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
328 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
329 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
330 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
331 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
332 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
333 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
334 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
335 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
336 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
337 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
338 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
339 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
340 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
341 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
342 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
343 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
344 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
345 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
346 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
347 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
348 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
349 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
350 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
351 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
352 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
353 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
354 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
355 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
356 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
357 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
358 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
359 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
360 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
361 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
362 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
363 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
364 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
365 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
366 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
367 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
368 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
369 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
370 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
371 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
372 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
373 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
374 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
375 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
376 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
377 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
378 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
379 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
380 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
381 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
382 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
383 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
384 3300049529 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
385 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
386 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
387 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
388 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
389 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
390 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
391 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
392 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
393 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
394 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
395 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
396 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
397 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
398 3300049662 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control Metagenome Rhizosphere
399 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
400 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
401 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
402 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
403 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
404 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
405 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
406 3300049775 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought Metagenome Rhizosphere
407 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
408 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
409 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
410 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
411 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
412 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
413 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
414 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
415 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
416 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
417 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
418 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
419 3300053079 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere Metagenome Endosphere
420 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
421 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
422 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
423 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
424 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
425 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
426 3300053110 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere Metagenome Endosphere
427 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
428 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
429 3300053121 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere Metagenome Endosphere
430 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
431 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
432 3300053128 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere Metagenome Endosphere
433 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
434 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
435 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
436 3300053138 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere Metagenome Endosphere
437 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
438 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
439 3300053141 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere Metagenome Endosphere
440 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
441 3300053154 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere Metagenome Endosphere
442 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
443 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
444 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
445 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
446 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
447 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
448 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
449 2513020051 Variovorax sp. CF313 Isolate Rhizosphere
450 2547132374 Acidovorax radicis N35 Isolate Unclassified
451 2585428057 Methylibium sp. YR605 Isolate Rhizosphere
452 2599185214 Variovorax sp. NFACC26 Isolate Rhizoplane
453 2599185226 Variovorax sp. NFACC27 Isolate Rhizoplane
454 2599185227 Variovorax sp. NFACC28 Isolate Rhizoplane
455 2599185229 Variovorax sp. NFACC29 Isolate Endosphere
456 2643221554 Duganella sp. Root1480D1 Isolate Unclassified
457 2643221556 Massilia sp. Root1485 Isolate Unclassified
458 2643221592 Rhizobacter sp. Root16D2 Isolate Unclassified
459 2643221596 Acidovorax sp. Root70 Isolate Unclassified
460 2643221628 Variovorax sp. Root318D1 Isolate Unclassified
461 2643221638 Duganella sp. Root336D2 Isolate Unclassified
462 2643221645 Massilia sp. Root351 Isolate Unclassified
463 2643221658 Variovorax sp. Root411 Isolate Unclassified
464 2643221664 Massilia sp. Root418 Isolate Unclassified
465 2643221672 Variovorax sp. Root434 Isolate Unclassified
466 2643221683 Variovorax sp. Root473 Isolate Unclassified
467 2643221684 Massilia sp. Root133 Isolate Unclassified
468 2643221717 Acidovorax sp. Root267 Isolate Unclassified
469 2738541277 Variovorax sp. GV051 Isolate Unclassified
470 2738541280 Massilia sp. GV090 Isolate Unclassified
471 2738541281 Methylobacterium sp. GV094 Isolate Unclassified
472 2738541297 Duganella sp. GV083 Isolate Unclassified
473 2738541300 Massilia sp. GV016 Isolate Unclassified
474 2738541307 Variovorax sp. GV008 Isolate Unclassified
475 2738541357 Duganella sp. GV053 Isolate Unclassified
476 2738543003 Duganella sp. GV066 Isolate Unclassified
477 2738543013 Variovorax sp. BT01 Isolate Unclassified
478 2738543018 Massilia sp. GV045 Isolate Unclassified
479 2738543019 Variovorax sp. GV040 Isolate Unclassified
480 2738543026 Duganella sp. GV089 Isolate Unclassified
481 2738543029 Duganella sp. GV039 Isolate Unclassified
482 2738543030 Massilia sp. GV097 Isolate Unclassified
483 2738543032 Methylobacterium sp. GV104 Isolate Unclassified
484 2808606418 Herbaspirillum sp. SJZ107 Isolate Rhizosphere
485 2818991446 Variovorax sp. 1180 Isolate Unclassified
486 2831265667 Variovorax guangxiensis DSM 27352 Isolate Rhizosphere
487 2831864461 Roseateles noduli HZ7 Isolate Nodule
488 2838054893 Variovorax guangxiensis 34/80 Isolate Nodule
489 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
490 2842677519 Variovorax sp. R-72495 Isolate Unclassified
491 2842698319 Methylobacterium sp. R-72139 Isolate Unclassified
492 2842711865 Duganella sp. R-73148 Isolate Unclassified
493 2842733646 Variovorax sp. R-72446 Isolate Unclassified
494 2842747753 Variovorax sp. R-72060 Isolate Unclassified
495 2857553236 Duganella sp. R-74557 Isolate Unclassified
496 2857558681 Duganella sp. R-74565 Isolate Unclassified
497 2857564685 Duganella sp. R-74599 Isolate Unclassified
498 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
499 2885198086 Variovorax sp. 679 Isolate Unclassified
500 2885211737 Variovorax sp. 553 Isolate Unclassified
501 2886848708 Mitsuaria sp. TWR114 Isolate Rhizosphere
502 2899924645 Variovorax sp. 369 Isolate Unclassified
503 2904424332 Duganella sp. 1411 Isolate Rhizosphere
504 2904449895 Variovorax sp. 1763 Isolate Rhizosphere
505 2904456579 Variovorax sp. 2002 Isolate Unclassified
506 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
507 2919462493 Variovorax sp. 3319 Isolate Rhizosphere
508 2919476304 Duganella sp. 3397 Isolate Unclassified
509 2928037797 Variovorax sp. 1126 Isolate Unclassified
510 2928044640 Variovorax sp. 1128 Isolate Unclassified
511 2928051484 Variovorax sp. 1133 Isolate Unclassified
512 2928064002 Variovorax sp. 1140 Isolate Rhizosphere
513 2928070936 Variovorax gossypii 1167 Isolate Unclassified
514 2928084124 Variovorax paradoxus 1218 Isolate Unclassified
515 2928115317 Pseudacidovorax sp. 1753 Isolate Rhizosphere
516 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
517 2929520902 Variovorax beijingensis 502 Isolate Unclassified
518 2945909444 Variovorax sp. CRF3-Va-1 W1I1 Isolate Rhizosphere
519 2945945610 Variovorax paradoxus W1I18 Isolate Rhizosphere
520 2945972063 Variovorax paradoxus W2I8 Isolate Rhizosphere
521 2945984333 Variovorax sp. W2I14 Isolate Rhizosphere
522 2954767861 Variovorax sp. TBS-050B Isolate Rhizosphere
523 2990710928 Acidovorax delafieldii SLBN-75 Isolate Rhizosphere
524 8047673197 Telluria mixta LMG 11547 Isolate Rhizosphere
525 8057160832 Larsenimonas rhizosphaerae GH2-1 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 93.95
Metatranscriptomes 0.43
Isolates 5.62

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 15.85
Nodule 0.86
Rhizoplane 2.95
Rhizosphere 72.69
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0500622_0009139 3300053156 Bacteria 5500
2 JGI24740J21852_10032511 3300001979 Bacteria 1668
3 JGI25154J39366_1001311 3300002738 Bacteria 9235
4 JGI25158J39367_1017892 3300002739 Bacteria 882
5 JGI25152J39213_1021523 3300002773 Bacteria 1129
6 JGI25150J39212_1001139 3300002774 Bacteria 7993
7 JGI25150J39212_1006853 3300002774 Bacteria 2322
8 JGI25159J45721_1002152 3300002987 Bacteria 7678
9 JGI25151J46595_10003411 3300003187 Bacteria 8795
10 JGI25151J46595_10008465 3300003187 Bacteria 4947
11 JGI25153J46596_10064191 3300003215 Bacteria 981
12 rootH1_10007233 3300003316 Bacteria 8349
13 rootH2_10031368 3300003320 Bacteria 3709
14 rootL2_10002108 3300003322 Bacteria 31499
15 rootL2_10045051 3300003322 Bacteria 1560
16 rootL2_10087294 3300003322 Bacteria 1268
17 rootH1_10004227 3300003316 Bacteria 4326
18 rootH1_10004227 3300003323 Bacteria 8883
19 JGI25160J50197_1009062 3300003354 Bacteria 3726
20 JGI25161J50226_1001836 3300003374 Bacteria 5946
21 Ga0007417J51691_1007451 3300003544 Bacteria 2685
22 Ga0007410J51695_1012132 3300003574 Bacteria 2827
23 Ga0006562J51391_1043541 3300003578 Bacteria 4291
24 Ga0006562J51391_1043542 3300003578 Bacteria 4990
25 Ga0055525_1000011 3300003759 Bacteria 503124
26 Ga0055525_1000073 3300003759 Bacteria 180663
27 Ga0055535_1000364 3300003761 Bacteria 43640
28 Ga0055542_1000114 3300003762 Bacteria 107058
29 Ga0055529_1000208 3300003763 Bacteria 77951
30 Ga0055526_1000077 3300003771 Bacteria 92111
31 Ga0055526_1000094 3300003771 Bacteria 80954
32 Ga0055526_1005930 3300003771 Bacteria 6816
33 Ga0055526_1019641 3300003771 Bacteria 2451
34 Ga0055526_1029088 3300003771 Bacteria 1652
35 Ga0055537_1000484 3300003773 Bacteria 24629
36 Ga0055537_1007829 3300003773 Bacteria 2528
37 Ga0055524_1000007 3300003775 Bacteria 298766
38 Ga0055524_1000334 3300003775 Bacteria 43451
39 Ga0055524_1004119 3300003775 Bacteria 6816
40 Ga0055524_1004131 3300003775 Bacteria 6800
41 Ga0055524_1004645 3300003775 Bacteria 6300
42 Ga0055524_1008878 3300003775 Bacteria 4137
43 Ga0055536_1007729 3300003781 Bacteria 4756
44 Ga0055534_1000406 3300003784 Bacteria 26436
45 Ga0055534_1005715 3300003784 Bacteria 3272
46 Ga0055528_1000813 3300003790 Bacteria 21449
47 Ga0055528_1013114 3300003790 Bacteria 3165
48 Ga0055528_1024492 3300003790 Bacteria 1807
49 Ga0055530_10000777 3300003791 Bacteria 26621
50 Ga0055530_10018320 3300003791 Bacteria 2163
51 Ga0055540_1001349 3300003792 Bacteria 14772
52 Ga0055540_1007393 3300003792 Bacteria 4153
53 Ga0055540_1017711 3300003792 Bacteria 1978
54 Ga0055531_10001441 3300003794 Bacteria 17545
55 Ga0055531_10009422 3300003794 Bacteria 4990
56 Ga0055543_1000748 3300004625 Bacteria 16355
57 Ga0055543_1003842 3300004625 Bacteria 4265
58 Ga0055543_1004175 3300004625 Bacteria 4006
59 Ga0065165_1000006 3300005262 Bacteria 352298
60 Ga0065165_1000094 3300005262 Bacteria 146099
61 Ga0065165_1000230 3300005262 Bacteria 97470
62 Ga0065165_1001757 3300005262 Bacteria 21551
63 Ga0065165_1005587 3300005262 Bacteria 6976
64 Ga0065165_1044083 3300005262 Bacteria 1306
65 Ga0070658_10473481 3300005327 Bacteria 1080
66 Ga0070676_10070202 3300005328 Bacteria 2100
67 Ga0070670_100017063 3300005331 Bacteria 6230
68 Ga0068869_100189670 3300005334 Bacteria 1616
69 Ga0070680_100185989 3300005336 Bacteria 1750
70 Ga0070660_100009975 3300005339 Bacteria 6696
71 Ga0070660_100050280 3300005339 Bacteria 3207
72 Ga0070689_100063108 3300005340 Bacteria 2883
73 Ga0070661_100139450 3300005344 Bacteria 1826
74 Ga0070669_100135351 3300005353 Bacteria 1895
75 Ga0070675_100095515 3300005354 Bacteria 2496
76 Ga0070675_100466587 3300005354 Bacteria 1134
77 Ga0070674_100019524 3300005356 Bacteria 4306
78 Ga0070674_100851233 3300005356 Bacteria 791
79 Ga0070674_101019359 3300005356 Bacteria 727
80 Ga0070673_100043327 3300005364 Bacteria 3477
81 Ga0070673_100336762 3300005364 Bacteria 1336
82 Ga0070659_100010185 3300005366 Bacteria 6919
83 Ga0070659_100116362 3300005366 Bacteria 2161
84 Ga0070659_100450851 3300005366 Bacteria 1091
85 Ga0070667_100500683 3300005367 Bacteria 1114
86 Ga0070714_100215054 3300005435 Bacteria 1764
87 Ga0070713_100698833 3300005436 Bacteria 968
88 Ga0070678_100537024 3300005456 Bacteria 1036
89 Ga0070662_100012605 3300005457 Bacteria 5608
90 Ga0070681_10189700 3300005458 Bacteria 1975
91 Ga0068867_100920952 3300005459 Bacteria 788
92 Ga0070698_100413980 3300005471 Bacteria 1282
93 Ga0070679_100014542 3300005530 Bacteria 7561
94 Ga0070679_100036197 3300005530 Bacteria 4898
95 Ga0070679_100444670 3300005530 Bacteria 1241
96 Ga0070697_100473017 3300005536 Bacteria 1094
97 Ga0068853_100042996 3300005539 Bacteria 3865
98 Ga0068853_100120354 3300005539 Bacteria 2341
99 Ga0068853_100549350 3300005539 Bacteria 1094
100 Ga0070672_100540710 3300005543 Bacteria 1011
101 Ga0070693_100071609 3300005547 Bacteria 2043
102 Ga0070665_100055825 3300005548 Bacteria 3960
103 Ga0068855_100007205 3300005563 Bacteria 13496
104 Ga0068855_100162276 3300005563 Bacteria 2535
105 Ga0068855_100385629 3300005563 Bacteria 1538
106 Ga0070664_100026610 3300005564 Bacteria 4800
107 Ga0070664_100256320 3300005564 Bacteria 1573
108 Ga0068857_100053870 3300005577 Bacteria 3568
109 Ga0068857_100139021 3300005577 Bacteria 2195
110 Ga0068854_100583919 3300005578 Bacteria 952
111 Ga0068852_100096885 3300005616 Bacteria 2653
112 Ga0068852_100147171 3300005616 Bacteria 2186
113 Ga0068852_100164392 3300005616 Bacteria 2075
114 Ga0068851_10046197 3300005834 Bacteria 2202
115 Ga0068858_100041447 3300005842 Bacteria 4268
116 Ga0068862_100093797 3300005844 Bacteria 2618
117 Ga0068862_100253613 3300005844 Bacteria 1604
118 Ga0081539_10050675 3300005985 Bacteria 2347
119 Ga0075365_10026402 3300006038 Bacteria 3687
120 Ga0075365_10055877 3300006038 Bacteria 2623
121 Ga0075365_10135617 3300006038 Bacteria 1706
122 Ga0075363_100008149 3300006048 Bacteria 4865
123 Ga0075363_100052055 3300006048 Bacteria 2185
124 Ga0075362_10019634 3300006177 Bacteria 2813
125 Ga0075362_10020895 3300006177 Bacteria 2739
126 Ga0075362_10046340 3300006177 Bacteria 1933
127 Ga0075367_10120451 3300006178 Bacteria 1617
128 Ga0075367_10180060 3300006178 Bacteria 1318
129 Ga0075369_10237729 3300006186 Bacteria 845
130 Ga0075369_10285862 3300006186 Bacteria 769
131 Ga0075366_10002796 3300006195 Bacteria 9022
132 Ga0075366_10018902 3300006195 Bacteria 3982
133 Ga0075366_10113145 3300006195 Bacteria 1634
134 Ga0075366_10165338 3300006195 Bacteria 1341
135 Ga0075366_10323073 3300006195 Bacteria 945
136 Ga0075370_10000200 3300006353 Bacteria 21094
137 Ga0075370_10002669 3300006353 Bacteria 8338
138 Ga0075370_10031904 3300006353 Bacteria 2942
139 Ga0075370_10033873 3300006353 Bacteria 2862
140 Ga0075370_10072254 3300006353 Bacteria 1974
141 Ga0075370_10376921 3300006353 Bacteria 850
142 Ga0068871_100137347 3300006358 Bacteria 2077
143 Ga0075431_100480821 3300006847 Bacteria 1235
144 Ga0075434_100045544 3300006871 Bacteria 4352
145 Ga0068865_100318757 3300006881 Bacteria 1250
146 Ga0075436_100005826 3300006914 Bacteria 8458
147 Ga0099823_1004022 3300006944 Bacteria 14210
148 Ga0079104_1005131 3300006946 Bacteria 5328
149 Ga0079104_1018383 3300006946 Bacteria 1980
150 Ga0099826_10000003 3300006948 Bacteria 1067817
151 Ga0099826_10001182 3300006948 Bacteria 15114
152 Ga0075435_100106252 3300007076 Bacteria 2331
153 Ga0105244_10005211 3300009036 Bacteria 8698
154 Ga0105244_10007865 3300009036 Bacteria 6725
155 Ga0105244_10057774 3300009036 Bacteria 1960
156 Ga0105240_10013928 3300009093 Bacteria 11009
157 Ga0105240_10135868 3300009093 Bacteria 2945
158 Ga0105240_10279076 3300009093 Bacteria 1920
159 Ga0105245_10417428 3300009098 Bacteria 1344
160 Ga0105245_10476637 3300009098 Bacteria 1260
161 Ga0105245_10831844 3300009098 Bacteria 962
162 Ga0105243_10003393 3300009148 Bacteria 12920
163 Ga0105243_10004657 3300009148 Bacteria 10800
164 Ga0105243_10107021 3300009148 Bacteria 2332
165 Ga0105243_10145657 3300009148 Bacteria 2026
166 Ga0105241_10065294 3300009174 Bacteria 2812
167 Ga0105242_10003383 3300009176 Bacteria 12419
168 Ga0105242_10014082 3300009176 Bacteria 6190
169 Ga0105242_10017712 3300009176 Bacteria 5555
170 Ga0105242_10639476 3300009176 Bacteria 1033
171 Ga0105248_10016344 3300009177 Bacteria 8166
172 Ga0105248_10269634 3300009177 Bacteria 1917
173 Ga0105237_10084896 3300009545 Bacteria 3156
174 Ga0105238_10008824 3300009551 Bacteria 10085
175 Ga0105238_10144266 3300009551 Bacteria 2357
176 Ga0105238_10231255 3300009551 Bacteria 1825
177 Ga0105238_11187362 3300009551 Bacteria 787
178 Ga0105249_10308991 3300009553 Bacteria 1588
179 Ga0105239_10033491 3300010375 Bacteria 5642
180 Ga0157319_1000012 3300012497 Bacteria 165761
181 Ga0157373_10025544 3300013100 Bacteria 4271
182 Ga0157373_10107377 3300013100 Bacteria 1962
183 Ga0157371_10000001 3300013102 Bacteria 1162285
184 Ga0157371_10104225 3300013102 Bacteria 2013
185 Ga0157370_10011376 3300013104 Bacteria 9316
186 Ga0157370_10094025 3300013104 Bacteria 2813
187 Ga0157370_10235209 3300013104 Bacteria 1695
188 Ga0157370_10571025 3300013104 Bacteria 1036
189 Ga0157369_10193073 3300013105 Bacteria 2139
190 Ga0157378_10649905 3300013297 Bacteria 1070
191 Ga0163162_10121755 3300013306 Bacteria 2714
192 Ga0163162_10146915 3300013306 Bacteria 2474
193 Ga0163162_10595176 3300013306 Bacteria 1232
194 Ga0157375_10175896 3300013308 Bacteria 2290
195 Ga0163163_10754812 3300014325 Bacteria 1036
196 Ga0157380_10110521 3300014326 Bacteria 2308
197 Ga0157380_10626639 3300014326 Bacteria 1069
198 Ga0157380_10681473 3300014326 Bacteria 1030
199 Ga0182008_10000893 3300014497 Bacteria 20726
200 Ga0182008_10003192 3300014497 Bacteria 10015
201 Ga0182008_10010607 3300014497 Bacteria 4927
202 Ga0182008_10021377 3300014497 Bacteria 3322
203 Ga0182008_10021606 3300014497 Bacteria 3304
204 Ga0157379_10250271 3300014968 Bacteria 1608
205 Ga0157379_10314606 3300014968 Bacteria 1429
206 Ga0182006_1000021 3300015261 Bacteria 280808
207 Ga0182006_1001088 3300015261 Bacteria 17410
208 Ga0182006_1068286 3300015261 Bacteria 1324
209 Ga0182007_10012859 3300015262 Bacteria 3210
210 Ga0182007_10022091 3300015262 Bacteria 2251
211 Ga0182007_10025460 3300015262 Bacteria 2062
212 Ga0182007_10048705 3300015262 Bacteria 1400
213 Ga0182005_1000020 3300015265 Bacteria 278671
214 Ga0183362_10001 3300015683 Bacteria 2046624
215 Ga0163161_10000193 3300017792 Bacteria 56074
216 Ga0163161_10282731 3300017792 Bacteria 1302
217 Ga0213872_10000002 3300021361 Bacteria 554092
218 Ga0213872_10000027 3300021361 Bacteria 148884
219 Ga0213872_10000049 3300021361 Bacteria 109094
220 Ga0213872_10000143 3300021361 Bacteria 64736
221 Ga0213872_10000153 3300021361 Bacteria 63358
222 Ga0213872_10000156 3300021361 Bacteria 62916
223 Ga0213872_10000394 3300021361 Bacteria 36299
224 Ga0213872_10029381 3300021361 Bacteria 2521
225 Ga0213872_10057901 3300021361 Bacteria 1754
226 Ga0213872_10088226 3300021361 Bacteria 1389
227 Ga0224712_10102079 3300022467 Bacteria 1218
228 Ga0209436_101987 3300025208 Bacteria 6507
229 Ga0209436_103446 3300025208 Bacteria 4211
230 Ga0209672_103096 3300025228 Bacteria 3603
231 Ga0209147_100575 3300025229 Bacteria 20578
232 Ga0209563_100005 3300025230 Bacteria 1774893
233 Ga0209563_100007 3300025230 Bacteria 1579402
234 Ga0209437_107547 3300025233 Bacteria 1764
235 Ga0209258_100225 3300025242 Bacteria 107138
236 Ga0207425_1000224 3300025245 Bacteria 44543
237 Ga0207425_1000295 3300025245 Bacteria 36319
238 Ga0207425_1000566 3300025245 Bacteria 21775
239 Ga0209646_1000028 3300025246 Bacteria 387986
240 Ga0209026_1012811 3300025250 Bacteria 1449
241 Ga0209148_1000040 3300025254 Bacteria 473531
242 Ga0209148_1002241 3300025254 Bacteria 7042
243 Ga0209129_1000007 3300025258 Bacteria 771325
244 Ga0209129_1000723 3300025258 Bacteria 21251
245 Ga0209129_1004098 3300025258 Bacteria 5933
246 Ga0209565_1000085 3300025263 Bacteria 153075
247 Ga0209565_1000644 3300025263 Bacteria 22599
248 Ga0209565_1000937 3300025263 Bacteria 15341
249 Ga0209565_1001692 3300025263 Bacteria 9131
250 Ga0209565_1002166 3300025263 Bacteria 7391
251 Ga0209565_1014274 3300025263 Bacteria 1830
252 Ga0209455_1000049 3300025272 Bacteria 374414
253 Ga0209673_1000133 3300025273 Bacteria 161740
254 Ga0209673_1000304 3300025273 Bacteria 91151
255 Ga0209673_1001052 3300025273 Bacteria 31821
256 Ga0209673_1003491 3300025273 Bacteria 9218
257 Ga0209673_1007483 3300025273 Bacteria 5022
258 Ga0209673_1018452 3300025273 Bacteria 2536
259 Ga0209673_1028951 3300025273 Bacteria 1772
260 Ga0209673_1034076 3300025273 Bacteria 1543
261 Ga0209130_1000324 3300025284 Bacteria 55802
262 Ga0209130_1000326 3300025284 Bacteria 54842
263 Ga0209130_1000800 3300025284 Bacteria 26748
264 Ga0209130_1003269 3300025284 Bacteria 7076
265 Ga0209130_1003568 3300025284 Bacteria 6509
266 Ga0209675_1000083 3300025291 Bacteria 153075
267 Ga0209675_1000516 3300025291 Bacteria 28507
268 Ga0209675_1001124 3300025291 Bacteria 16310
269 Ga0209675_1001236 3300025291 Bacteria 15383
270 Ga0209675_1003686 3300025291 Bacteria 7151
271 Ga0209676_1000122 3300025292 Bacteria 195510
272 Ga0209676_1000268 3300025292 Bacteria 108430
273 Ga0209676_1001471 3300025292 Bacteria 21884
274 Ga0209025_1000073 3300025294 Bacteria 282133
275 Ga0209025_1000111 3300025294 Bacteria 218982
276 Ga0209025_1000432 3300025294 Bacteria 82875
277 Ga0209025_1005232 3300025294 Bacteria 10693
278 Ga0209025_1008304 3300025294 Bacteria 7493
279 Ga0209025_1008949 3300025294 Bacteria 7081
280 Ga0209025_1073075 3300025294 Bacteria 1205
281 Ga0209564_1000003 3300025295 Bacteria 1585848
282 Ga0209564_1000009 3300025295 Bacteria 950196
283 Ga0209564_1000045 3300025295 Bacteria 376549
284 Ga0209564_1000175 3300025295 Bacteria 153109
285 Ga0209564_1000524 3300025295 Bacteria 62668
286 Ga0209564_1000594 3300025295 Bacteria 56686
287 Ga0209564_1001280 3300025295 Bacteria 27544
288 Ga0209564_1056414 3300025295 Bacteria 913
289 Ga0209758_1000025 3300025297 Bacteria 586687
290 Ga0209758_1000456 3300025297 Bacteria 68269
291 Ga0209758_1002137 3300025297 Bacteria 20841
292 Ga0209050_1000002 3300025298 Bacteria 1792849
293 Ga0209050_1000339 3300025298 Bacteria 92915
294 Ga0209050_1000384 3300025298 Bacteria 83323
295 Ga0209050_1001024 3300025298 Bacteria 34874
296 Ga0209050_1002458 3300025298 Bacteria 15805
297 Ga0209050_1009165 3300025298 Bacteria 5117
298 Ga0209256_1000005 3300025299 Bacteria 1315082
299 Ga0209256_1000050 3300025299 Bacteria 308622
300 Ga0209256_1000063 3300025299 Bacteria 252716
301 Ga0209256_1000373 3300025299 Bacteria 71879
302 Ga0209256_1002180 3300025299 Bacteria 16812
303 Ga0209256_1003554 3300025299 Bacteria 10801
304 Ga0209256_1010020 3300025299 Bacteria 4049
305 Ga0209256_1014525 3300025299 Bacteria 2825
306 Ga0207426_1000001 3300025302 Bacteria 1341301
307 Ga0207426_1000028 3300025302 Bacteria 483955
308 Ga0207426_1004897 3300025302 Bacteria 6323
309 Ga0209051_1000002 3300025303 Bacteria 1631846
310 Ga0209051_1000343 3300025303 Bacteria 69952
311 Ga0209051_1000618 3300025303 Bacteria 40891
312 Ga0209051_1000665 3300025303 Bacteria 38573
313 Ga0209051_1003457 3300025303 Bacteria 10342
314 Ga0209051_1004603 3300025303 Bacteria 8412
315 Ga0209051_1013868 3300025303 Bacteria 3801
316 Ga0209257_1000002 3300025304 Bacteria 1767052
317 Ga0209257_1000107 3300025304 Bacteria 240937
318 Ga0209257_1000333 3300025304 Bacteria 98599
319 Ga0209257_1000671 3300025304 Bacteria 53537
320 Ga0209257_1001657 3300025304 Bacteria 25275
321 Ga0209257_1001964 3300025304 Bacteria 22160
322 Ga0209257_1002139 3300025304 Bacteria 20582
323 Ga0209257_1011830 3300025304 Bacteria 4131
324 Ga0207656_10030962 3300025321 Bacteria 2213
325 Ga0207655_1004524 3300025728 Bacteria 9824
326 Ga0207655_1009233 3300025728 Bacteria 6152
327 Ga0207655_1016530 3300025728 Bacteria 4029
328 Ga0207680_10238982 3300025903 Bacteria 1251
329 Ga0207645_10145926 3300025907 Bacteria 1543
330 Ga0207705_10041375 3300025909 Bacteria 3306
331 Ga0207705_10153962 3300025909 Bacteria 1724
332 Ga0207707_10372311 3300025912 Bacteria 1229
333 Ga0207695_10289081 3300025913 Bacteria 1532
334 Ga0207695_10310688 3300025913 Bacteria 1466
335 Ga0207695_10323152 3300025913 Bacteria 1432
336 Ga0207662_10111489 3300025918 Bacteria 1706
337 Ga0207662_10160500 3300025918 Bacteria 1436
338 Ga0207657_10018275 3300025919 Bacteria 6703
339 Ga0207652_10065323 3300025921 Bacteria 3151
340 Ga0207652_10069362 3300025921 Bacteria 3061
341 Ga0207652_10616145 3300025921 Bacteria 972
342 Ga0207652_10688677 3300025921 Bacteria 913
343 Ga0207681_10006569 3300025923 Bacteria 7140
344 Ga0207694_10394908 3300025924 Bacteria 1149
345 Ga0207694_10662563 3300025924 Bacteria 880
346 Ga0207650_10015881 3300025925 Bacteria 5253
347 Ga0207659_10073136 3300025926 Bacteria 2509
348 Ga0207659_10236097 3300025926 Bacteria 1477
349 Ga0207687_10045521 3300025927 Bacteria 3033
350 Ga0207687_10194333 3300025927 Bacteria 1581
351 Ga0207700_10369812 3300025928 Bacteria 1251
352 Ga0207664_10249707 3300025929 Bacteria 1548
353 Ga0207690_10012121 3300025932 Bacteria 5157
354 Ga0207690_10210416 3300025932 Bacteria 1482
355 Ga0207690_10463884 3300025932 Bacteria 1020
356 Ga0207690_10551005 3300025932 Bacteria 937
357 Ga0207706_10007783 3300025933 Bacteria 9887
358 Ga0207706_10267200 3300025933 Bacteria 1493
359 Ga0207706_10270071 3300025933 Bacteria 1484
360 Ga0207686_10010419 3300025934 Bacteria 5062
361 Ga0207686_10028855 3300025934 Bacteria 3266
362 Ga0207686_10600104 3300025934 Bacteria 866
363 Ga0207709_10000425 3300025935 Bacteria 40645
364 Ga0207709_10001100 3300025935 Bacteria 19836
365 Ga0207709_10186361 3300025935 Bacteria 1470
366 Ga0207670_10062321 3300025936 Bacteria 2548
367 Ga0207669_10497107 3300025937 Bacteria 975
368 Ga0207669_10617846 3300025937 Bacteria 883
369 Ga0207691_10107315 3300025940 Bacteria 2486
370 Ga0207711_10097396 3300025941 Bacteria 2597
371 Ga0207711_10104872 3300025941 Bacteria 2506
372 Ga0207711_10117330 3300025941 Bacteria 2373
373 Ga0207689_10452512 3300025942 Bacteria 1073
374 Ga0207679_10071405 3300025945 Bacteria 2619
375 Ga0207679_10202978 3300025945 Bacteria 1657
376 Ga0207667_10052973 3300025949 Bacteria 4271
377 Ga0207667_10311301 3300025949 Bacteria 1608
378 Ga0207667_10403162 3300025949 Bacteria 1392
379 Ga0207667_10473532 3300025949 Bacteria 1271
380 Ga0207651_10357396 3300025960 Bacteria 1232
381 Ga0207651_10641910 3300025960 Bacteria 931
382 Ga0207640_10145120 3300025981 Bacteria 1735
383 Ga0207640_10413841 3300025981 Bacteria 1101
384 Ga0207703_10030373 3300026035 Bacteria 4270
385 Ga0207639_10082753 3300026041 Bacteria 2545
386 Ga0207639_10097266 3300026041 Bacteria 2370
387 Ga0207639_10514633 3300026041 Bacteria 1095
388 Ga0207678_10149869 3300026067 Bacteria 1991
389 Ga0207702_10248638 3300026078 Bacteria 1669
390 Ga0207702_10418520 3300026078 Bacteria 1295
391 Ga0207641_10253765 3300026088 Bacteria 1644
392 Ga0207648_10008612 3300026089 Bacteria 9865
393 Ga0207648_10082404 3300026089 Bacteria 2805
394 Ga0207648_10268532 3300026089 Bacteria 1523
395 Ga0207648_10309500 3300026089 Bacteria 1418
396 Ga0207674_10075892 3300026116 Bacteria 3370
397 Ga0207674_10317677 3300026116 Bacteria 1507
398 Ga0207683_10111999 3300026121 Bacteria 2444
399 Ga0207683_10170118 3300026121 Bacteria 1973
400 Ga0207698_10050162 3300026142 Bacteria 3182
401 Ga0207698_10075019 3300026142 Bacteria 2701
402 Ga0207698_10119684 3300026142 Bacteria 2226
403 Ga0207698_10384720 3300026142 Bacteria 1336
404 Ga0209389_1032076 3300027296 Bacteria 4375
405 Ga0209282_1000002 3300027666 Bacteria 1067825
406 Ga0209282_1002923 3300027666 Bacteria 10039
407 Ga0209974_10028908 3300027876 Bacteria 1836
408 Ga0268266_10006337 3300028379 Bacteria 10847
409 Ga0268265_10037903 3300028380 Bacteria 3541
410 Ga0307515_10002898 3300028794 Bacteria 36447
411 Ga0307515_10201053 3300028794 Bacteria 1868
412 Ga0307512_10245390 3300030522 Bacteria 900
413 Ga0316177_1102847 3300030731 Bacteria 3266
414 Ga0316177_1113384 3300030731 Bacteria 5863
415 Ga0316176_1137514 3300030732 Bacteria 2391
416 Ga0314311_1096514 3300030733 Bacteria 1904
417 Ga0316180_1082133 3300030736 Bacteria 5499
418 Ga0316183_1124842 3300030742 Bacteria 12846
419 Ga0316183_1151357 3300030742 Bacteria 1727
420 Ga0316181_1114218 3300030744 Bacteria 1402
421 Ga0316181_1266017 3300030744 Bacteria 1313
422 Ga0316182_1250603 3300030745 Bacteria 1044
423 Ga0316182_1422285 3300030745 Bacteria 1435
424 Ga0265328_10020764 3300031239 Bacteria 2512
425 Ga0265340_10005016 3300031247 Bacteria 7363
426 Ga0265331_10028699 3300031250 Bacteria 2781
427 Ga0265327_10000083 3300031251 Bacteria 204923
428 Ga0265327_10001090 3300031251 Bacteria 37696
429 Ga0265327_10086302 3300031251 Bacteria 1540
430 Ga0307509_10024292 3300031507 Bacteria 6789
431 Ga0307509_10053210 3300031507 Bacteria 4318
432 Ga0307408_100000446 3300031548 Bacteria 36247
433 Ga0307408_100001168 3300031548 Bacteria 19919
434 Ga0307408_100007266 3300031548 Bacteria 7326
435 Ga0307408_100016837 3300031548 Bacteria 4886
436 Ga0307408_100020249 3300031548 Bacteria 4487
437 Ga0307408_100059801 3300031548 Bacteria 2775
438 Ga0307408_100437700 3300031548 Bacteria 1131
439 Ga0307514_10079272 3300031649 Bacteria 2435
440 Ga0307516_10402858 3300031730 Bacteria 1027
441 Ga0307405_10013073 3300031731 Bacteria 4417
442 Ga0307405_10054930 3300031731 Bacteria 2489
443 Ga0307405_10148814 3300031731 Bacteria 1643
444 Ga0307405_10151225 3300031731 Bacteria 1632
445 Ga0307518_10033465 3300031838 Bacteria 3729
446 Ga0307406_10000864 3300031901 Bacteria 17063
447 Ga0307412_10011951 3300031911 Bacteria 5044
448 Ga0307412_10018730 3300031911 Bacteria 4174
449 Ga0307409_100519646 3300031995 Bacteria 1163
450 Ga0307409_100535803 3300031995 Bacteria 1147
451 Ga0307416_100306418 3300032002 Bacteria 1582
452 Ga0307416_100736897 3300032002 Bacteria 1077
453 Ga0307416_101157029 3300032002 Bacteria 879
454 Ga0307414_10175610 3300032004 Bacteria 1717
455 Ga0307414_10268447 3300032004 Bacteria 1427
456 Ga0307414_10520637 3300032004 Bacteria 1055
457 Ga0307414_10729228 3300032004 Bacteria 899
458 Ga0307414_10736711 3300032004 Bacteria 895
459 Ga0307411_10193180 3300032005 Bacteria 1556
460 Ga0373952_0000147 3300035092 Bacteria 10390
461 Ga0373923_0083176 3300035111 Bacteria 1391
462 Ga0373942_0006206 3300035207 Bacteria 2760
463 Ga0373931_0061724 3300035691 Bacteria 2022
464 Ga0373931_0152738 3300035691 Bacteria 1347
465 Ga0395899_0000028 3300037312 Bacteria 334378
466 Ga0395899_0080247 3300037312 Bacteria 2375
467 Ga0395899_0115663 3300037312 Bacteria 1925
468 Ga0395899_0235483 3300037312 Bacteria 1262
469 Ga0395899_0355033 3300037312 Bacteria 979
470 Ga0395900_0004850 3300037418 Bacteria 14170
471 Ga0395900_0164294 3300037418 Bacteria 2263
472 Ga0395900_0374743 3300037418 Bacteria 1392
473 Ga0395900_0745979 3300037418 Bacteria 909
474 Ga0395898_0019113 3300037466 Bacteria 6975
475 Ga0395898_0028733 3300037466 Bacteria 5573
476 Ga0395898_0098824 3300037466 Bacteria 2802
477 Ga0395898_0161107 3300037466 Bacteria 2146
478 Ga0395898_0251897 3300037466 Bacteria 1684
479 Ga0395898_0620781 3300037466 Bacteria 1024
480 Ga0395905_0000811 3300037471 Bacteria 41049
481 Ga0395905_0001473 3300037471 Bacteria 28215
482 Ga0395905_0009721 3300037471 Bacteria 9384
483 Ga0395905_0015426 3300037471 Bacteria 7263
484 Ga0395905_0033102 3300037471 Bacteria 4858
485 Ga0395905_0052461 3300037471 Bacteria 3817
486 Ga0395905_0059933 3300037471 Bacteria 3558
487 Ga0395905_0095398 3300037471 Bacteria 2791
488 Ga0395905_0181281 3300037471 Bacteria 1977
489 Ga0395905_0304829 3300037471 Bacteria 1480
490 Ga0436364_1478795 3300037853 Bacteria 2908
491 Ga0395901_0000551 3300038443 Bacteria 43296
492 Ga0395901_0014806 3300038443 Bacteria 7925
493 Ga0395901_0017358 3300038443 Bacteria 7347
494 Ga0395901_0046520 3300038443 Bacteria 4507
495 Ga0395901_0058900 3300038443 Bacteria 3996
496 Ga0395901_0064151 3300038443 Bacteria 3823
497 Ga0395901_0263219 3300038443 Bacteria 1794
498 Ga0395901_0679437 3300038443 Bacteria 1029
499 Ga0400489_70414 3300039093 Bacteria 1726
500 Ga0436361_0065895 3300039447 Bacteria 15338
501 Ga0436361_0082864 3300039447 Bacteria 107951
502 Ga0436361_0195300 3300039447 Bacteria 3490
503 Ga0436361_0283051 3300039447 Bacteria 6926
504 Ga0436361_0349482 3300039447 Bacteria 149171
505 Ga0436361_0412881 3300039447 Bacteria 12400
506 Ga0436361_0570400 3300039447 Bacteria 111725
507 Ga0436361_0669746 3300039447 Bacteria 73604
508 Ga0436361_0715105 3300039447 Bacteria 7706
509 Ga0436361_0755903 3300039447 Bacteria 56394
510 Ga0436361_0921993 3300039447 Bacteria 2576
511 Ga0436361_1084239 3300039447 Bacteria 8504
512 Ga0439436_0000333 3300041404 Bacteria 11611
513 Ga0439439_0025307 3300041406 Bacteria 1493
514 Ga0439447_030509 3300041407 Bacteria 1358
515 Ga0439461_0001234 3300041410 Bacteria 3901
516 Ga0439466_0005348 3300041411 Bacteria 4909
517 Ga0439466_0008119 3300041411 Bacteria 3957
518 Ga0439466_0035279 3300041411 Bacteria 1692
519 Ga0439465_0000072 3300041413 Bacteria 22229
520 Ga0439465_0013050 3300041413 Bacteria 2595
521 Ga0451789_0279339 3300041443 Bacteria 747
522 Ga0451841_1018191 3300041498 Bacteria 2305
523 Ga0439431_0000235 3300041997 Bacteria 11239
524 Ga0439433_0000055 3300041999 Bacteria 13711
525 Ga0439442_003249 3300042002 Bacteria 3212
526 Ga0439442_024288 3300042002 Bacteria 1260
527 Ga0439442_053096 3300042002 Bacteria 856
528 Ga0439445_0000190 3300042004 Bacteria 11147
529 Ga0439448_0001453 3300042005 Bacteria 6137
530 Ga0439448_0126644 3300042005 Bacteria 878
531 Ga0439432_003056 3300042006 Bacteria 6229
532 Ga0439432_016046 3300042006 Bacteria 2523
533 Ga0439449_0000135 3300042007 Bacteria 24942
534 Ga0439449_0000254 3300042007 Bacteria 19110
535 Ga0439449_0008857 3300042007 Bacteria 3818
536 Ga0439449_0033848 3300042007 Bacteria 1903
537 Ga0439452_003187 3300042010 Bacteria 5805
538 Ga0439455_0007915 3300042012 Bacteria 2264
539 Ga0439457_004905 3300042014 Bacteria 3428
540 Ga0439457_025642 3300042014 Bacteria 1304
541 Ga0439462_0007285 3300042015 Bacteria 2765
542 Ga0450920_009948 3300042122 Bacteria 1758
543 Ga0450920_046904 3300042122 Bacteria 864
544 Ga0450923_012604 3300042125 Bacteria 1541
545 Ga0450897_000764 3300042128 Bacteria 1939
546 Ga0450894_001622 3300042131 Bacteria 3177
547 Ga0450899_005005 3300042135 Bacteria 1422
548 Ga0450899_005406 3300042135 Bacteria 1372
549 Ga0450904_000042 3300042139 Bacteria 28290
550 Ga0450906_004361 3300042145 Bacteria 2966
551 Ga0450910_011646 3300042147 Bacteria 1263
552 Ga0439446_0000384 3300042156 Bacteria 8495
553 Ga0450908_000283 3300042184 Bacteria 10062
554 Ga0450908_003570 3300042184 Bacteria 3029
555 Ga0450909_007295 3300042185 Bacteria 1598
556 Ga0439434_0011099 3300042435 Bacteria 2661
557 Ga0439434_0016719 3300042435 Bacteria 2192
558 Ga0439434_0017421 3300042435 Bacteria 2150
559 Ga0439459_0002257 3300042438 Bacteria 2954
560 Ga0450918_011672 3300042531 Bacteria 1530
561 Ga0451577_0010581 3300042876 Bacteria 8798
562 Ga0451577_0309719 3300042876 Bacteria 1431
563 Ga0466969_0009184 3300044656 Bacteria 5242
564 Ga0466969_0069770 3300044656 Bacteria 1691
565 Ga0466969_0215674 3300044656 Bacteria 873
566 Ga0453683_0002793 3300044673 Bacteria 13286
567 Ga0466965_0009285 3300044683 Bacteria 4570
568 Ga0466965_0017289 3300044683 Bacteria 3445
569 Ga0466965_0020808 3300044683 Bacteria 3157
570 Ga0466965_0021204 3300044683 Bacteria 3126
571 Ga0466965_0139809 3300044683 Bacteria 1260
572 Ga0466966_0003089 3300044684 Bacteria 10969
573 Ga0466966_0012809 3300044684 Bacteria 5555
574 Ga0466966_0216260 3300044684 Bacteria 1157
575 Ga0466961_0000186 3300044693 Bacteria 41739
576 Ga0466961_0130891 3300044693 Bacteria 1572
577 Ga0466963_0227398 3300044694 Bacteria 1307
578 Ga0466963_0464526 3300044694 Bacteria 893
579 Ga0466964_0000976 3300044706 Bacteria 9479
580 Ga0466964_0001673 3300044706 Bacteria 7652
581 Ga0453684_0207653 3300044712 Bacteria 2278
582 Ga0466971_0226662 3300044719 Bacteria 886
583 Ga0466968_0189887 3300044735 Bacteria 958
584 Ga0466970_0069538 3300044765 Bacteria 1893
585 Ga0466960_0066633 3300044901 Bacteria 1781
586 Ga0466959_0019572 3300045049 Bacteria 4978
587 Ga0466959_0095938 3300045049 Bacteria 2126
588 Ga0451576_0008365 3300045051 Bacteria 12151
589 Ga0451576_0040933 3300045051 Bacteria 4899
590 Ga0451576_0383934 3300045051 Bacteria 1472
591 Ga0451576_1294922 3300045051 Bacteria 760
592 Ga0466958_0070050 3300045836 Bacteria 2145
593 Ga0466958_0190510 3300045836 Bacteria 1303
594 Ga0466967_0095348 3300045976 Bacteria 2711
595 Ga0466967_0134591 3300045976 Bacteria 2298
596 Ga0495617_000006 3300046452 Bacteria 398279
597 Ga0495617_000008 3300046452 Bacteria 340369
598 Ga0495617_000181 3300046452 Bacteria 39863
599 Ga0495617_003640 3300046452 Bacteria 5747
600 Ga0495627_000005 3300046453 Bacteria 630805
601 Ga0495627_000191 3300046453 Bacteria 67637
602 Ga0495627_010430 3300046453 Bacteria 3377
603 Ga0495627_012527 3300046453 Bacteria 3005
604 Ga0495627_013199 3300046453 Bacteria 2911
605 Ga0495627_022723 3300046453 Bacteria 2060
606 Ga0495627_030465 3300046453 Bacteria 1709
607 Ga0495603_0013530 3300046455 Bacteria 4935
608 Ga0495603_0035438 3300046455 Bacteria 2997
609 Ga0495603_0330373 3300046455 Bacteria 875
610 Ga0495590_0000003 3300046457 Bacteria 478593
611 Ga0495590_0000017 3300046457 Bacteria 216944
612 Ga0495590_0004143 3300046457 Bacteria 5875
613 Ga0495590_0004512 3300046457 Bacteria 5615
614 Ga0495590_0006026 3300046457 Bacteria 4755
615 Ga0495590_0038510 3300046457 Bacteria 1667
616 Ga0495590_0205310 3300046457 Bacteria 725
617 Ga0495591_000091 3300046458 Bacteria 101618
618 Ga0495591_010708 3300046458 Bacteria 3529
619 Ga0495629_0015125 3300046459 Bacteria 5546
620 Ga0495629_0114108 3300046459 Bacteria 1883
621 Ga0495638_0000118 3300046460 Bacteria 127657
622 Ga0495638_0001982 3300046460 Bacteria 17487
623 Ga0495638_0002148 3300046460 Bacteria 16553
624 Ga0495638_0030426 3300046460 Bacteria 3476
625 Ga0495638_0033813 3300046460 Bacteria 3267
626 Ga0495638_0041204 3300046460 Bacteria 2923
627 Ga0495638_0067056 3300046460 Bacteria 2204
628 Ga0495638_0363337 3300046460 Bacteria 761
629 Ga0495653_0006483 3300046463 Bacteria 9596
630 Ga0495653_0208964 3300046463 Bacteria 1319
631 Ga0495653_0210188 3300046463 Bacteria 1314
632 Ga0495650_0000015 3300046471 Bacteria 557595
633 Ga0495650_0000131 3300046471 Bacteria 174698
634 Ga0495650_0000147 3300046471 Bacteria 160862
635 Ga0495650_0000189 3300046471 Bacteria 133931
636 Ga0495650_0000195 3300046471 Bacteria 131338
637 Ga0495650_0000339 3300046471 Bacteria 83278
638 Ga0495650_0004295 3300046471 Bacteria 9840
639 Ga0495650_0009310 3300046471 Bacteria 5599
640 Ga0495650_0018881 3300046471 Bacteria 3414
641 Ga0495650_0079380 3300046471 Bacteria 1269
642 Ga0495580_0051138 3300046472 Bacteria 2921
643 Ga0495580_0158398 3300046472 Bacteria 1567
644 Ga0495582_0003229 3300046473 Bacteria 9156
645 Ga0495582_0226020 3300046473 Bacteria 1071
646 Ga0495605_0000003 3300046474 Bacteria 491502
647 Ga0495605_0000083 3300046474 Bacteria 124953
648 Ga0495605_0000184 3300046474 Bacteria 77694
649 Ga0495605_0000949 3300046474 Bacteria 19773
650 Ga0495605_0007708 3300046474 Bacteria 6101
651 Ga0495605_0026781 3300046474 Bacteria 2993
652 Ga0495605_0049067 3300046474 Bacteria 2063
653 Ga0495605_0067073 3300046474 Bacteria 1703
654 Ga0495605_0089617 3300046474 Bacteria 1427
655 Ga0495605_0267568 3300046474 Bacteria 728
656 Ga0495639_0002216 3300046475 Bacteria 8552
657 Ga0495639_0087599 3300046475 Bacteria 1457
658 Ga0495584_0000008 3300046491 Bacteria 283067
659 Ga0495584_0001294 3300046491 Bacteria 15218
660 Ga0495584_0002379 3300046491 Bacteria 10693
661 Ga0495584_0002758 3300046491 Bacteria 9816
662 Ga0495584_0003880 3300046491 Bacteria 8101
663 Ga0495584_0017677 3300046491 Bacteria 3628
664 Ga0495584_0018378 3300046491 Bacteria 3552
665 Ga0495584_0027667 3300046491 Bacteria 2873
666 Ga0495584_0058171 3300046491 Bacteria 1945
667 Ga0495584_0100945 3300046491 Bacteria 1458
668 Ga0495584_0153509 3300046491 Bacteria 1170
669 Ga0495585_0000159 3300046492 Bacteria 72318
670 Ga0495585_0001407 3300046492 Bacteria 18938
671 Ga0495585_0001639 3300046492 Bacteria 17119
672 Ga0495585_0002634 3300046492 Bacteria 12641
673 Ga0495585_0004935 3300046492 Bacteria 8530
674 Ga0495585_0032368 3300046492 Bacteria 2962
675 Ga0495585_0032785 3300046492 Bacteria 2941
676 Ga0495585_0041693 3300046492 Bacteria 2573
677 Ga0495585_0072070 3300046492 Bacteria 1882
678 Ga0495585_0082731 3300046492 Bacteria 1737
679 Ga0495585_0083832 3300046492 Bacteria 1724
680 Ga0495585_0135422 3300046492 Bacteria 1293
681 Ga0495585_0307753 3300046492 Bacteria 777
682 Ga0495594_0003660 3300046499 Bacteria 7899
683 Ga0495594_0005566 3300046499 Bacteria 6470
684 Ga0495594_0022332 3300046499 Bacteria 3384
685 Ga0495594_0027830 3300046499 Bacteria 3047
686 Ga0495596_0004495 3300046500 Bacteria 6779
687 Ga0495596_0007196 3300046500 Bacteria 5036
688 Ga0495596_0012957 3300046500 Bacteria 3551
689 Ga0495596_0015118 3300046500 Bacteria 3240
690 Ga0495596_0038447 3300046500 Bacteria 1891
691 Ga0495596_0042390 3300046500 Bacteria 1793
692 Ga0495607_0000982 3300046501 Bacteria 26451
693 Ga0495607_0001248 3300046501 Bacteria 22826
694 Ga0495607_0002566 3300046501 Bacteria 14673
695 Ga0495607_0003301 3300046501 Bacteria 12394
696 Ga0495607_0004635 3300046501 Bacteria 10066
697 Ga0495607_0007891 3300046501 Bacteria 7320
698 Ga0495607_0013444 3300046501 Bacteria 5363
699 Ga0495607_0032846 3300046501 Bacteria 3163
700 Ga0495607_0077550 3300046501 Bacteria 1835
701 Ga0495607_0089104 3300046501 Bacteria 1675
702 Ga0495583_0000026 3300046506 Bacteria 256777
703 Ga0495583_0000049 3300046506 Bacteria 216069
704 Ga0495583_0000079 3300046506 Bacteria 169681
705 Ga0495583_0000165 3300046506 Bacteria 111940
706 Ga0495583_0000301 3300046506 Bacteria 78482
707 Ga0495583_0000615 3300046506 Bacteria 48092
708 Ga0495583_0001880 3300046506 Bacteria 19520
709 Ga0495583_0003090 3300046506 Bacteria 13174
710 Ga0495583_0004713 3300046506 Bacteria 9594
711 Ga0495583_0018084 3300046506 Bacteria 3722
712 Ga0495583_0022172 3300046506 Bacteria 3247
713 Ga0495583_0027765 3300046506 Bacteria 2789
714 Ga0495583_0028432 3300046506 Bacteria 2748
715 Ga0495583_0035623 3300046506 Bacteria 2374
716 Ga0495583_0038010 3300046506 Bacteria 2277
717 Ga0495583_0091099 3300046506 Bacteria 1312
718 Ga0495606_0000068 3300046507 Bacteria 179653
719 Ga0495606_0000185 3300046507 Bacteria 109977
720 Ga0495606_0000345 3300046507 Bacteria 79767
721 Ga0495606_0000650 3300046507 Bacteria 54709
722 Ga0495606_0001149 3300046507 Bacteria 37553
723 Ga0495606_0001239 3300046507 Bacteria 35637
724 Ga0495606_0002011 3300046507 Bacteria 24980
725 Ga0495606_0002106 3300046507 Bacteria 24222
726 Ga0495606_0004703 3300046507 Bacteria 13468
727 Ga0495606_0008579 3300046507 Bacteria 8843
728 Ga0495606_0025046 3300046507 Bacteria 4282
729 Ga0495606_0049582 3300046507 Bacteria 2752
730 Ga0495606_0050580 3300046507 Bacteria 2717
731 Ga0495606_0062167 3300046507 Bacteria 2385
732 Ga0495606_0090506 3300046507 Bacteria 1883
733 Ga0495610_0000004 3300046512 Bacteria 1006135
734 Ga0495610_0001058 3300046512 Bacteria 25288
735 Ga0495610_0001361 3300046512 Bacteria 21713
736 Ga0495610_0003372 3300046512 Bacteria 12502
737 Ga0495610_0016743 3300046512 Bacteria 4208
738 Ga0495610_0017601 3300046512 Bacteria 4068
739 Ga0495610_0041930 3300046512 Bacteria 2293
740 Ga0495610_0076209 3300046512 Bacteria 1551
741 Ga0495610_0090970 3300046512 Bacteria 1383
742 Ga0495616_0000042 3300046513 Bacteria 120923
743 Ga0495616_0000395 3300046513 Bacteria 33694
744 Ga0495616_0000694 3300046513 Bacteria 24922
745 Ga0495616_0002414 3300046513 Bacteria 12434
746 Ga0495616_0004085 3300046513 Bacteria 9263
747 Ga0495616_0030515 3300046513 Bacteria 2833
748 Ga0495616_0042107 3300046513 Bacteria 2326
749 Ga0495616_0059779 3300046513 Bacteria 1873
750 Ga0495616_0089833 3300046513 Bacteria 1456
751 Ga0495616_0102929 3300046513 Bacteria 1337
752 Ga0495616_0110476 3300046513 Bacteria 1277
753 Ga0495620_0005295 3300046515 Bacteria 7215
754 Ga0495620_0173030 3300046515 Bacteria 836
755 Ga0495630_0090599 3300046517 Bacteria 2310
756 Ga0495630_0117029 3300046517 Bacteria 2020
757 Ga0495631_0000228 3300046518 Bacteria 38440
758 Ga0495631_0001731 3300046518 Bacteria 12966
759 Ga0495631_0004132 3300046518 Bacteria 7787
760 Ga0495631_0010178 3300046518 Bacteria 4665
761 Ga0495631_0016503 3300046518 Bacteria 3518
762 Ga0495631_0043813 3300046518 Bacteria 1973
763 Ga0495631_0069145 3300046518 Bacteria 1527
764 Ga0495631_0080908 3300046518 Bacteria 1401
765 Ga0495632_0000065 3300046519 Bacteria 116086
766 Ga0495632_0000155 3300046519 Bacteria 70814
767 Ga0495632_0000476 3300046519 Bacteria 38017
768 Ga0495632_0000934 3300046519 Bacteria 25619
769 Ga0495632_0002365 3300046519 Bacteria 14429
770 Ga0495632_0018366 3300046519 Bacteria 3838
771 Ga0495632_0030965 3300046519 Bacteria 2771
772 Ga0495632_0059646 3300046519 Bacteria 1856
773 Ga0495632_0082038 3300046519 Bacteria 1537
774 Ga0495632_0126101 3300046519 Bacteria 1193
775 Ga0495637_0000281 3300046520 Bacteria 39852
776 Ga0495637_0001371 3300046520 Bacteria 14609
777 Ga0495637_0005539 3300046520 Bacteria 6411
778 Ga0495637_0006672 3300046520 Bacteria 5780
779 Ga0495637_0009184 3300046520 Bacteria 4826
780 Ga0495637_0033017 3300046520 Bacteria 2276
781 Ga0495637_0046202 3300046520 Bacteria 1843
782 Ga0495643_0000106 3300046522 Bacteria 138657
783 Ga0495643_0000417 3300046522 Bacteria 55799
784 Ga0495643_0000653 3300046522 Bacteria 41007
785 Ga0495643_0000792 3300046522 Bacteria 35101
786 Ga0495643_0000798 3300046522 Bacteria 34846
787 Ga0495643_0003931 3300046522 Bacteria 10645
788 Ga0495643_0018930 3300046522 Bacteria 3988
789 Ga0495643_0042824 3300046522 Bacteria 2465
790 Ga0495643_0044883 3300046522 Bacteria 2400
791 Ga0495643_0076345 3300046522 Bacteria 1752
792 Ga0495643_0086747 3300046522 Bacteria 1621
793 Ga0495644_0001181 3300046523 Bacteria 10694
794 Ga0495644_0002400 3300046523 Bacteria 7474
795 Ga0495644_0010071 3300046523 Bacteria 3642
796 Ga0495644_0011983 3300046523 Bacteria 3331
797 Ga0495644_0012194 3300046523 Bacteria 3304
798 Ga0495644_0048526 3300046523 Bacteria 1594
799 Ga0495644_0061910 3300046523 Bacteria 1406
800 Ga0495644_0215599 3300046523 Bacteria 741
801 Ga0495648_0000055 3300046524 Bacteria 158686
802 Ga0495648_0000070 3300046524 Bacteria 136680
803 Ga0495648_0000807 3300046524 Bacteria 33208
804 Ga0495648_0001050 3300046524 Bacteria 28021
805 Ga0495648_0001715 3300046524 Bacteria 21171
806 Ga0495648_0001752 3300046524 Bacteria 20979
807 Ga0495648_0007473 3300046524 Bacteria 8739
808 Ga0495648_0012736 3300046524 Bacteria 6249
809 Ga0495648_0019149 3300046524 Bacteria 4825
810 Ga0495648_0022274 3300046524 Bacteria 4365
811 Ga0495648_0025287 3300046524 Bacteria 4022
812 Ga0495648_0027763 3300046524 Bacteria 3783
813 Ga0495648_0049531 3300046524 Bacteria 2574
814 Ga0495648_0061393 3300046524 Bacteria 2232
815 Ga0495663_0004309 3300046525 Bacteria 4009
816 Ga0495663_0007498 3300046525 Bacteria 3017
817 Ga0495663_0059277 3300046525 Bacteria 1201
818 Ga0495663_0083624 3300046525 Bacteria 1031
819 Ga0495666_0000191 3300046526 Bacteria 26321
820 Ga0495666_0009730 3300046526 Bacteria 4804
821 Ga0495666_0017781 3300046526 Bacteria 3540
822 Ga0495666_0111281 3300046526 Bacteria 1286
823 Ga0495642_0000376 3300046528 Bacteria 24226
824 Ga0495642_0004461 3300046528 Bacteria 5431
825 Ga0495642_0006415 3300046528 Bacteria 4512
826 Ga0495642_0007548 3300046528 Bacteria 4166
827 Ga0495642_0013474 3300046528 Bacteria 3162
828 Ga0495642_0014314 3300046528 Bacteria 3073
829 Ga0495642_0016642 3300046528 Bacteria 2868
830 Ga0495642_0044172 3300046528 Bacteria 1818
831 Ga0495642_0051328 3300046528 Bacteria 1696
832 Ga0495642_0059104 3300046528 Bacteria 1588
833 Ga0495642_0063647 3300046528 Bacteria 1533
834 Ga0495642_0065624 3300046528 Bacteria 1511
835 Ga0495642_0088016 3300046528 Bacteria 1312
836 Ga0495652_0007892 3300046529 Bacteria 9772
837 Ga0495652_0086558 3300046529 Bacteria 2572
838 Ga0495654_0000035 3300046530 Bacteria 192768
839 Ga0495654_0002939 3300046530 Bacteria 10669
840 Ga0495654_0007918 3300046530 Bacteria 5908
841 Ga0495654_0021948 3300046530 Bacteria 3319
842 Ga0495654_0025901 3300046530 Bacteria 3020
843 Ga0495654_0054915 3300046530 Bacteria 1930
844 Ga0495654_0127670 3300046530 Bacteria 1144
845 Ga0495665_0000579 3300046531 Bacteria 18637
846 Ga0495665_0058964 3300046531 Bacteria 2026
847 Ga0495586_0015584 3300046535 Bacteria 4044
848 Ga0495586_0074212 3300046535 Bacteria 1861
849 Ga0495609_0000002 3300046538 Bacteria 739816
850 Ga0495609_0002255 3300046538 Bacteria 12026
851 Ga0495609_0003201 3300046538 Bacteria 9510
852 Ga0495609_0005670 3300046538 Bacteria 6500
853 Ga0495609_0009486 3300046538 Bacteria 4707
854 Ga0495609_0020559 3300046538 Bacteria 3049
855 Ga0495609_0035605 3300046538 Bacteria 2252
856 Ga0495609_0035737 3300046538 Bacteria 2247
857 Ga0495609_0066770 3300046538 Bacteria 1584
858 Ga0495609_0076781 3300046538 Bacteria 1463
859 Ga0495609_0094363 3300046538 Bacteria 1299
860 Ga0495609_0175104 3300046538 Bacteria 904
861 Ga0495621_0004628 3300046539 Bacteria 3889
862 Ga0495621_0023711 3300046539 Bacteria 2043
863 Ga0495621_0052958 3300046539 Bacteria 1456
864 Ga0495597_0000656 3300046542 Bacteria 28086
865 Ga0495597_0000770 3300046542 Bacteria 25349
866 Ga0495597_0001497 3300046542 Bacteria 16714
867 Ga0495597_0006143 3300046542 Bacteria 6247
868 Ga0495597_0006807 3300046542 Bacteria 5876
869 Ga0495597_0019166 3300046542 Bacteria 3203
870 Ga0495597_0020596 3300046542 Bacteria 3070
871 Ga0495597_0024339 3300046542 Bacteria 2796
872 Ga0495597_0247375 3300046542 Bacteria 701
873 Ga0495645_0018376 3300046543 Bacteria 5019
874 Ga0495645_0247881 3300046543 Bacteria 1185
875 Ga0495622_0001144 3300046557 Bacteria 13830
876 Ga0495622_0002556 3300046557 Bacteria 8793
877 Ga0495622_0030061 3300046557 Bacteria 2538
878 Ga0495622_0034568 3300046557 Bacteria 2358
879 Ga0495622_0062496 3300046557 Bacteria 1723
880 Ga0495633_0000164 3300046558 Bacteria 87086
881 Ga0495633_0001230 3300046558 Bacteria 20537
882 Ga0495633_0004437 3300046558 Bacteria 8929
883 Ga0495633_0014037 3300046558 Bacteria 4200
884 Ga0495633_0021203 3300046558 Bacteria 3252
885 Ga0495633_0021768 3300046558 Bacteria 3201
886 Ga0495633_0030004 3300046558 Bacteria 2643
887 Ga0495633_0078254 3300046558 Bacteria 1539
888 Ga0495633_0130031 3300046558 Bacteria 1165
889 Ga0495667_0062092 3300046559 Bacteria 2449
890 Ga0495656_0000184 3300046615 Bacteria 22413
891 Ga0495656_0039298 3300046615 Bacteria 1964
892 Ga0495656_0039929 3300046615 Bacteria 1953
893 Ga0495656_0059687 3300046615 Bacteria 1660
894 Ga0495656_0161458 3300046615 Bacteria 1089
895 Ga0495656_0246771 3300046615 Bacteria 901
896 Ga0495668_0000094 3300046616 Bacteria 141412
897 Ga0495668_0000104 3300046616 Bacteria 134968
898 Ga0495668_0000865 3300046616 Bacteria 34113
899 Ga0495668_0001664 3300046616 Bacteria 20682
900 Ga0495668_0002283 3300046616 Bacteria 16113
901 Ga0495668_0004387 3300046616 Bacteria 10054
902 Ga0495668_0011158 3300046616 Bacteria 5396
903 Ga0495668_0017455 3300046616 Bacteria 4161
904 Ga0495668_0020584 3300046616 Bacteria 3792
905 Ga0495668_0022941 3300046616 Bacteria 3564
906 Ga0495668_0024814 3300046616 Bacteria 3409
907 Ga0495668_0093216 3300046616 Bacteria 1649
908 Ga0495668_0173644 3300046616 Bacteria 1181
909 Ga0495634_0030606 3300046642 Bacteria 3716
910 Ga0495611_0000157 3300046648 Bacteria 48892
911 Ga0495611_0002084 3300046648 Bacteria 9400
912 Ga0495611_0010425 3300046648 Bacteria 3932
913 Ga0495611_0018978 3300046648 Bacteria 2952
914 Ga0495611_0021596 3300046648 Bacteria 2780
915 Ga0495611_0207151 3300046648 Bacteria 914
916 Ga0495625_0000038 3300046660 Bacteria 211808
917 Ga0495625_0000044 3300046660 Bacteria 203855
918 Ga0495625_0000335 3300046660 Bacteria 71730
919 Ga0495625_0002328 3300046660 Bacteria 20765
920 Ga0495625_0010789 3300046660 Bacteria 7520
921 Ga0495625_0017421 3300046660 Bacteria 5625
922 Ga0495625_0026929 3300046660 Bacteria 4335
923 Ga0495625_0062562 3300046660 Bacteria 2630
924 Ga0495625_0080807 3300046660 Bacteria 2263
925 Ga0495625_0084238 3300046660 Bacteria 2208
926 Ga0495625_0095870 3300046660 Bacteria 2044
927 Ga0495625_0548477 3300046660 Bacteria 700
928 Ga0495625_0577945 3300046660 Bacteria 677
929 Ga0495635_0119065 3300046663 Bacteria 1802
930 Ga0495635_0221081 3300046663 Bacteria 1281
931 Ga0495635_0367416 3300046663 Bacteria 958
932 Ga0495659_0000204 3300046664 Bacteria 25590
933 Ga0495659_0004423 3300046664 Bacteria 4425
934 Ga0495659_0041718 3300046664 Bacteria 1640
935 Ga0495659_0115132 3300046664 Bacteria 1053
936 Ga0495661_0000149 3300046665 Bacteria 81455
937 Ga0495661_0001612 3300046665 Bacteria 18484
938 Ga0495661_0005402 3300046665 Bacteria 9085
939 Ga0495661_0008766 3300046665 Bacteria 6979
940 Ga0495661_0023769 3300046665 Bacteria 3974
941 Ga0495661_0031146 3300046665 Bacteria 3388
942 Ga0495661_0035738 3300046665 Bacteria 3115
943 Ga0495661_0048168 3300046665 Bacteria 2590
944 Ga0495661_0052068 3300046665 Bacteria 2468
945 Ga0495661_0066224 3300046665 Bacteria 2127
946 Ga0495661_0117579 3300046665 Bacteria 1472
947 Ga0495661_0258093 3300046665 Bacteria 886
948 Ga0495588_0000245 3300046674 Bacteria 45623
949 Ga0495588_0013099 3300046674 Bacteria 3942
950 Ga0495588_0019611 3300046674 Bacteria 3314
951 Ga0495588_0035055 3300046674 Bacteria 2541
952 Ga0495588_0043228 3300046674 Bacteria 2305
953 Ga0495588_0080913 3300046674 Bacteria 1695
954 Ga0495588_0084515 3300046674 Bacteria 1658
955 Ga0495588_0096530 3300046674 Bacteria 1550
956 Ga0495588_0117375 3300046674 Bacteria 1402
957 Ga0495588_0136152 3300046674 Bacteria 1296
958 Ga0495588_0232606 3300046674 Bacteria 972
959 Ga0495588_0295902 3300046674 Bacteria 852
960 Ga0495657_0314692 3300046675 Bacteria 931
961 Ga0495623_0037757 3300046679 Bacteria 3089
962 Ga0495623_0083346 3300046679 Bacteria 1975
963 Ga0495623_0088281 3300046679 Bacteria 1909
964 Ga0495623_0096875 3300046679 Bacteria 1802
965 Ga0495646_0057326 3300046680 Bacteria 2332
966 Ga0495646_0081104 3300046680 Bacteria 1891
967 Ga0495658_0185694 3300046683 Bacteria 1291
968 Ga0495669_0000108 3300046684 Bacteria 53418
969 Ga0495669_0002705 3300046684 Bacteria 7265
970 Ga0495669_0025697 3300046684 Bacteria 2569
971 Ga0495669_0076370 3300046684 Bacteria 1533
972 Ga0495669_0102761 3300046684 Bacteria 1328
973 Ga0495669_0241752 3300046684 Bacteria 866
974 Ga0495613_0018048 3300046689 Bacteria 5258
975 Ga0495613_0099291 3300046689 Bacteria 2103
976 Ga0495624_0200999 3300046690 Bacteria 1211
977 Ga0495670_0002374 3300046691 Bacteria 9265
978 Ga0495670_0002798 3300046691 Bacteria 8631
979 Ga0495670_0003871 3300046691 Bacteria 7351
980 Ga0495670_0034793 3300046691 Bacteria 2510
981 Ga0495670_0067909 3300046691 Bacteria 1800
982 Ga0495670_0082015 3300046691 Bacteria 1643
983 Ga0495670_0109148 3300046691 Bacteria 1430
984 Ga0495670_0299735 3300046691 Bacteria 861
985 Ga0495671_0000001 3300046692 Bacteria 1169494
986 Ga0495671_0000109 3300046692 Bacteria 74002
987 Ga0495671_0000228 3300046692 Bacteria 48268
988 Ga0495671_0004274 3300046692 Bacteria 8580
989 Ga0495671_0005357 3300046692 Bacteria 7528
990 Ga0495671_0027657 3300046692 Bacteria 2926
991 Ga0495671_0033851 3300046692 Bacteria 2601
992 Ga0495671_0082593 3300046692 Bacteria 1574
993 Ga0495649_0000326 3300046694 Bacteria 41384
994 Ga0495649_0003055 3300046694 Bacteria 11464
995 Ga0495649_0005429 3300046694 Bacteria 8110
996 Ga0495649_0007802 3300046694 Bacteria 6491
997 Ga0495649_0007839 3300046694 Bacteria 6466
998 Ga0495649_0024587 3300046694 Bacteria 3357
999 Ga0495649_0044443 3300046694 Bacteria 2425
1000 Ga0495649_0075295 3300046694 Bacteria 1808
1001 Ga0495649_0106332 3300046694 Bacteria 1489
1002 Ga0495649_0331830 3300046694 Bacteria 770
1003 Ga0495589_0000009 3300046794 Bacteria 256265
1004 Ga0495589_0000062 3300046794 Bacteria 104349
1005 Ga0495589_0000153 3300046794 Bacteria 63596
1006 Ga0495589_0009570 3300046794 Bacteria 5038
1007 Ga0495589_0010537 3300046794 Bacteria 4805
1008 Ga0495589_0024597 3300046794 Bacteria 3060
1009 Ga0495589_0040238 3300046794 Bacteria 2334
1010 Ga0495589_0070105 3300046794 Bacteria 1714
1011 Ga0495589_0113578 3300046794 Bacteria 1306
1012 Ga0495589_0180722 3300046794 Bacteria 1000
1013 Ga0495600_0023871 3300046809 Bacteria 3934
1014 Ga0495660_0000082 3300046810 Bacteria 101508
1015 Ga0495660_0000716 3300046810 Bacteria 25359
1016 Ga0495660_0001543 3300046810 Bacteria 15508
1017 Ga0495660_0009811 3300046810 Bacteria 5576
1018 Ga0495660_0014318 3300046810 Bacteria 4592
1019 Ga0495660_0045363 3300046810 Bacteria 2413
1020 Ga0495660_0049177 3300046810 Bacteria 2303
1021 Ga0495660_0064752 3300046810 Bacteria 1952
1022 Ga0495660_0065943 3300046810 Bacteria 1931
1023 Ga0495660_0078530 3300046810 Bacteria 1735
1024 Ga0495660_0185687 3300046810 Bacteria 1002
1025 Ga0495581_0091440 3300047315 Bacteria 1765
1026 Ga0495581_0104580 3300047315 Bacteria 1645
1027 Ga0495581_0154575 3300047315 Bacteria 1340
1028 Ga0495581_0320671 3300047315 Bacteria 905
1029 Ga0495604_0049360 3300047317 Bacteria 3270
1030 Ga0495604_0140406 3300047317 Bacteria 1726
1031 Ga0495636_0000379 3300047318 Bacteria 16746
1032 Ga0495636_0004307 3300047318 Bacteria 5585
1033 Ga0495636_0005717 3300047318 Bacteria 4874
1034 Ga0495636_0031241 3300047318 Bacteria 2182
1035 Ga0495636_0035538 3300047318 Bacteria 2052
1036 Ga0495636_0267941 3300047318 Bacteria 793
1037 Ga0495672_0000032 3300047320 Bacteria 295356
1038 Ga0495672_0000098 3300047320 Bacteria 141277
1039 Ga0495672_0000236 3300047320 Bacteria 78296
1040 Ga0495672_0000244 3300047320 Bacteria 76463
1041 Ga0495672_0000272 3300047320 Bacteria 71551
1042 Ga0495672_0000316 3300047320 Bacteria 64226
1043 Ga0495672_0001208 3300047320 Bacteria 26051
1044 Ga0495672_0011075 3300047320 Bacteria 6384
1045 Ga0495672_0018606 3300047320 Bacteria 4605
1046 Ga0495672_0061315 3300047320 Bacteria 2168
1047 Ga0495672_0154716 3300047320 Bacteria 1185
1048 Ga0495676_0000296 3300047321 Bacteria 40331
1049 Ga0495676_0014815 3300047321 Bacteria 6962
1050 Ga0495676_0016422 3300047321 Bacteria 6571
1051 Ga0495676_0020517 3300047321 Bacteria 5795
1052 Ga0495676_0110069 3300047321 Bacteria 2023
1053 Ga0495683_0000247 3300047323 Bacteria 48691
1054 Ga0495683_0000923 3300047323 Bacteria 20721
1055 Ga0495683_0002926 3300047323 Bacteria 10109
1056 Ga0495683_0003240 3300047323 Bacteria 9514
1057 Ga0495683_0003731 3300047323 Bacteria 8816
1058 Ga0495683_0005473 3300047323 Bacteria 7043
1059 Ga0495683_0038293 3300047323 Bacteria 2428
1060 Ga0495683_0065997 3300047323 Bacteria 1784
1061 Ga0495683_0092101 3300047323 Bacteria 1467
1062 Ga0495683_0095175 3300047323 Bacteria 1438
1063 Ga0495683_0165637 3300047323 Bacteria 1019
1064 Ga0495687_000013 3300047443 Bacteria 371058
1065 Ga0495687_000063 3300047443 Bacteria 169101
1066 Ga0495687_000064 3300047443 Bacteria 163468
1067 Ga0495687_000173 3300047443 Bacteria 95361
1068 Ga0495687_000589 3300047443 Bacteria 42402
1069 Ga0495687_000939 3300047443 Bacteria 30095
1070 Ga0495687_002034 3300047443 Bacteria 17090
1071 Ga0495675_0059301 3300047444 Bacteria 2426
1072 Ga0495677_0000043 3300047445 Bacteria 75056
1073 Ga0495677_0000610 3300047445 Bacteria 14617
1074 Ga0495677_0003220 3300047445 Bacteria 6368
1075 Ga0495677_0004191 3300047445 Bacteria 5560
1076 Ga0495677_0014151 3300047445 Bacteria 2906
1077 Ga0495677_0048616 3300047445 Bacteria 1558
1078 Ga0495677_0058386 3300047445 Bacteria 1427
1079 Ga0495677_0079406 3300047445 Bacteria 1228
1080 Ga0495677_0190687 3300047445 Bacteria 796
1081 Ga0495679_000520 3300047446 Bacteria 27232
1082 Ga0495679_019508 3300047446 Bacteria 2380
1083 Ga0495679_022687 3300047446 Bacteria 2144
1084 Ga0495679_027836 3300047446 Bacteria 1859
1085 Ga0495685_000027 3300047447 Bacteria 62875
1086 Ga0495685_035467 3300047447 Bacteria 1714
1087 Ga0495685_125215 3300047447 Bacteria 842
1088 Ga0495673_0000006 3300047469 Bacteria 908691
1089 Ga0495673_0000014 3300047469 Bacteria 599202
1090 Ga0495673_0000090 3300047469 Bacteria 188187
1091 Ga0495673_0020986 3300047469 Bacteria 3237
1092 Ga0495673_0037598 3300047469 Bacteria 2209
1093 Ga0495681_0000266 3300047470 Bacteria 41789
1094 Ga0495681_0000573 3300047470 Bacteria 28131
1095 Ga0495681_0002781 3300047470 Bacteria 12383
1096 Ga0495681_0008662 3300047470 Bacteria 6352
1097 Ga0495681_0008859 3300047470 Bacteria 6254
1098 Ga0495681_0018573 3300047470 Bacteria 3828
1099 Ga0495681_0072031 3300047470 Bacteria 1563
1100 Ga0495686_0000225 3300047472 Bacteria 104121
1101 Ga0495686_0000672 3300047472 Bacteria 46206
1102 Ga0495686_0001200 3300047472 Bacteria 29911
1103 Ga0495686_0001524 3300047472 Bacteria 24912
1104 Ga0495686_0002471 3300047472 Bacteria 17405
1105 Ga0495686_0007591 3300047472 Bacteria 8102
1106 Ga0495686_0023543 3300047472 Bacteria 4061
1107 Ga0495686_0067506 3300047472 Bacteria 2207
1108 Ga0495593_0007756 3300047673 Bacteria 6256
1109 Ga0495593_0016871 3300047673 Bacteria 4111
1110 Ga0495593_0048511 3300047673 Bacteria 2256
1111 Ga0495602_0006654 3300048088 Bacteria 12114
1112 Ga0495602_0069762 3300048088 Bacteria 3011
1113 Ga0495614_0004411 3300048089 Bacteria 6345
1114 Ga0495615_0003239 3300048090 Bacteria 2704
1115 Ga0495615_0017482 3300048090 Bacteria 1563
1116 Ga0495626_0000003 3300048091 Bacteria 427774
1117 Ga0495626_0000733 3300048091 Bacteria 30516
1118 Ga0495626_0001553 3300048091 Bacteria 18015
1119 Ga0495626_0002765 3300048091 Bacteria 11765
1120 Ga0495626_0003541 3300048091 Bacteria 9978
1121 Ga0495626_0006784 3300048091 Bacteria 6473
1122 Ga0495626_0008582 3300048091 Bacteria 5585
1123 Ga0495626_0008881 3300048091 Bacteria 5461
1124 Ga0495626_0010830 3300048091 Bacteria 4843
1125 Ga0495626_0016993 3300048091 Bacteria 3682
1126 Ga0495626_0017167 3300048091 Bacteria 3661
1127 Ga0495626_0024413 3300048091 Bacteria 2963
1128 Ga0495626_0040095 3300048091 Bacteria 2213
1129 Ga0495626_0042451 3300048091 Bacteria 2136
1130 Ga0495626_0051187 3300048091 Bacteria 1905
1131 Ga0495626_0062223 3300048091 Bacteria 1695
1132 Ga0495626_0091555 3300048091 Bacteria 1336
1133 Ga0495626_0144099 3300048091 Bacteria 1008
1134 Ga0495626_0146670 3300048091 Bacteria 997
1135 Ga0495626_0197094 3300048091 Bacteria 827
1136 Ga0496100_0130197 3300048903 Bacteria 1771
1137 Ga0496100_0193668 3300048903 Bacteria 1477
1138 Ga0496101_0003681 3300048904 Bacteria 9567
1139 Ga0496101_0056025 3300048904 Bacteria 2849
1140 Ga0496101_0099187 3300048904 Bacteria 2177
1141 Ga0496102_0000407 3300048905 Bacteria 49858
1142 Ga0496102_0001834 3300048905 Bacteria 18352
1143 Ga0496102_0012505 3300048905 Bacteria 7349
1144 Ga0496102_0032567 3300048905 Bacteria 4683
1145 Ga0496102_0097668 3300048905 Bacteria 2724
1146 Ga0496102_0694474 3300048905 Bacteria 940
1147 Ga0496102_0790248 3300048905 Bacteria 871
1148 Ga0496103_0092063 3300048906 Bacteria 1914
1149 Ga0496103_0145605 3300048906 Bacteria 1516
1150 Ga0496103_0456548 3300048906 Bacteria 819
1151 Ga0496104_0008803 3300048907 Bacteria 8972
1152 Ga0496104_0164681 3300048907 Bacteria 2126
1153 Ga0496104_0499747 3300048907 Bacteria 1127
1154 Ga0496105_0162220 3300048908 Bacteria 1835
1155 Ga0496106_0025756 3300048909 Bacteria 4377
1156 Ga0496106_0100786 3300048909 Bacteria 2240
1157 Ga0496107_0408106 3300048910 Bacteria 1010
1158 Ga0496108_0069677 3300048911 Bacteria 2968
1159 Ga0496108_0078438 3300048911 Bacteria 2795
1160 Ga0496108_0232757 3300048911 Bacteria 1602
1161 Ga0496109_0141910 3300048912 Bacteria 2246
1162 Ga0496109_0710623 3300048912 Bacteria 942
1163 Ga0496109_0749910 3300048912 Bacteria 914
1164 Ga0496110_0000226 3300048913 Bacteria 36613
1165 Ga0496110_0084403 3300048913 Bacteria 2834
1166 Ga0496111_0088022 3300048914 Bacteria 2274
1167 Ga0496112_0161737 3300048915 Bacteria 2205
1168 Ga0496112_1120245 3300048915 Bacteria 705
1169 Ga0496114_0009548 3300048917 Bacteria 7700
1170 Ga0496114_0398241 3300048917 Bacteria 1219
1171 Ga0496115_0037025 3300048918 Bacteria 3865
1172 Ga0496115_0550593 3300048918 Bacteria 922
1173 Ga0496116_0031449 3300048919 Bacteria 3799
1174 Ga0496116_0097897 3300048919 Bacteria 1762
1175 Ga0496116_0156966 3300048919 Bacteria 1254
1176 Ga0496116_0248871 3300048919 Bacteria 886
1177 Ga0496117_0011194 3300048920 Bacteria 8056
1178 Ga0496118_0005647 3300048921 Bacteria 14107
1179 Ga0496118_0043877 3300048921 Bacteria 3508
1180 Ga0496118_0176967 3300048921 Bacteria 1295
1181 Ga0496119_0299238 3300048922 Bacteria 794
1182 Ga0496121_0095753 3300048924 Bacteria 2306
1183 Ga0496121_0345531 3300048924 Bacteria 993
1184 Ga0496122_0000034 3300048925 Bacteria 320661
1185 Ga0496122_0000210 3300048925 Bacteria 130178
1186 Ga0496122_0001371 3300048925 Bacteria 39650
1187 Ga0496122_0023266 3300048925 Bacteria 5471
1188 Ga0496122_0052243 3300048925 Bacteria 3096
1189 Ga0496122_0182675 3300048925 Bacteria 1249
1190 Ga0496123_0000141 3300048926 Bacteria 147111
1191 Ga0496123_0000597 3300048926 Bacteria 61302
1192 Ga0496123_0007555 3300048926 Bacteria 10187
1193 Ga0496123_0009027 3300048926 Bacteria 9041
1194 Ga0496123_0134471 3300048926 Bacteria 1363
1195 Ga0496123_0243180 3300048926 Bacteria 892
1196 Ga0496124_0023549 3300048927 Bacteria 5620
1197 Ga0496124_0031199 3300048927 Bacteria 4721
1198 Ga0496124_0090641 3300048927 Bacteria 2493
1199 Ga0496124_0101386 3300048927 Bacteria 2332
1200 Ga0496124_0180977 3300048927 Bacteria 1622
1201 Ga0496124_0191340 3300048927 Bacteria 1565
1202 Ga0496124_0542426 3300048927 Bacteria 770
1203 Ga0496125_0000789 3300048928 Bacteria 51669
1204 Ga0496126_0027791 3300048929 Bacteria 5397
1205 Ga0496126_0293789 3300048929 Bacteria 1343
1206 Ga0496126_0503829 3300048929 Bacteria 967
1207 Ga0495678_000016 3300049459 Bacteria 303426
1208 Ga0495678_000153 3300049459 Bacteria 83461
1209 Ga0495678_000284 3300049459 Bacteria 55655
1210 Ga0495678_000330 3300049459 Bacteria 50079
1211 Ga0495678_001967 3300049459 Bacteria 14806
1212 Ga0495678_002471 3300049459 Bacteria 12478
1213 Ga0495678_008825 3300049459 Bacteria 5043
1214 Ga0495678_011714 3300049459 Bacteria 4187
1215 Ga0495678_012024 3300049459 Bacteria 4118
1216 Ga0495678_129640 3300049459 Bacteria 837
1217 Ga0495678_133239 3300049459 Bacteria 821
1218 Ga0495682_0005588 3300049460 Bacteria 5204
1219 Ga0495682_0014799 3300049460 Bacteria 2957
1220 Ga0495682_0021404 3300049460 Bacteria 2422
1221 Ga0495682_0162017 3300049460 Bacteria 796
1222 Ga0501313_001575 3300049529 Bacteria 2022
1223 Ga0501032_0397969 3300049569 Bacteria 885
1224 Ga0501032_0413007 3300049569 Bacteria 866
1225 Ga0501034_0044672 3300049571 Bacteria 4479
1226 Ga0501036_0035603 3300049572 Bacteria 4212
1227 Ga0501036_0332016 3300049572 Bacteria 1270
1228 Ga0501038_0194877 3300049574 Bacteria 1629
1229 Ga0501040_0110602 3300049576 Bacteria 1921
1230 Ga0501043_0000108 3300049579 Bacteria 77329
1231 Ga0501043_0292338 3300049579 Bacteria 1247
1232 Ga0501046_0000050 3300049580 Bacteria 134922
1233 Ga0501046_0155915 3300049580 Bacteria 1720
1234 Ga0501047_0000012 3300049581 Bacteria 368824
1235 Ga0501047_0222681 3300049581 Bacteria 1742
1236 Ga0501048_0000695 3300049582 Bacteria 24464
1237 Ga0501048_0229175 3300049582 Bacteria 1318
1238 Ga0501068_0086951 3300049584 Bacteria 1925
1239 Ga0501072_0016664 3300049588 Bacteria 5644
1240 Ga0501073_0192850 3300049589 Bacteria 1410
1241 Ga0501074_0649801 3300049590 Bacteria 745
1242 Ga0501222_009934 3300049662 Bacteria 1257
1243 Ga0501249_020799 3300049679 Bacteria 1429
1244 Ga0501225_0007229 3300049705 Bacteria 3223
1245 Ga0501080_0321235 3300049742 Bacteria 1401
1246 Ga0501080_0535524 3300049742 Bacteria 1044
1247 Ga0501081_0016309 3300049743 Bacteria 4910
1248 Ga0501241_019337 3300049758 Bacteria 1250
1249 Ga0501262_001175 3300049759 Bacteria 2965
1250 Ga0501269_000282 3300049766 Bacteria 14169
1251 Ga0501279_006907 3300049775 Bacteria 1503
1252 Ga0501044_0034715 3300049823 Bacteria 5287
1253 Ga0501045_0004835 3300049824 Bacteria 9319
1254 Ga0501045_0074503 3300049824 Bacteria 2499
1255 nmdc:mga03683_10301_c1 3300050489 Bacteria 3351
1256 nmdc:mga03683_3723_c1 3300050489 Bacteria 4970
1257 nmdc:mga03n38_34599_c1 3300050490 Bacteria 2159
1258 nmdc:mga00v17_1720_c1 3300050491 Bacteria 11368
1259 nmdc:mga0yw44_4298_c1 3300050492 Bacteria 6502
1260 nmdc:mga0yw44_9677_c1 3300050492 Bacteria 4892
1261 nmdc:mga0k408_129432_c1 3300050493 Bacteria 1498
1262 nmdc:mga0k408_20318_c1 3300050493 Bacteria 3719
1263 nmdc:mga0k408_2939_c1 3300050493 Bacteria 9034
1264 nmdc:mga0k408_36383_c1 3300050493 Bacteria 1785
1265 nmdc:mga0k408_36483_c1 3300050493 Bacteria 2822
1266 nmdc:mga0k408_4515_c2 3300050493 Bacteria 5258
1267 nmdc:mga07m45_185456_c1 3300050496 Bacteria 1210
1268 nmdc:mga07m45_611_c1 3300050496 Bacteria 15206
1269 nmdc:mga07m45_7294_c1 3300050496 Bacteria 5641
1270 nmdc:mga0n895_119263_c1 3300050512 Bacteria 2659
1271 nmdc:mga0rr50_217718_c1 3300050513 Bacteria 1576
1272 nmdc:mga08x19_2421_c1 3300050514 Bacteria 11326
1273 nmdc:mga0sz30_293882_c1 3300050516 Bacteria 724
1274 Ga0500610_0000863 3300053079 Bacteria 9710
1275 Ga0500610_0002219 3300053079 Bacteria 7031
1276 Ga0500610_0033809 3300053079 Bacteria 2612
1277 Ga0500578_0001334 3300053086 Bacteria 25244
1278 Ga0500643_004104 3300053087 Bacteria 6712
1279 Ga0500651_0000097 3300053093 Bacteria 53876
1280 Ga0500566_0041641 3300053094 Bacteria 2652
1281 Ga0500555_037566 3300053103 Bacteria 1356
1282 Ga0500562_110527 3300053108 Bacteria 749
1283 Ga0500571_000190 3300053110 Bacteria 22258
1284 Ga0500593_000202 3300053117 Bacteria 24296
1285 Ga0500594_0008916 3300053118 Bacteria 2298
1286 Ga0500607_000181 3300053121 Bacteria 56273
1287 Ga0500608_032284 3300053122 Bacteria 2487
1288 Ga0500608_098022 3300053122 Bacteria 1361
1289 Ga0500618_002212 3300053125 Bacteria 7606
1290 Ga0500626_010486 3300053128 Bacteria 3895
1291 Ga0500655_003364 3300053133 Bacteria 2893
1292 Ga0500658_0000521 3300053134 Bacteria 16260
1293 Ga0500658_0000753 3300053134 Bacteria 13371
1294 Ga0500559_0001463 3300053136 Bacteria 13371
1295 Ga0500559_0013536 3300053136 Bacteria 3452
1296 Ga0500559_0019274 3300053136 Bacteria 2883
1297 Ga0500564_035058 3300053138 Bacteria 2316
1298 Ga0500568_0002122 3300053139 Bacteria 11970
1299 Ga0500573_0039643 3300053140 Bacteria 2721
1300 Ga0500574_048069 3300053141 Bacteria 1211
1301 Ga0500604_0005739 3300053151 Bacteria 3279
1302 Ga0500619_098524 3300053154 Bacteria 991
1303 Ga0500627_0004369 3300053158 Bacteria 4530
1304 Ga0500634_0012204 3300053161 Bacteria 4466
1305 Ga0500634_0012879 3300053161 Bacteria 4369
1306 Ga0500634_0045507 3300053161 Bacteria 2374
1307 Ga0500636_0141804 3300053177 Bacteria 1329
1308 Ga0500636_0200247 3300053177 Bacteria 1057
1309 Ga0501084_0033108 3300054114 Bacteria 4323
1310 Ga0501082_0063318 3300060353 Bacteria 3184
1311 Ga0530510_0026313 3300061734 Bacteria 4163
1312 2509388073 2509276021 Bacteria 7634384
1313 2513229561 2513020051 Bacteria 6053213
1314 2548497730 2547132374 Bacteria 5530232
1315 2587725607 2585428057 Bacteria 6737412
1316 2599623552 2599185214 Bacteria 8209958
1317 2599671830 2599185226 Bacteria 8233575
1318 2599681157 2599185227 Bacteria 8246414
1319 2599693439 2599185229 Bacteria 8216126
1320 2643789083 2643221554 Bacteria 6603920
1321 2643798429 2643221556 Bacteria 7251154
1322 2643971207 2643221592 Bacteria 6608788
1323 2643990115 2643221596 Bacteria 5006805
1324 2644160722 2643221628 Bacteria 5745828
1325 2644213915 2643221638 Bacteria 6579467
1326 2644254033 2643221645 Bacteria 7207331
1327 2644327521 2643221658 Bacteria 6064537
1328 2644356802 2643221664 Bacteria 7272945
1329 2644401561 2643221672 Bacteria 6322190
1330 2644468078 2643221683 Bacteria 5749203
1331 2644475433 2643221684 Bacteria 7145183
1332 2644645138 2643221717 Bacteria 5676132
1333 2738717628 2738541277 Bacteria 7458140
1334 2738742011 2738541280 Bacteria 6630198
1335 2738747687 2738541281 Bacteria 5112672
1336 2738824949 2738541297 Bacteria 6549566
1337 2738844464 2738541300 Bacteria 6675882
1338 2738879243 2738541307 Bacteria 8606193
1339 2739148746 2738541357 Bacteria 6549408
1340 2739190665 2738543003 Bacteria 6549560
1341 2739248122 2738543013 Bacteria 5618633
1342 2739277042 2738543018 Bacteria 6718814
1343 2739278314 2738543019 Bacteria 7459457
1344 2739317142 2738543026 Bacteria 6549408
1345 2739335383 2738543029 Bacteria 6549249
1346 2739346017 2738543030 Bacteria 6719714
1347 2739356950 2738543032 Bacteria 5115625
1348 2809144845 2808606418 Bacteria 6724496
1349 2819597118 2818991446 Bacteria 7757362
1350 2831266237 2831265667 Bacteria 7184833
1351 2831864943 2831864461 Bacteria 6502356
1352 2838057653 2838054893 Bacteria 7451788
1353 2842368599 2842363717 Bacteria 6844742
1354 2842678929 2842677519 Bacteria 5615038
1355 2842699548 2842698319 Bacteria 5190321
1356 2842716834 2842711865 Bacteria 7155354
1357 2842735183 2842733646 Bacteria 5716726
1358 2842751073 2842747753 Bacteria 5578255
1359 2857553680 2857553236 Bacteria 6166726
1360 2857561233 2857558681 Bacteria 6617694
1361 2857565352 2857564685 Bacteria 6290584
1362 2885192392 2885192300 Bacteria 5882526
1363 2885204354 2885198086 Bacteria 7212419
1364 2885218007 2885211737 Bacteria 7212420
1365 2886851715 2886848708 Bacteria 5632523
1366 2899930141 2899924645 Bacteria 7487985
1367 2904426664 2904424332 Bacteria 7633521
1368 2904456186 2904449895 Bacteria 6927402
1369 2904457736 2904456579 Bacteria 6819253
1370 2904543476 2904541872 Bacteria 8915136
1371 2919467529 2919462493 Bacteria 5817112
1372 2919480306 2919476304 Bacteria 5888696
1373 2928039254 2928037797 Bacteria 7273642
1374 2928045141 2928044640 Bacteria 7271509
1375 2928052947 2928051484 Bacteria 7773759
1376 2928064382 2928064002 Bacteria 7419480
1377 2928071835 2928070936 Bacteria 8062541
1378 2928084228 2928084124 Bacteria 7159212
1379 2928116334 2928115317 Bacteria 6477646
1380 2929162989 2929160207 Bacteria 9075316
1381 2929527220 2929520902 Bacteria 6765052
1382 2945911459 2945909444 Bacteria 7065066
1383 2945947635 2945945610 Bacteria 5951079
1384 2945977502 2945972063 Bacteria 6086495
1385 2945986233 2945984333 Bacteria 7358892
1386 2954772521 2954767861 Bacteria 5535784
1387 2990711169 2990710928 Bacteria 5002431
1388 8047674276 8047673197 Bacteria 7395230
1389 8057161515 8057160832 Bacteria 3268302
1390 Ga0500622_0009139
1391 JGI24740J21852_10032511
1392 JGI25154J39366_1001311
1393 JGI25158J39367_1017892
1394 JGI25152J39213_1021523
1395 JGI25150J39212_1001139
1396 JGI25150J39212_1006853
1397 JGI25159J45721_1002152
1398 JGI25151J46595_10003411
1399 JGI25151J46595_10008465
1400 JGI25153J46596_10064191
1401 rootH1_10007233
1402 rootH2_10031368
1403 rootL2_10002108
1404 rootL2_10045051
1405 rootL2_10087294
1406 rootH1_10004227
1407 JGI25160J50197_1009062
1408 JGI25161J50226_1001836
1409 Ga0007417J51691_1007451
1410 Ga0007410J51695_1012132
1411 Ga0006562J51391_1043541
1412 Ga0006562J51391_1043542
1413 Ga0055525_1000011
1414 Ga0055525_1000073
1415 Ga0055535_1000364
1416 Ga0055542_1000114
1417 Ga0055529_1000208
1418 Ga0055526_1000077
1419 Ga0055526_1000094
1420 Ga0055526_1005930
1421 Ga0055526_1019641
1422 Ga0055526_1029088
1423 Ga0055537_1000484
1424 Ga0055537_1007829
1425 Ga0055524_1000007
1426 Ga0055524_1000334
1427 Ga0055524_1004119
1428 Ga0055524_1004131
1429 Ga0055524_1004645
1430 Ga0055524_1008878
1431 Ga0055536_1007729
1432 Ga0055534_1000406
1433 Ga0055534_1005715
1434 Ga0055528_1000813
1435 Ga0055528_1013114
1436 Ga0055528_1024492
1437 Ga0055530_10000777
1438 Ga0055530_10018320
1439 Ga0055540_1001349
1440 Ga0055540_1007393
1441 Ga0055540_1017711
1442 Ga0055531_10001441
1443 Ga0055531_10009422
1444 Ga0055543_1000748
1445 Ga0055543_1003842
1446 Ga0055543_1004175
1447 Ga0065165_1000006
1448 Ga0065165_1000094
1449 Ga0065165_1000230
1450 Ga0065165_1001757
1451 Ga0065165_1005587
1452 Ga0065165_1044083
1453 Ga0070658_10473481
1454 Ga0070676_10070202
1455 Ga0070670_100017063
1456 Ga0068869_100189670
1457 Ga0070680_100185989
1458 Ga0070660_100009975
1459 Ga0070660_100050280
1460 Ga0070689_100063108
1461 Ga0070661_100139450
1462 Ga0070669_100135351
1463 Ga0070675_100095515
1464 Ga0070675_100466587
1465 Ga0070674_100019524
1466 Ga0070674_100851233
1467 Ga0070674_101019359
1468 Ga0070673_100043327
1469 Ga0070673_100336762
1470 Ga0070659_100010185
1471 Ga0070659_100116362
1472 Ga0070659_100450851
1473 Ga0070667_100500683
1474 Ga0070714_100215054
1475 Ga0070713_100698833
1476 Ga0070678_100537024
1477 Ga0070662_100012605
1478 Ga0070681_10189700
1479 Ga0068867_100920952
1480 Ga0070698_100413980
1481 Ga0070679_100014542
1482 Ga0070679_100036197
1483 Ga0070679_100444670
1484 Ga0070697_100473017
1485 Ga0068853_100042996
1486 Ga0068853_100120354
1487 Ga0068853_100549350
1488 Ga0070672_100540710
1489 Ga0070693_100071609
1490 Ga0070665_100055825
1491 Ga0068855_100007205
1492 Ga0068855_100162276
1493 Ga0068855_100385629
1494 Ga0070664_100026610
1495 Ga0070664_100256320
1496 Ga0068857_100053870
1497 Ga0068857_100139021
1498 Ga0068854_100583919
1499 Ga0068852_100096885
1500 Ga0068852_100147171
1501 Ga0068852_100164392
1502 Ga0068851_10046197
1503 Ga0068858_100041447
1504 Ga0068862_100093797
1505 Ga0068862_100253613
1506 Ga0081539_10050675
1507 Ga0075365_10026402
1508 Ga0075365_10055877
1509 Ga0075365_10135617
1510 Ga0075363_100008149
1511 Ga0075363_100052055
1512 Ga0075362_10019634
1513 Ga0075362_10020895
1514 Ga0075362_10046340
1515 Ga0075367_10120451
1516 Ga0075367_10180060
1517 Ga0075369_10237729
1518 Ga0075369_10285862
1519 Ga0075366_10002796
1520 Ga0075366_10018902
1521 Ga0075366_10113145
1522 Ga0075366_10165338
1523 Ga0075366_10323073
1524 Ga0075370_10000200
1525 Ga0075370_10002669
1526 Ga0075370_10031904
1527 Ga0075370_10033873
1528 Ga0075370_10072254
1529 Ga0075370_10376921
1530 Ga0068871_100137347
1531 Ga0075431_100480821
1532 Ga0075434_100045544
1533 Ga0068865_100318757
1534 Ga0075436_100005826
1535 Ga0099823_1004022
1536 Ga0079104_1005131
1537 Ga0079104_1018383
1538 Ga0099826_10000003
1539 Ga0099826_10001182
1540 Ga0075435_100106252
1541 Ga0105244_10005211
1542 Ga0105244_10007865
1543 Ga0105244_10057774
1544 Ga0105240_10013928
1545 Ga0105240_10135868
1546 Ga0105240_10279076
1547 Ga0105245_10417428
1548 Ga0105245_10476637
1549 Ga0105245_10831844
1550 Ga0105243_10003393
1551 Ga0105243_10004657
1552 Ga0105243_10107021
1553 Ga0105243_10145657
1554 Ga0105241_10065294
1555 Ga0105242_10003383
1556 Ga0105242_10014082
1557 Ga0105242_10017712
1558 Ga0105242_10639476
1559 Ga0105248_10016344
1560 Ga0105248_10269634
1561 Ga0105237_10084896
1562 Ga0105238_10008824
1563 Ga0105238_10144266
1564 Ga0105238_10231255
1565 Ga0105238_11187362
1566 Ga0105249_10308991
1567 Ga0105239_10033491
1568 Ga0157319_1000012
1569 Ga0157373_10025544
1570 Ga0157373_10107377
1571 Ga0157371_10000001
1572 Ga0157371_10104225
1573 Ga0157370_10011376
1574 Ga0157370_10094025
1575 Ga0157370_10235209
1576 Ga0157370_10571025
1577 Ga0157369_10193073
1578 Ga0157378_10649905
1579 Ga0163162_10121755
1580 Ga0163162_10146915
1581 Ga0163162_10595176
1582 Ga0157375_10175896
1583 Ga0163163_10754812
1584 Ga0157380_10110521
1585 Ga0157380_10626639
1586 Ga0157380_10681473
1587 Ga0182008_10000893
1588 Ga0182008_10003192
1589 Ga0182008_10010607
1590 Ga0182008_10021377
1591 Ga0182008_10021606
1592 Ga0157379_10250271
1593 Ga0157379_10314606
1594 Ga0182006_1000021
1595 Ga0182006_1001088
1596 Ga0182006_1068286
1597 Ga0182007_10012859
1598 Ga0182007_10022091
1599 Ga0182007_10025460
1600 Ga0182007_10048705
1601 Ga0182005_1000020
1602 Ga0183362_10001
1603 Ga0163161_10000193
1604 Ga0163161_10282731
1605 Ga0213872_10000002
1606 Ga0213872_10000027
1607 Ga0213872_10000049
1608 Ga0213872_10000143
1609 Ga0213872_10000153
1610 Ga0213872_10000156
1611 Ga0213872_10000394
1612 Ga0213872_10029381
1613 Ga0213872_10057901
1614 Ga0213872_10088226
1615 Ga0224712_10102079
1616 Ga0209436_101987
1617 Ga0209436_103446
1618 Ga0209672_103096
1619 Ga0209147_100575
1620 Ga0209563_100005
1621 Ga0209563_100007
1622 Ga0209437_107547
1623 Ga0209258_100225
1624 Ga0207425_1000224
1625 Ga0207425_1000295
1626 Ga0207425_1000566
1627 Ga0209646_1000028
1628 Ga0209026_1012811
1629 Ga0209148_1000040
1630 Ga0209148_1002241
1631 Ga0209129_1000007
1632 Ga0209129_1000723
1633 Ga0209129_1004098
1634 Ga0209565_1000085
1635 Ga0209565_1000644
1636 Ga0209565_1000937
1637 Ga0209565_1001692
1638 Ga0209565_1002166
1639 Ga0209565_1014274
1640 Ga0209455_1000049
1641 Ga0209673_1000133
1642 Ga0209673_1000304
1643 Ga0209673_1001052
1644 Ga0209673_1003491
1645 Ga0209673_1007483
1646 Ga0209673_1018452
1647 Ga0209673_1028951
1648 Ga0209673_1034076
1649 Ga0209130_1000324
1650 Ga0209130_1000326
1651 Ga0209130_1000800
1652 Ga0209130_1003269
1653 Ga0209130_1003568
1654 Ga0209675_1000083
1655 Ga0209675_1000516
1656 Ga0209675_1001124
1657 Ga0209675_1001236
1658 Ga0209675_1003686
1659 Ga0209676_1000122
1660 Ga0209676_1000268
1661 Ga0209676_1001471
1662 Ga0209025_1000073
1663 Ga0209025_1000111
1664 Ga0209025_1000432
1665 Ga0209025_1005232
1666 Ga0209025_1008304
1667 Ga0209025_1008949
1668 Ga0209025_1073075
1669 Ga0209564_1000003
1670 Ga0209564_1000009
1671 Ga0209564_1000045
1672 Ga0209564_1000175
1673 Ga0209564_1000524
1674 Ga0209564_1000594
1675 Ga0209564_1001280
1676 Ga0209564_1056414
1677 Ga0209758_1000025
1678 Ga0209758_1000456
1679 Ga0209758_1002137
1680 Ga0209050_1000002
1681 Ga0209050_1000339
1682 Ga0209050_1000384
1683 Ga0209050_1001024
1684 Ga0209050_1002458
1685 Ga0209050_1009165
1686 Ga0209256_1000005
1687 Ga0209256_1000050
1688 Ga0209256_1000063
1689 Ga0209256_1000373
1690 Ga0209256_1002180
1691 Ga0209256_1003554
1692 Ga0209256_1010020
1693 Ga0209256_1014525
1694 Ga0207426_1000001
1695 Ga0207426_1000028
1696 Ga0207426_1004897
1697 Ga0209051_1000002
1698 Ga0209051_1000343
1699 Ga0209051_1000618
1700 Ga0209051_1000665
1701 Ga0209051_1003457
1702 Ga0209051_1004603
1703 Ga0209051_1013868
1704 Ga0209257_1000002
1705 Ga0209257_1000107
1706 Ga0209257_1000333
1707 Ga0209257_1000671
1708 Ga0209257_1001657
1709 Ga0209257_1001964
1710 Ga0209257_1002139
1711 Ga0209257_1011830
1712 Ga0207656_10030962
1713 Ga0207655_1004524
1714 Ga0207655_1009233
1715 Ga0207655_1016530
1716 Ga0207680_10238982
1717 Ga0207645_10145926
1718 Ga0207705_10041375
1719 Ga0207705_10153962
1720 Ga0207707_10372311
1721 Ga0207695_10289081
1722 Ga0207695_10310688
1723 Ga0207695_10323152
1724 Ga0207662_10111489
1725 Ga0207662_10160500
1726 Ga0207657_10018275
1727 Ga0207652_10065323
1728 Ga0207652_10069362
1729 Ga0207652_10616145
1730 Ga0207652_10688677
1731 Ga0207681_10006569
1732 Ga0207694_10394908
1733 Ga0207694_10662563
1734 Ga0207650_10015881
1735 Ga0207659_10073136
1736 Ga0207659_10236097
1737 Ga0207687_10045521
1738 Ga0207687_10194333
1739 Ga0207700_10369812
1740 Ga0207664_10249707
1741 Ga0207690_10012121
1742 Ga0207690_10210416
1743 Ga0207690_10463884
1744 Ga0207690_10551005
1745 Ga0207706_10007783
1746 Ga0207706_10267200
1747 Ga0207706_10270071
1748 Ga0207686_10010419
1749 Ga0207686_10028855
1750 Ga0207686_10600104
1751 Ga0207709_10000425
1752 Ga0207709_10001100
1753 Ga0207709_10186361
1754 Ga0207670_10062321
1755 Ga0207669_10497107
1756 Ga0207669_10617846
1757 Ga0207691_10107315
1758 Ga0207711_10097396
1759 Ga0207711_10104872
1760 Ga0207711_10117330
1761 Ga0207689_10452512
1762 Ga0207679_10071405
1763 Ga0207679_10202978
1764 Ga0207667_10052973
1765 Ga0207667_10311301
1766 Ga0207667_10403162
1767 Ga0207667_10473532
1768 Ga0207651_10357396
1769 Ga0207651_10641910
1770 Ga0207640_10145120
1771 Ga0207640_10413841
1772 Ga0207703_10030373
1773 Ga0207639_10082753
1774 Ga0207639_10097266
1775 Ga0207639_10514633
1776 Ga0207678_10149869
1777 Ga0207702_10248638
1778 Ga0207702_10418520
1779 Ga0207641_10253765
1780 Ga0207648_10008612
1781 Ga0207648_10082404
1782 Ga0207648_10268532
1783 Ga0207648_10309500
1784 Ga0207674_10075892
1785 Ga0207674_10317677
1786 Ga0207683_10111999
1787 Ga0207683_10170118
1788 Ga0207698_10050162
1789 Ga0207698_10075019
1790 Ga0207698_10119684
1791 Ga0207698_10384720
1792 Ga0209389_1032076
1793 Ga0209282_1000002
1794 Ga0209282_1002923
1795 Ga0209974_10028908
1796 Ga0268266_10006337
1797 Ga0268265_10037903
1798 Ga0307515_10002898
1799 Ga0307515_10201053
1800 Ga0307512_10245390
1801 Ga0316177_1102847
1802 Ga0316177_1113384
1803 Ga0316176_1137514
1804 Ga0314311_1096514
1805 Ga0316180_1082133
1806 Ga0316183_1124842
1807 Ga0316183_1151357
1808 Ga0316181_1114218
1809 Ga0316181_1266017
1810 Ga0316182_1250603
1811 Ga0316182_1422285
1812 Ga0265328_10020764
1813 Ga0265340_10005016
1814 Ga0265331_10028699
1815 Ga0265327_10000083
1816 Ga0265327_10001090
1817 Ga0265327_10086302
1818 Ga0307509_10024292
1819 Ga0307509_10053210
1820 Ga0307408_100000446
1821 Ga0307408_100001168
1822 Ga0307408_100007266
1823 Ga0307408_100016837
1824 Ga0307408_100020249
1825 Ga0307408_100059801
1826 Ga0307408_100437700
1827 Ga0307514_10079272
1828 Ga0307516_10402858
1829 Ga0307405_10013073
1830 Ga0307405_10054930
1831 Ga0307405_10148814
1832 Ga0307405_10151225
1833 Ga0307518_10033465
1834 Ga0307406_10000864
1835 Ga0307412_10011951
1836 Ga0307412_10018730
1837 Ga0307409_100519646
1838 Ga0307409_100535803
1839 Ga0307416_100306418
1840 Ga0307416_100736897
1841 Ga0307416_101157029
1842 Ga0307414_10175610
1843 Ga0307414_10268447
1844 Ga0307414_10520637
1845 Ga0307414_10729228
1846 Ga0307414_10736711
1847 Ga0307411_10193180
1848 Ga0373952_0000147
1849 Ga0373923_0083176
1850 Ga0373942_0006206
1851 Ga0373931_0061724
1852 Ga0373931_0152738
1853 Ga0395899_0000028
1854 Ga0395899_0080247
1855 Ga0395899_0115663
1856 Ga0395899_0235483
1857 Ga0395899_0355033
1858 Ga0395900_0004850
1859 Ga0395900_0164294
1860 Ga0395900_0374743
1861 Ga0395900_0745979
1862 Ga0395898_0019113
1863 Ga0395898_0028733
1864 Ga0395898_0098824
1865 Ga0395898_0161107
1866 Ga0395898_0251897
1867 Ga0395898_0620781
1868 Ga0395905_0000811
1869 Ga0395905_0001473
1870 Ga0395905_0009721
1871 Ga0395905_0015426
1872 Ga0395905_0033102
1873 Ga0395905_0052461
1874 Ga0395905_0059933
1875 Ga0395905_0095398
1876 Ga0395905_0181281
1877 Ga0395905_0304829
1878 Ga0436364_1478795
1879 Ga0395901_0000551
1880 Ga0395901_0014806
1881 Ga0395901_0017358
1882 Ga0395901_0046520
1883 Ga0395901_0058900
1884 Ga0395901_0064151
1885 Ga0395901_0263219
1886 Ga0395901_0679437
1887 Ga0400489_70414
1888 Ga0436361_0065895
1889 Ga0436361_0082864
1890 Ga0436361_0195300
1891 Ga0436361_0283051
1892 Ga0436361_0349482
1893 Ga0436361_0412881
1894 Ga0436361_0570400
1895 Ga0436361_0669746
1896 Ga0436361_0715105
1897 Ga0436361_0755903
1898 Ga0436361_0921993
1899 Ga0436361_1084239
1900 Ga0439436_0000333
1901 Ga0439439_0025307
1902 Ga0439447_030509
1903 Ga0439461_0001234
1904 Ga0439466_0005348
1905 Ga0439466_0008119
1906 Ga0439466_0035279
1907 Ga0439465_0000072
1908 Ga0439465_0013050
1909 Ga0451789_0279339
1910 Ga0451841_1018191
1911 Ga0439431_0000235
1912 Ga0439433_0000055
1913 Ga0439442_003249
1914 Ga0439442_024288
1915 Ga0439442_053096
1916 Ga0439445_0000190
1917 Ga0439448_0001453
1918 Ga0439448_0126644
1919 Ga0439432_003056
1920 Ga0439432_016046
1921 Ga0439449_0000135
1922 Ga0439449_0000254
1923 Ga0439449_0008857
1924 Ga0439449_0033848
1925 Ga0439452_003187
1926 Ga0439455_0007915
1927 Ga0439457_004905
1928 Ga0439457_025642
1929 Ga0439462_0007285
1930 Ga0450920_009948
1931 Ga0450920_046904
1932 Ga0450923_012604
1933 Ga0450897_000764
1934 Ga0450894_001622
1935 Ga0450899_005005
1936 Ga0450899_005406
1937 Ga0450904_000042
1938 Ga0450906_004361
1939 Ga0450910_011646
1940 Ga0439446_0000384
1941 Ga0450908_000283
1942 Ga0450908_003570
1943 Ga0450909_007295
1944 Ga0439434_0011099
1945 Ga0439434_0016719
1946 Ga0439434_0017421
1947 Ga0439459_0002257
1948 Ga0450918_011672
1949 Ga0451577_0010581
1950 Ga0451577_0309719
1951 Ga0466969_0009184
1952 Ga0466969_0069770
1953 Ga0466969_0215674
1954 Ga0453683_0002793
1955 Ga0466965_0009285
1956 Ga0466965_0017289
1957 Ga0466965_0020808
1958 Ga0466965_0021204
1959 Ga0466965_0139809
1960 Ga0466966_0003089
1961 Ga0466966_0012809
1962 Ga0466966_0216260
1963 Ga0466961_0000186
1964 Ga0466961_0130891
1965 Ga0466963_0227398
1966 Ga0466963_0464526
1967 Ga0466964_0000976
1968 Ga0466964_0001673
1969 Ga0453684_0207653
1970 Ga0466971_0226662
1971 Ga0466968_0189887
1972 Ga0466970_0069538
1973 Ga0466960_0066633
1974 Ga0466959_0019572
1975 Ga0466959_0095938
1976 Ga0451576_0008365
1977 Ga0451576_0040933
1978 Ga0451576_0383934
1979 Ga0451576_1294922
1980 Ga0466958_0070050
1981 Ga0466958_0190510
1982 Ga0466967_0095348
1983 Ga0466967_0134591
1984 Ga0495617_000006
1985 Ga0495617_000008
1986 Ga0495617_000181
1987 Ga0495617_003640
1988 Ga0495627_000005
1989 Ga0495627_000191
1990 Ga0495627_010430
1991 Ga0495627_012527
1992 Ga0495627_013199
1993 Ga0495627_022723
1994 Ga0495627_030465
1995 Ga0495603_0013530
1996 Ga0495603_0035438
1997 Ga0495603_0330373
1998 Ga0495590_0000003
1999 Ga0495590_0000017
2000 Ga0495590_0004143
2001 Ga0495590_0004512
2002 Ga0495590_0006026
2003 Ga0495590_0038510
2004 Ga0495590_0205310
2005 Ga0495591_000091
2006 Ga0495591_010708
2007 Ga0495629_0015125
2008 Ga0495629_0114108
2009 Ga0495638_0000118
2010 Ga0495638_0001982
2011 Ga0495638_0002148
2012 Ga0495638_0030426
2013 Ga0495638_0033813
2014 Ga0495638_0041204
2015 Ga0495638_0067056
2016 Ga0495638_0363337
2017 Ga0495653_0006483
2018 Ga0495653_0208964
2019 Ga0495653_0210188
2020 Ga0495650_0000015
2021 Ga0495650_0000131
2022 Ga0495650_0000147
2023 Ga0495650_0000189
2024 Ga0495650_0000195
2025 Ga0495650_0000339
2026 Ga0495650_0004295
2027 Ga0495650_0009310
2028 Ga0495650_0018881
2029 Ga0495650_0079380
2030 Ga0495580_0051138
2031 Ga0495580_0158398
2032 Ga0495582_0003229
2033 Ga0495582_0226020
2034 Ga0495605_0000003
2035 Ga0495605_0000083
2036 Ga0495605_0000184
2037 Ga0495605_0000949
2038 Ga0495605_0007708
2039 Ga0495605_0026781
2040 Ga0495605_0049067
2041 Ga0495605_0067073
2042 Ga0495605_0089617
2043 Ga0495605_0267568
2044 Ga0495639_0002216
2045 Ga0495639_0087599
2046 Ga0495584_0000008
2047 Ga0495584_0001294
2048 Ga0495584_0002379
2049 Ga0495584_0002758
2050 Ga0495584_0003880
2051 Ga0495584_0017677
2052 Ga0495584_0018378
2053 Ga0495584_0027667
2054 Ga0495584_0058171
2055 Ga0495584_0100945
2056 Ga0495584_0153509
2057 Ga0495585_0000159
2058 Ga0495585_0001407
2059 Ga0495585_0001639
2060 Ga0495585_0002634
2061 Ga0495585_0004935
2062 Ga0495585_0032368
2063 Ga0495585_0032785
2064 Ga0495585_0041693
2065 Ga0495585_0072070
2066 Ga0495585_0082731
2067 Ga0495585_0083832
2068 Ga0495585_0135422
2069 Ga0495585_0307753
2070 Ga0495594_0003660
2071 Ga0495594_0005566
2072 Ga0495594_0022332
2073 Ga0495594_0027830
2074 Ga0495596_0004495
2075 Ga0495596_0007196
2076 Ga0495596_0012957
2077 Ga0495596_0015118
2078 Ga0495596_0038447
2079 Ga0495596_0042390
2080 Ga0495607_0000982
2081 Ga0495607_0001248
2082 Ga0495607_0002566
2083 Ga0495607_0003301
2084 Ga0495607_0004635
2085 Ga0495607_0007891
2086 Ga0495607_0013444
2087 Ga0495607_0032846
2088 Ga0495607_0077550
2089 Ga0495607_0089104
2090 Ga0495583_0000026
2091 Ga0495583_0000049
2092 Ga0495583_0000079
2093 Ga0495583_0000165
2094 Ga0495583_0000301
2095 Ga0495583_0000615
2096 Ga0495583_0001880
2097 Ga0495583_0003090
2098 Ga0495583_0004713
2099 Ga0495583_0018084
2100 Ga0495583_0022172
2101 Ga0495583_0027765
2102 Ga0495583_0028432
2103 Ga0495583_0035623
2104 Ga0495583_0038010
2105 Ga0495583_0091099
2106 Ga0495606_0000068
2107 Ga0495606_0000185
2108 Ga0495606_0000345
2109 Ga0495606_0000650
2110 Ga0495606_0001149
2111 Ga0495606_0001239
2112 Ga0495606_0002011
2113 Ga0495606_0002106
2114 Ga0495606_0004703
2115 Ga0495606_0008579
2116 Ga0495606_0025046
2117 Ga0495606_0049582
2118 Ga0495606_0050580
2119 Ga0495606_0062167
2120 Ga0495606_0090506
2121 Ga0495610_0000004
2122 Ga0495610_0001058
2123 Ga0495610_0001361
2124 Ga0495610_0003372
2125 Ga0495610_0016743
2126 Ga0495610_0017601
2127 Ga0495610_0041930
2128 Ga0495610_0076209
2129 Ga0495610_0090970
2130 Ga0495616_0000042
2131 Ga0495616_0000395
2132 Ga0495616_0000694
2133 Ga0495616_0002414
2134 Ga0495616_0004085
2135 Ga0495616_0030515
2136 Ga0495616_0042107
2137 Ga0495616_0059779
2138 Ga0495616_0089833
2139 Ga0495616_0102929
2140 Ga0495616_0110476
2141 Ga0495620_0005295
2142 Ga0495620_0173030
2143 Ga0495630_0090599
2144 Ga0495630_0117029
2145 Ga0495631_0000228
2146 Ga0495631_0001731
2147 Ga0495631_0004132
2148 Ga0495631_0010178
2149 Ga0495631_0016503
2150 Ga0495631_0043813
2151 Ga0495631_0069145
2152 Ga0495631_0080908
2153 Ga0495632_0000065
2154 Ga0495632_0000155
2155 Ga0495632_0000476
2156 Ga0495632_0000934
2157 Ga0495632_0002365
2158 Ga0495632_0018366
2159 Ga0495632_0030965
2160 Ga0495632_0059646
2161 Ga0495632_0082038
2162 Ga0495632_0126101
2163 Ga0495637_0000281
2164 Ga0495637_0001371
2165 Ga0495637_0005539
2166 Ga0495637_0006672
2167 Ga0495637_0009184
2168 Ga0495637_0033017
2169 Ga0495637_0046202
2170 Ga0495643_0000106
2171 Ga0495643_0000417
2172 Ga0495643_0000653
2173 Ga0495643_0000792
2174 Ga0495643_0000798
2175 Ga0495643_0003931
2176 Ga0495643_0018930
2177 Ga0495643_0042824
2178 Ga0495643_0044883
2179 Ga0495643_0076345
2180 Ga0495643_0086747
2181 Ga0495644_0001181
2182 Ga0495644_0002400
2183 Ga0495644_0010071
2184 Ga0495644_0011983
2185 Ga0495644_0012194
2186 Ga0495644_0048526
2187 Ga0495644_0061910
2188 Ga0495644_0215599
2189 Ga0495648_0000055
2190 Ga0495648_0000070
2191 Ga0495648_0000807
2192 Ga0495648_0001050
2193 Ga0495648_0001715
2194 Ga0495648_0001752
2195 Ga0495648_0007473
2196 Ga0495648_0012736
2197 Ga0495648_0019149
2198 Ga0495648_0022274
2199 Ga0495648_0025287
2200 Ga0495648_0027763
2201 Ga0495648_0049531
2202 Ga0495648_0061393
2203 Ga0495663_0004309
2204 Ga0495663_0007498
2205 Ga0495663_0059277
2206 Ga0495663_0083624
2207 Ga0495666_0000191
2208 Ga0495666_0009730
2209 Ga0495666_0017781
2210 Ga0495666_0111281
2211 Ga0495642_0000376
2212 Ga0495642_0004461
2213 Ga0495642_0006415
2214 Ga0495642_0007548
2215 Ga0495642_0013474
2216 Ga0495642_0014314
2217 Ga0495642_0016642
2218 Ga0495642_0044172
2219 Ga0495642_0051328
2220 Ga0495642_0059104
2221 Ga0495642_0063647
2222 Ga0495642_0065624
2223 Ga0495642_0088016
2224 Ga0495652_0007892
2225 Ga0495652_0086558
2226 Ga0495654_0000035
2227 Ga0495654_0002939
2228 Ga0495654_0007918
2229 Ga0495654_0021948
2230 Ga0495654_0025901
2231 Ga0495654_0054915
2232 Ga0495654_0127670
2233 Ga0495665_0000579
2234 Ga0495665_0058964
2235 Ga0495586_0015584
2236 Ga0495586_0074212
2237 Ga0495609_0000002
2238 Ga0495609_0002255
2239 Ga0495609_0003201
2240 Ga0495609_0005670
2241 Ga0495609_0009486
2242 Ga0495609_0020559
2243 Ga0495609_0035605
2244 Ga0495609_0035737
2245 Ga0495609_0066770
2246 Ga0495609_0076781
2247 Ga0495609_0094363
2248 Ga0495609_0175104
2249 Ga0495621_0004628
2250 Ga0495621_0023711
2251 Ga0495621_0052958
2252 Ga0495597_0000656
2253 Ga0495597_0000770
2254 Ga0495597_0001497
2255 Ga0495597_0006143
2256 Ga0495597_0006807
2257 Ga0495597_0019166
2258 Ga0495597_0020596
2259 Ga0495597_0024339
2260 Ga0495597_0247375
2261 Ga0495645_0018376
2262 Ga0495645_0247881
2263 Ga0495622_0001144
2264 Ga0495622_0002556
2265 Ga0495622_0030061
2266 Ga0495622_0034568
2267 Ga0495622_0062496
2268 Ga0495633_0000164
2269 Ga0495633_0001230
2270 Ga0495633_0004437
2271 Ga0495633_0014037
2272 Ga0495633_0021203
2273 Ga0495633_0021768
2274 Ga0495633_0030004
2275 Ga0495633_0078254
2276 Ga0495633_0130031
2277 Ga0495667_0062092
2278 Ga0495656_0000184
2279 Ga0495656_0039298
2280 Ga0495656_0039929
2281 Ga0495656_0059687
2282 Ga0495656_0161458
2283 Ga0495656_0246771
2284 Ga0495668_0000094
2285 Ga0495668_0000104
2286 Ga0495668_0000865
2287 Ga0495668_0001664
2288 Ga0495668_0002283
2289 Ga0495668_0004387
2290 Ga0495668_0011158
2291 Ga0495668_0017455
2292 Ga0495668_0020584
2293 Ga0495668_0022941
2294 Ga0495668_0024814
2295 Ga0495668_0093216
2296 Ga0495668_0173644
2297 Ga0495634_0030606
2298 Ga0495611_0000157
2299 Ga0495611_0002084
2300 Ga0495611_0010425
2301 Ga0495611_0018978
2302 Ga0495611_0021596
2303 Ga0495611_0207151
2304 Ga0495625_0000038
2305 Ga0495625_0000044
2306 Ga0495625_0000335
2307 Ga0495625_0002328
2308 Ga0495625_0010789
2309 Ga0495625_0017421
2310 Ga0495625_0026929
2311 Ga0495625_0062562
2312 Ga0495625_0080807
2313 Ga0495625_0084238
2314 Ga0495625_0095870
2315 Ga0495625_0548477
2316 Ga0495625_0577945
2317 Ga0495635_0119065
2318 Ga0495635_0221081
2319 Ga0495635_0367416
2320 Ga0495659_0000204
2321 Ga0495659_0004423
2322 Ga0495659_0041718
2323 Ga0495659_0115132
2324 Ga0495661_0000149
2325 Ga0495661_0001612
2326 Ga0495661_0005402
2327 Ga0495661_0008766
2328 Ga0495661_0023769
2329 Ga0495661_0031146
2330 Ga0495661_0035738
2331 Ga0495661_0048168
2332 Ga0495661_0052068
2333 Ga0495661_0066224
2334 Ga0495661_0117579
2335 Ga0495661_0258093
2336 Ga0495588_0000245
2337 Ga0495588_0013099
2338 Ga0495588_0019611
2339 Ga0495588_0035055
2340 Ga0495588_0043228
2341 Ga0495588_0080913
2342 Ga0495588_0084515
2343 Ga0495588_0096530
2344 Ga0495588_0117375
2345 Ga0495588_0136152
2346 Ga0495588_0232606
2347 Ga0495588_0295902
2348 Ga0495657_0314692
2349 Ga0495623_0037757
2350 Ga0495623_0083346
2351 Ga0495623_0088281
2352 Ga0495623_0096875
2353 Ga0495646_0057326
2354 Ga0495646_0081104
2355 Ga0495658_0185694
2356 Ga0495669_0000108
2357 Ga0495669_0002705
2358 Ga0495669_0025697
2359 Ga0495669_0076370
2360 Ga0495669_0102761
2361 Ga0495669_0241752
2362 Ga0495613_0018048
2363 Ga0495613_0099291
2364 Ga0495624_0200999
2365 Ga0495670_0002374
2366 Ga0495670_0002798
2367 Ga0495670_0003871
2368 Ga0495670_0034793
2369 Ga0495670_0067909
2370 Ga0495670_0082015
2371 Ga0495670_0109148
2372 Ga0495670_0299735
2373 Ga0495671_0000001
2374 Ga0495671_0000109
2375 Ga0495671_0000228
2376 Ga0495671_0004274
2377 Ga0495671_0005357
2378 Ga0495671_0027657
2379 Ga0495671_0033851
2380 Ga0495671_0082593
2381 Ga0495649_0000326
2382 Ga0495649_0003055
2383 Ga0495649_0005429
2384 Ga0495649_0007802
2385 Ga0495649_0007839
2386 Ga0495649_0024587
2387 Ga0495649_0044443
2388 Ga0495649_0075295
2389 Ga0495649_0106332
2390 Ga0495649_0331830
2391 Ga0495589_0000009
2392 Ga0495589_0000062
2393 Ga0495589_0000153
2394 Ga0495589_0009570
2395 Ga0495589_0010537
2396 Ga0495589_0024597
2397 Ga0495589_0040238
2398 Ga0495589_0070105
2399 Ga0495589_0113578
2400 Ga0495589_0180722
2401 Ga0495600_0023871
2402 Ga0495660_0000082
2403 Ga0495660_0000716
2404 Ga0495660_0001543
2405 Ga0495660_0009811
2406 Ga0495660_0014318
2407 Ga0495660_0045363
2408 Ga0495660_0049177
2409 Ga0495660_0064752
2410 Ga0495660_0065943
2411 Ga0495660_0078530
2412 Ga0495660_0185687
2413 Ga0495581_0091440
2414 Ga0495581_0104580
2415 Ga0495581_0154575
2416 Ga0495581_0320671
2417 Ga0495604_0049360
2418 Ga0495604_0140406
2419 Ga0495636_0000379
2420 Ga0495636_0004307
2421 Ga0495636_0005717
2422 Ga0495636_0031241
2423 Ga0495636_0035538
2424 Ga0495636_0267941
2425 Ga0495672_0000032
2426 Ga0495672_0000098
2427 Ga0495672_0000236
2428 Ga0495672_0000244
2429 Ga0495672_0000272
2430 Ga0495672_0000316
2431 Ga0495672_0001208
2432 Ga0495672_0011075
2433 Ga0495672_0018606
2434 Ga0495672_0061315
2435 Ga0495672_0154716
2436 Ga0495676_0000296
2437 Ga0495676_0014815
2438 Ga0495676_0016422
2439 Ga0495676_0020517
2440 Ga0495676_0110069
2441 Ga0495683_0000247
2442 Ga0495683_0000923
2443 Ga0495683_0002926
2444 Ga0495683_0003240
2445 Ga0495683_0003731
2446 Ga0495683_0005473
2447 Ga0495683_0038293
2448 Ga0495683_0065997
2449 Ga0495683_0092101
2450 Ga0495683_0095175
2451 Ga0495683_0165637
2452 Ga0495687_000013
2453 Ga0495687_000063
2454 Ga0495687_000064
2455 Ga0495687_000173
2456 Ga0495687_000589
2457 Ga0495687_000939
2458 Ga0495687_002034
2459 Ga0495675_0059301
2460 Ga0495677_0000043
2461 Ga0495677_0000610
2462 Ga0495677_0003220
2463 Ga0495677_0004191
2464 Ga0495677_0014151
2465 Ga0495677_0048616
2466 Ga0495677_0058386
2467 Ga0495677_0079406
2468 Ga0495677_0190687
2469 Ga0495679_000520
2470 Ga0495679_019508
2471 Ga0495679_022687
2472 Ga0495679_027836
2473 Ga0495685_000027
2474 Ga0495685_035467
2475 Ga0495685_125215
2476 Ga0495673_0000006
2477 Ga0495673_0000014
2478 Ga0495673_0000090
2479 Ga0495673_0020986
2480 Ga0495673_0037598
2481 Ga0495681_0000266
2482 Ga0495681_0000573
2483 Ga0495681_0002781
2484 Ga0495681_0008662
2485 Ga0495681_0008859
2486 Ga0495681_0018573
2487 Ga0495681_0072031
2488 Ga0495686_0000225
2489 Ga0495686_0000672
2490 Ga0495686_0001200
2491 Ga0495686_0001524
2492 Ga0495686_0002471
2493 Ga0495686_0007591
2494 Ga0495686_0023543
2495 Ga0495686_0067506
2496 Ga0495593_0007756
2497 Ga0495593_0016871
2498 Ga0495593_0048511
2499 Ga0495602_0006654
2500 Ga0495602_0069762
2501 Ga0495614_0004411
2502 Ga0495615_0003239
2503 Ga0495615_0017482
2504 Ga0495626_0000003
2505 Ga0495626_0000733
2506 Ga0495626_0001553
2507 Ga0495626_0002765
2508 Ga0495626_0003541
2509 Ga0495626_0006784
2510 Ga0495626_0008582
2511 Ga0495626_0008881
2512 Ga0495626_0010830
2513 Ga0495626_0016993
2514 Ga0495626_0017167
2515 Ga0495626_0024413
2516 Ga0495626_0040095
2517 Ga0495626_0042451
2518 Ga0495626_0051187
2519 Ga0495626_0062223
2520 Ga0495626_0091555
2521 Ga0495626_0144099
2522 Ga0495626_0146670
2523 Ga0495626_0197094
2524 Ga0496100_0130197
2525 Ga0496100_0193668
2526 Ga0496101_0003681
2527 Ga0496101_0056025
2528 Ga0496101_0099187
2529 Ga0496102_0000407
2530 Ga0496102_0001834
2531 Ga0496102_0012505
2532 Ga0496102_0032567
2533 Ga0496102_0097668
2534 Ga0496102_0694474
2535 Ga0496102_0790248
2536 Ga0496103_0092063
2537 Ga0496103_0145605
2538 Ga0496103_0456548
2539 Ga0496104_0008803
2540 Ga0496104_0164681
2541 Ga0496104_0499747
2542 Ga0496105_0162220
2543 Ga0496106_0025756
2544 Ga0496106_0100786
2545 Ga0496107_0408106
2546 Ga0496108_0069677
2547 Ga0496108_0078438
2548 Ga0496108_0232757
2549 Ga0496109_0141910
2550 Ga0496109_0710623
2551 Ga0496109_0749910
2552 Ga0496110_0000226
2553 Ga0496110_0084403
2554 Ga0496111_0088022
2555 Ga0496112_0161737
2556 Ga0496112_1120245
2557 Ga0496114_0009548
2558 Ga0496114_0398241
2559 Ga0496115_0037025
2560 Ga0496115_0550593
2561 Ga0496116_0031449
2562 Ga0496116_0097897
2563 Ga0496116_0156966
2564 Ga0496116_0248871
2565 Ga0496117_0011194
2566 Ga0496118_0005647
2567 Ga0496118_0043877
2568 Ga0496118_0176967
2569 Ga0496119_0299238
2570 Ga0496121_0095753
2571 Ga0496121_0345531
2572 Ga0496122_0000034
2573 Ga0496122_0000210
2574 Ga0496122_0001371
2575 Ga0496122_0023266
2576 Ga0496122_0052243
2577 Ga0496122_0182675
2578 Ga0496123_0000141
2579 Ga0496123_0000597
2580 Ga0496123_0007555
2581 Ga0496123_0009027
2582 Ga0496123_0134471
2583 Ga0496123_0243180
2584 Ga0496124_0023549
2585 Ga0496124_0031199
2586 Ga0496124_0090641
2587 Ga0496124_0101386
2588 Ga0496124_0180977
2589 Ga0496124_0191340
2590 Ga0496124_0542426
2591 Ga0496125_0000789
2592 Ga0496126_0027791
2593 Ga0496126_0293789
2594 Ga0496126_0503829
2595 Ga0495678_000016
2596 Ga0495678_000153
2597 Ga0495678_000284
2598 Ga0495678_000330
2599 Ga0495678_001967
2600 Ga0495678_002471
2601 Ga0495678_008825
2602 Ga0495678_011714
2603 Ga0495678_012024
2604 Ga0495678_129640
2605 Ga0495678_133239
2606 Ga0495682_0005588
2607 Ga0495682_0014799
2608 Ga0495682_0021404
2609 Ga0495682_0162017
2610 Ga0501313_001575
2611 Ga0501032_0397969
2612 Ga0501032_0413007
2613 Ga0501034_0044672
2614 Ga0501036_0035603
2615 Ga0501036_0332016
2616 Ga0501038_0194877
2617 Ga0501040_0110602
2618 Ga0501043_0000108
2619 Ga0501043_0292338
2620 Ga0501046_0000050
2621 Ga0501046_0155915
2622 Ga0501047_0000012
2623 Ga0501047_0222681
2624 Ga0501048_0000695
2625 Ga0501048_0229175
2626 Ga0501068_0086951
2627 Ga0501072_0016664
2628 Ga0501073_0192850
2629 Ga0501074_0649801
2630 Ga0501222_009934
2631 Ga0501249_020799
2632 Ga0501225_0007229
2633 Ga0501080_0321235
2634 Ga0501080_0535524
2635 Ga0501081_0016309
2636 Ga0501241_019337
2637 Ga0501262_001175
2638 Ga0501269_000282
2639 Ga0501279_006907
2640 Ga0501044_0034715
2641 Ga0501045_0004835
2642 Ga0501045_0074503
2643 nmdc:mga03683_10301_c1
2644 nmdc:mga03683_3723_c1
2645 nmdc:mga03n38_34599_c1
2646 nmdc:mga00v17_1720_c1
2647 nmdc:mga0yw44_4298_c1
2648 nmdc:mga0yw44_9677_c1
2649 nmdc:mga0k408_129432_c1
2650 nmdc:mga0k408_20318_c1
2651 nmdc:mga0k408_2939_c1
2652 nmdc:mga0k408_36383_c1
2653 nmdc:mga0k408_36483_c1
2654 nmdc:mga0k408_4515_c2
2655 nmdc:mga07m45_185456_c1
2656 nmdc:mga07m45_611_c1
2657 nmdc:mga07m45_7294_c1
2658 nmdc:mga0n895_119263_c1
2659 nmdc:mga0rr50_217718_c1
2660 nmdc:mga08x19_2421_c1
2661 nmdc:mga0sz30_293882_c1
2662 Ga0500610_0000863
2663 Ga0500610_0002219
2664 Ga0500610_0033809
2665 Ga0500578_0001334
2666 Ga0500643_004104
2667 Ga0500651_0000097
2668 Ga0500566_0041641
2669 Ga0500555_037566
2670 Ga0500562_110527
2671 Ga0500571_000190
2672 Ga0500593_000202
2673 Ga0500594_0008916
2674 Ga0500607_000181
2675 Ga0500608_032284
2676 Ga0500608_098022
2677 Ga0500618_002212
2678 Ga0500626_010486
2679 Ga0500655_003364
2680 Ga0500658_0000521
2681 Ga0500658_0000753
2682 Ga0500559_0001463
2683 Ga0500559_0013536
2684 Ga0500559_0019274
2685 Ga0500564_035058
2686 Ga0500568_0002122
2687 Ga0500573_0039643
2688 Ga0500574_048069
2689 Ga0500604_0005739
2690 Ga0500619_098524
2691 Ga0500627_0004369
2692 Ga0500634_0012204
2693 Ga0500634_0012879
2694 Ga0500634_0045507
2695 Ga0500636_0141804
2696 Ga0500636_0200247
2697 Ga0501084_0033108
2698 Ga0501082_0063318
2699 Ga0530510_0026313
2700 2509388073
2701 2513229561
2702 2548497730
2703 2587725607
2704 2599623552
2705 2599671830
2706 2599681157
2707 2599693439
2708 2643789083
2709 2643798429
2710 2643971207
2711 2643990115
2712 2644160722
2713 2644213915
2714 2644254033
2715 2644327521
2716 2644356802
2717 2644401561
2718 2644468078
2719 2644475433
2720 2644645138
2721 2738717628
2722 2738742011
2723 2738747687
2724 2738824949
2725 2738844464
2726 2738879243
2727 2739148746
2728 2739190665
2729 2739248122
2730 2739277042
2731 2739278314
2732 2739317142
2733 2739335383
2734 2739346017
2735 2739356950
2736 2809144845
2737 2819597118
2738 2831266237
2739 2831864943
2740 2838057653
2741 2842368599
2742 2842678929
2743 2842699548
2744 2842716834
2745 2842735183
2746 2842751073
2747 2857553680
2748 2857561233
2749 2857565352
2750 2885192392
2751 2885204354
2752 2885218007
2753 2886851715
2754 2899930141
2755 2904426664
2756 2904456186
2757 2904457736
2758 2904543476
2759 2919467529
2760 2919480306
2761 2928039254
2762 2928045141
2763 2928052947
2764 2928064382
2765 2928071835
2766 2928084228
2767 2928116334
2768 2929162989
2769 2929527220
2770 2945911459
2771 2945947635
2772 2945977502
2773 2945986233
2774 2954772521
2775 2990711169
2776 8047674276
2777 8057161515

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00072

Response_reg

Response regulator receiver domain

32

142

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
3w9s-assembly1.cif.gz_B crystal structure analysis of the n-terminal receiver domain of response regulator pmra 0.9468 2 101
2pl1-assembly1.cif.gz_A berrylium fluoride activated receiver domain of e.coli phop 0.9415 1 102
6rh1-assembly1.cif.gz_C revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 0.937 3 99
5uic-assembly1.cif.gz_A structure of the francisella response regulator receiver domain, qseb 0.9297 1 101
5hm6-assembly1.cif.gz_A n-terminal domain of bfmr from acinetobacter baumannii 0.9234 3 101
ID Description Score Start End Superfamily
af_Q06065_2_134_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9455 3 104 3.40.50.2300
4s04F01 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9338 1 101 3.40.50.2300
5hm6B00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9249 3 101 3.40.50.2300
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9194 3 100 3.40.50.2300
3cfyA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.9194 3 102 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A847J0D0-F1-model_v4 Response regulator transcription factor 0.9559 3 104 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A401WU37-F1-model_v4 OmpR/PhoB-type domain-containing protein 0.949 115 201 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993
AF-A0A2N3AJC3-F1-model_v4 Two-component system response regulator 0.9428 3 101 GO:0000160
GO:0005524
GO:0006355
GO:0016887
AF-A0A354ZI13-F1-model_v4 Sigma-54-dependent Fis family transcriptional regulator 0.942 3 104 GO:0000160
GO:0005524
GO:0006355
GO:0016887
GO:0043565
AF-A0A3L7TDR4-F1-model_v4 Response regulator 0.9415 3 100 GO:0000160

Map