F493571
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1388 | 525 | 2777 | 217 |
Family's Representative Sequence
| Representative Sequence | 3300053156|Ga0500622_0009139|Ga0500622_0009139_671_1417 |
| Length | 248 |
| Sequence | VSASALALTGAAPRGLRPRRVMAACTIAAMRLLLVEDDLMIGEQLLELLRAEGYAVDWVRDGEIADTALQSQTYDLVILDLGLPKRDGMSVLQALRGRKQAVPVLIATARDATAQRVAGLDAGADDYVLKPFELDELLARIRALLRRAAGRAEPVYEHMGVSINPATREVTAHGHPVTLSQREWAVLEPLLARPGMVLSRQQLEEKLYGWKDEISSNAVEVYIHGLRKKLGAELIQNVRGVGYRVPKE |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 2 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 3 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 4 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 5 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 6 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 7 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 8 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 9 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 10 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 11 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 12 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 13 | 3300003323 | Sugarcane root Sample H1 | Metagenome | Unclassified |
| 14 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 15 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 16 | 3300003544 | Grassland soil microbial communities from Hopland, California, USA - Sample H2_Rhizo_33 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 17 | 3300003574 | Grassland soil microbial communities from Hopland, California, USA - Sample H1_Rhizo_26 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Rhizosphere |
| 18 | 3300003578 | Arabidopsis root microbial communities from the University of North Carolina, USA - metaT NBMF1_36_input_d2 (Metagenome Metatranscriptome, Counting Only) | Metatranscriptome | Unclassified |
| 19 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 20 | 3300003761 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 | Metagenome | Endosphere |
| 21 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 22 | 3300003763 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 | Metagenome | Endosphere |
| 23 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 24 | 3300003773 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 | Metagenome | Endosphere |
| 25 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 26 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 27 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 28 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 29 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 30 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 31 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 32 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 33 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 34 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 38 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 39 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 41 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 45 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 50 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 51 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 53 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 57 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 58 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 59 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 62 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 64 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 65 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 66 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 67 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 68 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 69 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 70 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 71 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 72 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 73 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 74 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 75 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 76 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 77 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 78 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 79 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 80 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 81 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 82 | 3300006944 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW | Metagenome | Nodule |
| 83 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 84 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 85 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 86 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 89 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 90 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 91 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 92 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 93 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 94 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 95 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 96 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 97 | 3300012497 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Cvi.2.old.240510 | Metagenome | Rhizosphere |
| 98 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 102 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 103 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 104 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 105 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 106 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 107 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 108 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 109 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 110 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 111 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 112 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 113 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 115 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 116 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 117 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 118 | 3300025229 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 119 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 120 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 121 | 3300025242 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 122 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 123 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 124 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 125 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 126 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 127 | 3300025263 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mTSA_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 128 | 3300025272 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 129 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 130 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 131 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 132 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 133 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 134 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 135 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 136 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 137 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 138 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 139 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 140 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 141 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025728 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300027296 | Root nodule microbial communities of legume samples collected from California, USA - Cow pea red BW (SPAdes) (version 2) | Metagenome | Nodule |
| 181 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 182 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 186 | 3300030522 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM | Metagenome | Unclassified |
| 187 | 3300030731 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 3 | Metagenome | Rhizosphere |
| 188 | 3300030732 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 | Metagenome | Rhizosphere |
| 189 | 3300030733 | Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 | Metagenome | Rhizosphere |
| 190 | 3300030736 | Rhizosphere soil microbial communities in healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 6 | Metagenome | Rhizosphere |
| 191 | 3300030742 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 9 | Metagenome | Rhizosphere |
| 192 | 3300030744 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 7 | Metagenome | Rhizosphere |
| 193 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 194 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 195 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 196 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 197 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 198 | 3300031507 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 10_EM | Metagenome | Unclassified |
| 199 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 200 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 201 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 202 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 203 | 3300031838 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 25_EM | Metagenome | Unclassified |
| 204 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 205 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 206 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 207 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 208 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 209 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 210 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 211 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 212 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 213 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 214 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 215 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 216 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 217 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 218 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 219 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 220 | 3300039093 | Seagrass microbial communities from Seahorse Key, FL, USA - TH0818 | Metagenome | Unclassified |
| 221 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 222 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 223 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 224 | 3300041407 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z080117_5416 | Metagenome | Rhizosphere |
| 225 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 226 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 227 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 228 | 3300041443 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_2 MetaG | Metagenome | Rhizoplane |
| 229 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 230 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 231 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 232 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 233 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 234 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 235 | 3300042006 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z080117_5437 | Metagenome | Rhizosphere |
| 236 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 237 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 238 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 239 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 240 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 241 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 242 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 243 | 3300042128 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0117W_E14_070716_123 | Metagenome | Rhizosphere |
| 244 | 3300042131 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 | Metagenome | Rhizosphere |
| 245 | 3300042135 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 | Metagenome | Rhizosphere |
| 246 | 3300042139 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 | Metagenome | Rhizosphere |
| 247 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 248 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 249 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 250 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 251 | 3300042185 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0515W_E14_080116_2592 | Metagenome | Rhizosphere |
| 252 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 253 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 254 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 255 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 256 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 257 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 258 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 259 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 260 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 261 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 262 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 263 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 264 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 265 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 266 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 267 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 268 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 269 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 270 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 271 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 272 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046458 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046471 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co3_9_34 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 340 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 341 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 342 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 344 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 345 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 346 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 347 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 348 | 3300047447 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere | Metagenome | Rhizosphere |
| 349 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 350 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 351 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 352 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 353 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 354 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 355 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 356 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 357 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 358 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 359 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 360 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 361 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 362 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 363 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 364 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 365 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 366 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 367 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 368 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 369 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 370 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 371 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 372 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 373 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 374 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 375 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 376 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 377 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 378 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 379 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 380 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 381 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 382 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 384 | 3300049529 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_A_2_control (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 385 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 387 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 388 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 389 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 390 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 391 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 392 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 393 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 394 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 395 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 396 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 397 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 398 | 3300049662 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F2_A_2_control | Metagenome | Rhizosphere |
| 399 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 400 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 401 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 402 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 403 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 404 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 405 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 406 | 3300049775 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F22_A_5_drought | Metagenome | Rhizosphere |
| 407 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 408 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 409 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 410 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 411 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 412 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 413 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 414 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 415 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 416 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 417 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 418 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 419 | 3300053079 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 endosphere | Metagenome | Endosphere |
| 420 | 3300053086 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere | Metagenome | Endosphere |
| 421 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 422 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 423 | 3300053094 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere | Metagenome | Endosphere |
| 424 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 425 | 3300053108 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere | Metagenome | Endosphere |
| 426 | 3300053110 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 endosphere | Metagenome | Endosphere |
| 427 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 428 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 429 | 3300053121 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 endosphere | Metagenome | Endosphere |
| 430 | 3300053122 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere | Metagenome | Endosphere |
| 431 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 432 | 3300053128 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 endosphere | Metagenome | Endosphere |
| 433 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 434 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 435 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 436 | 3300053138 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 endosphere | Metagenome | Endosphere |
| 437 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 438 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 439 | 3300053141 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 endosphere | Metagenome | Endosphere |
| 440 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 441 | 3300053154 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 endosphere | Metagenome | Endosphere |
| 442 | 3300053158 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere | Metagenome | Endosphere |
| 443 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 444 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 445 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 446 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 447 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
| 448 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 449 | 2513020051 | Variovorax sp. CF313 | Isolate | Rhizosphere |
| 450 | 2547132374 | Acidovorax radicis N35 | Isolate | Unclassified |
| 451 | 2585428057 | Methylibium sp. YR605 | Isolate | Rhizosphere |
| 452 | 2599185214 | Variovorax sp. NFACC26 | Isolate | Rhizoplane |
| 453 | 2599185226 | Variovorax sp. NFACC27 | Isolate | Rhizoplane |
| 454 | 2599185227 | Variovorax sp. NFACC28 | Isolate | Rhizoplane |
| 455 | 2599185229 | Variovorax sp. NFACC29 | Isolate | Endosphere |
| 456 | 2643221554 | Duganella sp. Root1480D1 | Isolate | Unclassified |
| 457 | 2643221556 | Massilia sp. Root1485 | Isolate | Unclassified |
| 458 | 2643221592 | Rhizobacter sp. Root16D2 | Isolate | Unclassified |
| 459 | 2643221596 | Acidovorax sp. Root70 | Isolate | Unclassified |
| 460 | 2643221628 | Variovorax sp. Root318D1 | Isolate | Unclassified |
| 461 | 2643221638 | Duganella sp. Root336D2 | Isolate | Unclassified |
| 462 | 2643221645 | Massilia sp. Root351 | Isolate | Unclassified |
| 463 | 2643221658 | Variovorax sp. Root411 | Isolate | Unclassified |
| 464 | 2643221664 | Massilia sp. Root418 | Isolate | Unclassified |
| 465 | 2643221672 | Variovorax sp. Root434 | Isolate | Unclassified |
| 466 | 2643221683 | Variovorax sp. Root473 | Isolate | Unclassified |
| 467 | 2643221684 | Massilia sp. Root133 | Isolate | Unclassified |
| 468 | 2643221717 | Acidovorax sp. Root267 | Isolate | Unclassified |
| 469 | 2738541277 | Variovorax sp. GV051 | Isolate | Unclassified |
| 470 | 2738541280 | Massilia sp. GV090 | Isolate | Unclassified |
| 471 | 2738541281 | Methylobacterium sp. GV094 | Isolate | Unclassified |
| 472 | 2738541297 | Duganella sp. GV083 | Isolate | Unclassified |
| 473 | 2738541300 | Massilia sp. GV016 | Isolate | Unclassified |
| 474 | 2738541307 | Variovorax sp. GV008 | Isolate | Unclassified |
| 475 | 2738541357 | Duganella sp. GV053 | Isolate | Unclassified |
| 476 | 2738543003 | Duganella sp. GV066 | Isolate | Unclassified |
| 477 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 478 | 2738543018 | Massilia sp. GV045 | Isolate | Unclassified |
| 479 | 2738543019 | Variovorax sp. GV040 | Isolate | Unclassified |
| 480 | 2738543026 | Duganella sp. GV089 | Isolate | Unclassified |
| 481 | 2738543029 | Duganella sp. GV039 | Isolate | Unclassified |
| 482 | 2738543030 | Massilia sp. GV097 | Isolate | Unclassified |
| 483 | 2738543032 | Methylobacterium sp. GV104 | Isolate | Unclassified |
| 484 | 2808606418 | Herbaspirillum sp. SJZ107 | Isolate | Rhizosphere |
| 485 | 2818991446 | Variovorax sp. 1180 | Isolate | Unclassified |
| 486 | 2831265667 | Variovorax guangxiensis DSM 27352 | Isolate | Rhizosphere |
| 487 | 2831864461 | Roseateles noduli HZ7 | Isolate | Nodule |
| 488 | 2838054893 | Variovorax guangxiensis 34/80 | Isolate | Nodule |
| 489 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 490 | 2842677519 | Variovorax sp. R-72495 | Isolate | Unclassified |
| 491 | 2842698319 | Methylobacterium sp. R-72139 | Isolate | Unclassified |
| 492 | 2842711865 | Duganella sp. R-73148 | Isolate | Unclassified |
| 493 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 494 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 495 | 2857553236 | Duganella sp. R-74557 | Isolate | Unclassified |
| 496 | 2857558681 | Duganella sp. R-74565 | Isolate | Unclassified |
| 497 | 2857564685 | Duganella sp. R-74599 | Isolate | Unclassified |
| 498 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 499 | 2885198086 | Variovorax sp. 679 | Isolate | Unclassified |
| 500 | 2885211737 | Variovorax sp. 553 | Isolate | Unclassified |
| 501 | 2886848708 | Mitsuaria sp. TWR114 | Isolate | Rhizosphere |
| 502 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 503 | 2904424332 | Duganella sp. 1411 | Isolate | Rhizosphere |
| 504 | 2904449895 | Variovorax sp. 1763 | Isolate | Rhizosphere |
| 505 | 2904456579 | Variovorax sp. 2002 | Isolate | Unclassified |
| 506 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 507 | 2919462493 | Variovorax sp. 3319 | Isolate | Rhizosphere |
| 508 | 2919476304 | Duganella sp. 3397 | Isolate | Unclassified |
| 509 | 2928037797 | Variovorax sp. 1126 | Isolate | Unclassified |
| 510 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 511 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 512 | 2928064002 | Variovorax sp. 1140 | Isolate | Rhizosphere |
| 513 | 2928070936 | Variovorax gossypii 1167 | Isolate | Unclassified |
| 514 | 2928084124 | Variovorax paradoxus 1218 | Isolate | Unclassified |
| 515 | 2928115317 | Pseudacidovorax sp. 1753 | Isolate | Rhizosphere |
| 516 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 517 | 2929520902 | Variovorax beijingensis 502 | Isolate | Unclassified |
| 518 | 2945909444 | Variovorax sp. CRF3-Va-1 W1I1 | Isolate | Rhizosphere |
| 519 | 2945945610 | Variovorax paradoxus W1I18 | Isolate | Rhizosphere |
| 520 | 2945972063 | Variovorax paradoxus W2I8 | Isolate | Rhizosphere |
| 521 | 2945984333 | Variovorax sp. W2I14 | Isolate | Rhizosphere |
| 522 | 2954767861 | Variovorax sp. TBS-050B | Isolate | Rhizosphere |
| 523 | 2990710928 | Acidovorax delafieldii SLBN-75 | Isolate | Rhizosphere |
| 524 | 8047673197 | Telluria mixta LMG 11547 | Isolate | Rhizosphere |
| 525 | 8057160832 | Larsenimonas rhizosphaerae GH2-1 | Isolate | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 93.95 |
| Metatranscriptomes | 0.43 |
| Isolates | 5.62 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 15.85 |
| Nodule | 0.86 |
| Rhizoplane | 2.95 |
| Rhizosphere | 72.69 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 0 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0500622_0009139 | 3300053156 | Bacteria | 5500 |
| 2 | JGI24740J21852_10032511 | 3300001979 | Bacteria | 1668 |
| 3 | JGI25154J39366_1001311 | 3300002738 | Bacteria | 9235 |
| 4 | JGI25158J39367_1017892 | 3300002739 | Bacteria | 882 |
| 5 | JGI25152J39213_1021523 | 3300002773 | Bacteria | 1129 |
| 6 | JGI25150J39212_1001139 | 3300002774 | Bacteria | 7993 |
| 7 | JGI25150J39212_1006853 | 3300002774 | Bacteria | 2322 |
| 8 | JGI25159J45721_1002152 | 3300002987 | Bacteria | 7678 |
| 9 | JGI25151J46595_10003411 | 3300003187 | Bacteria | 8795 |
| 10 | JGI25151J46595_10008465 | 3300003187 | Bacteria | 4947 |
| 11 | JGI25153J46596_10064191 | 3300003215 | Bacteria | 981 |
| 12 | rootH1_10007233 | 3300003316 | Bacteria | 8349 |
| 13 | rootH2_10031368 | 3300003320 | Bacteria | 3709 |
| 14 | rootL2_10002108 | 3300003322 | Bacteria | 31499 |
| 15 | rootL2_10045051 | 3300003322 | Bacteria | 1560 |
| 16 | rootL2_10087294 | 3300003322 | Bacteria | 1268 |
| 17 | rootH1_10004227 | 3300003316 | Bacteria | 4326 |
| 18 | rootH1_10004227 | 3300003323 | Bacteria | 8883 |
| 19 | JGI25160J50197_1009062 | 3300003354 | Bacteria | 3726 |
| 20 | JGI25161J50226_1001836 | 3300003374 | Bacteria | 5946 |
| 21 | Ga0007417J51691_1007451 | 3300003544 | Bacteria | 2685 |
| 22 | Ga0007410J51695_1012132 | 3300003574 | Bacteria | 2827 |
| 23 | Ga0006562J51391_1043541 | 3300003578 | Bacteria | 4291 |
| 24 | Ga0006562J51391_1043542 | 3300003578 | Bacteria | 4990 |
| 25 | Ga0055525_1000011 | 3300003759 | Bacteria | 503124 |
| 26 | Ga0055525_1000073 | 3300003759 | Bacteria | 180663 |
| 27 | Ga0055535_1000364 | 3300003761 | Bacteria | 43640 |
| 28 | Ga0055542_1000114 | 3300003762 | Bacteria | 107058 |
| 29 | Ga0055529_1000208 | 3300003763 | Bacteria | 77951 |
| 30 | Ga0055526_1000077 | 3300003771 | Bacteria | 92111 |
| 31 | Ga0055526_1000094 | 3300003771 | Bacteria | 80954 |
| 32 | Ga0055526_1005930 | 3300003771 | Bacteria | 6816 |
| 33 | Ga0055526_1019641 | 3300003771 | Bacteria | 2451 |
| 34 | Ga0055526_1029088 | 3300003771 | Bacteria | 1652 |
| 35 | Ga0055537_1000484 | 3300003773 | Bacteria | 24629 |
| 36 | Ga0055537_1007829 | 3300003773 | Bacteria | 2528 |
| 37 | Ga0055524_1000007 | 3300003775 | Bacteria | 298766 |
| 38 | Ga0055524_1000334 | 3300003775 | Bacteria | 43451 |
| 39 | Ga0055524_1004119 | 3300003775 | Bacteria | 6816 |
| 40 | Ga0055524_1004131 | 3300003775 | Bacteria | 6800 |
| 41 | Ga0055524_1004645 | 3300003775 | Bacteria | 6300 |
| 42 | Ga0055524_1008878 | 3300003775 | Bacteria | 4137 |
| 43 | Ga0055536_1007729 | 3300003781 | Bacteria | 4756 |
| 44 | Ga0055534_1000406 | 3300003784 | Bacteria | 26436 |
| 45 | Ga0055534_1005715 | 3300003784 | Bacteria | 3272 |
| 46 | Ga0055528_1000813 | 3300003790 | Bacteria | 21449 |
| 47 | Ga0055528_1013114 | 3300003790 | Bacteria | 3165 |
| 48 | Ga0055528_1024492 | 3300003790 | Bacteria | 1807 |
| 49 | Ga0055530_10000777 | 3300003791 | Bacteria | 26621 |
| 50 | Ga0055530_10018320 | 3300003791 | Bacteria | 2163 |
| 51 | Ga0055540_1001349 | 3300003792 | Bacteria | 14772 |
| 52 | Ga0055540_1007393 | 3300003792 | Bacteria | 4153 |
| 53 | Ga0055540_1017711 | 3300003792 | Bacteria | 1978 |
| 54 | Ga0055531_10001441 | 3300003794 | Bacteria | 17545 |
| 55 | Ga0055531_10009422 | 3300003794 | Bacteria | 4990 |
| 56 | Ga0055543_1000748 | 3300004625 | Bacteria | 16355 |
| 57 | Ga0055543_1003842 | 3300004625 | Bacteria | 4265 |
| 58 | Ga0055543_1004175 | 3300004625 | Bacteria | 4006 |
| 59 | Ga0065165_1000006 | 3300005262 | Bacteria | 352298 |
| 60 | Ga0065165_1000094 | 3300005262 | Bacteria | 146099 |
| 61 | Ga0065165_1000230 | 3300005262 | Bacteria | 97470 |
| 62 | Ga0065165_1001757 | 3300005262 | Bacteria | 21551 |
| 63 | Ga0065165_1005587 | 3300005262 | Bacteria | 6976 |
| 64 | Ga0065165_1044083 | 3300005262 | Bacteria | 1306 |
| 65 | Ga0070658_10473481 | 3300005327 | Bacteria | 1080 |
| 66 | Ga0070676_10070202 | 3300005328 | Bacteria | 2100 |
| 67 | Ga0070670_100017063 | 3300005331 | Bacteria | 6230 |
| 68 | Ga0068869_100189670 | 3300005334 | Bacteria | 1616 |
| 69 | Ga0070680_100185989 | 3300005336 | Bacteria | 1750 |
| 70 | Ga0070660_100009975 | 3300005339 | Bacteria | 6696 |
| 71 | Ga0070660_100050280 | 3300005339 | Bacteria | 3207 |
| 72 | Ga0070689_100063108 | 3300005340 | Bacteria | 2883 |
| 73 | Ga0070661_100139450 | 3300005344 | Bacteria | 1826 |
| 74 | Ga0070669_100135351 | 3300005353 | Bacteria | 1895 |
| 75 | Ga0070675_100095515 | 3300005354 | Bacteria | 2496 |
| 76 | Ga0070675_100466587 | 3300005354 | Bacteria | 1134 |
| 77 | Ga0070674_100019524 | 3300005356 | Bacteria | 4306 |
| 78 | Ga0070674_100851233 | 3300005356 | Bacteria | 791 |
| 79 | Ga0070674_101019359 | 3300005356 | Bacteria | 727 |
| 80 | Ga0070673_100043327 | 3300005364 | Bacteria | 3477 |
| 81 | Ga0070673_100336762 | 3300005364 | Bacteria | 1336 |
| 82 | Ga0070659_100010185 | 3300005366 | Bacteria | 6919 |
| 83 | Ga0070659_100116362 | 3300005366 | Bacteria | 2161 |
| 84 | Ga0070659_100450851 | 3300005366 | Bacteria | 1091 |
| 85 | Ga0070667_100500683 | 3300005367 | Bacteria | 1114 |
| 86 | Ga0070714_100215054 | 3300005435 | Bacteria | 1764 |
| 87 | Ga0070713_100698833 | 3300005436 | Bacteria | 968 |
| 88 | Ga0070678_100537024 | 3300005456 | Bacteria | 1036 |
| 89 | Ga0070662_100012605 | 3300005457 | Bacteria | 5608 |
| 90 | Ga0070681_10189700 | 3300005458 | Bacteria | 1975 |
| 91 | Ga0068867_100920952 | 3300005459 | Bacteria | 788 |
| 92 | Ga0070698_100413980 | 3300005471 | Bacteria | 1282 |
| 93 | Ga0070679_100014542 | 3300005530 | Bacteria | 7561 |
| 94 | Ga0070679_100036197 | 3300005530 | Bacteria | 4898 |
| 95 | Ga0070679_100444670 | 3300005530 | Bacteria | 1241 |
| 96 | Ga0070697_100473017 | 3300005536 | Bacteria | 1094 |
| 97 | Ga0068853_100042996 | 3300005539 | Bacteria | 3865 |
| 98 | Ga0068853_100120354 | 3300005539 | Bacteria | 2341 |
| 99 | Ga0068853_100549350 | 3300005539 | Bacteria | 1094 |
| 100 | Ga0070672_100540710 | 3300005543 | Bacteria | 1011 |
| 101 | Ga0070693_100071609 | 3300005547 | Bacteria | 2043 |
| 102 | Ga0070665_100055825 | 3300005548 | Bacteria | 3960 |
| 103 | Ga0068855_100007205 | 3300005563 | Bacteria | 13496 |
| 104 | Ga0068855_100162276 | 3300005563 | Bacteria | 2535 |
| 105 | Ga0068855_100385629 | 3300005563 | Bacteria | 1538 |
| 106 | Ga0070664_100026610 | 3300005564 | Bacteria | 4800 |
| 107 | Ga0070664_100256320 | 3300005564 | Bacteria | 1573 |
| 108 | Ga0068857_100053870 | 3300005577 | Bacteria | 3568 |
| 109 | Ga0068857_100139021 | 3300005577 | Bacteria | 2195 |
| 110 | Ga0068854_100583919 | 3300005578 | Bacteria | 952 |
| 111 | Ga0068852_100096885 | 3300005616 | Bacteria | 2653 |
| 112 | Ga0068852_100147171 | 3300005616 | Bacteria | 2186 |
| 113 | Ga0068852_100164392 | 3300005616 | Bacteria | 2075 |
| 114 | Ga0068851_10046197 | 3300005834 | Bacteria | 2202 |
| 115 | Ga0068858_100041447 | 3300005842 | Bacteria | 4268 |
| 116 | Ga0068862_100093797 | 3300005844 | Bacteria | 2618 |
| 117 | Ga0068862_100253613 | 3300005844 | Bacteria | 1604 |
| 118 | Ga0081539_10050675 | 3300005985 | Bacteria | 2347 |
| 119 | Ga0075365_10026402 | 3300006038 | Bacteria | 3687 |
| 120 | Ga0075365_10055877 | 3300006038 | Bacteria | 2623 |
| 121 | Ga0075365_10135617 | 3300006038 | Bacteria | 1706 |
| 122 | Ga0075363_100008149 | 3300006048 | Bacteria | 4865 |
| 123 | Ga0075363_100052055 | 3300006048 | Bacteria | 2185 |
| 124 | Ga0075362_10019634 | 3300006177 | Bacteria | 2813 |
| 125 | Ga0075362_10020895 | 3300006177 | Bacteria | 2739 |
| 126 | Ga0075362_10046340 | 3300006177 | Bacteria | 1933 |
| 127 | Ga0075367_10120451 | 3300006178 | Bacteria | 1617 |
| 128 | Ga0075367_10180060 | 3300006178 | Bacteria | 1318 |
| 129 | Ga0075369_10237729 | 3300006186 | Bacteria | 845 |
| 130 | Ga0075369_10285862 | 3300006186 | Bacteria | 769 |
| 131 | Ga0075366_10002796 | 3300006195 | Bacteria | 9022 |
| 132 | Ga0075366_10018902 | 3300006195 | Bacteria | 3982 |
| 133 | Ga0075366_10113145 | 3300006195 | Bacteria | 1634 |
| 134 | Ga0075366_10165338 | 3300006195 | Bacteria | 1341 |
| 135 | Ga0075366_10323073 | 3300006195 | Bacteria | 945 |
| 136 | Ga0075370_10000200 | 3300006353 | Bacteria | 21094 |
| 137 | Ga0075370_10002669 | 3300006353 | Bacteria | 8338 |
| 138 | Ga0075370_10031904 | 3300006353 | Bacteria | 2942 |
| 139 | Ga0075370_10033873 | 3300006353 | Bacteria | 2862 |
| 140 | Ga0075370_10072254 | 3300006353 | Bacteria | 1974 |
| 141 | Ga0075370_10376921 | 3300006353 | Bacteria | 850 |
| 142 | Ga0068871_100137347 | 3300006358 | Bacteria | 2077 |
| 143 | Ga0075431_100480821 | 3300006847 | Bacteria | 1235 |
| 144 | Ga0075434_100045544 | 3300006871 | Bacteria | 4352 |
| 145 | Ga0068865_100318757 | 3300006881 | Bacteria | 1250 |
| 146 | Ga0075436_100005826 | 3300006914 | Bacteria | 8458 |
| 147 | Ga0099823_1004022 | 3300006944 | Bacteria | 14210 |
| 148 | Ga0079104_1005131 | 3300006946 | Bacteria | 5328 |
| 149 | Ga0079104_1018383 | 3300006946 | Bacteria | 1980 |
| 150 | Ga0099826_10000003 | 3300006948 | Bacteria | 1067817 |
| 151 | Ga0099826_10001182 | 3300006948 | Bacteria | 15114 |
| 152 | Ga0075435_100106252 | 3300007076 | Bacteria | 2331 |
| 153 | Ga0105244_10005211 | 3300009036 | Bacteria | 8698 |
| 154 | Ga0105244_10007865 | 3300009036 | Bacteria | 6725 |
| 155 | Ga0105244_10057774 | 3300009036 | Bacteria | 1960 |
| 156 | Ga0105240_10013928 | 3300009093 | Bacteria | 11009 |
| 157 | Ga0105240_10135868 | 3300009093 | Bacteria | 2945 |
| 158 | Ga0105240_10279076 | 3300009093 | Bacteria | 1920 |
| 159 | Ga0105245_10417428 | 3300009098 | Bacteria | 1344 |
| 160 | Ga0105245_10476637 | 3300009098 | Bacteria | 1260 |
| 161 | Ga0105245_10831844 | 3300009098 | Bacteria | 962 |
| 162 | Ga0105243_10003393 | 3300009148 | Bacteria | 12920 |
| 163 | Ga0105243_10004657 | 3300009148 | Bacteria | 10800 |
| 164 | Ga0105243_10107021 | 3300009148 | Bacteria | 2332 |
| 165 | Ga0105243_10145657 | 3300009148 | Bacteria | 2026 |
| 166 | Ga0105241_10065294 | 3300009174 | Bacteria | 2812 |
| 167 | Ga0105242_10003383 | 3300009176 | Bacteria | 12419 |
| 168 | Ga0105242_10014082 | 3300009176 | Bacteria | 6190 |
| 169 | Ga0105242_10017712 | 3300009176 | Bacteria | 5555 |
| 170 | Ga0105242_10639476 | 3300009176 | Bacteria | 1033 |
| 171 | Ga0105248_10016344 | 3300009177 | Bacteria | 8166 |
| 172 | Ga0105248_10269634 | 3300009177 | Bacteria | 1917 |
| 173 | Ga0105237_10084896 | 3300009545 | Bacteria | 3156 |
| 174 | Ga0105238_10008824 | 3300009551 | Bacteria | 10085 |
| 175 | Ga0105238_10144266 | 3300009551 | Bacteria | 2357 |
| 176 | Ga0105238_10231255 | 3300009551 | Bacteria | 1825 |
| 177 | Ga0105238_11187362 | 3300009551 | Bacteria | 787 |
| 178 | Ga0105249_10308991 | 3300009553 | Bacteria | 1588 |
| 179 | Ga0105239_10033491 | 3300010375 | Bacteria | 5642 |
| 180 | Ga0157319_1000012 | 3300012497 | Bacteria | 165761 |
| 181 | Ga0157373_10025544 | 3300013100 | Bacteria | 4271 |
| 182 | Ga0157373_10107377 | 3300013100 | Bacteria | 1962 |
| 183 | Ga0157371_10000001 | 3300013102 | Bacteria | 1162285 |
| 184 | Ga0157371_10104225 | 3300013102 | Bacteria | 2013 |
| 185 | Ga0157370_10011376 | 3300013104 | Bacteria | 9316 |
| 186 | Ga0157370_10094025 | 3300013104 | Bacteria | 2813 |
| 187 | Ga0157370_10235209 | 3300013104 | Bacteria | 1695 |
| 188 | Ga0157370_10571025 | 3300013104 | Bacteria | 1036 |
| 189 | Ga0157369_10193073 | 3300013105 | Bacteria | 2139 |
| 190 | Ga0157378_10649905 | 3300013297 | Bacteria | 1070 |
| 191 | Ga0163162_10121755 | 3300013306 | Bacteria | 2714 |
| 192 | Ga0163162_10146915 | 3300013306 | Bacteria | 2474 |
| 193 | Ga0163162_10595176 | 3300013306 | Bacteria | 1232 |
| 194 | Ga0157375_10175896 | 3300013308 | Bacteria | 2290 |
| 195 | Ga0163163_10754812 | 3300014325 | Bacteria | 1036 |
| 196 | Ga0157380_10110521 | 3300014326 | Bacteria | 2308 |
| 197 | Ga0157380_10626639 | 3300014326 | Bacteria | 1069 |
| 198 | Ga0157380_10681473 | 3300014326 | Bacteria | 1030 |
| 199 | Ga0182008_10000893 | 3300014497 | Bacteria | 20726 |
| 200 | Ga0182008_10003192 | 3300014497 | Bacteria | 10015 |
| 201 | Ga0182008_10010607 | 3300014497 | Bacteria | 4927 |
| 202 | Ga0182008_10021377 | 3300014497 | Bacteria | 3322 |
| 203 | Ga0182008_10021606 | 3300014497 | Bacteria | 3304 |
| 204 | Ga0157379_10250271 | 3300014968 | Bacteria | 1608 |
| 205 | Ga0157379_10314606 | 3300014968 | Bacteria | 1429 |
| 206 | Ga0182006_1000021 | 3300015261 | Bacteria | 280808 |
| 207 | Ga0182006_1001088 | 3300015261 | Bacteria | 17410 |
| 208 | Ga0182006_1068286 | 3300015261 | Bacteria | 1324 |
| 209 | Ga0182007_10012859 | 3300015262 | Bacteria | 3210 |
| 210 | Ga0182007_10022091 | 3300015262 | Bacteria | 2251 |
| 211 | Ga0182007_10025460 | 3300015262 | Bacteria | 2062 |
| 212 | Ga0182007_10048705 | 3300015262 | Bacteria | 1400 |
| 213 | Ga0182005_1000020 | 3300015265 | Bacteria | 278671 |
| 214 | Ga0183362_10001 | 3300015683 | Bacteria | 2046624 |
| 215 | Ga0163161_10000193 | 3300017792 | Bacteria | 56074 |
| 216 | Ga0163161_10282731 | 3300017792 | Bacteria | 1302 |
| 217 | Ga0213872_10000002 | 3300021361 | Bacteria | 554092 |
| 218 | Ga0213872_10000027 | 3300021361 | Bacteria | 148884 |
| 219 | Ga0213872_10000049 | 3300021361 | Bacteria | 109094 |
| 220 | Ga0213872_10000143 | 3300021361 | Bacteria | 64736 |
| 221 | Ga0213872_10000153 | 3300021361 | Bacteria | 63358 |
| 222 | Ga0213872_10000156 | 3300021361 | Bacteria | 62916 |
| 223 | Ga0213872_10000394 | 3300021361 | Bacteria | 36299 |
| 224 | Ga0213872_10029381 | 3300021361 | Bacteria | 2521 |
| 225 | Ga0213872_10057901 | 3300021361 | Bacteria | 1754 |
| 226 | Ga0213872_10088226 | 3300021361 | Bacteria | 1389 |
| 227 | Ga0224712_10102079 | 3300022467 | Bacteria | 1218 |
| 228 | Ga0209436_101987 | 3300025208 | Bacteria | 6507 |
| 229 | Ga0209436_103446 | 3300025208 | Bacteria | 4211 |
| 230 | Ga0209672_103096 | 3300025228 | Bacteria | 3603 |
| 231 | Ga0209147_100575 | 3300025229 | Bacteria | 20578 |
| 232 | Ga0209563_100005 | 3300025230 | Bacteria | 1774893 |
| 233 | Ga0209563_100007 | 3300025230 | Bacteria | 1579402 |
| 234 | Ga0209437_107547 | 3300025233 | Bacteria | 1764 |
| 235 | Ga0209258_100225 | 3300025242 | Bacteria | 107138 |
| 236 | Ga0207425_1000224 | 3300025245 | Bacteria | 44543 |
| 237 | Ga0207425_1000295 | 3300025245 | Bacteria | 36319 |
| 238 | Ga0207425_1000566 | 3300025245 | Bacteria | 21775 |
| 239 | Ga0209646_1000028 | 3300025246 | Bacteria | 387986 |
| 240 | Ga0209026_1012811 | 3300025250 | Bacteria | 1449 |
| 241 | Ga0209148_1000040 | 3300025254 | Bacteria | 473531 |
| 242 | Ga0209148_1002241 | 3300025254 | Bacteria | 7042 |
| 243 | Ga0209129_1000007 | 3300025258 | Bacteria | 771325 |
| 244 | Ga0209129_1000723 | 3300025258 | Bacteria | 21251 |
| 245 | Ga0209129_1004098 | 3300025258 | Bacteria | 5933 |
| 246 | Ga0209565_1000085 | 3300025263 | Bacteria | 153075 |
| 247 | Ga0209565_1000644 | 3300025263 | Bacteria | 22599 |
| 248 | Ga0209565_1000937 | 3300025263 | Bacteria | 15341 |
| 249 | Ga0209565_1001692 | 3300025263 | Bacteria | 9131 |
| 250 | Ga0209565_1002166 | 3300025263 | Bacteria | 7391 |
| 251 | Ga0209565_1014274 | 3300025263 | Bacteria | 1830 |
| 252 | Ga0209455_1000049 | 3300025272 | Bacteria | 374414 |
| 253 | Ga0209673_1000133 | 3300025273 | Bacteria | 161740 |
| 254 | Ga0209673_1000304 | 3300025273 | Bacteria | 91151 |
| 255 | Ga0209673_1001052 | 3300025273 | Bacteria | 31821 |
| 256 | Ga0209673_1003491 | 3300025273 | Bacteria | 9218 |
| 257 | Ga0209673_1007483 | 3300025273 | Bacteria | 5022 |
| 258 | Ga0209673_1018452 | 3300025273 | Bacteria | 2536 |
| 259 | Ga0209673_1028951 | 3300025273 | Bacteria | 1772 |
| 260 | Ga0209673_1034076 | 3300025273 | Bacteria | 1543 |
| 261 | Ga0209130_1000324 | 3300025284 | Bacteria | 55802 |
| 262 | Ga0209130_1000326 | 3300025284 | Bacteria | 54842 |
| 263 | Ga0209130_1000800 | 3300025284 | Bacteria | 26748 |
| 264 | Ga0209130_1003269 | 3300025284 | Bacteria | 7076 |
| 265 | Ga0209130_1003568 | 3300025284 | Bacteria | 6509 |
| 266 | Ga0209675_1000083 | 3300025291 | Bacteria | 153075 |
| 267 | Ga0209675_1000516 | 3300025291 | Bacteria | 28507 |
| 268 | Ga0209675_1001124 | 3300025291 | Bacteria | 16310 |
| 269 | Ga0209675_1001236 | 3300025291 | Bacteria | 15383 |
| 270 | Ga0209675_1003686 | 3300025291 | Bacteria | 7151 |
| 271 | Ga0209676_1000122 | 3300025292 | Bacteria | 195510 |
| 272 | Ga0209676_1000268 | 3300025292 | Bacteria | 108430 |
| 273 | Ga0209676_1001471 | 3300025292 | Bacteria | 21884 |
| 274 | Ga0209025_1000073 | 3300025294 | Bacteria | 282133 |
| 275 | Ga0209025_1000111 | 3300025294 | Bacteria | 218982 |
| 276 | Ga0209025_1000432 | 3300025294 | Bacteria | 82875 |
| 277 | Ga0209025_1005232 | 3300025294 | Bacteria | 10693 |
| 278 | Ga0209025_1008304 | 3300025294 | Bacteria | 7493 |
| 279 | Ga0209025_1008949 | 3300025294 | Bacteria | 7081 |
| 280 | Ga0209025_1073075 | 3300025294 | Bacteria | 1205 |
| 281 | Ga0209564_1000003 | 3300025295 | Bacteria | 1585848 |
| 282 | Ga0209564_1000009 | 3300025295 | Bacteria | 950196 |
| 283 | Ga0209564_1000045 | 3300025295 | Bacteria | 376549 |
| 284 | Ga0209564_1000175 | 3300025295 | Bacteria | 153109 |
| 285 | Ga0209564_1000524 | 3300025295 | Bacteria | 62668 |
| 286 | Ga0209564_1000594 | 3300025295 | Bacteria | 56686 |
| 287 | Ga0209564_1001280 | 3300025295 | Bacteria | 27544 |
| 288 | Ga0209564_1056414 | 3300025295 | Bacteria | 913 |
| 289 | Ga0209758_1000025 | 3300025297 | Bacteria | 586687 |
| 290 | Ga0209758_1000456 | 3300025297 | Bacteria | 68269 |
| 291 | Ga0209758_1002137 | 3300025297 | Bacteria | 20841 |
| 292 | Ga0209050_1000002 | 3300025298 | Bacteria | 1792849 |
| 293 | Ga0209050_1000339 | 3300025298 | Bacteria | 92915 |
| 294 | Ga0209050_1000384 | 3300025298 | Bacteria | 83323 |
| 295 | Ga0209050_1001024 | 3300025298 | Bacteria | 34874 |
| 296 | Ga0209050_1002458 | 3300025298 | Bacteria | 15805 |
| 297 | Ga0209050_1009165 | 3300025298 | Bacteria | 5117 |
| 298 | Ga0209256_1000005 | 3300025299 | Bacteria | 1315082 |
| 299 | Ga0209256_1000050 | 3300025299 | Bacteria | 308622 |
| 300 | Ga0209256_1000063 | 3300025299 | Bacteria | 252716 |
| 301 | Ga0209256_1000373 | 3300025299 | Bacteria | 71879 |
| 302 | Ga0209256_1002180 | 3300025299 | Bacteria | 16812 |
| 303 | Ga0209256_1003554 | 3300025299 | Bacteria | 10801 |
| 304 | Ga0209256_1010020 | 3300025299 | Bacteria | 4049 |
| 305 | Ga0209256_1014525 | 3300025299 | Bacteria | 2825 |
| 306 | Ga0207426_1000001 | 3300025302 | Bacteria | 1341301 |
| 307 | Ga0207426_1000028 | 3300025302 | Bacteria | 483955 |
| 308 | Ga0207426_1004897 | 3300025302 | Bacteria | 6323 |
| 309 | Ga0209051_1000002 | 3300025303 | Bacteria | 1631846 |
| 310 | Ga0209051_1000343 | 3300025303 | Bacteria | 69952 |
| 311 | Ga0209051_1000618 | 3300025303 | Bacteria | 40891 |
| 312 | Ga0209051_1000665 | 3300025303 | Bacteria | 38573 |
| 313 | Ga0209051_1003457 | 3300025303 | Bacteria | 10342 |
| 314 | Ga0209051_1004603 | 3300025303 | Bacteria | 8412 |
| 315 | Ga0209051_1013868 | 3300025303 | Bacteria | 3801 |
| 316 | Ga0209257_1000002 | 3300025304 | Bacteria | 1767052 |
| 317 | Ga0209257_1000107 | 3300025304 | Bacteria | 240937 |
| 318 | Ga0209257_1000333 | 3300025304 | Bacteria | 98599 |
| 319 | Ga0209257_1000671 | 3300025304 | Bacteria | 53537 |
| 320 | Ga0209257_1001657 | 3300025304 | Bacteria | 25275 |
| 321 | Ga0209257_1001964 | 3300025304 | Bacteria | 22160 |
| 322 | Ga0209257_1002139 | 3300025304 | Bacteria | 20582 |
| 323 | Ga0209257_1011830 | 3300025304 | Bacteria | 4131 |
| 324 | Ga0207656_10030962 | 3300025321 | Bacteria | 2213 |
| 325 | Ga0207655_1004524 | 3300025728 | Bacteria | 9824 |
| 326 | Ga0207655_1009233 | 3300025728 | Bacteria | 6152 |
| 327 | Ga0207655_1016530 | 3300025728 | Bacteria | 4029 |
| 328 | Ga0207680_10238982 | 3300025903 | Bacteria | 1251 |
| 329 | Ga0207645_10145926 | 3300025907 | Bacteria | 1543 |
| 330 | Ga0207705_10041375 | 3300025909 | Bacteria | 3306 |
| 331 | Ga0207705_10153962 | 3300025909 | Bacteria | 1724 |
| 332 | Ga0207707_10372311 | 3300025912 | Bacteria | 1229 |
| 333 | Ga0207695_10289081 | 3300025913 | Bacteria | 1532 |
| 334 | Ga0207695_10310688 | 3300025913 | Bacteria | 1466 |
| 335 | Ga0207695_10323152 | 3300025913 | Bacteria | 1432 |
| 336 | Ga0207662_10111489 | 3300025918 | Bacteria | 1706 |
| 337 | Ga0207662_10160500 | 3300025918 | Bacteria | 1436 |
| 338 | Ga0207657_10018275 | 3300025919 | Bacteria | 6703 |
| 339 | Ga0207652_10065323 | 3300025921 | Bacteria | 3151 |
| 340 | Ga0207652_10069362 | 3300025921 | Bacteria | 3061 |
| 341 | Ga0207652_10616145 | 3300025921 | Bacteria | 972 |
| 342 | Ga0207652_10688677 | 3300025921 | Bacteria | 913 |
| 343 | Ga0207681_10006569 | 3300025923 | Bacteria | 7140 |
| 344 | Ga0207694_10394908 | 3300025924 | Bacteria | 1149 |
| 345 | Ga0207694_10662563 | 3300025924 | Bacteria | 880 |
| 346 | Ga0207650_10015881 | 3300025925 | Bacteria | 5253 |
| 347 | Ga0207659_10073136 | 3300025926 | Bacteria | 2509 |
| 348 | Ga0207659_10236097 | 3300025926 | Bacteria | 1477 |
| 349 | Ga0207687_10045521 | 3300025927 | Bacteria | 3033 |
| 350 | Ga0207687_10194333 | 3300025927 | Bacteria | 1581 |
| 351 | Ga0207700_10369812 | 3300025928 | Bacteria | 1251 |
| 352 | Ga0207664_10249707 | 3300025929 | Bacteria | 1548 |
| 353 | Ga0207690_10012121 | 3300025932 | Bacteria | 5157 |
| 354 | Ga0207690_10210416 | 3300025932 | Bacteria | 1482 |
| 355 | Ga0207690_10463884 | 3300025932 | Bacteria | 1020 |
| 356 | Ga0207690_10551005 | 3300025932 | Bacteria | 937 |
| 357 | Ga0207706_10007783 | 3300025933 | Bacteria | 9887 |
| 358 | Ga0207706_10267200 | 3300025933 | Bacteria | 1493 |
| 359 | Ga0207706_10270071 | 3300025933 | Bacteria | 1484 |
| 360 | Ga0207686_10010419 | 3300025934 | Bacteria | 5062 |
| 361 | Ga0207686_10028855 | 3300025934 | Bacteria | 3266 |
| 362 | Ga0207686_10600104 | 3300025934 | Bacteria | 866 |
| 363 | Ga0207709_10000425 | 3300025935 | Bacteria | 40645 |
| 364 | Ga0207709_10001100 | 3300025935 | Bacteria | 19836 |
| 365 | Ga0207709_10186361 | 3300025935 | Bacteria | 1470 |
| 366 | Ga0207670_10062321 | 3300025936 | Bacteria | 2548 |
| 367 | Ga0207669_10497107 | 3300025937 | Bacteria | 975 |
| 368 | Ga0207669_10617846 | 3300025937 | Bacteria | 883 |
| 369 | Ga0207691_10107315 | 3300025940 | Bacteria | 2486 |
| 370 | Ga0207711_10097396 | 3300025941 | Bacteria | 2597 |
| 371 | Ga0207711_10104872 | 3300025941 | Bacteria | 2506 |
| 372 | Ga0207711_10117330 | 3300025941 | Bacteria | 2373 |
| 373 | Ga0207689_10452512 | 3300025942 | Bacteria | 1073 |
| 374 | Ga0207679_10071405 | 3300025945 | Bacteria | 2619 |
| 375 | Ga0207679_10202978 | 3300025945 | Bacteria | 1657 |
| 376 | Ga0207667_10052973 | 3300025949 | Bacteria | 4271 |
| 377 | Ga0207667_10311301 | 3300025949 | Bacteria | 1608 |
| 378 | Ga0207667_10403162 | 3300025949 | Bacteria | 1392 |
| 379 | Ga0207667_10473532 | 3300025949 | Bacteria | 1271 |
| 380 | Ga0207651_10357396 | 3300025960 | Bacteria | 1232 |
| 381 | Ga0207651_10641910 | 3300025960 | Bacteria | 931 |
| 382 | Ga0207640_10145120 | 3300025981 | Bacteria | 1735 |
| 383 | Ga0207640_10413841 | 3300025981 | Bacteria | 1101 |
| 384 | Ga0207703_10030373 | 3300026035 | Bacteria | 4270 |
| 385 | Ga0207639_10082753 | 3300026041 | Bacteria | 2545 |
| 386 | Ga0207639_10097266 | 3300026041 | Bacteria | 2370 |
| 387 | Ga0207639_10514633 | 3300026041 | Bacteria | 1095 |
| 388 | Ga0207678_10149869 | 3300026067 | Bacteria | 1991 |
| 389 | Ga0207702_10248638 | 3300026078 | Bacteria | 1669 |
| 390 | Ga0207702_10418520 | 3300026078 | Bacteria | 1295 |
| 391 | Ga0207641_10253765 | 3300026088 | Bacteria | 1644 |
| 392 | Ga0207648_10008612 | 3300026089 | Bacteria | 9865 |
| 393 | Ga0207648_10082404 | 3300026089 | Bacteria | 2805 |
| 394 | Ga0207648_10268532 | 3300026089 | Bacteria | 1523 |
| 395 | Ga0207648_10309500 | 3300026089 | Bacteria | 1418 |
| 396 | Ga0207674_10075892 | 3300026116 | Bacteria | 3370 |
| 397 | Ga0207674_10317677 | 3300026116 | Bacteria | 1507 |
| 398 | Ga0207683_10111999 | 3300026121 | Bacteria | 2444 |
| 399 | Ga0207683_10170118 | 3300026121 | Bacteria | 1973 |
| 400 | Ga0207698_10050162 | 3300026142 | Bacteria | 3182 |
| 401 | Ga0207698_10075019 | 3300026142 | Bacteria | 2701 |
| 402 | Ga0207698_10119684 | 3300026142 | Bacteria | 2226 |
| 403 | Ga0207698_10384720 | 3300026142 | Bacteria | 1336 |
| 404 | Ga0209389_1032076 | 3300027296 | Bacteria | 4375 |
| 405 | Ga0209282_1000002 | 3300027666 | Bacteria | 1067825 |
| 406 | Ga0209282_1002923 | 3300027666 | Bacteria | 10039 |
| 407 | Ga0209974_10028908 | 3300027876 | Bacteria | 1836 |
| 408 | Ga0268266_10006337 | 3300028379 | Bacteria | 10847 |
| 409 | Ga0268265_10037903 | 3300028380 | Bacteria | 3541 |
| 410 | Ga0307515_10002898 | 3300028794 | Bacteria | 36447 |
| 411 | Ga0307515_10201053 | 3300028794 | Bacteria | 1868 |
| 412 | Ga0307512_10245390 | 3300030522 | Bacteria | 900 |
| 413 | Ga0316177_1102847 | 3300030731 | Bacteria | 3266 |
| 414 | Ga0316177_1113384 | 3300030731 | Bacteria | 5863 |
| 415 | Ga0316176_1137514 | 3300030732 | Bacteria | 2391 |
| 416 | Ga0314311_1096514 | 3300030733 | Bacteria | 1904 |
| 417 | Ga0316180_1082133 | 3300030736 | Bacteria | 5499 |
| 418 | Ga0316183_1124842 | 3300030742 | Bacteria | 12846 |
| 419 | Ga0316183_1151357 | 3300030742 | Bacteria | 1727 |
| 420 | Ga0316181_1114218 | 3300030744 | Bacteria | 1402 |
| 421 | Ga0316181_1266017 | 3300030744 | Bacteria | 1313 |
| 422 | Ga0316182_1250603 | 3300030745 | Bacteria | 1044 |
| 423 | Ga0316182_1422285 | 3300030745 | Bacteria | 1435 |
| 424 | Ga0265328_10020764 | 3300031239 | Bacteria | 2512 |
| 425 | Ga0265340_10005016 | 3300031247 | Bacteria | 7363 |
| 426 | Ga0265331_10028699 | 3300031250 | Bacteria | 2781 |
| 427 | Ga0265327_10000083 | 3300031251 | Bacteria | 204923 |
| 428 | Ga0265327_10001090 | 3300031251 | Bacteria | 37696 |
| 429 | Ga0265327_10086302 | 3300031251 | Bacteria | 1540 |
| 430 | Ga0307509_10024292 | 3300031507 | Bacteria | 6789 |
| 431 | Ga0307509_10053210 | 3300031507 | Bacteria | 4318 |
| 432 | Ga0307408_100000446 | 3300031548 | Bacteria | 36247 |
| 433 | Ga0307408_100001168 | 3300031548 | Bacteria | 19919 |
| 434 | Ga0307408_100007266 | 3300031548 | Bacteria | 7326 |
| 435 | Ga0307408_100016837 | 3300031548 | Bacteria | 4886 |
| 436 | Ga0307408_100020249 | 3300031548 | Bacteria | 4487 |
| 437 | Ga0307408_100059801 | 3300031548 | Bacteria | 2775 |
| 438 | Ga0307408_100437700 | 3300031548 | Bacteria | 1131 |
| 439 | Ga0307514_10079272 | 3300031649 | Bacteria | 2435 |
| 440 | Ga0307516_10402858 | 3300031730 | Bacteria | 1027 |
| 441 | Ga0307405_10013073 | 3300031731 | Bacteria | 4417 |
| 442 | Ga0307405_10054930 | 3300031731 | Bacteria | 2489 |
| 443 | Ga0307405_10148814 | 3300031731 | Bacteria | 1643 |
| 444 | Ga0307405_10151225 | 3300031731 | Bacteria | 1632 |
| 445 | Ga0307518_10033465 | 3300031838 | Bacteria | 3729 |
| 446 | Ga0307406_10000864 | 3300031901 | Bacteria | 17063 |
| 447 | Ga0307412_10011951 | 3300031911 | Bacteria | 5044 |
| 448 | Ga0307412_10018730 | 3300031911 | Bacteria | 4174 |
| 449 | Ga0307409_100519646 | 3300031995 | Bacteria | 1163 |
| 450 | Ga0307409_100535803 | 3300031995 | Bacteria | 1147 |
| 451 | Ga0307416_100306418 | 3300032002 | Bacteria | 1582 |
| 452 | Ga0307416_100736897 | 3300032002 | Bacteria | 1077 |
| 453 | Ga0307416_101157029 | 3300032002 | Bacteria | 879 |
| 454 | Ga0307414_10175610 | 3300032004 | Bacteria | 1717 |
| 455 | Ga0307414_10268447 | 3300032004 | Bacteria | 1427 |
| 456 | Ga0307414_10520637 | 3300032004 | Bacteria | 1055 |
| 457 | Ga0307414_10729228 | 3300032004 | Bacteria | 899 |
| 458 | Ga0307414_10736711 | 3300032004 | Bacteria | 895 |
| 459 | Ga0307411_10193180 | 3300032005 | Bacteria | 1556 |
| 460 | Ga0373952_0000147 | 3300035092 | Bacteria | 10390 |
| 461 | Ga0373923_0083176 | 3300035111 | Bacteria | 1391 |
| 462 | Ga0373942_0006206 | 3300035207 | Bacteria | 2760 |
| 463 | Ga0373931_0061724 | 3300035691 | Bacteria | 2022 |
| 464 | Ga0373931_0152738 | 3300035691 | Bacteria | 1347 |
| 465 | Ga0395899_0000028 | 3300037312 | Bacteria | 334378 |
| 466 | Ga0395899_0080247 | 3300037312 | Bacteria | 2375 |
| 467 | Ga0395899_0115663 | 3300037312 | Bacteria | 1925 |
| 468 | Ga0395899_0235483 | 3300037312 | Bacteria | 1262 |
| 469 | Ga0395899_0355033 | 3300037312 | Bacteria | 979 |
| 470 | Ga0395900_0004850 | 3300037418 | Bacteria | 14170 |
| 471 | Ga0395900_0164294 | 3300037418 | Bacteria | 2263 |
| 472 | Ga0395900_0374743 | 3300037418 | Bacteria | 1392 |
| 473 | Ga0395900_0745979 | 3300037418 | Bacteria | 909 |
| 474 | Ga0395898_0019113 | 3300037466 | Bacteria | 6975 |
| 475 | Ga0395898_0028733 | 3300037466 | Bacteria | 5573 |
| 476 | Ga0395898_0098824 | 3300037466 | Bacteria | 2802 |
| 477 | Ga0395898_0161107 | 3300037466 | Bacteria | 2146 |
| 478 | Ga0395898_0251897 | 3300037466 | Bacteria | 1684 |
| 479 | Ga0395898_0620781 | 3300037466 | Bacteria | 1024 |
| 480 | Ga0395905_0000811 | 3300037471 | Bacteria | 41049 |
| 481 | Ga0395905_0001473 | 3300037471 | Bacteria | 28215 |
| 482 | Ga0395905_0009721 | 3300037471 | Bacteria | 9384 |
| 483 | Ga0395905_0015426 | 3300037471 | Bacteria | 7263 |
| 484 | Ga0395905_0033102 | 3300037471 | Bacteria | 4858 |
| 485 | Ga0395905_0052461 | 3300037471 | Bacteria | 3817 |
| 486 | Ga0395905_0059933 | 3300037471 | Bacteria | 3558 |
| 487 | Ga0395905_0095398 | 3300037471 | Bacteria | 2791 |
| 488 | Ga0395905_0181281 | 3300037471 | Bacteria | 1977 |
| 489 | Ga0395905_0304829 | 3300037471 | Bacteria | 1480 |
| 490 | Ga0436364_1478795 | 3300037853 | Bacteria | 2908 |
| 491 | Ga0395901_0000551 | 3300038443 | Bacteria | 43296 |
| 492 | Ga0395901_0014806 | 3300038443 | Bacteria | 7925 |
| 493 | Ga0395901_0017358 | 3300038443 | Bacteria | 7347 |
| 494 | Ga0395901_0046520 | 3300038443 | Bacteria | 4507 |
| 495 | Ga0395901_0058900 | 3300038443 | Bacteria | 3996 |
| 496 | Ga0395901_0064151 | 3300038443 | Bacteria | 3823 |
| 497 | Ga0395901_0263219 | 3300038443 | Bacteria | 1794 |
| 498 | Ga0395901_0679437 | 3300038443 | Bacteria | 1029 |
| 499 | Ga0400489_70414 | 3300039093 | Bacteria | 1726 |
| 500 | Ga0436361_0065895 | 3300039447 | Bacteria | 15338 |
| 501 | Ga0436361_0082864 | 3300039447 | Bacteria | 107951 |
| 502 | Ga0436361_0195300 | 3300039447 | Bacteria | 3490 |
| 503 | Ga0436361_0283051 | 3300039447 | Bacteria | 6926 |
| 504 | Ga0436361_0349482 | 3300039447 | Bacteria | 149171 |
| 505 | Ga0436361_0412881 | 3300039447 | Bacteria | 12400 |
| 506 | Ga0436361_0570400 | 3300039447 | Bacteria | 111725 |
| 507 | Ga0436361_0669746 | 3300039447 | Bacteria | 73604 |
| 508 | Ga0436361_0715105 | 3300039447 | Bacteria | 7706 |
| 509 | Ga0436361_0755903 | 3300039447 | Bacteria | 56394 |
| 510 | Ga0436361_0921993 | 3300039447 | Bacteria | 2576 |
| 511 | Ga0436361_1084239 | 3300039447 | Bacteria | 8504 |
| 512 | Ga0439436_0000333 | 3300041404 | Bacteria | 11611 |
| 513 | Ga0439439_0025307 | 3300041406 | Bacteria | 1493 |
| 514 | Ga0439447_030509 | 3300041407 | Bacteria | 1358 |
| 515 | Ga0439461_0001234 | 3300041410 | Bacteria | 3901 |
| 516 | Ga0439466_0005348 | 3300041411 | Bacteria | 4909 |
| 517 | Ga0439466_0008119 | 3300041411 | Bacteria | 3957 |
| 518 | Ga0439466_0035279 | 3300041411 | Bacteria | 1692 |
| 519 | Ga0439465_0000072 | 3300041413 | Bacteria | 22229 |
| 520 | Ga0439465_0013050 | 3300041413 | Bacteria | 2595 |
| 521 | Ga0451789_0279339 | 3300041443 | Bacteria | 747 |
| 522 | Ga0451841_1018191 | 3300041498 | Bacteria | 2305 |
| 523 | Ga0439431_0000235 | 3300041997 | Bacteria | 11239 |
| 524 | Ga0439433_0000055 | 3300041999 | Bacteria | 13711 |
| 525 | Ga0439442_003249 | 3300042002 | Bacteria | 3212 |
| 526 | Ga0439442_024288 | 3300042002 | Bacteria | 1260 |
| 527 | Ga0439442_053096 | 3300042002 | Bacteria | 856 |
| 528 | Ga0439445_0000190 | 3300042004 | Bacteria | 11147 |
| 529 | Ga0439448_0001453 | 3300042005 | Bacteria | 6137 |
| 530 | Ga0439448_0126644 | 3300042005 | Bacteria | 878 |
| 531 | Ga0439432_003056 | 3300042006 | Bacteria | 6229 |
| 532 | Ga0439432_016046 | 3300042006 | Bacteria | 2523 |
| 533 | Ga0439449_0000135 | 3300042007 | Bacteria | 24942 |
| 534 | Ga0439449_0000254 | 3300042007 | Bacteria | 19110 |
| 535 | Ga0439449_0008857 | 3300042007 | Bacteria | 3818 |
| 536 | Ga0439449_0033848 | 3300042007 | Bacteria | 1903 |
| 537 | Ga0439452_003187 | 3300042010 | Bacteria | 5805 |
| 538 | Ga0439455_0007915 | 3300042012 | Bacteria | 2264 |
| 539 | Ga0439457_004905 | 3300042014 | Bacteria | 3428 |
| 540 | Ga0439457_025642 | 3300042014 | Bacteria | 1304 |
| 541 | Ga0439462_0007285 | 3300042015 | Bacteria | 2765 |
| 542 | Ga0450920_009948 | 3300042122 | Bacteria | 1758 |
| 543 | Ga0450920_046904 | 3300042122 | Bacteria | 864 |
| 544 | Ga0450923_012604 | 3300042125 | Bacteria | 1541 |
| 545 | Ga0450897_000764 | 3300042128 | Bacteria | 1939 |
| 546 | Ga0450894_001622 | 3300042131 | Bacteria | 3177 |
| 547 | Ga0450899_005005 | 3300042135 | Bacteria | 1422 |
| 548 | Ga0450899_005406 | 3300042135 | Bacteria | 1372 |
| 549 | Ga0450904_000042 | 3300042139 | Bacteria | 28290 |
| 550 | Ga0450906_004361 | 3300042145 | Bacteria | 2966 |
| 551 | Ga0450910_011646 | 3300042147 | Bacteria | 1263 |
| 552 | Ga0439446_0000384 | 3300042156 | Bacteria | 8495 |
| 553 | Ga0450908_000283 | 3300042184 | Bacteria | 10062 |
| 554 | Ga0450908_003570 | 3300042184 | Bacteria | 3029 |
| 555 | Ga0450909_007295 | 3300042185 | Bacteria | 1598 |
| 556 | Ga0439434_0011099 | 3300042435 | Bacteria | 2661 |
| 557 | Ga0439434_0016719 | 3300042435 | Bacteria | 2192 |
| 558 | Ga0439434_0017421 | 3300042435 | Bacteria | 2150 |
| 559 | Ga0439459_0002257 | 3300042438 | Bacteria | 2954 |
| 560 | Ga0450918_011672 | 3300042531 | Bacteria | 1530 |
| 561 | Ga0451577_0010581 | 3300042876 | Bacteria | 8798 |
| 562 | Ga0451577_0309719 | 3300042876 | Bacteria | 1431 |
| 563 | Ga0466969_0009184 | 3300044656 | Bacteria | 5242 |
| 564 | Ga0466969_0069770 | 3300044656 | Bacteria | 1691 |
| 565 | Ga0466969_0215674 | 3300044656 | Bacteria | 873 |
| 566 | Ga0453683_0002793 | 3300044673 | Bacteria | 13286 |
| 567 | Ga0466965_0009285 | 3300044683 | Bacteria | 4570 |
| 568 | Ga0466965_0017289 | 3300044683 | Bacteria | 3445 |
| 569 | Ga0466965_0020808 | 3300044683 | Bacteria | 3157 |
| 570 | Ga0466965_0021204 | 3300044683 | Bacteria | 3126 |
| 571 | Ga0466965_0139809 | 3300044683 | Bacteria | 1260 |
| 572 | Ga0466966_0003089 | 3300044684 | Bacteria | 10969 |
| 573 | Ga0466966_0012809 | 3300044684 | Bacteria | 5555 |
| 574 | Ga0466966_0216260 | 3300044684 | Bacteria | 1157 |
| 575 | Ga0466961_0000186 | 3300044693 | Bacteria | 41739 |
| 576 | Ga0466961_0130891 | 3300044693 | Bacteria | 1572 |
| 577 | Ga0466963_0227398 | 3300044694 | Bacteria | 1307 |
| 578 | Ga0466963_0464526 | 3300044694 | Bacteria | 893 |
| 579 | Ga0466964_0000976 | 3300044706 | Bacteria | 9479 |
| 580 | Ga0466964_0001673 | 3300044706 | Bacteria | 7652 |
| 581 | Ga0453684_0207653 | 3300044712 | Bacteria | 2278 |
| 582 | Ga0466971_0226662 | 3300044719 | Bacteria | 886 |
| 583 | Ga0466968_0189887 | 3300044735 | Bacteria | 958 |
| 584 | Ga0466970_0069538 | 3300044765 | Bacteria | 1893 |
| 585 | Ga0466960_0066633 | 3300044901 | Bacteria | 1781 |
| 586 | Ga0466959_0019572 | 3300045049 | Bacteria | 4978 |
| 587 | Ga0466959_0095938 | 3300045049 | Bacteria | 2126 |
| 588 | Ga0451576_0008365 | 3300045051 | Bacteria | 12151 |
| 589 | Ga0451576_0040933 | 3300045051 | Bacteria | 4899 |
| 590 | Ga0451576_0383934 | 3300045051 | Bacteria | 1472 |
| 591 | Ga0451576_1294922 | 3300045051 | Bacteria | 760 |
| 592 | Ga0466958_0070050 | 3300045836 | Bacteria | 2145 |
| 593 | Ga0466958_0190510 | 3300045836 | Bacteria | 1303 |
| 594 | Ga0466967_0095348 | 3300045976 | Bacteria | 2711 |
| 595 | Ga0466967_0134591 | 3300045976 | Bacteria | 2298 |
| 596 | Ga0495617_000006 | 3300046452 | Bacteria | 398279 |
| 597 | Ga0495617_000008 | 3300046452 | Bacteria | 340369 |
| 598 | Ga0495617_000181 | 3300046452 | Bacteria | 39863 |
| 599 | Ga0495617_003640 | 3300046452 | Bacteria | 5747 |
| 600 | Ga0495627_000005 | 3300046453 | Bacteria | 630805 |
| 601 | Ga0495627_000191 | 3300046453 | Bacteria | 67637 |
| 602 | Ga0495627_010430 | 3300046453 | Bacteria | 3377 |
| 603 | Ga0495627_012527 | 3300046453 | Bacteria | 3005 |
| 604 | Ga0495627_013199 | 3300046453 | Bacteria | 2911 |
| 605 | Ga0495627_022723 | 3300046453 | Bacteria | 2060 |
| 606 | Ga0495627_030465 | 3300046453 | Bacteria | 1709 |
| 607 | Ga0495603_0013530 | 3300046455 | Bacteria | 4935 |
| 608 | Ga0495603_0035438 | 3300046455 | Bacteria | 2997 |
| 609 | Ga0495603_0330373 | 3300046455 | Bacteria | 875 |
| 610 | Ga0495590_0000003 | 3300046457 | Bacteria | 478593 |
| 611 | Ga0495590_0000017 | 3300046457 | Bacteria | 216944 |
| 612 | Ga0495590_0004143 | 3300046457 | Bacteria | 5875 |
| 613 | Ga0495590_0004512 | 3300046457 | Bacteria | 5615 |
| 614 | Ga0495590_0006026 | 3300046457 | Bacteria | 4755 |
| 615 | Ga0495590_0038510 | 3300046457 | Bacteria | 1667 |
| 616 | Ga0495590_0205310 | 3300046457 | Bacteria | 725 |
| 617 | Ga0495591_000091 | 3300046458 | Bacteria | 101618 |
| 618 | Ga0495591_010708 | 3300046458 | Bacteria | 3529 |
| 619 | Ga0495629_0015125 | 3300046459 | Bacteria | 5546 |
| 620 | Ga0495629_0114108 | 3300046459 | Bacteria | 1883 |
| 621 | Ga0495638_0000118 | 3300046460 | Bacteria | 127657 |
| 622 | Ga0495638_0001982 | 3300046460 | Bacteria | 17487 |
| 623 | Ga0495638_0002148 | 3300046460 | Bacteria | 16553 |
| 624 | Ga0495638_0030426 | 3300046460 | Bacteria | 3476 |
| 625 | Ga0495638_0033813 | 3300046460 | Bacteria | 3267 |
| 626 | Ga0495638_0041204 | 3300046460 | Bacteria | 2923 |
| 627 | Ga0495638_0067056 | 3300046460 | Bacteria | 2204 |
| 628 | Ga0495638_0363337 | 3300046460 | Bacteria | 761 |
| 629 | Ga0495653_0006483 | 3300046463 | Bacteria | 9596 |
| 630 | Ga0495653_0208964 | 3300046463 | Bacteria | 1319 |
| 631 | Ga0495653_0210188 | 3300046463 | Bacteria | 1314 |
| 632 | Ga0495650_0000015 | 3300046471 | Bacteria | 557595 |
| 633 | Ga0495650_0000131 | 3300046471 | Bacteria | 174698 |
| 634 | Ga0495650_0000147 | 3300046471 | Bacteria | 160862 |
| 635 | Ga0495650_0000189 | 3300046471 | Bacteria | 133931 |
| 636 | Ga0495650_0000195 | 3300046471 | Bacteria | 131338 |
| 637 | Ga0495650_0000339 | 3300046471 | Bacteria | 83278 |
| 638 | Ga0495650_0004295 | 3300046471 | Bacteria | 9840 |
| 639 | Ga0495650_0009310 | 3300046471 | Bacteria | 5599 |
| 640 | Ga0495650_0018881 | 3300046471 | Bacteria | 3414 |
| 641 | Ga0495650_0079380 | 3300046471 | Bacteria | 1269 |
| 642 | Ga0495580_0051138 | 3300046472 | Bacteria | 2921 |
| 643 | Ga0495580_0158398 | 3300046472 | Bacteria | 1567 |
| 644 | Ga0495582_0003229 | 3300046473 | Bacteria | 9156 |
| 645 | Ga0495582_0226020 | 3300046473 | Bacteria | 1071 |
| 646 | Ga0495605_0000003 | 3300046474 | Bacteria | 491502 |
| 647 | Ga0495605_0000083 | 3300046474 | Bacteria | 124953 |
| 648 | Ga0495605_0000184 | 3300046474 | Bacteria | 77694 |
| 649 | Ga0495605_0000949 | 3300046474 | Bacteria | 19773 |
| 650 | Ga0495605_0007708 | 3300046474 | Bacteria | 6101 |
| 651 | Ga0495605_0026781 | 3300046474 | Bacteria | 2993 |
| 652 | Ga0495605_0049067 | 3300046474 | Bacteria | 2063 |
| 653 | Ga0495605_0067073 | 3300046474 | Bacteria | 1703 |
| 654 | Ga0495605_0089617 | 3300046474 | Bacteria | 1427 |
| 655 | Ga0495605_0267568 | 3300046474 | Bacteria | 728 |
| 656 | Ga0495639_0002216 | 3300046475 | Bacteria | 8552 |
| 657 | Ga0495639_0087599 | 3300046475 | Bacteria | 1457 |
| 658 | Ga0495584_0000008 | 3300046491 | Bacteria | 283067 |
| 659 | Ga0495584_0001294 | 3300046491 | Bacteria | 15218 |
| 660 | Ga0495584_0002379 | 3300046491 | Bacteria | 10693 |
| 661 | Ga0495584_0002758 | 3300046491 | Bacteria | 9816 |
| 662 | Ga0495584_0003880 | 3300046491 | Bacteria | 8101 |
| 663 | Ga0495584_0017677 | 3300046491 | Bacteria | 3628 |
| 664 | Ga0495584_0018378 | 3300046491 | Bacteria | 3552 |
| 665 | Ga0495584_0027667 | 3300046491 | Bacteria | 2873 |
| 666 | Ga0495584_0058171 | 3300046491 | Bacteria | 1945 |
| 667 | Ga0495584_0100945 | 3300046491 | Bacteria | 1458 |
| 668 | Ga0495584_0153509 | 3300046491 | Bacteria | 1170 |
| 669 | Ga0495585_0000159 | 3300046492 | Bacteria | 72318 |
| 670 | Ga0495585_0001407 | 3300046492 | Bacteria | 18938 |
| 671 | Ga0495585_0001639 | 3300046492 | Bacteria | 17119 |
| 672 | Ga0495585_0002634 | 3300046492 | Bacteria | 12641 |
| 673 | Ga0495585_0004935 | 3300046492 | Bacteria | 8530 |
| 674 | Ga0495585_0032368 | 3300046492 | Bacteria | 2962 |
| 675 | Ga0495585_0032785 | 3300046492 | Bacteria | 2941 |
| 676 | Ga0495585_0041693 | 3300046492 | Bacteria | 2573 |
| 677 | Ga0495585_0072070 | 3300046492 | Bacteria | 1882 |
| 678 | Ga0495585_0082731 | 3300046492 | Bacteria | 1737 |
| 679 | Ga0495585_0083832 | 3300046492 | Bacteria | 1724 |
| 680 | Ga0495585_0135422 | 3300046492 | Bacteria | 1293 |
| 681 | Ga0495585_0307753 | 3300046492 | Bacteria | 777 |
| 682 | Ga0495594_0003660 | 3300046499 | Bacteria | 7899 |
| 683 | Ga0495594_0005566 | 3300046499 | Bacteria | 6470 |
| 684 | Ga0495594_0022332 | 3300046499 | Bacteria | 3384 |
| 685 | Ga0495594_0027830 | 3300046499 | Bacteria | 3047 |
| 686 | Ga0495596_0004495 | 3300046500 | Bacteria | 6779 |
| 687 | Ga0495596_0007196 | 3300046500 | Bacteria | 5036 |
| 688 | Ga0495596_0012957 | 3300046500 | Bacteria | 3551 |
| 689 | Ga0495596_0015118 | 3300046500 | Bacteria | 3240 |
| 690 | Ga0495596_0038447 | 3300046500 | Bacteria | 1891 |
| 691 | Ga0495596_0042390 | 3300046500 | Bacteria | 1793 |
| 692 | Ga0495607_0000982 | 3300046501 | Bacteria | 26451 |
| 693 | Ga0495607_0001248 | 3300046501 | Bacteria | 22826 |
| 694 | Ga0495607_0002566 | 3300046501 | Bacteria | 14673 |
| 695 | Ga0495607_0003301 | 3300046501 | Bacteria | 12394 |
| 696 | Ga0495607_0004635 | 3300046501 | Bacteria | 10066 |
| 697 | Ga0495607_0007891 | 3300046501 | Bacteria | 7320 |
| 698 | Ga0495607_0013444 | 3300046501 | Bacteria | 5363 |
| 699 | Ga0495607_0032846 | 3300046501 | Bacteria | 3163 |
| 700 | Ga0495607_0077550 | 3300046501 | Bacteria | 1835 |
| 701 | Ga0495607_0089104 | 3300046501 | Bacteria | 1675 |
| 702 | Ga0495583_0000026 | 3300046506 | Bacteria | 256777 |
| 703 | Ga0495583_0000049 | 3300046506 | Bacteria | 216069 |
| 704 | Ga0495583_0000079 | 3300046506 | Bacteria | 169681 |
| 705 | Ga0495583_0000165 | 3300046506 | Bacteria | 111940 |
| 706 | Ga0495583_0000301 | 3300046506 | Bacteria | 78482 |
| 707 | Ga0495583_0000615 | 3300046506 | Bacteria | 48092 |
| 708 | Ga0495583_0001880 | 3300046506 | Bacteria | 19520 |
| 709 | Ga0495583_0003090 | 3300046506 | Bacteria | 13174 |
| 710 | Ga0495583_0004713 | 3300046506 | Bacteria | 9594 |
| 711 | Ga0495583_0018084 | 3300046506 | Bacteria | 3722 |
| 712 | Ga0495583_0022172 | 3300046506 | Bacteria | 3247 |
| 713 | Ga0495583_0027765 | 3300046506 | Bacteria | 2789 |
| 714 | Ga0495583_0028432 | 3300046506 | Bacteria | 2748 |
| 715 | Ga0495583_0035623 | 3300046506 | Bacteria | 2374 |
| 716 | Ga0495583_0038010 | 3300046506 | Bacteria | 2277 |
| 717 | Ga0495583_0091099 | 3300046506 | Bacteria | 1312 |
| 718 | Ga0495606_0000068 | 3300046507 | Bacteria | 179653 |
| 719 | Ga0495606_0000185 | 3300046507 | Bacteria | 109977 |
| 720 | Ga0495606_0000345 | 3300046507 | Bacteria | 79767 |
| 721 | Ga0495606_0000650 | 3300046507 | Bacteria | 54709 |
| 722 | Ga0495606_0001149 | 3300046507 | Bacteria | 37553 |
| 723 | Ga0495606_0001239 | 3300046507 | Bacteria | 35637 |
| 724 | Ga0495606_0002011 | 3300046507 | Bacteria | 24980 |
| 725 | Ga0495606_0002106 | 3300046507 | Bacteria | 24222 |
| 726 | Ga0495606_0004703 | 3300046507 | Bacteria | 13468 |
| 727 | Ga0495606_0008579 | 3300046507 | Bacteria | 8843 |
| 728 | Ga0495606_0025046 | 3300046507 | Bacteria | 4282 |
| 729 | Ga0495606_0049582 | 3300046507 | Bacteria | 2752 |
| 730 | Ga0495606_0050580 | 3300046507 | Bacteria | 2717 |
| 731 | Ga0495606_0062167 | 3300046507 | Bacteria | 2385 |
| 732 | Ga0495606_0090506 | 3300046507 | Bacteria | 1883 |
| 733 | Ga0495610_0000004 | 3300046512 | Bacteria | 1006135 |
| 734 | Ga0495610_0001058 | 3300046512 | Bacteria | 25288 |
| 735 | Ga0495610_0001361 | 3300046512 | Bacteria | 21713 |
| 736 | Ga0495610_0003372 | 3300046512 | Bacteria | 12502 |
| 737 | Ga0495610_0016743 | 3300046512 | Bacteria | 4208 |
| 738 | Ga0495610_0017601 | 3300046512 | Bacteria | 4068 |
| 739 | Ga0495610_0041930 | 3300046512 | Bacteria | 2293 |
| 740 | Ga0495610_0076209 | 3300046512 | Bacteria | 1551 |
| 741 | Ga0495610_0090970 | 3300046512 | Bacteria | 1383 |
| 742 | Ga0495616_0000042 | 3300046513 | Bacteria | 120923 |
| 743 | Ga0495616_0000395 | 3300046513 | Bacteria | 33694 |
| 744 | Ga0495616_0000694 | 3300046513 | Bacteria | 24922 |
| 745 | Ga0495616_0002414 | 3300046513 | Bacteria | 12434 |
| 746 | Ga0495616_0004085 | 3300046513 | Bacteria | 9263 |
| 747 | Ga0495616_0030515 | 3300046513 | Bacteria | 2833 |
| 748 | Ga0495616_0042107 | 3300046513 | Bacteria | 2326 |
| 749 | Ga0495616_0059779 | 3300046513 | Bacteria | 1873 |
| 750 | Ga0495616_0089833 | 3300046513 | Bacteria | 1456 |
| 751 | Ga0495616_0102929 | 3300046513 | Bacteria | 1337 |
| 752 | Ga0495616_0110476 | 3300046513 | Bacteria | 1277 |
| 753 | Ga0495620_0005295 | 3300046515 | Bacteria | 7215 |
| 754 | Ga0495620_0173030 | 3300046515 | Bacteria | 836 |
| 755 | Ga0495630_0090599 | 3300046517 | Bacteria | 2310 |
| 756 | Ga0495630_0117029 | 3300046517 | Bacteria | 2020 |
| 757 | Ga0495631_0000228 | 3300046518 | Bacteria | 38440 |
| 758 | Ga0495631_0001731 | 3300046518 | Bacteria | 12966 |
| 759 | Ga0495631_0004132 | 3300046518 | Bacteria | 7787 |
| 760 | Ga0495631_0010178 | 3300046518 | Bacteria | 4665 |
| 761 | Ga0495631_0016503 | 3300046518 | Bacteria | 3518 |
| 762 | Ga0495631_0043813 | 3300046518 | Bacteria | 1973 |
| 763 | Ga0495631_0069145 | 3300046518 | Bacteria | 1527 |
| 764 | Ga0495631_0080908 | 3300046518 | Bacteria | 1401 |
| 765 | Ga0495632_0000065 | 3300046519 | Bacteria | 116086 |
| 766 | Ga0495632_0000155 | 3300046519 | Bacteria | 70814 |
| 767 | Ga0495632_0000476 | 3300046519 | Bacteria | 38017 |
| 768 | Ga0495632_0000934 | 3300046519 | Bacteria | 25619 |
| 769 | Ga0495632_0002365 | 3300046519 | Bacteria | 14429 |
| 770 | Ga0495632_0018366 | 3300046519 | Bacteria | 3838 |
| 771 | Ga0495632_0030965 | 3300046519 | Bacteria | 2771 |
| 772 | Ga0495632_0059646 | 3300046519 | Bacteria | 1856 |
| 773 | Ga0495632_0082038 | 3300046519 | Bacteria | 1537 |
| 774 | Ga0495632_0126101 | 3300046519 | Bacteria | 1193 |
| 775 | Ga0495637_0000281 | 3300046520 | Bacteria | 39852 |
| 776 | Ga0495637_0001371 | 3300046520 | Bacteria | 14609 |
| 777 | Ga0495637_0005539 | 3300046520 | Bacteria | 6411 |
| 778 | Ga0495637_0006672 | 3300046520 | Bacteria | 5780 |
| 779 | Ga0495637_0009184 | 3300046520 | Bacteria | 4826 |
| 780 | Ga0495637_0033017 | 3300046520 | Bacteria | 2276 |
| 781 | Ga0495637_0046202 | 3300046520 | Bacteria | 1843 |
| 782 | Ga0495643_0000106 | 3300046522 | Bacteria | 138657 |
| 783 | Ga0495643_0000417 | 3300046522 | Bacteria | 55799 |
| 784 | Ga0495643_0000653 | 3300046522 | Bacteria | 41007 |
| 785 | Ga0495643_0000792 | 3300046522 | Bacteria | 35101 |
| 786 | Ga0495643_0000798 | 3300046522 | Bacteria | 34846 |
| 787 | Ga0495643_0003931 | 3300046522 | Bacteria | 10645 |
| 788 | Ga0495643_0018930 | 3300046522 | Bacteria | 3988 |
| 789 | Ga0495643_0042824 | 3300046522 | Bacteria | 2465 |
| 790 | Ga0495643_0044883 | 3300046522 | Bacteria | 2400 |
| 791 | Ga0495643_0076345 | 3300046522 | Bacteria | 1752 |
| 792 | Ga0495643_0086747 | 3300046522 | Bacteria | 1621 |
| 793 | Ga0495644_0001181 | 3300046523 | Bacteria | 10694 |
| 794 | Ga0495644_0002400 | 3300046523 | Bacteria | 7474 |
| 795 | Ga0495644_0010071 | 3300046523 | Bacteria | 3642 |
| 796 | Ga0495644_0011983 | 3300046523 | Bacteria | 3331 |
| 797 | Ga0495644_0012194 | 3300046523 | Bacteria | 3304 |
| 798 | Ga0495644_0048526 | 3300046523 | Bacteria | 1594 |
| 799 | Ga0495644_0061910 | 3300046523 | Bacteria | 1406 |
| 800 | Ga0495644_0215599 | 3300046523 | Bacteria | 741 |
| 801 | Ga0495648_0000055 | 3300046524 | Bacteria | 158686 |
| 802 | Ga0495648_0000070 | 3300046524 | Bacteria | 136680 |
| 803 | Ga0495648_0000807 | 3300046524 | Bacteria | 33208 |
| 804 | Ga0495648_0001050 | 3300046524 | Bacteria | 28021 |
| 805 | Ga0495648_0001715 | 3300046524 | Bacteria | 21171 |
| 806 | Ga0495648_0001752 | 3300046524 | Bacteria | 20979 |
| 807 | Ga0495648_0007473 | 3300046524 | Bacteria | 8739 |
| 808 | Ga0495648_0012736 | 3300046524 | Bacteria | 6249 |
| 809 | Ga0495648_0019149 | 3300046524 | Bacteria | 4825 |
| 810 | Ga0495648_0022274 | 3300046524 | Bacteria | 4365 |
| 811 | Ga0495648_0025287 | 3300046524 | Bacteria | 4022 |
| 812 | Ga0495648_0027763 | 3300046524 | Bacteria | 3783 |
| 813 | Ga0495648_0049531 | 3300046524 | Bacteria | 2574 |
| 814 | Ga0495648_0061393 | 3300046524 | Bacteria | 2232 |
| 815 | Ga0495663_0004309 | 3300046525 | Bacteria | 4009 |
| 816 | Ga0495663_0007498 | 3300046525 | Bacteria | 3017 |
| 817 | Ga0495663_0059277 | 3300046525 | Bacteria | 1201 |
| 818 | Ga0495663_0083624 | 3300046525 | Bacteria | 1031 |
| 819 | Ga0495666_0000191 | 3300046526 | Bacteria | 26321 |
| 820 | Ga0495666_0009730 | 3300046526 | Bacteria | 4804 |
| 821 | Ga0495666_0017781 | 3300046526 | Bacteria | 3540 |
| 822 | Ga0495666_0111281 | 3300046526 | Bacteria | 1286 |
| 823 | Ga0495642_0000376 | 3300046528 | Bacteria | 24226 |
| 824 | Ga0495642_0004461 | 3300046528 | Bacteria | 5431 |
| 825 | Ga0495642_0006415 | 3300046528 | Bacteria | 4512 |
| 826 | Ga0495642_0007548 | 3300046528 | Bacteria | 4166 |
| 827 | Ga0495642_0013474 | 3300046528 | Bacteria | 3162 |
| 828 | Ga0495642_0014314 | 3300046528 | Bacteria | 3073 |
| 829 | Ga0495642_0016642 | 3300046528 | Bacteria | 2868 |
| 830 | Ga0495642_0044172 | 3300046528 | Bacteria | 1818 |
| 831 | Ga0495642_0051328 | 3300046528 | Bacteria | 1696 |
| 832 | Ga0495642_0059104 | 3300046528 | Bacteria | 1588 |
| 833 | Ga0495642_0063647 | 3300046528 | Bacteria | 1533 |
| 834 | Ga0495642_0065624 | 3300046528 | Bacteria | 1511 |
| 835 | Ga0495642_0088016 | 3300046528 | Bacteria | 1312 |
| 836 | Ga0495652_0007892 | 3300046529 | Bacteria | 9772 |
| 837 | Ga0495652_0086558 | 3300046529 | Bacteria | 2572 |
| 838 | Ga0495654_0000035 | 3300046530 | Bacteria | 192768 |
| 839 | Ga0495654_0002939 | 3300046530 | Bacteria | 10669 |
| 840 | Ga0495654_0007918 | 3300046530 | Bacteria | 5908 |
| 841 | Ga0495654_0021948 | 3300046530 | Bacteria | 3319 |
| 842 | Ga0495654_0025901 | 3300046530 | Bacteria | 3020 |
| 843 | Ga0495654_0054915 | 3300046530 | Bacteria | 1930 |
| 844 | Ga0495654_0127670 | 3300046530 | Bacteria | 1144 |
| 845 | Ga0495665_0000579 | 3300046531 | Bacteria | 18637 |
| 846 | Ga0495665_0058964 | 3300046531 | Bacteria | 2026 |
| 847 | Ga0495586_0015584 | 3300046535 | Bacteria | 4044 |
| 848 | Ga0495586_0074212 | 3300046535 | Bacteria | 1861 |
| 849 | Ga0495609_0000002 | 3300046538 | Bacteria | 739816 |
| 850 | Ga0495609_0002255 | 3300046538 | Bacteria | 12026 |
| 851 | Ga0495609_0003201 | 3300046538 | Bacteria | 9510 |
| 852 | Ga0495609_0005670 | 3300046538 | Bacteria | 6500 |
| 853 | Ga0495609_0009486 | 3300046538 | Bacteria | 4707 |
| 854 | Ga0495609_0020559 | 3300046538 | Bacteria | 3049 |
| 855 | Ga0495609_0035605 | 3300046538 | Bacteria | 2252 |
| 856 | Ga0495609_0035737 | 3300046538 | Bacteria | 2247 |
| 857 | Ga0495609_0066770 | 3300046538 | Bacteria | 1584 |
| 858 | Ga0495609_0076781 | 3300046538 | Bacteria | 1463 |
| 859 | Ga0495609_0094363 | 3300046538 | Bacteria | 1299 |
| 860 | Ga0495609_0175104 | 3300046538 | Bacteria | 904 |
| 861 | Ga0495621_0004628 | 3300046539 | Bacteria | 3889 |
| 862 | Ga0495621_0023711 | 3300046539 | Bacteria | 2043 |
| 863 | Ga0495621_0052958 | 3300046539 | Bacteria | 1456 |
| 864 | Ga0495597_0000656 | 3300046542 | Bacteria | 28086 |
| 865 | Ga0495597_0000770 | 3300046542 | Bacteria | 25349 |
| 866 | Ga0495597_0001497 | 3300046542 | Bacteria | 16714 |
| 867 | Ga0495597_0006143 | 3300046542 | Bacteria | 6247 |
| 868 | Ga0495597_0006807 | 3300046542 | Bacteria | 5876 |
| 869 | Ga0495597_0019166 | 3300046542 | Bacteria | 3203 |
| 870 | Ga0495597_0020596 | 3300046542 | Bacteria | 3070 |
| 871 | Ga0495597_0024339 | 3300046542 | Bacteria | 2796 |
| 872 | Ga0495597_0247375 | 3300046542 | Bacteria | 701 |
| 873 | Ga0495645_0018376 | 3300046543 | Bacteria | 5019 |
| 874 | Ga0495645_0247881 | 3300046543 | Bacteria | 1185 |
| 875 | Ga0495622_0001144 | 3300046557 | Bacteria | 13830 |
| 876 | Ga0495622_0002556 | 3300046557 | Bacteria | 8793 |
| 877 | Ga0495622_0030061 | 3300046557 | Bacteria | 2538 |
| 878 | Ga0495622_0034568 | 3300046557 | Bacteria | 2358 |
| 879 | Ga0495622_0062496 | 3300046557 | Bacteria | 1723 |
| 880 | Ga0495633_0000164 | 3300046558 | Bacteria | 87086 |
| 881 | Ga0495633_0001230 | 3300046558 | Bacteria | 20537 |
| 882 | Ga0495633_0004437 | 3300046558 | Bacteria | 8929 |
| 883 | Ga0495633_0014037 | 3300046558 | Bacteria | 4200 |
| 884 | Ga0495633_0021203 | 3300046558 | Bacteria | 3252 |
| 885 | Ga0495633_0021768 | 3300046558 | Bacteria | 3201 |
| 886 | Ga0495633_0030004 | 3300046558 | Bacteria | 2643 |
| 887 | Ga0495633_0078254 | 3300046558 | Bacteria | 1539 |
| 888 | Ga0495633_0130031 | 3300046558 | Bacteria | 1165 |
| 889 | Ga0495667_0062092 | 3300046559 | Bacteria | 2449 |
| 890 | Ga0495656_0000184 | 3300046615 | Bacteria | 22413 |
| 891 | Ga0495656_0039298 | 3300046615 | Bacteria | 1964 |
| 892 | Ga0495656_0039929 | 3300046615 | Bacteria | 1953 |
| 893 | Ga0495656_0059687 | 3300046615 | Bacteria | 1660 |
| 894 | Ga0495656_0161458 | 3300046615 | Bacteria | 1089 |
| 895 | Ga0495656_0246771 | 3300046615 | Bacteria | 901 |
| 896 | Ga0495668_0000094 | 3300046616 | Bacteria | 141412 |
| 897 | Ga0495668_0000104 | 3300046616 | Bacteria | 134968 |
| 898 | Ga0495668_0000865 | 3300046616 | Bacteria | 34113 |
| 899 | Ga0495668_0001664 | 3300046616 | Bacteria | 20682 |
| 900 | Ga0495668_0002283 | 3300046616 | Bacteria | 16113 |
| 901 | Ga0495668_0004387 | 3300046616 | Bacteria | 10054 |
| 902 | Ga0495668_0011158 | 3300046616 | Bacteria | 5396 |
| 903 | Ga0495668_0017455 | 3300046616 | Bacteria | 4161 |
| 904 | Ga0495668_0020584 | 3300046616 | Bacteria | 3792 |
| 905 | Ga0495668_0022941 | 3300046616 | Bacteria | 3564 |
| 906 | Ga0495668_0024814 | 3300046616 | Bacteria | 3409 |
| 907 | Ga0495668_0093216 | 3300046616 | Bacteria | 1649 |
| 908 | Ga0495668_0173644 | 3300046616 | Bacteria | 1181 |
| 909 | Ga0495634_0030606 | 3300046642 | Bacteria | 3716 |
| 910 | Ga0495611_0000157 | 3300046648 | Bacteria | 48892 |
| 911 | Ga0495611_0002084 | 3300046648 | Bacteria | 9400 |
| 912 | Ga0495611_0010425 | 3300046648 | Bacteria | 3932 |
| 913 | Ga0495611_0018978 | 3300046648 | Bacteria | 2952 |
| 914 | Ga0495611_0021596 | 3300046648 | Bacteria | 2780 |
| 915 | Ga0495611_0207151 | 3300046648 | Bacteria | 914 |
| 916 | Ga0495625_0000038 | 3300046660 | Bacteria | 211808 |
| 917 | Ga0495625_0000044 | 3300046660 | Bacteria | 203855 |
| 918 | Ga0495625_0000335 | 3300046660 | Bacteria | 71730 |
| 919 | Ga0495625_0002328 | 3300046660 | Bacteria | 20765 |
| 920 | Ga0495625_0010789 | 3300046660 | Bacteria | 7520 |
| 921 | Ga0495625_0017421 | 3300046660 | Bacteria | 5625 |
| 922 | Ga0495625_0026929 | 3300046660 | Bacteria | 4335 |
| 923 | Ga0495625_0062562 | 3300046660 | Bacteria | 2630 |
| 924 | Ga0495625_0080807 | 3300046660 | Bacteria | 2263 |
| 925 | Ga0495625_0084238 | 3300046660 | Bacteria | 2208 |
| 926 | Ga0495625_0095870 | 3300046660 | Bacteria | 2044 |
| 927 | Ga0495625_0548477 | 3300046660 | Bacteria | 700 |
| 928 | Ga0495625_0577945 | 3300046660 | Bacteria | 677 |
| 929 | Ga0495635_0119065 | 3300046663 | Bacteria | 1802 |
| 930 | Ga0495635_0221081 | 3300046663 | Bacteria | 1281 |
| 931 | Ga0495635_0367416 | 3300046663 | Bacteria | 958 |
| 932 | Ga0495659_0000204 | 3300046664 | Bacteria | 25590 |
| 933 | Ga0495659_0004423 | 3300046664 | Bacteria | 4425 |
| 934 | Ga0495659_0041718 | 3300046664 | Bacteria | 1640 |
| 935 | Ga0495659_0115132 | 3300046664 | Bacteria | 1053 |
| 936 | Ga0495661_0000149 | 3300046665 | Bacteria | 81455 |
| 937 | Ga0495661_0001612 | 3300046665 | Bacteria | 18484 |
| 938 | Ga0495661_0005402 | 3300046665 | Bacteria | 9085 |
| 939 | Ga0495661_0008766 | 3300046665 | Bacteria | 6979 |
| 940 | Ga0495661_0023769 | 3300046665 | Bacteria | 3974 |
| 941 | Ga0495661_0031146 | 3300046665 | Bacteria | 3388 |
| 942 | Ga0495661_0035738 | 3300046665 | Bacteria | 3115 |
| 943 | Ga0495661_0048168 | 3300046665 | Bacteria | 2590 |
| 944 | Ga0495661_0052068 | 3300046665 | Bacteria | 2468 |
| 945 | Ga0495661_0066224 | 3300046665 | Bacteria | 2127 |
| 946 | Ga0495661_0117579 | 3300046665 | Bacteria | 1472 |
| 947 | Ga0495661_0258093 | 3300046665 | Bacteria | 886 |
| 948 | Ga0495588_0000245 | 3300046674 | Bacteria | 45623 |
| 949 | Ga0495588_0013099 | 3300046674 | Bacteria | 3942 |
| 950 | Ga0495588_0019611 | 3300046674 | Bacteria | 3314 |
| 951 | Ga0495588_0035055 | 3300046674 | Bacteria | 2541 |
| 952 | Ga0495588_0043228 | 3300046674 | Bacteria | 2305 |
| 953 | Ga0495588_0080913 | 3300046674 | Bacteria | 1695 |
| 954 | Ga0495588_0084515 | 3300046674 | Bacteria | 1658 |
| 955 | Ga0495588_0096530 | 3300046674 | Bacteria | 1550 |
| 956 | Ga0495588_0117375 | 3300046674 | Bacteria | 1402 |
| 957 | Ga0495588_0136152 | 3300046674 | Bacteria | 1296 |
| 958 | Ga0495588_0232606 | 3300046674 | Bacteria | 972 |
| 959 | Ga0495588_0295902 | 3300046674 | Bacteria | 852 |
| 960 | Ga0495657_0314692 | 3300046675 | Bacteria | 931 |
| 961 | Ga0495623_0037757 | 3300046679 | Bacteria | 3089 |
| 962 | Ga0495623_0083346 | 3300046679 | Bacteria | 1975 |
| 963 | Ga0495623_0088281 | 3300046679 | Bacteria | 1909 |
| 964 | Ga0495623_0096875 | 3300046679 | Bacteria | 1802 |
| 965 | Ga0495646_0057326 | 3300046680 | Bacteria | 2332 |
| 966 | Ga0495646_0081104 | 3300046680 | Bacteria | 1891 |
| 967 | Ga0495658_0185694 | 3300046683 | Bacteria | 1291 |
| 968 | Ga0495669_0000108 | 3300046684 | Bacteria | 53418 |
| 969 | Ga0495669_0002705 | 3300046684 | Bacteria | 7265 |
| 970 | Ga0495669_0025697 | 3300046684 | Bacteria | 2569 |
| 971 | Ga0495669_0076370 | 3300046684 | Bacteria | 1533 |
| 972 | Ga0495669_0102761 | 3300046684 | Bacteria | 1328 |
| 973 | Ga0495669_0241752 | 3300046684 | Bacteria | 866 |
| 974 | Ga0495613_0018048 | 3300046689 | Bacteria | 5258 |
| 975 | Ga0495613_0099291 | 3300046689 | Bacteria | 2103 |
| 976 | Ga0495624_0200999 | 3300046690 | Bacteria | 1211 |
| 977 | Ga0495670_0002374 | 3300046691 | Bacteria | 9265 |
| 978 | Ga0495670_0002798 | 3300046691 | Bacteria | 8631 |
| 979 | Ga0495670_0003871 | 3300046691 | Bacteria | 7351 |
| 980 | Ga0495670_0034793 | 3300046691 | Bacteria | 2510 |
| 981 | Ga0495670_0067909 | 3300046691 | Bacteria | 1800 |
| 982 | Ga0495670_0082015 | 3300046691 | Bacteria | 1643 |
| 983 | Ga0495670_0109148 | 3300046691 | Bacteria | 1430 |
| 984 | Ga0495670_0299735 | 3300046691 | Bacteria | 861 |
| 985 | Ga0495671_0000001 | 3300046692 | Bacteria | 1169494 |
| 986 | Ga0495671_0000109 | 3300046692 | Bacteria | 74002 |
| 987 | Ga0495671_0000228 | 3300046692 | Bacteria | 48268 |
| 988 | Ga0495671_0004274 | 3300046692 | Bacteria | 8580 |
| 989 | Ga0495671_0005357 | 3300046692 | Bacteria | 7528 |
| 990 | Ga0495671_0027657 | 3300046692 | Bacteria | 2926 |
| 991 | Ga0495671_0033851 | 3300046692 | Bacteria | 2601 |
| 992 | Ga0495671_0082593 | 3300046692 | Bacteria | 1574 |
| 993 | Ga0495649_0000326 | 3300046694 | Bacteria | 41384 |
| 994 | Ga0495649_0003055 | 3300046694 | Bacteria | 11464 |
| 995 | Ga0495649_0005429 | 3300046694 | Bacteria | 8110 |
| 996 | Ga0495649_0007802 | 3300046694 | Bacteria | 6491 |
| 997 | Ga0495649_0007839 | 3300046694 | Bacteria | 6466 |
| 998 | Ga0495649_0024587 | 3300046694 | Bacteria | 3357 |
| 999 | Ga0495649_0044443 | 3300046694 | Bacteria | 2425 |
| 1000 | Ga0495649_0075295 | 3300046694 | Bacteria | 1808 |
| 1001 | Ga0495649_0106332 | 3300046694 | Bacteria | 1489 |
| 1002 | Ga0495649_0331830 | 3300046694 | Bacteria | 770 |
| 1003 | Ga0495589_0000009 | 3300046794 | Bacteria | 256265 |
| 1004 | Ga0495589_0000062 | 3300046794 | Bacteria | 104349 |
| 1005 | Ga0495589_0000153 | 3300046794 | Bacteria | 63596 |
| 1006 | Ga0495589_0009570 | 3300046794 | Bacteria | 5038 |
| 1007 | Ga0495589_0010537 | 3300046794 | Bacteria | 4805 |
| 1008 | Ga0495589_0024597 | 3300046794 | Bacteria | 3060 |
| 1009 | Ga0495589_0040238 | 3300046794 | Bacteria | 2334 |
| 1010 | Ga0495589_0070105 | 3300046794 | Bacteria | 1714 |
| 1011 | Ga0495589_0113578 | 3300046794 | Bacteria | 1306 |
| 1012 | Ga0495589_0180722 | 3300046794 | Bacteria | 1000 |
| 1013 | Ga0495600_0023871 | 3300046809 | Bacteria | 3934 |
| 1014 | Ga0495660_0000082 | 3300046810 | Bacteria | 101508 |
| 1015 | Ga0495660_0000716 | 3300046810 | Bacteria | 25359 |
| 1016 | Ga0495660_0001543 | 3300046810 | Bacteria | 15508 |
| 1017 | Ga0495660_0009811 | 3300046810 | Bacteria | 5576 |
| 1018 | Ga0495660_0014318 | 3300046810 | Bacteria | 4592 |
| 1019 | Ga0495660_0045363 | 3300046810 | Bacteria | 2413 |
| 1020 | Ga0495660_0049177 | 3300046810 | Bacteria | 2303 |
| 1021 | Ga0495660_0064752 | 3300046810 | Bacteria | 1952 |
| 1022 | Ga0495660_0065943 | 3300046810 | Bacteria | 1931 |
| 1023 | Ga0495660_0078530 | 3300046810 | Bacteria | 1735 |
| 1024 | Ga0495660_0185687 | 3300046810 | Bacteria | 1002 |
| 1025 | Ga0495581_0091440 | 3300047315 | Bacteria | 1765 |
| 1026 | Ga0495581_0104580 | 3300047315 | Bacteria | 1645 |
| 1027 | Ga0495581_0154575 | 3300047315 | Bacteria | 1340 |
| 1028 | Ga0495581_0320671 | 3300047315 | Bacteria | 905 |
| 1029 | Ga0495604_0049360 | 3300047317 | Bacteria | 3270 |
| 1030 | Ga0495604_0140406 | 3300047317 | Bacteria | 1726 |
| 1031 | Ga0495636_0000379 | 3300047318 | Bacteria | 16746 |
| 1032 | Ga0495636_0004307 | 3300047318 | Bacteria | 5585 |
| 1033 | Ga0495636_0005717 | 3300047318 | Bacteria | 4874 |
| 1034 | Ga0495636_0031241 | 3300047318 | Bacteria | 2182 |
| 1035 | Ga0495636_0035538 | 3300047318 | Bacteria | 2052 |
| 1036 | Ga0495636_0267941 | 3300047318 | Bacteria | 793 |
| 1037 | Ga0495672_0000032 | 3300047320 | Bacteria | 295356 |
| 1038 | Ga0495672_0000098 | 3300047320 | Bacteria | 141277 |
| 1039 | Ga0495672_0000236 | 3300047320 | Bacteria | 78296 |
| 1040 | Ga0495672_0000244 | 3300047320 | Bacteria | 76463 |
| 1041 | Ga0495672_0000272 | 3300047320 | Bacteria | 71551 |
| 1042 | Ga0495672_0000316 | 3300047320 | Bacteria | 64226 |
| 1043 | Ga0495672_0001208 | 3300047320 | Bacteria | 26051 |
| 1044 | Ga0495672_0011075 | 3300047320 | Bacteria | 6384 |
| 1045 | Ga0495672_0018606 | 3300047320 | Bacteria | 4605 |
| 1046 | Ga0495672_0061315 | 3300047320 | Bacteria | 2168 |
| 1047 | Ga0495672_0154716 | 3300047320 | Bacteria | 1185 |
| 1048 | Ga0495676_0000296 | 3300047321 | Bacteria | 40331 |
| 1049 | Ga0495676_0014815 | 3300047321 | Bacteria | 6962 |
| 1050 | Ga0495676_0016422 | 3300047321 | Bacteria | 6571 |
| 1051 | Ga0495676_0020517 | 3300047321 | Bacteria | 5795 |
| 1052 | Ga0495676_0110069 | 3300047321 | Bacteria | 2023 |
| 1053 | Ga0495683_0000247 | 3300047323 | Bacteria | 48691 |
| 1054 | Ga0495683_0000923 | 3300047323 | Bacteria | 20721 |
| 1055 | Ga0495683_0002926 | 3300047323 | Bacteria | 10109 |
| 1056 | Ga0495683_0003240 | 3300047323 | Bacteria | 9514 |
| 1057 | Ga0495683_0003731 | 3300047323 | Bacteria | 8816 |
| 1058 | Ga0495683_0005473 | 3300047323 | Bacteria | 7043 |
| 1059 | Ga0495683_0038293 | 3300047323 | Bacteria | 2428 |
| 1060 | Ga0495683_0065997 | 3300047323 | Bacteria | 1784 |
| 1061 | Ga0495683_0092101 | 3300047323 | Bacteria | 1467 |
| 1062 | Ga0495683_0095175 | 3300047323 | Bacteria | 1438 |
| 1063 | Ga0495683_0165637 | 3300047323 | Bacteria | 1019 |
| 1064 | Ga0495687_000013 | 3300047443 | Bacteria | 371058 |
| 1065 | Ga0495687_000063 | 3300047443 | Bacteria | 169101 |
| 1066 | Ga0495687_000064 | 3300047443 | Bacteria | 163468 |
| 1067 | Ga0495687_000173 | 3300047443 | Bacteria | 95361 |
| 1068 | Ga0495687_000589 | 3300047443 | Bacteria | 42402 |
| 1069 | Ga0495687_000939 | 3300047443 | Bacteria | 30095 |
| 1070 | Ga0495687_002034 | 3300047443 | Bacteria | 17090 |
| 1071 | Ga0495675_0059301 | 3300047444 | Bacteria | 2426 |
| 1072 | Ga0495677_0000043 | 3300047445 | Bacteria | 75056 |
| 1073 | Ga0495677_0000610 | 3300047445 | Bacteria | 14617 |
| 1074 | Ga0495677_0003220 | 3300047445 | Bacteria | 6368 |
| 1075 | Ga0495677_0004191 | 3300047445 | Bacteria | 5560 |
| 1076 | Ga0495677_0014151 | 3300047445 | Bacteria | 2906 |
| 1077 | Ga0495677_0048616 | 3300047445 | Bacteria | 1558 |
| 1078 | Ga0495677_0058386 | 3300047445 | Bacteria | 1427 |
| 1079 | Ga0495677_0079406 | 3300047445 | Bacteria | 1228 |
| 1080 | Ga0495677_0190687 | 3300047445 | Bacteria | 796 |
| 1081 | Ga0495679_000520 | 3300047446 | Bacteria | 27232 |
| 1082 | Ga0495679_019508 | 3300047446 | Bacteria | 2380 |
| 1083 | Ga0495679_022687 | 3300047446 | Bacteria | 2144 |
| 1084 | Ga0495679_027836 | 3300047446 | Bacteria | 1859 |
| 1085 | Ga0495685_000027 | 3300047447 | Bacteria | 62875 |
| 1086 | Ga0495685_035467 | 3300047447 | Bacteria | 1714 |
| 1087 | Ga0495685_125215 | 3300047447 | Bacteria | 842 |
| 1088 | Ga0495673_0000006 | 3300047469 | Bacteria | 908691 |
| 1089 | Ga0495673_0000014 | 3300047469 | Bacteria | 599202 |
| 1090 | Ga0495673_0000090 | 3300047469 | Bacteria | 188187 |
| 1091 | Ga0495673_0020986 | 3300047469 | Bacteria | 3237 |
| 1092 | Ga0495673_0037598 | 3300047469 | Bacteria | 2209 |
| 1093 | Ga0495681_0000266 | 3300047470 | Bacteria | 41789 |
| 1094 | Ga0495681_0000573 | 3300047470 | Bacteria | 28131 |
| 1095 | Ga0495681_0002781 | 3300047470 | Bacteria | 12383 |
| 1096 | Ga0495681_0008662 | 3300047470 | Bacteria | 6352 |
| 1097 | Ga0495681_0008859 | 3300047470 | Bacteria | 6254 |
| 1098 | Ga0495681_0018573 | 3300047470 | Bacteria | 3828 |
| 1099 | Ga0495681_0072031 | 3300047470 | Bacteria | 1563 |
| 1100 | Ga0495686_0000225 | 3300047472 | Bacteria | 104121 |
| 1101 | Ga0495686_0000672 | 3300047472 | Bacteria | 46206 |
| 1102 | Ga0495686_0001200 | 3300047472 | Bacteria | 29911 |
| 1103 | Ga0495686_0001524 | 3300047472 | Bacteria | 24912 |
| 1104 | Ga0495686_0002471 | 3300047472 | Bacteria | 17405 |
| 1105 | Ga0495686_0007591 | 3300047472 | Bacteria | 8102 |
| 1106 | Ga0495686_0023543 | 3300047472 | Bacteria | 4061 |
| 1107 | Ga0495686_0067506 | 3300047472 | Bacteria | 2207 |
| 1108 | Ga0495593_0007756 | 3300047673 | Bacteria | 6256 |
| 1109 | Ga0495593_0016871 | 3300047673 | Bacteria | 4111 |
| 1110 | Ga0495593_0048511 | 3300047673 | Bacteria | 2256 |
| 1111 | Ga0495602_0006654 | 3300048088 | Bacteria | 12114 |
| 1112 | Ga0495602_0069762 | 3300048088 | Bacteria | 3011 |
| 1113 | Ga0495614_0004411 | 3300048089 | Bacteria | 6345 |
| 1114 | Ga0495615_0003239 | 3300048090 | Bacteria | 2704 |
| 1115 | Ga0495615_0017482 | 3300048090 | Bacteria | 1563 |
| 1116 | Ga0495626_0000003 | 3300048091 | Bacteria | 427774 |
| 1117 | Ga0495626_0000733 | 3300048091 | Bacteria | 30516 |
| 1118 | Ga0495626_0001553 | 3300048091 | Bacteria | 18015 |
| 1119 | Ga0495626_0002765 | 3300048091 | Bacteria | 11765 |
| 1120 | Ga0495626_0003541 | 3300048091 | Bacteria | 9978 |
| 1121 | Ga0495626_0006784 | 3300048091 | Bacteria | 6473 |
| 1122 | Ga0495626_0008582 | 3300048091 | Bacteria | 5585 |
| 1123 | Ga0495626_0008881 | 3300048091 | Bacteria | 5461 |
| 1124 | Ga0495626_0010830 | 3300048091 | Bacteria | 4843 |
| 1125 | Ga0495626_0016993 | 3300048091 | Bacteria | 3682 |
| 1126 | Ga0495626_0017167 | 3300048091 | Bacteria | 3661 |
| 1127 | Ga0495626_0024413 | 3300048091 | Bacteria | 2963 |
| 1128 | Ga0495626_0040095 | 3300048091 | Bacteria | 2213 |
| 1129 | Ga0495626_0042451 | 3300048091 | Bacteria | 2136 |
| 1130 | Ga0495626_0051187 | 3300048091 | Bacteria | 1905 |
| 1131 | Ga0495626_0062223 | 3300048091 | Bacteria | 1695 |
| 1132 | Ga0495626_0091555 | 3300048091 | Bacteria | 1336 |
| 1133 | Ga0495626_0144099 | 3300048091 | Bacteria | 1008 |
| 1134 | Ga0495626_0146670 | 3300048091 | Bacteria | 997 |
| 1135 | Ga0495626_0197094 | 3300048091 | Bacteria | 827 |
| 1136 | Ga0496100_0130197 | 3300048903 | Bacteria | 1771 |
| 1137 | Ga0496100_0193668 | 3300048903 | Bacteria | 1477 |
| 1138 | Ga0496101_0003681 | 3300048904 | Bacteria | 9567 |
| 1139 | Ga0496101_0056025 | 3300048904 | Bacteria | 2849 |
| 1140 | Ga0496101_0099187 | 3300048904 | Bacteria | 2177 |
| 1141 | Ga0496102_0000407 | 3300048905 | Bacteria | 49858 |
| 1142 | Ga0496102_0001834 | 3300048905 | Bacteria | 18352 |
| 1143 | Ga0496102_0012505 | 3300048905 | Bacteria | 7349 |
| 1144 | Ga0496102_0032567 | 3300048905 | Bacteria | 4683 |
| 1145 | Ga0496102_0097668 | 3300048905 | Bacteria | 2724 |
| 1146 | Ga0496102_0694474 | 3300048905 | Bacteria | 940 |
| 1147 | Ga0496102_0790248 | 3300048905 | Bacteria | 871 |
| 1148 | Ga0496103_0092063 | 3300048906 | Bacteria | 1914 |
| 1149 | Ga0496103_0145605 | 3300048906 | Bacteria | 1516 |
| 1150 | Ga0496103_0456548 | 3300048906 | Bacteria | 819 |
| 1151 | Ga0496104_0008803 | 3300048907 | Bacteria | 8972 |
| 1152 | Ga0496104_0164681 | 3300048907 | Bacteria | 2126 |
| 1153 | Ga0496104_0499747 | 3300048907 | Bacteria | 1127 |
| 1154 | Ga0496105_0162220 | 3300048908 | Bacteria | 1835 |
| 1155 | Ga0496106_0025756 | 3300048909 | Bacteria | 4377 |
| 1156 | Ga0496106_0100786 | 3300048909 | Bacteria | 2240 |
| 1157 | Ga0496107_0408106 | 3300048910 | Bacteria | 1010 |
| 1158 | Ga0496108_0069677 | 3300048911 | Bacteria | 2968 |
| 1159 | Ga0496108_0078438 | 3300048911 | Bacteria | 2795 |
| 1160 | Ga0496108_0232757 | 3300048911 | Bacteria | 1602 |
| 1161 | Ga0496109_0141910 | 3300048912 | Bacteria | 2246 |
| 1162 | Ga0496109_0710623 | 3300048912 | Bacteria | 942 |
| 1163 | Ga0496109_0749910 | 3300048912 | Bacteria | 914 |
| 1164 | Ga0496110_0000226 | 3300048913 | Bacteria | 36613 |
| 1165 | Ga0496110_0084403 | 3300048913 | Bacteria | 2834 |
| 1166 | Ga0496111_0088022 | 3300048914 | Bacteria | 2274 |
| 1167 | Ga0496112_0161737 | 3300048915 | Bacteria | 2205 |
| 1168 | Ga0496112_1120245 | 3300048915 | Bacteria | 705 |
| 1169 | Ga0496114_0009548 | 3300048917 | Bacteria | 7700 |
| 1170 | Ga0496114_0398241 | 3300048917 | Bacteria | 1219 |
| 1171 | Ga0496115_0037025 | 3300048918 | Bacteria | 3865 |
| 1172 | Ga0496115_0550593 | 3300048918 | Bacteria | 922 |
| 1173 | Ga0496116_0031449 | 3300048919 | Bacteria | 3799 |
| 1174 | Ga0496116_0097897 | 3300048919 | Bacteria | 1762 |
| 1175 | Ga0496116_0156966 | 3300048919 | Bacteria | 1254 |
| 1176 | Ga0496116_0248871 | 3300048919 | Bacteria | 886 |
| 1177 | Ga0496117_0011194 | 3300048920 | Bacteria | 8056 |
| 1178 | Ga0496118_0005647 | 3300048921 | Bacteria | 14107 |
| 1179 | Ga0496118_0043877 | 3300048921 | Bacteria | 3508 |
| 1180 | Ga0496118_0176967 | 3300048921 | Bacteria | 1295 |
| 1181 | Ga0496119_0299238 | 3300048922 | Bacteria | 794 |
| 1182 | Ga0496121_0095753 | 3300048924 | Bacteria | 2306 |
| 1183 | Ga0496121_0345531 | 3300048924 | Bacteria | 993 |
| 1184 | Ga0496122_0000034 | 3300048925 | Bacteria | 320661 |
| 1185 | Ga0496122_0000210 | 3300048925 | Bacteria | 130178 |
| 1186 | Ga0496122_0001371 | 3300048925 | Bacteria | 39650 |
| 1187 | Ga0496122_0023266 | 3300048925 | Bacteria | 5471 |
| 1188 | Ga0496122_0052243 | 3300048925 | Bacteria | 3096 |
| 1189 | Ga0496122_0182675 | 3300048925 | Bacteria | 1249 |
| 1190 | Ga0496123_0000141 | 3300048926 | Bacteria | 147111 |
| 1191 | Ga0496123_0000597 | 3300048926 | Bacteria | 61302 |
| 1192 | Ga0496123_0007555 | 3300048926 | Bacteria | 10187 |
| 1193 | Ga0496123_0009027 | 3300048926 | Bacteria | 9041 |
| 1194 | Ga0496123_0134471 | 3300048926 | Bacteria | 1363 |
| 1195 | Ga0496123_0243180 | 3300048926 | Bacteria | 892 |
| 1196 | Ga0496124_0023549 | 3300048927 | Bacteria | 5620 |
| 1197 | Ga0496124_0031199 | 3300048927 | Bacteria | 4721 |
| 1198 | Ga0496124_0090641 | 3300048927 | Bacteria | 2493 |
| 1199 | Ga0496124_0101386 | 3300048927 | Bacteria | 2332 |
| 1200 | Ga0496124_0180977 | 3300048927 | Bacteria | 1622 |
| 1201 | Ga0496124_0191340 | 3300048927 | Bacteria | 1565 |
| 1202 | Ga0496124_0542426 | 3300048927 | Bacteria | 770 |
| 1203 | Ga0496125_0000789 | 3300048928 | Bacteria | 51669 |
| 1204 | Ga0496126_0027791 | 3300048929 | Bacteria | 5397 |
| 1205 | Ga0496126_0293789 | 3300048929 | Bacteria | 1343 |
| 1206 | Ga0496126_0503829 | 3300048929 | Bacteria | 967 |
| 1207 | Ga0495678_000016 | 3300049459 | Bacteria | 303426 |
| 1208 | Ga0495678_000153 | 3300049459 | Bacteria | 83461 |
| 1209 | Ga0495678_000284 | 3300049459 | Bacteria | 55655 |
| 1210 | Ga0495678_000330 | 3300049459 | Bacteria | 50079 |
| 1211 | Ga0495678_001967 | 3300049459 | Bacteria | 14806 |
| 1212 | Ga0495678_002471 | 3300049459 | Bacteria | 12478 |
| 1213 | Ga0495678_008825 | 3300049459 | Bacteria | 5043 |
| 1214 | Ga0495678_011714 | 3300049459 | Bacteria | 4187 |
| 1215 | Ga0495678_012024 | 3300049459 | Bacteria | 4118 |
| 1216 | Ga0495678_129640 | 3300049459 | Bacteria | 837 |
| 1217 | Ga0495678_133239 | 3300049459 | Bacteria | 821 |
| 1218 | Ga0495682_0005588 | 3300049460 | Bacteria | 5204 |
| 1219 | Ga0495682_0014799 | 3300049460 | Bacteria | 2957 |
| 1220 | Ga0495682_0021404 | 3300049460 | Bacteria | 2422 |
| 1221 | Ga0495682_0162017 | 3300049460 | Bacteria | 796 |
| 1222 | Ga0501313_001575 | 3300049529 | Bacteria | 2022 |
| 1223 | Ga0501032_0397969 | 3300049569 | Bacteria | 885 |
| 1224 | Ga0501032_0413007 | 3300049569 | Bacteria | 866 |
| 1225 | Ga0501034_0044672 | 3300049571 | Bacteria | 4479 |
| 1226 | Ga0501036_0035603 | 3300049572 | Bacteria | 4212 |
| 1227 | Ga0501036_0332016 | 3300049572 | Bacteria | 1270 |
| 1228 | Ga0501038_0194877 | 3300049574 | Bacteria | 1629 |
| 1229 | Ga0501040_0110602 | 3300049576 | Bacteria | 1921 |
| 1230 | Ga0501043_0000108 | 3300049579 | Bacteria | 77329 |
| 1231 | Ga0501043_0292338 | 3300049579 | Bacteria | 1247 |
| 1232 | Ga0501046_0000050 | 3300049580 | Bacteria | 134922 |
| 1233 | Ga0501046_0155915 | 3300049580 | Bacteria | 1720 |
| 1234 | Ga0501047_0000012 | 3300049581 | Bacteria | 368824 |
| 1235 | Ga0501047_0222681 | 3300049581 | Bacteria | 1742 |
| 1236 | Ga0501048_0000695 | 3300049582 | Bacteria | 24464 |
| 1237 | Ga0501048_0229175 | 3300049582 | Bacteria | 1318 |
| 1238 | Ga0501068_0086951 | 3300049584 | Bacteria | 1925 |
| 1239 | Ga0501072_0016664 | 3300049588 | Bacteria | 5644 |
| 1240 | Ga0501073_0192850 | 3300049589 | Bacteria | 1410 |
| 1241 | Ga0501074_0649801 | 3300049590 | Bacteria | 745 |
| 1242 | Ga0501222_009934 | 3300049662 | Bacteria | 1257 |
| 1243 | Ga0501249_020799 | 3300049679 | Bacteria | 1429 |
| 1244 | Ga0501225_0007229 | 3300049705 | Bacteria | 3223 |
| 1245 | Ga0501080_0321235 | 3300049742 | Bacteria | 1401 |
| 1246 | Ga0501080_0535524 | 3300049742 | Bacteria | 1044 |
| 1247 | Ga0501081_0016309 | 3300049743 | Bacteria | 4910 |
| 1248 | Ga0501241_019337 | 3300049758 | Bacteria | 1250 |
| 1249 | Ga0501262_001175 | 3300049759 | Bacteria | 2965 |
| 1250 | Ga0501269_000282 | 3300049766 | Bacteria | 14169 |
| 1251 | Ga0501279_006907 | 3300049775 | Bacteria | 1503 |
| 1252 | Ga0501044_0034715 | 3300049823 | Bacteria | 5287 |
| 1253 | Ga0501045_0004835 | 3300049824 | Bacteria | 9319 |
| 1254 | Ga0501045_0074503 | 3300049824 | Bacteria | 2499 |
| 1255 | nmdc:mga03683_10301_c1 | 3300050489 | Bacteria | 3351 |
| 1256 | nmdc:mga03683_3723_c1 | 3300050489 | Bacteria | 4970 |
| 1257 | nmdc:mga03n38_34599_c1 | 3300050490 | Bacteria | 2159 |
| 1258 | nmdc:mga00v17_1720_c1 | 3300050491 | Bacteria | 11368 |
| 1259 | nmdc:mga0yw44_4298_c1 | 3300050492 | Bacteria | 6502 |
| 1260 | nmdc:mga0yw44_9677_c1 | 3300050492 | Bacteria | 4892 |
| 1261 | nmdc:mga0k408_129432_c1 | 3300050493 | Bacteria | 1498 |
| 1262 | nmdc:mga0k408_20318_c1 | 3300050493 | Bacteria | 3719 |
| 1263 | nmdc:mga0k408_2939_c1 | 3300050493 | Bacteria | 9034 |
| 1264 | nmdc:mga0k408_36383_c1 | 3300050493 | Bacteria | 1785 |
| 1265 | nmdc:mga0k408_36483_c1 | 3300050493 | Bacteria | 2822 |
| 1266 | nmdc:mga0k408_4515_c2 | 3300050493 | Bacteria | 5258 |
| 1267 | nmdc:mga07m45_185456_c1 | 3300050496 | Bacteria | 1210 |
| 1268 | nmdc:mga07m45_611_c1 | 3300050496 | Bacteria | 15206 |
| 1269 | nmdc:mga07m45_7294_c1 | 3300050496 | Bacteria | 5641 |
| 1270 | nmdc:mga0n895_119263_c1 | 3300050512 | Bacteria | 2659 |
| 1271 | nmdc:mga0rr50_217718_c1 | 3300050513 | Bacteria | 1576 |
| 1272 | nmdc:mga08x19_2421_c1 | 3300050514 | Bacteria | 11326 |
| 1273 | nmdc:mga0sz30_293882_c1 | 3300050516 | Bacteria | 724 |
| 1274 | Ga0500610_0000863 | 3300053079 | Bacteria | 9710 |
| 1275 | Ga0500610_0002219 | 3300053079 | Bacteria | 7031 |
| 1276 | Ga0500610_0033809 | 3300053079 | Bacteria | 2612 |
| 1277 | Ga0500578_0001334 | 3300053086 | Bacteria | 25244 |
| 1278 | Ga0500643_004104 | 3300053087 | Bacteria | 6712 |
| 1279 | Ga0500651_0000097 | 3300053093 | Bacteria | 53876 |
| 1280 | Ga0500566_0041641 | 3300053094 | Bacteria | 2652 |
| 1281 | Ga0500555_037566 | 3300053103 | Bacteria | 1356 |
| 1282 | Ga0500562_110527 | 3300053108 | Bacteria | 749 |
| 1283 | Ga0500571_000190 | 3300053110 | Bacteria | 22258 |
| 1284 | Ga0500593_000202 | 3300053117 | Bacteria | 24296 |
| 1285 | Ga0500594_0008916 | 3300053118 | Bacteria | 2298 |
| 1286 | Ga0500607_000181 | 3300053121 | Bacteria | 56273 |
| 1287 | Ga0500608_032284 | 3300053122 | Bacteria | 2487 |
| 1288 | Ga0500608_098022 | 3300053122 | Bacteria | 1361 |
| 1289 | Ga0500618_002212 | 3300053125 | Bacteria | 7606 |
| 1290 | Ga0500626_010486 | 3300053128 | Bacteria | 3895 |
| 1291 | Ga0500655_003364 | 3300053133 | Bacteria | 2893 |
| 1292 | Ga0500658_0000521 | 3300053134 | Bacteria | 16260 |
| 1293 | Ga0500658_0000753 | 3300053134 | Bacteria | 13371 |
| 1294 | Ga0500559_0001463 | 3300053136 | Bacteria | 13371 |
| 1295 | Ga0500559_0013536 | 3300053136 | Bacteria | 3452 |
| 1296 | Ga0500559_0019274 | 3300053136 | Bacteria | 2883 |
| 1297 | Ga0500564_035058 | 3300053138 | Bacteria | 2316 |
| 1298 | Ga0500568_0002122 | 3300053139 | Bacteria | 11970 |
| 1299 | Ga0500573_0039643 | 3300053140 | Bacteria | 2721 |
| 1300 | Ga0500574_048069 | 3300053141 | Bacteria | 1211 |
| 1301 | Ga0500604_0005739 | 3300053151 | Bacteria | 3279 |
| 1302 | Ga0500619_098524 | 3300053154 | Bacteria | 991 |
| 1303 | Ga0500627_0004369 | 3300053158 | Bacteria | 4530 |
| 1304 | Ga0500634_0012204 | 3300053161 | Bacteria | 4466 |
| 1305 | Ga0500634_0012879 | 3300053161 | Bacteria | 4369 |
| 1306 | Ga0500634_0045507 | 3300053161 | Bacteria | 2374 |
| 1307 | Ga0500636_0141804 | 3300053177 | Bacteria | 1329 |
| 1308 | Ga0500636_0200247 | 3300053177 | Bacteria | 1057 |
| 1309 | Ga0501084_0033108 | 3300054114 | Bacteria | 4323 |
| 1310 | Ga0501082_0063318 | 3300060353 | Bacteria | 3184 |
| 1311 | Ga0530510_0026313 | 3300061734 | Bacteria | 4163 |
| 1312 | 2509388073 | 2509276021 | Bacteria | 7634384 |
| 1313 | 2513229561 | 2513020051 | Bacteria | 6053213 |
| 1314 | 2548497730 | 2547132374 | Bacteria | 5530232 |
| 1315 | 2587725607 | 2585428057 | Bacteria | 6737412 |
| 1316 | 2599623552 | 2599185214 | Bacteria | 8209958 |
| 1317 | 2599671830 | 2599185226 | Bacteria | 8233575 |
| 1318 | 2599681157 | 2599185227 | Bacteria | 8246414 |
| 1319 | 2599693439 | 2599185229 | Bacteria | 8216126 |
| 1320 | 2643789083 | 2643221554 | Bacteria | 6603920 |
| 1321 | 2643798429 | 2643221556 | Bacteria | 7251154 |
| 1322 | 2643971207 | 2643221592 | Bacteria | 6608788 |
| 1323 | 2643990115 | 2643221596 | Bacteria | 5006805 |
| 1324 | 2644160722 | 2643221628 | Bacteria | 5745828 |
| 1325 | 2644213915 | 2643221638 | Bacteria | 6579467 |
| 1326 | 2644254033 | 2643221645 | Bacteria | 7207331 |
| 1327 | 2644327521 | 2643221658 | Bacteria | 6064537 |
| 1328 | 2644356802 | 2643221664 | Bacteria | 7272945 |
| 1329 | 2644401561 | 2643221672 | Bacteria | 6322190 |
| 1330 | 2644468078 | 2643221683 | Bacteria | 5749203 |
| 1331 | 2644475433 | 2643221684 | Bacteria | 7145183 |
| 1332 | 2644645138 | 2643221717 | Bacteria | 5676132 |
| 1333 | 2738717628 | 2738541277 | Bacteria | 7458140 |
| 1334 | 2738742011 | 2738541280 | Bacteria | 6630198 |
| 1335 | 2738747687 | 2738541281 | Bacteria | 5112672 |
| 1336 | 2738824949 | 2738541297 | Bacteria | 6549566 |
| 1337 | 2738844464 | 2738541300 | Bacteria | 6675882 |
| 1338 | 2738879243 | 2738541307 | Bacteria | 8606193 |
| 1339 | 2739148746 | 2738541357 | Bacteria | 6549408 |
| 1340 | 2739190665 | 2738543003 | Bacteria | 6549560 |
| 1341 | 2739248122 | 2738543013 | Bacteria | 5618633 |
| 1342 | 2739277042 | 2738543018 | Bacteria | 6718814 |
| 1343 | 2739278314 | 2738543019 | Bacteria | 7459457 |
| 1344 | 2739317142 | 2738543026 | Bacteria | 6549408 |
| 1345 | 2739335383 | 2738543029 | Bacteria | 6549249 |
| 1346 | 2739346017 | 2738543030 | Bacteria | 6719714 |
| 1347 | 2739356950 | 2738543032 | Bacteria | 5115625 |
| 1348 | 2809144845 | 2808606418 | Bacteria | 6724496 |
| 1349 | 2819597118 | 2818991446 | Bacteria | 7757362 |
| 1350 | 2831266237 | 2831265667 | Bacteria | 7184833 |
| 1351 | 2831864943 | 2831864461 | Bacteria | 6502356 |
| 1352 | 2838057653 | 2838054893 | Bacteria | 7451788 |
| 1353 | 2842368599 | 2842363717 | Bacteria | 6844742 |
| 1354 | 2842678929 | 2842677519 | Bacteria | 5615038 |
| 1355 | 2842699548 | 2842698319 | Bacteria | 5190321 |
| 1356 | 2842716834 | 2842711865 | Bacteria | 7155354 |
| 1357 | 2842735183 | 2842733646 | Bacteria | 5716726 |
| 1358 | 2842751073 | 2842747753 | Bacteria | 5578255 |
| 1359 | 2857553680 | 2857553236 | Bacteria | 6166726 |
| 1360 | 2857561233 | 2857558681 | Bacteria | 6617694 |
| 1361 | 2857565352 | 2857564685 | Bacteria | 6290584 |
| 1362 | 2885192392 | 2885192300 | Bacteria | 5882526 |
| 1363 | 2885204354 | 2885198086 | Bacteria | 7212419 |
| 1364 | 2885218007 | 2885211737 | Bacteria | 7212420 |
| 1365 | 2886851715 | 2886848708 | Bacteria | 5632523 |
| 1366 | 2899930141 | 2899924645 | Bacteria | 7487985 |
| 1367 | 2904426664 | 2904424332 | Bacteria | 7633521 |
| 1368 | 2904456186 | 2904449895 | Bacteria | 6927402 |
| 1369 | 2904457736 | 2904456579 | Bacteria | 6819253 |
| 1370 | 2904543476 | 2904541872 | Bacteria | 8915136 |
| 1371 | 2919467529 | 2919462493 | Bacteria | 5817112 |
| 1372 | 2919480306 | 2919476304 | Bacteria | 5888696 |
| 1373 | 2928039254 | 2928037797 | Bacteria | 7273642 |
| 1374 | 2928045141 | 2928044640 | Bacteria | 7271509 |
| 1375 | 2928052947 | 2928051484 | Bacteria | 7773759 |
| 1376 | 2928064382 | 2928064002 | Bacteria | 7419480 |
| 1377 | 2928071835 | 2928070936 | Bacteria | 8062541 |
| 1378 | 2928084228 | 2928084124 | Bacteria | 7159212 |
| 1379 | 2928116334 | 2928115317 | Bacteria | 6477646 |
| 1380 | 2929162989 | 2929160207 | Bacteria | 9075316 |
| 1381 | 2929527220 | 2929520902 | Bacteria | 6765052 |
| 1382 | 2945911459 | 2945909444 | Bacteria | 7065066 |
| 1383 | 2945947635 | 2945945610 | Bacteria | 5951079 |
| 1384 | 2945977502 | 2945972063 | Bacteria | 6086495 |
| 1385 | 2945986233 | 2945984333 | Bacteria | 7358892 |
| 1386 | 2954772521 | 2954767861 | Bacteria | 5535784 |
| 1387 | 2990711169 | 2990710928 | Bacteria | 5002431 |
| 1388 | 8047674276 | 8047673197 | Bacteria | 7395230 |
| 1389 | 8057161515 | 8057160832 | Bacteria | 3268302 |
| 1390 | Ga0500622_0009139 | |||
| 1391 | JGI24740J21852_10032511 | |||
| 1392 | JGI25154J39366_1001311 | |||
| 1393 | JGI25158J39367_1017892 | |||
| 1394 | JGI25152J39213_1021523 | |||
| 1395 | JGI25150J39212_1001139 | |||
| 1396 | JGI25150J39212_1006853 | |||
| 1397 | JGI25159J45721_1002152 | |||
| 1398 | JGI25151J46595_10003411 | |||
| 1399 | JGI25151J46595_10008465 | |||
| 1400 | JGI25153J46596_10064191 | |||
| 1401 | rootH1_10007233 | |||
| 1402 | rootH2_10031368 | |||
| 1403 | rootL2_10002108 | |||
| 1404 | rootL2_10045051 | |||
| 1405 | rootL2_10087294 | |||
| 1406 | rootH1_10004227 | |||
| 1407 | JGI25160J50197_1009062 | |||
| 1408 | JGI25161J50226_1001836 | |||
| 1409 | Ga0007417J51691_1007451 | |||
| 1410 | Ga0007410J51695_1012132 | |||
| 1411 | Ga0006562J51391_1043541 | |||
| 1412 | Ga0006562J51391_1043542 | |||
| 1413 | Ga0055525_1000011 | |||
| 1414 | Ga0055525_1000073 | |||
| 1415 | Ga0055535_1000364 | |||
| 1416 | Ga0055542_1000114 | |||
| 1417 | Ga0055529_1000208 | |||
| 1418 | Ga0055526_1000077 | |||
| 1419 | Ga0055526_1000094 | |||
| 1420 | Ga0055526_1005930 | |||
| 1421 | Ga0055526_1019641 | |||
| 1422 | Ga0055526_1029088 | |||
| 1423 | Ga0055537_1000484 | |||
| 1424 | Ga0055537_1007829 | |||
| 1425 | Ga0055524_1000007 | |||
| 1426 | Ga0055524_1000334 | |||
| 1427 | Ga0055524_1004119 | |||
| 1428 | Ga0055524_1004131 | |||
| 1429 | Ga0055524_1004645 | |||
| 1430 | Ga0055524_1008878 | |||
| 1431 | Ga0055536_1007729 | |||
| 1432 | Ga0055534_1000406 | |||
| 1433 | Ga0055534_1005715 | |||
| 1434 | Ga0055528_1000813 | |||
| 1435 | Ga0055528_1013114 | |||
| 1436 | Ga0055528_1024492 | |||
| 1437 | Ga0055530_10000777 | |||
| 1438 | Ga0055530_10018320 | |||
| 1439 | Ga0055540_1001349 | |||
| 1440 | Ga0055540_1007393 | |||
| 1441 | Ga0055540_1017711 | |||
| 1442 | Ga0055531_10001441 | |||
| 1443 | Ga0055531_10009422 | |||
| 1444 | Ga0055543_1000748 | |||
| 1445 | Ga0055543_1003842 | |||
| 1446 | Ga0055543_1004175 | |||
| 1447 | Ga0065165_1000006 | |||
| 1448 | Ga0065165_1000094 | |||
| 1449 | Ga0065165_1000230 | |||
| 1450 | Ga0065165_1001757 | |||
| 1451 | Ga0065165_1005587 | |||
| 1452 | Ga0065165_1044083 | |||
| 1453 | Ga0070658_10473481 | |||
| 1454 | Ga0070676_10070202 | |||
| 1455 | Ga0070670_100017063 | |||
| 1456 | Ga0068869_100189670 | |||
| 1457 | Ga0070680_100185989 | |||
| 1458 | Ga0070660_100009975 | |||
| 1459 | Ga0070660_100050280 | |||
| 1460 | Ga0070689_100063108 | |||
| 1461 | Ga0070661_100139450 | |||
| 1462 | Ga0070669_100135351 | |||
| 1463 | Ga0070675_100095515 | |||
| 1464 | Ga0070675_100466587 | |||
| 1465 | Ga0070674_100019524 | |||
| 1466 | Ga0070674_100851233 | |||
| 1467 | Ga0070674_101019359 | |||
| 1468 | Ga0070673_100043327 | |||
| 1469 | Ga0070673_100336762 | |||
| 1470 | Ga0070659_100010185 | |||
| 1471 | Ga0070659_100116362 | |||
| 1472 | Ga0070659_100450851 | |||
| 1473 | Ga0070667_100500683 | |||
| 1474 | Ga0070714_100215054 | |||
| 1475 | Ga0070713_100698833 | |||
| 1476 | Ga0070678_100537024 | |||
| 1477 | Ga0070662_100012605 | |||
| 1478 | Ga0070681_10189700 | |||
| 1479 | Ga0068867_100920952 | |||
| 1480 | Ga0070698_100413980 | |||
| 1481 | Ga0070679_100014542 | |||
| 1482 | Ga0070679_100036197 | |||
| 1483 | Ga0070679_100444670 | |||
| 1484 | Ga0070697_100473017 | |||
| 1485 | Ga0068853_100042996 | |||
| 1486 | Ga0068853_100120354 | |||
| 1487 | Ga0068853_100549350 | |||
| 1488 | Ga0070672_100540710 | |||
| 1489 | Ga0070693_100071609 | |||
| 1490 | Ga0070665_100055825 | |||
| 1491 | Ga0068855_100007205 | |||
| 1492 | Ga0068855_100162276 | |||
| 1493 | Ga0068855_100385629 | |||
| 1494 | Ga0070664_100026610 | |||
| 1495 | Ga0070664_100256320 | |||
| 1496 | Ga0068857_100053870 | |||
| 1497 | Ga0068857_100139021 | |||
| 1498 | Ga0068854_100583919 | |||
| 1499 | Ga0068852_100096885 | |||
| 1500 | Ga0068852_100147171 | |||
| 1501 | Ga0068852_100164392 | |||
| 1502 | Ga0068851_10046197 | |||
| 1503 | Ga0068858_100041447 | |||
| 1504 | Ga0068862_100093797 | |||
| 1505 | Ga0068862_100253613 | |||
| 1506 | Ga0081539_10050675 | |||
| 1507 | Ga0075365_10026402 | |||
| 1508 | Ga0075365_10055877 | |||
| 1509 | Ga0075365_10135617 | |||
| 1510 | Ga0075363_100008149 | |||
| 1511 | Ga0075363_100052055 | |||
| 1512 | Ga0075362_10019634 | |||
| 1513 | Ga0075362_10020895 | |||
| 1514 | Ga0075362_10046340 | |||
| 1515 | Ga0075367_10120451 | |||
| 1516 | Ga0075367_10180060 | |||
| 1517 | Ga0075369_10237729 | |||
| 1518 | Ga0075369_10285862 | |||
| 1519 | Ga0075366_10002796 | |||
| 1520 | Ga0075366_10018902 | |||
| 1521 | Ga0075366_10113145 | |||
| 1522 | Ga0075366_10165338 | |||
| 1523 | Ga0075366_10323073 | |||
| 1524 | Ga0075370_10000200 | |||
| 1525 | Ga0075370_10002669 | |||
| 1526 | Ga0075370_10031904 | |||
| 1527 | Ga0075370_10033873 | |||
| 1528 | Ga0075370_10072254 | |||
| 1529 | Ga0075370_10376921 | |||
| 1530 | Ga0068871_100137347 | |||
| 1531 | Ga0075431_100480821 | |||
| 1532 | Ga0075434_100045544 | |||
| 1533 | Ga0068865_100318757 | |||
| 1534 | Ga0075436_100005826 | |||
| 1535 | Ga0099823_1004022 | |||
| 1536 | Ga0079104_1005131 | |||
| 1537 | Ga0079104_1018383 | |||
| 1538 | Ga0099826_10000003 | |||
| 1539 | Ga0099826_10001182 | |||
| 1540 | Ga0075435_100106252 | |||
| 1541 | Ga0105244_10005211 | |||
| 1542 | Ga0105244_10007865 | |||
| 1543 | Ga0105244_10057774 | |||
| 1544 | Ga0105240_10013928 | |||
| 1545 | Ga0105240_10135868 | |||
| 1546 | Ga0105240_10279076 | |||
| 1547 | Ga0105245_10417428 | |||
| 1548 | Ga0105245_10476637 | |||
| 1549 | Ga0105245_10831844 | |||
| 1550 | Ga0105243_10003393 | |||
| 1551 | Ga0105243_10004657 | |||
| 1552 | Ga0105243_10107021 | |||
| 1553 | Ga0105243_10145657 | |||
| 1554 | Ga0105241_10065294 | |||
| 1555 | Ga0105242_10003383 | |||
| 1556 | Ga0105242_10014082 | |||
| 1557 | Ga0105242_10017712 | |||
| 1558 | Ga0105242_10639476 | |||
| 1559 | Ga0105248_10016344 | |||
| 1560 | Ga0105248_10269634 | |||
| 1561 | Ga0105237_10084896 | |||
| 1562 | Ga0105238_10008824 | |||
| 1563 | Ga0105238_10144266 | |||
| 1564 | Ga0105238_10231255 | |||
| 1565 | Ga0105238_11187362 | |||
| 1566 | Ga0105249_10308991 | |||
| 1567 | Ga0105239_10033491 | |||
| 1568 | Ga0157319_1000012 | |||
| 1569 | Ga0157373_10025544 | |||
| 1570 | Ga0157373_10107377 | |||
| 1571 | Ga0157371_10000001 | |||
| 1572 | Ga0157371_10104225 | |||
| 1573 | Ga0157370_10011376 | |||
| 1574 | Ga0157370_10094025 | |||
| 1575 | Ga0157370_10235209 | |||
| 1576 | Ga0157370_10571025 | |||
| 1577 | Ga0157369_10193073 | |||
| 1578 | Ga0157378_10649905 | |||
| 1579 | Ga0163162_10121755 | |||
| 1580 | Ga0163162_10146915 | |||
| 1581 | Ga0163162_10595176 | |||
| 1582 | Ga0157375_10175896 | |||
| 1583 | Ga0163163_10754812 | |||
| 1584 | Ga0157380_10110521 | |||
| 1585 | Ga0157380_10626639 | |||
| 1586 | Ga0157380_10681473 | |||
| 1587 | Ga0182008_10000893 | |||
| 1588 | Ga0182008_10003192 | |||
| 1589 | Ga0182008_10010607 | |||
| 1590 | Ga0182008_10021377 | |||
| 1591 | Ga0182008_10021606 | |||
| 1592 | Ga0157379_10250271 | |||
| 1593 | Ga0157379_10314606 | |||
| 1594 | Ga0182006_1000021 | |||
| 1595 | Ga0182006_1001088 | |||
| 1596 | Ga0182006_1068286 | |||
| 1597 | Ga0182007_10012859 | |||
| 1598 | Ga0182007_10022091 | |||
| 1599 | Ga0182007_10025460 | |||
| 1600 | Ga0182007_10048705 | |||
| 1601 | Ga0182005_1000020 | |||
| 1602 | Ga0183362_10001 | |||
| 1603 | Ga0163161_10000193 | |||
| 1604 | Ga0163161_10282731 | |||
| 1605 | Ga0213872_10000002 | |||
| 1606 | Ga0213872_10000027 | |||
| 1607 | Ga0213872_10000049 | |||
| 1608 | Ga0213872_10000143 | |||
| 1609 | Ga0213872_10000153 | |||
| 1610 | Ga0213872_10000156 | |||
| 1611 | Ga0213872_10000394 | |||
| 1612 | Ga0213872_10029381 | |||
| 1613 | Ga0213872_10057901 | |||
| 1614 | Ga0213872_10088226 | |||
| 1615 | Ga0224712_10102079 | |||
| 1616 | Ga0209436_101987 | |||
| 1617 | Ga0209436_103446 | |||
| 1618 | Ga0209672_103096 | |||
| 1619 | Ga0209147_100575 | |||
| 1620 | Ga0209563_100005 | |||
| 1621 | Ga0209563_100007 | |||
| 1622 | Ga0209437_107547 | |||
| 1623 | Ga0209258_100225 | |||
| 1624 | Ga0207425_1000224 | |||
| 1625 | Ga0207425_1000295 | |||
| 1626 | Ga0207425_1000566 | |||
| 1627 | Ga0209646_1000028 | |||
| 1628 | Ga0209026_1012811 | |||
| 1629 | Ga0209148_1000040 | |||
| 1630 | Ga0209148_1002241 | |||
| 1631 | Ga0209129_1000007 | |||
| 1632 | Ga0209129_1000723 | |||
| 1633 | Ga0209129_1004098 | |||
| 1634 | Ga0209565_1000085 | |||
| 1635 | Ga0209565_1000644 | |||
| 1636 | Ga0209565_1000937 | |||
| 1637 | Ga0209565_1001692 | |||
| 1638 | Ga0209565_1002166 | |||
| 1639 | Ga0209565_1014274 | |||
| 1640 | Ga0209455_1000049 | |||
| 1641 | Ga0209673_1000133 | |||
| 1642 | Ga0209673_1000304 | |||
| 1643 | Ga0209673_1001052 | |||
| 1644 | Ga0209673_1003491 | |||
| 1645 | Ga0209673_1007483 | |||
| 1646 | Ga0209673_1018452 | |||
| 1647 | Ga0209673_1028951 | |||
| 1648 | Ga0209673_1034076 | |||
| 1649 | Ga0209130_1000324 | |||
| 1650 | Ga0209130_1000326 | |||
| 1651 | Ga0209130_1000800 | |||
| 1652 | Ga0209130_1003269 | |||
| 1653 | Ga0209130_1003568 | |||
| 1654 | Ga0209675_1000083 | |||
| 1655 | Ga0209675_1000516 | |||
| 1656 | Ga0209675_1001124 | |||
| 1657 | Ga0209675_1001236 | |||
| 1658 | Ga0209675_1003686 | |||
| 1659 | Ga0209676_1000122 | |||
| 1660 | Ga0209676_1000268 | |||
| 1661 | Ga0209676_1001471 | |||
| 1662 | Ga0209025_1000073 | |||
| 1663 | Ga0209025_1000111 | |||
| 1664 | Ga0209025_1000432 | |||
| 1665 | Ga0209025_1005232 | |||
| 1666 | Ga0209025_1008304 | |||
| 1667 | Ga0209025_1008949 | |||
| 1668 | Ga0209025_1073075 | |||
| 1669 | Ga0209564_1000003 | |||
| 1670 | Ga0209564_1000009 | |||
| 1671 | Ga0209564_1000045 | |||
| 1672 | Ga0209564_1000175 | |||
| 1673 | Ga0209564_1000524 | |||
| 1674 | Ga0209564_1000594 | |||
| 1675 | Ga0209564_1001280 | |||
| 1676 | Ga0209564_1056414 | |||
| 1677 | Ga0209758_1000025 | |||
| 1678 | Ga0209758_1000456 | |||
| 1679 | Ga0209758_1002137 | |||
| 1680 | Ga0209050_1000002 | |||
| 1681 | Ga0209050_1000339 | |||
| 1682 | Ga0209050_1000384 | |||
| 1683 | Ga0209050_1001024 | |||
| 1684 | Ga0209050_1002458 | |||
| 1685 | Ga0209050_1009165 | |||
| 1686 | Ga0209256_1000005 | |||
| 1687 | Ga0209256_1000050 | |||
| 1688 | Ga0209256_1000063 | |||
| 1689 | Ga0209256_1000373 | |||
| 1690 | Ga0209256_1002180 | |||
| 1691 | Ga0209256_1003554 | |||
| 1692 | Ga0209256_1010020 | |||
| 1693 | Ga0209256_1014525 | |||
| 1694 | Ga0207426_1000001 | |||
| 1695 | Ga0207426_1000028 | |||
| 1696 | Ga0207426_1004897 | |||
| 1697 | Ga0209051_1000002 | |||
| 1698 | Ga0209051_1000343 | |||
| 1699 | Ga0209051_1000618 | |||
| 1700 | Ga0209051_1000665 | |||
| 1701 | Ga0209051_1003457 | |||
| 1702 | Ga0209051_1004603 | |||
| 1703 | Ga0209051_1013868 | |||
| 1704 | Ga0209257_1000002 | |||
| 1705 | Ga0209257_1000107 | |||
| 1706 | Ga0209257_1000333 | |||
| 1707 | Ga0209257_1000671 | |||
| 1708 | Ga0209257_1001657 | |||
| 1709 | Ga0209257_1001964 | |||
| 1710 | Ga0209257_1002139 | |||
| 1711 | Ga0209257_1011830 | |||
| 1712 | Ga0207656_10030962 | |||
| 1713 | Ga0207655_1004524 | |||
| 1714 | Ga0207655_1009233 | |||
| 1715 | Ga0207655_1016530 | |||
| 1716 | Ga0207680_10238982 | |||
| 1717 | Ga0207645_10145926 | |||
| 1718 | Ga0207705_10041375 | |||
| 1719 | Ga0207705_10153962 | |||
| 1720 | Ga0207707_10372311 | |||
| 1721 | Ga0207695_10289081 | |||
| 1722 | Ga0207695_10310688 | |||
| 1723 | Ga0207695_10323152 | |||
| 1724 | Ga0207662_10111489 | |||
| 1725 | Ga0207662_10160500 | |||
| 1726 | Ga0207657_10018275 | |||
| 1727 | Ga0207652_10065323 | |||
| 1728 | Ga0207652_10069362 | |||
| 1729 | Ga0207652_10616145 | |||
| 1730 | Ga0207652_10688677 | |||
| 1731 | Ga0207681_10006569 | |||
| 1732 | Ga0207694_10394908 | |||
| 1733 | Ga0207694_10662563 | |||
| 1734 | Ga0207650_10015881 | |||
| 1735 | Ga0207659_10073136 | |||
| 1736 | Ga0207659_10236097 | |||
| 1737 | Ga0207687_10045521 | |||
| 1738 | Ga0207687_10194333 | |||
| 1739 | Ga0207700_10369812 | |||
| 1740 | Ga0207664_10249707 | |||
| 1741 | Ga0207690_10012121 | |||
| 1742 | Ga0207690_10210416 | |||
| 1743 | Ga0207690_10463884 | |||
| 1744 | Ga0207690_10551005 | |||
| 1745 | Ga0207706_10007783 | |||
| 1746 | Ga0207706_10267200 | |||
| 1747 | Ga0207706_10270071 | |||
| 1748 | Ga0207686_10010419 | |||
| 1749 | Ga0207686_10028855 | |||
| 1750 | Ga0207686_10600104 | |||
| 1751 | Ga0207709_10000425 | |||
| 1752 | Ga0207709_10001100 | |||
| 1753 | Ga0207709_10186361 | |||
| 1754 | Ga0207670_10062321 | |||
| 1755 | Ga0207669_10497107 | |||
| 1756 | Ga0207669_10617846 | |||
| 1757 | Ga0207691_10107315 | |||
| 1758 | Ga0207711_10097396 | |||
| 1759 | Ga0207711_10104872 | |||
| 1760 | Ga0207711_10117330 | |||
| 1761 | Ga0207689_10452512 | |||
| 1762 | Ga0207679_10071405 | |||
| 1763 | Ga0207679_10202978 | |||
| 1764 | Ga0207667_10052973 | |||
| 1765 | Ga0207667_10311301 | |||
| 1766 | Ga0207667_10403162 | |||
| 1767 | Ga0207667_10473532 | |||
| 1768 | Ga0207651_10357396 | |||
| 1769 | Ga0207651_10641910 | |||
| 1770 | Ga0207640_10145120 | |||
| 1771 | Ga0207640_10413841 | |||
| 1772 | Ga0207703_10030373 | |||
| 1773 | Ga0207639_10082753 | |||
| 1774 | Ga0207639_10097266 | |||
| 1775 | Ga0207639_10514633 | |||
| 1776 | Ga0207678_10149869 | |||
| 1777 | Ga0207702_10248638 | |||
| 1778 | Ga0207702_10418520 | |||
| 1779 | Ga0207641_10253765 | |||
| 1780 | Ga0207648_10008612 | |||
| 1781 | Ga0207648_10082404 | |||
| 1782 | Ga0207648_10268532 | |||
| 1783 | Ga0207648_10309500 | |||
| 1784 | Ga0207674_10075892 | |||
| 1785 | Ga0207674_10317677 | |||
| 1786 | Ga0207683_10111999 | |||
| 1787 | Ga0207683_10170118 | |||
| 1788 | Ga0207698_10050162 | |||
| 1789 | Ga0207698_10075019 | |||
| 1790 | Ga0207698_10119684 | |||
| 1791 | Ga0207698_10384720 | |||
| 1792 | Ga0209389_1032076 | |||
| 1793 | Ga0209282_1000002 | |||
| 1794 | Ga0209282_1002923 | |||
| 1795 | Ga0209974_10028908 | |||
| 1796 | Ga0268266_10006337 | |||
| 1797 | Ga0268265_10037903 | |||
| 1798 | Ga0307515_10002898 | |||
| 1799 | Ga0307515_10201053 | |||
| 1800 | Ga0307512_10245390 | |||
| 1801 | Ga0316177_1102847 | |||
| 1802 | Ga0316177_1113384 | |||
| 1803 | Ga0316176_1137514 | |||
| 1804 | Ga0314311_1096514 | |||
| 1805 | Ga0316180_1082133 | |||
| 1806 | Ga0316183_1124842 | |||
| 1807 | Ga0316183_1151357 | |||
| 1808 | Ga0316181_1114218 | |||
| 1809 | Ga0316181_1266017 | |||
| 1810 | Ga0316182_1250603 | |||
| 1811 | Ga0316182_1422285 | |||
| 1812 | Ga0265328_10020764 | |||
| 1813 | Ga0265340_10005016 | |||
| 1814 | Ga0265331_10028699 | |||
| 1815 | Ga0265327_10000083 | |||
| 1816 | Ga0265327_10001090 | |||
| 1817 | Ga0265327_10086302 | |||
| 1818 | Ga0307509_10024292 | |||
| 1819 | Ga0307509_10053210 | |||
| 1820 | Ga0307408_100000446 | |||
| 1821 | Ga0307408_100001168 | |||
| 1822 | Ga0307408_100007266 | |||
| 1823 | Ga0307408_100016837 | |||
| 1824 | Ga0307408_100020249 | |||
| 1825 | Ga0307408_100059801 | |||
| 1826 | Ga0307408_100437700 | |||
| 1827 | Ga0307514_10079272 | |||
| 1828 | Ga0307516_10402858 | |||
| 1829 | Ga0307405_10013073 | |||
| 1830 | Ga0307405_10054930 | |||
| 1831 | Ga0307405_10148814 | |||
| 1832 | Ga0307405_10151225 | |||
| 1833 | Ga0307518_10033465 | |||
| 1834 | Ga0307406_10000864 | |||
| 1835 | Ga0307412_10011951 | |||
| 1836 | Ga0307412_10018730 | |||
| 1837 | Ga0307409_100519646 | |||
| 1838 | Ga0307409_100535803 | |||
| 1839 | Ga0307416_100306418 | |||
| 1840 | Ga0307416_100736897 | |||
| 1841 | Ga0307416_101157029 | |||
| 1842 | Ga0307414_10175610 | |||
| 1843 | Ga0307414_10268447 | |||
| 1844 | Ga0307414_10520637 | |||
| 1845 | Ga0307414_10729228 | |||
| 1846 | Ga0307414_10736711 | |||
| 1847 | Ga0307411_10193180 | |||
| 1848 | Ga0373952_0000147 | |||
| 1849 | Ga0373923_0083176 | |||
| 1850 | Ga0373942_0006206 | |||
| 1851 | Ga0373931_0061724 | |||
| 1852 | Ga0373931_0152738 | |||
| 1853 | Ga0395899_0000028 | |||
| 1854 | Ga0395899_0080247 | |||
| 1855 | Ga0395899_0115663 | |||
| 1856 | Ga0395899_0235483 | |||
| 1857 | Ga0395899_0355033 | |||
| 1858 | Ga0395900_0004850 | |||
| 1859 | Ga0395900_0164294 | |||
| 1860 | Ga0395900_0374743 | |||
| 1861 | Ga0395900_0745979 | |||
| 1862 | Ga0395898_0019113 | |||
| 1863 | Ga0395898_0028733 | |||
| 1864 | Ga0395898_0098824 | |||
| 1865 | Ga0395898_0161107 | |||
| 1866 | Ga0395898_0251897 | |||
| 1867 | Ga0395898_0620781 | |||
| 1868 | Ga0395905_0000811 | |||
| 1869 | Ga0395905_0001473 | |||
| 1870 | Ga0395905_0009721 | |||
| 1871 | Ga0395905_0015426 | |||
| 1872 | Ga0395905_0033102 | |||
| 1873 | Ga0395905_0052461 | |||
| 1874 | Ga0395905_0059933 | |||
| 1875 | Ga0395905_0095398 | |||
| 1876 | Ga0395905_0181281 | |||
| 1877 | Ga0395905_0304829 | |||
| 1878 | Ga0436364_1478795 | |||
| 1879 | Ga0395901_0000551 | |||
| 1880 | Ga0395901_0014806 | |||
| 1881 | Ga0395901_0017358 | |||
| 1882 | Ga0395901_0046520 | |||
| 1883 | Ga0395901_0058900 | |||
| 1884 | Ga0395901_0064151 | |||
| 1885 | Ga0395901_0263219 | |||
| 1886 | Ga0395901_0679437 | |||
| 1887 | Ga0400489_70414 | |||
| 1888 | Ga0436361_0065895 | |||
| 1889 | Ga0436361_0082864 | |||
| 1890 | Ga0436361_0195300 | |||
| 1891 | Ga0436361_0283051 | |||
| 1892 | Ga0436361_0349482 | |||
| 1893 | Ga0436361_0412881 | |||
| 1894 | Ga0436361_0570400 | |||
| 1895 | Ga0436361_0669746 | |||
| 1896 | Ga0436361_0715105 | |||
| 1897 | Ga0436361_0755903 | |||
| 1898 | Ga0436361_0921993 | |||
| 1899 | Ga0436361_1084239 | |||
| 1900 | Ga0439436_0000333 | |||
| 1901 | Ga0439439_0025307 | |||
| 1902 | Ga0439447_030509 | |||
| 1903 | Ga0439461_0001234 | |||
| 1904 | Ga0439466_0005348 | |||
| 1905 | Ga0439466_0008119 | |||
| 1906 | Ga0439466_0035279 | |||
| 1907 | Ga0439465_0000072 | |||
| 1908 | Ga0439465_0013050 | |||
| 1909 | Ga0451789_0279339 | |||
| 1910 | Ga0451841_1018191 | |||
| 1911 | Ga0439431_0000235 | |||
| 1912 | Ga0439433_0000055 | |||
| 1913 | Ga0439442_003249 | |||
| 1914 | Ga0439442_024288 | |||
| 1915 | Ga0439442_053096 | |||
| 1916 | Ga0439445_0000190 | |||
| 1917 | Ga0439448_0001453 | |||
| 1918 | Ga0439448_0126644 | |||
| 1919 | Ga0439432_003056 | |||
| 1920 | Ga0439432_016046 | |||
| 1921 | Ga0439449_0000135 | |||
| 1922 | Ga0439449_0000254 | |||
| 1923 | Ga0439449_0008857 | |||
| 1924 | Ga0439449_0033848 | |||
| 1925 | Ga0439452_003187 | |||
| 1926 | Ga0439455_0007915 | |||
| 1927 | Ga0439457_004905 | |||
| 1928 | Ga0439457_025642 | |||
| 1929 | Ga0439462_0007285 | |||
| 1930 | Ga0450920_009948 | |||
| 1931 | Ga0450920_046904 | |||
| 1932 | Ga0450923_012604 | |||
| 1933 | Ga0450897_000764 | |||
| 1934 | Ga0450894_001622 | |||
| 1935 | Ga0450899_005005 | |||
| 1936 | Ga0450899_005406 | |||
| 1937 | Ga0450904_000042 | |||
| 1938 | Ga0450906_004361 | |||
| 1939 | Ga0450910_011646 | |||
| 1940 | Ga0439446_0000384 | |||
| 1941 | Ga0450908_000283 | |||
| 1942 | Ga0450908_003570 | |||
| 1943 | Ga0450909_007295 | |||
| 1944 | Ga0439434_0011099 | |||
| 1945 | Ga0439434_0016719 | |||
| 1946 | Ga0439434_0017421 | |||
| 1947 | Ga0439459_0002257 | |||
| 1948 | Ga0450918_011672 | |||
| 1949 | Ga0451577_0010581 | |||
| 1950 | Ga0451577_0309719 | |||
| 1951 | Ga0466969_0009184 | |||
| 1952 | Ga0466969_0069770 | |||
| 1953 | Ga0466969_0215674 | |||
| 1954 | Ga0453683_0002793 | |||
| 1955 | Ga0466965_0009285 | |||
| 1956 | Ga0466965_0017289 | |||
| 1957 | Ga0466965_0020808 | |||
| 1958 | Ga0466965_0021204 | |||
| 1959 | Ga0466965_0139809 | |||
| 1960 | Ga0466966_0003089 | |||
| 1961 | Ga0466966_0012809 | |||
| 1962 | Ga0466966_0216260 | |||
| 1963 | Ga0466961_0000186 | |||
| 1964 | Ga0466961_0130891 | |||
| 1965 | Ga0466963_0227398 | |||
| 1966 | Ga0466963_0464526 | |||
| 1967 | Ga0466964_0000976 | |||
| 1968 | Ga0466964_0001673 | |||
| 1969 | Ga0453684_0207653 | |||
| 1970 | Ga0466971_0226662 | |||
| 1971 | Ga0466968_0189887 | |||
| 1972 | Ga0466970_0069538 | |||
| 1973 | Ga0466960_0066633 | |||
| 1974 | Ga0466959_0019572 | |||
| 1975 | Ga0466959_0095938 | |||
| 1976 | Ga0451576_0008365 | |||
| 1977 | Ga0451576_0040933 | |||
| 1978 | Ga0451576_0383934 | |||
| 1979 | Ga0451576_1294922 | |||
| 1980 | Ga0466958_0070050 | |||
| 1981 | Ga0466958_0190510 | |||
| 1982 | Ga0466967_0095348 | |||
| 1983 | Ga0466967_0134591 | |||
| 1984 | Ga0495617_000006 | |||
| 1985 | Ga0495617_000008 | |||
| 1986 | Ga0495617_000181 | |||
| 1987 | Ga0495617_003640 | |||
| 1988 | Ga0495627_000005 | |||
| 1989 | Ga0495627_000191 | |||
| 1990 | Ga0495627_010430 | |||
| 1991 | Ga0495627_012527 | |||
| 1992 | Ga0495627_013199 | |||
| 1993 | Ga0495627_022723 | |||
| 1994 | Ga0495627_030465 | |||
| 1995 | Ga0495603_0013530 | |||
| 1996 | Ga0495603_0035438 | |||
| 1997 | Ga0495603_0330373 | |||
| 1998 | Ga0495590_0000003 | |||
| 1999 | Ga0495590_0000017 | |||
| 2000 | Ga0495590_0004143 | |||
| 2001 | Ga0495590_0004512 | |||
| 2002 | Ga0495590_0006026 | |||
| 2003 | Ga0495590_0038510 | |||
| 2004 | Ga0495590_0205310 | |||
| 2005 | Ga0495591_000091 | |||
| 2006 | Ga0495591_010708 | |||
| 2007 | Ga0495629_0015125 | |||
| 2008 | Ga0495629_0114108 | |||
| 2009 | Ga0495638_0000118 | |||
| 2010 | Ga0495638_0001982 | |||
| 2011 | Ga0495638_0002148 | |||
| 2012 | Ga0495638_0030426 | |||
| 2013 | Ga0495638_0033813 | |||
| 2014 | Ga0495638_0041204 | |||
| 2015 | Ga0495638_0067056 | |||
| 2016 | Ga0495638_0363337 | |||
| 2017 | Ga0495653_0006483 | |||
| 2018 | Ga0495653_0208964 | |||
| 2019 | Ga0495653_0210188 | |||
| 2020 | Ga0495650_0000015 | |||
| 2021 | Ga0495650_0000131 | |||
| 2022 | Ga0495650_0000147 | |||
| 2023 | Ga0495650_0000189 | |||
| 2024 | Ga0495650_0000195 | |||
| 2025 | Ga0495650_0000339 | |||
| 2026 | Ga0495650_0004295 | |||
| 2027 | Ga0495650_0009310 | |||
| 2028 | Ga0495650_0018881 | |||
| 2029 | Ga0495650_0079380 | |||
| 2030 | Ga0495580_0051138 | |||
| 2031 | Ga0495580_0158398 | |||
| 2032 | Ga0495582_0003229 | |||
| 2033 | Ga0495582_0226020 | |||
| 2034 | Ga0495605_0000003 | |||
| 2035 | Ga0495605_0000083 | |||
| 2036 | Ga0495605_0000184 | |||
| 2037 | Ga0495605_0000949 | |||
| 2038 | Ga0495605_0007708 | |||
| 2039 | Ga0495605_0026781 | |||
| 2040 | Ga0495605_0049067 | |||
| 2041 | Ga0495605_0067073 | |||
| 2042 | Ga0495605_0089617 | |||
| 2043 | Ga0495605_0267568 | |||
| 2044 | Ga0495639_0002216 | |||
| 2045 | Ga0495639_0087599 | |||
| 2046 | Ga0495584_0000008 | |||
| 2047 | Ga0495584_0001294 | |||
| 2048 | Ga0495584_0002379 | |||
| 2049 | Ga0495584_0002758 | |||
| 2050 | Ga0495584_0003880 | |||
| 2051 | Ga0495584_0017677 | |||
| 2052 | Ga0495584_0018378 | |||
| 2053 | Ga0495584_0027667 | |||
| 2054 | Ga0495584_0058171 | |||
| 2055 | Ga0495584_0100945 | |||
| 2056 | Ga0495584_0153509 | |||
| 2057 | Ga0495585_0000159 | |||
| 2058 | Ga0495585_0001407 | |||
| 2059 | Ga0495585_0001639 | |||
| 2060 | Ga0495585_0002634 | |||
| 2061 | Ga0495585_0004935 | |||
| 2062 | Ga0495585_0032368 | |||
| 2063 | Ga0495585_0032785 | |||
| 2064 | Ga0495585_0041693 | |||
| 2065 | Ga0495585_0072070 | |||
| 2066 | Ga0495585_0082731 | |||
| 2067 | Ga0495585_0083832 | |||
| 2068 | Ga0495585_0135422 | |||
| 2069 | Ga0495585_0307753 | |||
| 2070 | Ga0495594_0003660 | |||
| 2071 | Ga0495594_0005566 | |||
| 2072 | Ga0495594_0022332 | |||
| 2073 | Ga0495594_0027830 | |||
| 2074 | Ga0495596_0004495 | |||
| 2075 | Ga0495596_0007196 | |||
| 2076 | Ga0495596_0012957 | |||
| 2077 | Ga0495596_0015118 | |||
| 2078 | Ga0495596_0038447 | |||
| 2079 | Ga0495596_0042390 | |||
| 2080 | Ga0495607_0000982 | |||
| 2081 | Ga0495607_0001248 | |||
| 2082 | Ga0495607_0002566 | |||
| 2083 | Ga0495607_0003301 | |||
| 2084 | Ga0495607_0004635 | |||
| 2085 | Ga0495607_0007891 | |||
| 2086 | Ga0495607_0013444 | |||
| 2087 | Ga0495607_0032846 | |||
| 2088 | Ga0495607_0077550 | |||
| 2089 | Ga0495607_0089104 | |||
| 2090 | Ga0495583_0000026 | |||
| 2091 | Ga0495583_0000049 | |||
| 2092 | Ga0495583_0000079 | |||
| 2093 | Ga0495583_0000165 | |||
| 2094 | Ga0495583_0000301 | |||
| 2095 | Ga0495583_0000615 | |||
| 2096 | Ga0495583_0001880 | |||
| 2097 | Ga0495583_0003090 | |||
| 2098 | Ga0495583_0004713 | |||
| 2099 | Ga0495583_0018084 | |||
| 2100 | Ga0495583_0022172 | |||
| 2101 | Ga0495583_0027765 | |||
| 2102 | Ga0495583_0028432 | |||
| 2103 | Ga0495583_0035623 | |||
| 2104 | Ga0495583_0038010 | |||
| 2105 | Ga0495583_0091099 | |||
| 2106 | Ga0495606_0000068 | |||
| 2107 | Ga0495606_0000185 | |||
| 2108 | Ga0495606_0000345 | |||
| 2109 | Ga0495606_0000650 | |||
| 2110 | Ga0495606_0001149 | |||
| 2111 | Ga0495606_0001239 | |||
| 2112 | Ga0495606_0002011 | |||
| 2113 | Ga0495606_0002106 | |||
| 2114 | Ga0495606_0004703 | |||
| 2115 | Ga0495606_0008579 | |||
| 2116 | Ga0495606_0025046 | |||
| 2117 | Ga0495606_0049582 | |||
| 2118 | Ga0495606_0050580 | |||
| 2119 | Ga0495606_0062167 | |||
| 2120 | Ga0495606_0090506 | |||
| 2121 | Ga0495610_0000004 | |||
| 2122 | Ga0495610_0001058 | |||
| 2123 | Ga0495610_0001361 | |||
| 2124 | Ga0495610_0003372 | |||
| 2125 | Ga0495610_0016743 | |||
| 2126 | Ga0495610_0017601 | |||
| 2127 | Ga0495610_0041930 | |||
| 2128 | Ga0495610_0076209 | |||
| 2129 | Ga0495610_0090970 | |||
| 2130 | Ga0495616_0000042 | |||
| 2131 | Ga0495616_0000395 | |||
| 2132 | Ga0495616_0000694 | |||
| 2133 | Ga0495616_0002414 | |||
| 2134 | Ga0495616_0004085 | |||
| 2135 | Ga0495616_0030515 | |||
| 2136 | Ga0495616_0042107 | |||
| 2137 | Ga0495616_0059779 | |||
| 2138 | Ga0495616_0089833 | |||
| 2139 | Ga0495616_0102929 | |||
| 2140 | Ga0495616_0110476 | |||
| 2141 | Ga0495620_0005295 | |||
| 2142 | Ga0495620_0173030 | |||
| 2143 | Ga0495630_0090599 | |||
| 2144 | Ga0495630_0117029 | |||
| 2145 | Ga0495631_0000228 | |||
| 2146 | Ga0495631_0001731 | |||
| 2147 | Ga0495631_0004132 | |||
| 2148 | Ga0495631_0010178 | |||
| 2149 | Ga0495631_0016503 | |||
| 2150 | Ga0495631_0043813 | |||
| 2151 | Ga0495631_0069145 | |||
| 2152 | Ga0495631_0080908 | |||
| 2153 | Ga0495632_0000065 | |||
| 2154 | Ga0495632_0000155 | |||
| 2155 | Ga0495632_0000476 | |||
| 2156 | Ga0495632_0000934 | |||
| 2157 | Ga0495632_0002365 | |||
| 2158 | Ga0495632_0018366 | |||
| 2159 | Ga0495632_0030965 | |||
| 2160 | Ga0495632_0059646 | |||
| 2161 | Ga0495632_0082038 | |||
| 2162 | Ga0495632_0126101 | |||
| 2163 | Ga0495637_0000281 | |||
| 2164 | Ga0495637_0001371 | |||
| 2165 | Ga0495637_0005539 | |||
| 2166 | Ga0495637_0006672 | |||
| 2167 | Ga0495637_0009184 | |||
| 2168 | Ga0495637_0033017 | |||
| 2169 | Ga0495637_0046202 | |||
| 2170 | Ga0495643_0000106 | |||
| 2171 | Ga0495643_0000417 | |||
| 2172 | Ga0495643_0000653 | |||
| 2173 | Ga0495643_0000792 | |||
| 2174 | Ga0495643_0000798 | |||
| 2175 | Ga0495643_0003931 | |||
| 2176 | Ga0495643_0018930 | |||
| 2177 | Ga0495643_0042824 | |||
| 2178 | Ga0495643_0044883 | |||
| 2179 | Ga0495643_0076345 | |||
| 2180 | Ga0495643_0086747 | |||
| 2181 | Ga0495644_0001181 | |||
| 2182 | Ga0495644_0002400 | |||
| 2183 | Ga0495644_0010071 | |||
| 2184 | Ga0495644_0011983 | |||
| 2185 | Ga0495644_0012194 | |||
| 2186 | Ga0495644_0048526 | |||
| 2187 | Ga0495644_0061910 | |||
| 2188 | Ga0495644_0215599 | |||
| 2189 | Ga0495648_0000055 | |||
| 2190 | Ga0495648_0000070 | |||
| 2191 | Ga0495648_0000807 | |||
| 2192 | Ga0495648_0001050 | |||
| 2193 | Ga0495648_0001715 | |||
| 2194 | Ga0495648_0001752 | |||
| 2195 | Ga0495648_0007473 | |||
| 2196 | Ga0495648_0012736 | |||
| 2197 | Ga0495648_0019149 | |||
| 2198 | Ga0495648_0022274 | |||
| 2199 | Ga0495648_0025287 | |||
| 2200 | Ga0495648_0027763 | |||
| 2201 | Ga0495648_0049531 | |||
| 2202 | Ga0495648_0061393 | |||
| 2203 | Ga0495663_0004309 | |||
| 2204 | Ga0495663_0007498 | |||
| 2205 | Ga0495663_0059277 | |||
| 2206 | Ga0495663_0083624 | |||
| 2207 | Ga0495666_0000191 | |||
| 2208 | Ga0495666_0009730 | |||
| 2209 | Ga0495666_0017781 | |||
| 2210 | Ga0495666_0111281 | |||
| 2211 | Ga0495642_0000376 | |||
| 2212 | Ga0495642_0004461 | |||
| 2213 | Ga0495642_0006415 | |||
| 2214 | Ga0495642_0007548 | |||
| 2215 | Ga0495642_0013474 | |||
| 2216 | Ga0495642_0014314 | |||
| 2217 | Ga0495642_0016642 | |||
| 2218 | Ga0495642_0044172 | |||
| 2219 | Ga0495642_0051328 | |||
| 2220 | Ga0495642_0059104 | |||
| 2221 | Ga0495642_0063647 | |||
| 2222 | Ga0495642_0065624 | |||
| 2223 | Ga0495642_0088016 | |||
| 2224 | Ga0495652_0007892 | |||
| 2225 | Ga0495652_0086558 | |||
| 2226 | Ga0495654_0000035 | |||
| 2227 | Ga0495654_0002939 | |||
| 2228 | Ga0495654_0007918 | |||
| 2229 | Ga0495654_0021948 | |||
| 2230 | Ga0495654_0025901 | |||
| 2231 | Ga0495654_0054915 | |||
| 2232 | Ga0495654_0127670 | |||
| 2233 | Ga0495665_0000579 | |||
| 2234 | Ga0495665_0058964 | |||
| 2235 | Ga0495586_0015584 | |||
| 2236 | Ga0495586_0074212 | |||
| 2237 | Ga0495609_0000002 | |||
| 2238 | Ga0495609_0002255 | |||
| 2239 | Ga0495609_0003201 | |||
| 2240 | Ga0495609_0005670 | |||
| 2241 | Ga0495609_0009486 | |||
| 2242 | Ga0495609_0020559 | |||
| 2243 | Ga0495609_0035605 | |||
| 2244 | Ga0495609_0035737 | |||
| 2245 | Ga0495609_0066770 | |||
| 2246 | Ga0495609_0076781 | |||
| 2247 | Ga0495609_0094363 | |||
| 2248 | Ga0495609_0175104 | |||
| 2249 | Ga0495621_0004628 | |||
| 2250 | Ga0495621_0023711 | |||
| 2251 | Ga0495621_0052958 | |||
| 2252 | Ga0495597_0000656 | |||
| 2253 | Ga0495597_0000770 | |||
| 2254 | Ga0495597_0001497 | |||
| 2255 | Ga0495597_0006143 | |||
| 2256 | Ga0495597_0006807 | |||
| 2257 | Ga0495597_0019166 | |||
| 2258 | Ga0495597_0020596 | |||
| 2259 | Ga0495597_0024339 | |||
| 2260 | Ga0495597_0247375 | |||
| 2261 | Ga0495645_0018376 | |||
| 2262 | Ga0495645_0247881 | |||
| 2263 | Ga0495622_0001144 | |||
| 2264 | Ga0495622_0002556 | |||
| 2265 | Ga0495622_0030061 | |||
| 2266 | Ga0495622_0034568 | |||
| 2267 | Ga0495622_0062496 | |||
| 2268 | Ga0495633_0000164 | |||
| 2269 | Ga0495633_0001230 | |||
| 2270 | Ga0495633_0004437 | |||
| 2271 | Ga0495633_0014037 | |||
| 2272 | Ga0495633_0021203 | |||
| 2273 | Ga0495633_0021768 | |||
| 2274 | Ga0495633_0030004 | |||
| 2275 | Ga0495633_0078254 | |||
| 2276 | Ga0495633_0130031 | |||
| 2277 | Ga0495667_0062092 | |||
| 2278 | Ga0495656_0000184 | |||
| 2279 | Ga0495656_0039298 | |||
| 2280 | Ga0495656_0039929 | |||
| 2281 | Ga0495656_0059687 | |||
| 2282 | Ga0495656_0161458 | |||
| 2283 | Ga0495656_0246771 | |||
| 2284 | Ga0495668_0000094 | |||
| 2285 | Ga0495668_0000104 | |||
| 2286 | Ga0495668_0000865 | |||
| 2287 | Ga0495668_0001664 | |||
| 2288 | Ga0495668_0002283 | |||
| 2289 | Ga0495668_0004387 | |||
| 2290 | Ga0495668_0011158 | |||
| 2291 | Ga0495668_0017455 | |||
| 2292 | Ga0495668_0020584 | |||
| 2293 | Ga0495668_0022941 | |||
| 2294 | Ga0495668_0024814 | |||
| 2295 | Ga0495668_0093216 | |||
| 2296 | Ga0495668_0173644 | |||
| 2297 | Ga0495634_0030606 | |||
| 2298 | Ga0495611_0000157 | |||
| 2299 | Ga0495611_0002084 | |||
| 2300 | Ga0495611_0010425 | |||
| 2301 | Ga0495611_0018978 | |||
| 2302 | Ga0495611_0021596 | |||
| 2303 | Ga0495611_0207151 | |||
| 2304 | Ga0495625_0000038 | |||
| 2305 | Ga0495625_0000044 | |||
| 2306 | Ga0495625_0000335 | |||
| 2307 | Ga0495625_0002328 | |||
| 2308 | Ga0495625_0010789 | |||
| 2309 | Ga0495625_0017421 | |||
| 2310 | Ga0495625_0026929 | |||
| 2311 | Ga0495625_0062562 | |||
| 2312 | Ga0495625_0080807 | |||
| 2313 | Ga0495625_0084238 | |||
| 2314 | Ga0495625_0095870 | |||
| 2315 | Ga0495625_0548477 | |||
| 2316 | Ga0495625_0577945 | |||
| 2317 | Ga0495635_0119065 | |||
| 2318 | Ga0495635_0221081 | |||
| 2319 | Ga0495635_0367416 | |||
| 2320 | Ga0495659_0000204 | |||
| 2321 | Ga0495659_0004423 | |||
| 2322 | Ga0495659_0041718 | |||
| 2323 | Ga0495659_0115132 | |||
| 2324 | Ga0495661_0000149 | |||
| 2325 | Ga0495661_0001612 | |||
| 2326 | Ga0495661_0005402 | |||
| 2327 | Ga0495661_0008766 | |||
| 2328 | Ga0495661_0023769 | |||
| 2329 | Ga0495661_0031146 | |||
| 2330 | Ga0495661_0035738 | |||
| 2331 | Ga0495661_0048168 | |||
| 2332 | Ga0495661_0052068 | |||
| 2333 | Ga0495661_0066224 | |||
| 2334 | Ga0495661_0117579 | |||
| 2335 | Ga0495661_0258093 | |||
| 2336 | Ga0495588_0000245 | |||
| 2337 | Ga0495588_0013099 | |||
| 2338 | Ga0495588_0019611 | |||
| 2339 | Ga0495588_0035055 | |||
| 2340 | Ga0495588_0043228 | |||
| 2341 | Ga0495588_0080913 | |||
| 2342 | Ga0495588_0084515 | |||
| 2343 | Ga0495588_0096530 | |||
| 2344 | Ga0495588_0117375 | |||
| 2345 | Ga0495588_0136152 | |||
| 2346 | Ga0495588_0232606 | |||
| 2347 | Ga0495588_0295902 | |||
| 2348 | Ga0495657_0314692 | |||
| 2349 | Ga0495623_0037757 | |||
| 2350 | Ga0495623_0083346 | |||
| 2351 | Ga0495623_0088281 | |||
| 2352 | Ga0495623_0096875 | |||
| 2353 | Ga0495646_0057326 | |||
| 2354 | Ga0495646_0081104 | |||
| 2355 | Ga0495658_0185694 | |||
| 2356 | Ga0495669_0000108 | |||
| 2357 | Ga0495669_0002705 | |||
| 2358 | Ga0495669_0025697 | |||
| 2359 | Ga0495669_0076370 | |||
| 2360 | Ga0495669_0102761 | |||
| 2361 | Ga0495669_0241752 | |||
| 2362 | Ga0495613_0018048 | |||
| 2363 | Ga0495613_0099291 | |||
| 2364 | Ga0495624_0200999 | |||
| 2365 | Ga0495670_0002374 | |||
| 2366 | Ga0495670_0002798 | |||
| 2367 | Ga0495670_0003871 | |||
| 2368 | Ga0495670_0034793 | |||
| 2369 | Ga0495670_0067909 | |||
| 2370 | Ga0495670_0082015 | |||
| 2371 | Ga0495670_0109148 | |||
| 2372 | Ga0495670_0299735 | |||
| 2373 | Ga0495671_0000001 | |||
| 2374 | Ga0495671_0000109 | |||
| 2375 | Ga0495671_0000228 | |||
| 2376 | Ga0495671_0004274 | |||
| 2377 | Ga0495671_0005357 | |||
| 2378 | Ga0495671_0027657 | |||
| 2379 | Ga0495671_0033851 | |||
| 2380 | Ga0495671_0082593 | |||
| 2381 | Ga0495649_0000326 | |||
| 2382 | Ga0495649_0003055 | |||
| 2383 | Ga0495649_0005429 | |||
| 2384 | Ga0495649_0007802 | |||
| 2385 | Ga0495649_0007839 | |||
| 2386 | Ga0495649_0024587 | |||
| 2387 | Ga0495649_0044443 | |||
| 2388 | Ga0495649_0075295 | |||
| 2389 | Ga0495649_0106332 | |||
| 2390 | Ga0495649_0331830 | |||
| 2391 | Ga0495589_0000009 | |||
| 2392 | Ga0495589_0000062 | |||
| 2393 | Ga0495589_0000153 | |||
| 2394 | Ga0495589_0009570 | |||
| 2395 | Ga0495589_0010537 | |||
| 2396 | Ga0495589_0024597 | |||
| 2397 | Ga0495589_0040238 | |||
| 2398 | Ga0495589_0070105 | |||
| 2399 | Ga0495589_0113578 | |||
| 2400 | Ga0495589_0180722 | |||
| 2401 | Ga0495600_0023871 | |||
| 2402 | Ga0495660_0000082 | |||
| 2403 | Ga0495660_0000716 | |||
| 2404 | Ga0495660_0001543 | |||
| 2405 | Ga0495660_0009811 | |||
| 2406 | Ga0495660_0014318 | |||
| 2407 | Ga0495660_0045363 | |||
| 2408 | Ga0495660_0049177 | |||
| 2409 | Ga0495660_0064752 | |||
| 2410 | Ga0495660_0065943 | |||
| 2411 | Ga0495660_0078530 | |||
| 2412 | Ga0495660_0185687 | |||
| 2413 | Ga0495581_0091440 | |||
| 2414 | Ga0495581_0104580 | |||
| 2415 | Ga0495581_0154575 | |||
| 2416 | Ga0495581_0320671 | |||
| 2417 | Ga0495604_0049360 | |||
| 2418 | Ga0495604_0140406 | |||
| 2419 | Ga0495636_0000379 | |||
| 2420 | Ga0495636_0004307 | |||
| 2421 | Ga0495636_0005717 | |||
| 2422 | Ga0495636_0031241 | |||
| 2423 | Ga0495636_0035538 | |||
| 2424 | Ga0495636_0267941 | |||
| 2425 | Ga0495672_0000032 | |||
| 2426 | Ga0495672_0000098 | |||
| 2427 | Ga0495672_0000236 | |||
| 2428 | Ga0495672_0000244 | |||
| 2429 | Ga0495672_0000272 | |||
| 2430 | Ga0495672_0000316 | |||
| 2431 | Ga0495672_0001208 | |||
| 2432 | Ga0495672_0011075 | |||
| 2433 | Ga0495672_0018606 | |||
| 2434 | Ga0495672_0061315 | |||
| 2435 | Ga0495672_0154716 | |||
| 2436 | Ga0495676_0000296 | |||
| 2437 | Ga0495676_0014815 | |||
| 2438 | Ga0495676_0016422 | |||
| 2439 | Ga0495676_0020517 | |||
| 2440 | Ga0495676_0110069 | |||
| 2441 | Ga0495683_0000247 | |||
| 2442 | Ga0495683_0000923 | |||
| 2443 | Ga0495683_0002926 | |||
| 2444 | Ga0495683_0003240 | |||
| 2445 | Ga0495683_0003731 | |||
| 2446 | Ga0495683_0005473 | |||
| 2447 | Ga0495683_0038293 | |||
| 2448 | Ga0495683_0065997 | |||
| 2449 | Ga0495683_0092101 | |||
| 2450 | Ga0495683_0095175 | |||
| 2451 | Ga0495683_0165637 | |||
| 2452 | Ga0495687_000013 | |||
| 2453 | Ga0495687_000063 | |||
| 2454 | Ga0495687_000064 | |||
| 2455 | Ga0495687_000173 | |||
| 2456 | Ga0495687_000589 | |||
| 2457 | Ga0495687_000939 | |||
| 2458 | Ga0495687_002034 | |||
| 2459 | Ga0495675_0059301 | |||
| 2460 | Ga0495677_0000043 | |||
| 2461 | Ga0495677_0000610 | |||
| 2462 | Ga0495677_0003220 | |||
| 2463 | Ga0495677_0004191 | |||
| 2464 | Ga0495677_0014151 | |||
| 2465 | Ga0495677_0048616 | |||
| 2466 | Ga0495677_0058386 | |||
| 2467 | Ga0495677_0079406 | |||
| 2468 | Ga0495677_0190687 | |||
| 2469 | Ga0495679_000520 | |||
| 2470 | Ga0495679_019508 | |||
| 2471 | Ga0495679_022687 | |||
| 2472 | Ga0495679_027836 | |||
| 2473 | Ga0495685_000027 | |||
| 2474 | Ga0495685_035467 | |||
| 2475 | Ga0495685_125215 | |||
| 2476 | Ga0495673_0000006 | |||
| 2477 | Ga0495673_0000014 | |||
| 2478 | Ga0495673_0000090 | |||
| 2479 | Ga0495673_0020986 | |||
| 2480 | Ga0495673_0037598 | |||
| 2481 | Ga0495681_0000266 | |||
| 2482 | Ga0495681_0000573 | |||
| 2483 | Ga0495681_0002781 | |||
| 2484 | Ga0495681_0008662 | |||
| 2485 | Ga0495681_0008859 | |||
| 2486 | Ga0495681_0018573 | |||
| 2487 | Ga0495681_0072031 | |||
| 2488 | Ga0495686_0000225 | |||
| 2489 | Ga0495686_0000672 | |||
| 2490 | Ga0495686_0001200 | |||
| 2491 | Ga0495686_0001524 | |||
| 2492 | Ga0495686_0002471 | |||
| 2493 | Ga0495686_0007591 | |||
| 2494 | Ga0495686_0023543 | |||
| 2495 | Ga0495686_0067506 | |||
| 2496 | Ga0495593_0007756 | |||
| 2497 | Ga0495593_0016871 | |||
| 2498 | Ga0495593_0048511 | |||
| 2499 | Ga0495602_0006654 | |||
| 2500 | Ga0495602_0069762 | |||
| 2501 | Ga0495614_0004411 | |||
| 2502 | Ga0495615_0003239 | |||
| 2503 | Ga0495615_0017482 | |||
| 2504 | Ga0495626_0000003 | |||
| 2505 | Ga0495626_0000733 | |||
| 2506 | Ga0495626_0001553 | |||
| 2507 | Ga0495626_0002765 | |||
| 2508 | Ga0495626_0003541 | |||
| 2509 | Ga0495626_0006784 | |||
| 2510 | Ga0495626_0008582 | |||
| 2511 | Ga0495626_0008881 | |||
| 2512 | Ga0495626_0010830 | |||
| 2513 | Ga0495626_0016993 | |||
| 2514 | Ga0495626_0017167 | |||
| 2515 | Ga0495626_0024413 | |||
| 2516 | Ga0495626_0040095 | |||
| 2517 | Ga0495626_0042451 | |||
| 2518 | Ga0495626_0051187 | |||
| 2519 | Ga0495626_0062223 | |||
| 2520 | Ga0495626_0091555 | |||
| 2521 | Ga0495626_0144099 | |||
| 2522 | Ga0495626_0146670 | |||
| 2523 | Ga0495626_0197094 | |||
| 2524 | Ga0496100_0130197 | |||
| 2525 | Ga0496100_0193668 | |||
| 2526 | Ga0496101_0003681 | |||
| 2527 | Ga0496101_0056025 | |||
| 2528 | Ga0496101_0099187 | |||
| 2529 | Ga0496102_0000407 | |||
| 2530 | Ga0496102_0001834 | |||
| 2531 | Ga0496102_0012505 | |||
| 2532 | Ga0496102_0032567 | |||
| 2533 | Ga0496102_0097668 | |||
| 2534 | Ga0496102_0694474 | |||
| 2535 | Ga0496102_0790248 | |||
| 2536 | Ga0496103_0092063 | |||
| 2537 | Ga0496103_0145605 | |||
| 2538 | Ga0496103_0456548 | |||
| 2539 | Ga0496104_0008803 | |||
| 2540 | Ga0496104_0164681 | |||
| 2541 | Ga0496104_0499747 | |||
| 2542 | Ga0496105_0162220 | |||
| 2543 | Ga0496106_0025756 | |||
| 2544 | Ga0496106_0100786 | |||
| 2545 | Ga0496107_0408106 | |||
| 2546 | Ga0496108_0069677 | |||
| 2547 | Ga0496108_0078438 | |||
| 2548 | Ga0496108_0232757 | |||
| 2549 | Ga0496109_0141910 | |||
| 2550 | Ga0496109_0710623 | |||
| 2551 | Ga0496109_0749910 | |||
| 2552 | Ga0496110_0000226 | |||
| 2553 | Ga0496110_0084403 | |||
| 2554 | Ga0496111_0088022 | |||
| 2555 | Ga0496112_0161737 | |||
| 2556 | Ga0496112_1120245 | |||
| 2557 | Ga0496114_0009548 | |||
| 2558 | Ga0496114_0398241 | |||
| 2559 | Ga0496115_0037025 | |||
| 2560 | Ga0496115_0550593 | |||
| 2561 | Ga0496116_0031449 | |||
| 2562 | Ga0496116_0097897 | |||
| 2563 | Ga0496116_0156966 | |||
| 2564 | Ga0496116_0248871 | |||
| 2565 | Ga0496117_0011194 | |||
| 2566 | Ga0496118_0005647 | |||
| 2567 | Ga0496118_0043877 | |||
| 2568 | Ga0496118_0176967 | |||
| 2569 | Ga0496119_0299238 | |||
| 2570 | Ga0496121_0095753 | |||
| 2571 | Ga0496121_0345531 | |||
| 2572 | Ga0496122_0000034 | |||
| 2573 | Ga0496122_0000210 | |||
| 2574 | Ga0496122_0001371 | |||
| 2575 | Ga0496122_0023266 | |||
| 2576 | Ga0496122_0052243 | |||
| 2577 | Ga0496122_0182675 | |||
| 2578 | Ga0496123_0000141 | |||
| 2579 | Ga0496123_0000597 | |||
| 2580 | Ga0496123_0007555 | |||
| 2581 | Ga0496123_0009027 | |||
| 2582 | Ga0496123_0134471 | |||
| 2583 | Ga0496123_0243180 | |||
| 2584 | Ga0496124_0023549 | |||
| 2585 | Ga0496124_0031199 | |||
| 2586 | Ga0496124_0090641 | |||
| 2587 | Ga0496124_0101386 | |||
| 2588 | Ga0496124_0180977 | |||
| 2589 | Ga0496124_0191340 | |||
| 2590 | Ga0496124_0542426 | |||
| 2591 | Ga0496125_0000789 | |||
| 2592 | Ga0496126_0027791 | |||
| 2593 | Ga0496126_0293789 | |||
| 2594 | Ga0496126_0503829 | |||
| 2595 | Ga0495678_000016 | |||
| 2596 | Ga0495678_000153 | |||
| 2597 | Ga0495678_000284 | |||
| 2598 | Ga0495678_000330 | |||
| 2599 | Ga0495678_001967 | |||
| 2600 | Ga0495678_002471 | |||
| 2601 | Ga0495678_008825 | |||
| 2602 | Ga0495678_011714 | |||
| 2603 | Ga0495678_012024 | |||
| 2604 | Ga0495678_129640 | |||
| 2605 | Ga0495678_133239 | |||
| 2606 | Ga0495682_0005588 | |||
| 2607 | Ga0495682_0014799 | |||
| 2608 | Ga0495682_0021404 | |||
| 2609 | Ga0495682_0162017 | |||
| 2610 | Ga0501313_001575 | |||
| 2611 | Ga0501032_0397969 | |||
| 2612 | Ga0501032_0413007 | |||
| 2613 | Ga0501034_0044672 | |||
| 2614 | Ga0501036_0035603 | |||
| 2615 | Ga0501036_0332016 | |||
| 2616 | Ga0501038_0194877 | |||
| 2617 | Ga0501040_0110602 | |||
| 2618 | Ga0501043_0000108 | |||
| 2619 | Ga0501043_0292338 | |||
| 2620 | Ga0501046_0000050 | |||
| 2621 | Ga0501046_0155915 | |||
| 2622 | Ga0501047_0000012 | |||
| 2623 | Ga0501047_0222681 | |||
| 2624 | Ga0501048_0000695 | |||
| 2625 | Ga0501048_0229175 | |||
| 2626 | Ga0501068_0086951 | |||
| 2627 | Ga0501072_0016664 | |||
| 2628 | Ga0501073_0192850 | |||
| 2629 | Ga0501074_0649801 | |||
| 2630 | Ga0501222_009934 | |||
| 2631 | Ga0501249_020799 | |||
| 2632 | Ga0501225_0007229 | |||
| 2633 | Ga0501080_0321235 | |||
| 2634 | Ga0501080_0535524 | |||
| 2635 | Ga0501081_0016309 | |||
| 2636 | Ga0501241_019337 | |||
| 2637 | Ga0501262_001175 | |||
| 2638 | Ga0501269_000282 | |||
| 2639 | Ga0501279_006907 | |||
| 2640 | Ga0501044_0034715 | |||
| 2641 | Ga0501045_0004835 | |||
| 2642 | Ga0501045_0074503 | |||
| 2643 | nmdc:mga03683_10301_c1 | |||
| 2644 | nmdc:mga03683_3723_c1 | |||
| 2645 | nmdc:mga03n38_34599_c1 | |||
| 2646 | nmdc:mga00v17_1720_c1 | |||
| 2647 | nmdc:mga0yw44_4298_c1 | |||
| 2648 | nmdc:mga0yw44_9677_c1 | |||
| 2649 | nmdc:mga0k408_129432_c1 | |||
| 2650 | nmdc:mga0k408_20318_c1 | |||
| 2651 | nmdc:mga0k408_2939_c1 | |||
| 2652 | nmdc:mga0k408_36383_c1 | |||
| 2653 | nmdc:mga0k408_36483_c1 | |||
| 2654 | nmdc:mga0k408_4515_c2 | |||
| 2655 | nmdc:mga07m45_185456_c1 | |||
| 2656 | nmdc:mga07m45_611_c1 | |||
| 2657 | nmdc:mga07m45_7294_c1 | |||
| 2658 | nmdc:mga0n895_119263_c1 | |||
| 2659 | nmdc:mga0rr50_217718_c1 | |||
| 2660 | nmdc:mga08x19_2421_c1 | |||
| 2661 | nmdc:mga0sz30_293882_c1 | |||
| 2662 | Ga0500610_0000863 | |||
| 2663 | Ga0500610_0002219 | |||
| 2664 | Ga0500610_0033809 | |||
| 2665 | Ga0500578_0001334 | |||
| 2666 | Ga0500643_004104 | |||
| 2667 | Ga0500651_0000097 | |||
| 2668 | Ga0500566_0041641 | |||
| 2669 | Ga0500555_037566 | |||
| 2670 | Ga0500562_110527 | |||
| 2671 | Ga0500571_000190 | |||
| 2672 | Ga0500593_000202 | |||
| 2673 | Ga0500594_0008916 | |||
| 2674 | Ga0500607_000181 | |||
| 2675 | Ga0500608_032284 | |||
| 2676 | Ga0500608_098022 | |||
| 2677 | Ga0500618_002212 | |||
| 2678 | Ga0500626_010486 | |||
| 2679 | Ga0500655_003364 | |||
| 2680 | Ga0500658_0000521 | |||
| 2681 | Ga0500658_0000753 | |||
| 2682 | Ga0500559_0001463 | |||
| 2683 | Ga0500559_0013536 | |||
| 2684 | Ga0500559_0019274 | |||
| 2685 | Ga0500564_035058 | |||
| 2686 | Ga0500568_0002122 | |||
| 2687 | Ga0500573_0039643 | |||
| 2688 | Ga0500574_048069 | |||
| 2689 | Ga0500604_0005739 | |||
| 2690 | Ga0500619_098524 | |||
| 2691 | Ga0500627_0004369 | |||
| 2692 | Ga0500634_0012204 | |||
| 2693 | Ga0500634_0012879 | |||
| 2694 | Ga0500634_0045507 | |||
| 2695 | Ga0500636_0141804 | |||
| 2696 | Ga0500636_0200247 | |||
| 2697 | Ga0501084_0033108 | |||
| 2698 | Ga0501082_0063318 | |||
| 2699 | Ga0530510_0026313 | |||
| 2700 | 2509388073 | |||
| 2701 | 2513229561 | |||
| 2702 | 2548497730 | |||
| 2703 | 2587725607 | |||
| 2704 | 2599623552 | |||
| 2705 | 2599671830 | |||
| 2706 | 2599681157 | |||
| 2707 | 2599693439 | |||
| 2708 | 2643789083 | |||
| 2709 | 2643798429 | |||
| 2710 | 2643971207 | |||
| 2711 | 2643990115 | |||
| 2712 | 2644160722 | |||
| 2713 | 2644213915 | |||
| 2714 | 2644254033 | |||
| 2715 | 2644327521 | |||
| 2716 | 2644356802 | |||
| 2717 | 2644401561 | |||
| 2718 | 2644468078 | |||
| 2719 | 2644475433 | |||
| 2720 | 2644645138 | |||
| 2721 | 2738717628 | |||
| 2722 | 2738742011 | |||
| 2723 | 2738747687 | |||
| 2724 | 2738824949 | |||
| 2725 | 2738844464 | |||
| 2726 | 2738879243 | |||
| 2727 | 2739148746 | |||
| 2728 | 2739190665 | |||
| 2729 | 2739248122 | |||
| 2730 | 2739277042 | |||
| 2731 | 2739278314 | |||
| 2732 | 2739317142 | |||
| 2733 | 2739335383 | |||
| 2734 | 2739346017 | |||
| 2735 | 2739356950 | |||
| 2736 | 2809144845 | |||
| 2737 | 2819597118 | |||
| 2738 | 2831266237 | |||
| 2739 | 2831864943 | |||
| 2740 | 2838057653 | |||
| 2741 | 2842368599 | |||
| 2742 | 2842678929 | |||
| 2743 | 2842699548 | |||
| 2744 | 2842716834 | |||
| 2745 | 2842735183 | |||
| 2746 | 2842751073 | |||
| 2747 | 2857553680 | |||
| 2748 | 2857561233 | |||
| 2749 | 2857565352 | |||
| 2750 | 2885192392 | |||
| 2751 | 2885204354 | |||
| 2752 | 2885218007 | |||
| 2753 | 2886851715 | |||
| 2754 | 2899930141 | |||
| 2755 | 2904426664 | |||
| 2756 | 2904456186 | |||
| 2757 | 2904457736 | |||
| 2758 | 2904543476 | |||
| 2759 | 2919467529 | |||
| 2760 | 2919480306 | |||
| 2761 | 2928039254 | |||
| 2762 | 2928045141 | |||
| 2763 | 2928052947 | |||
| 2764 | 2928064382 | |||
| 2765 | 2928071835 | |||
| 2766 | 2928084228 | |||
| 2767 | 2928116334 | |||
| 2768 | 2929162989 | |||
| 2769 | 2929527220 | |||
| 2770 | 2945911459 | |||
| 2771 | 2945947635 | |||
| 2772 | 2945977502 | |||
| 2773 | 2945986233 | |||
| 2774 | 2954772521 | |||
| 2775 | 2990711169 | |||
| 2776 | 8047674276 | |||
| 2777 | 8057161515 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3w9s-assembly1.cif.gz_B | crystal structure analysis of the n-terminal receiver domain of response regulator pmra | 0.9468 | 2 | 101 |
| 2pl1-assembly1.cif.gz_A | berrylium fluoride activated receiver domain of e.coli phop | 0.9415 | 1 | 102 |
| 6rh1-assembly1.cif.gz_C | revisiting ph-gated conformational switch. complex hk853-rr468 d53a ph 7 | 0.937 | 3 | 99 |
| 5uic-assembly1.cif.gz_A | structure of the francisella response regulator receiver domain, qseb | 0.9297 | 1 | 101 |
| 5hm6-assembly1.cif.gz_A | n-terminal domain of bfmr from acinetobacter baumannii | 0.9234 | 3 | 101 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_Q06065_2_134_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9455 | 3 | 104 | 3.40.50.2300 |
| 4s04F01 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9338 | 1 | 101 | 3.40.50.2300 |
| 5hm6B00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9249 | 3 | 101 | 3.40.50.2300 |
| 4d6yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9194 | 3 | 100 | 3.40.50.2300 |
| 3cfyA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.9194 | 3 | 102 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A847J0D0-F1-model_v4 | Response regulator transcription factor | 0.9559 | 3 | 104 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A401WU37-F1-model_v4 | OmpR/PhoB-type domain-containing protein | 0.949 | 115 | 201 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |
| AF-A0A2N3AJC3-F1-model_v4 | Two-component system response regulator | 0.9428 | 3 | 101 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 |
| AF-A0A354ZI13-F1-model_v4 | Sigma-54-dependent Fis family transcriptional regulator | 0.942 | 3 | 104 |
GO:0000160
GO:0005524 GO:0006355 GO:0016887 GO:0043565 |
| AF-A0A3L7TDR4-F1-model_v4 | Response regulator | 0.9415 | 3 | 100 |
GO:0000160
|