F493567

General Info

Members Datasets Scaffolds Average Seq Length
1388 539 1225 392

Family's Representative Sequence

Representative Sequence 3300028381|Ga0268264_10115744|Ga0268264_101157442
Length 466
Sequence VAATTNLTAGSAEQEQNDDMSFPASGGRQTFPQRLSGRRSHRHRCSSSGPRRHIFRPVESRVWIEPGSGKRYLMKALTWHGKRDVRIDTVADPSIKEPTDAIIRVTSSGLCGSDLHLYELFGPFIDEGDILGHEPMGIVEEVGSQVSHIKPGDRVVVPFNISCGECWMCAQGLQSQCEATQVREHGTGASLFGYTKLYGQVAGGQAEFLRVPQAQYGPIKVPEGPPDERYLFLSDVLPTAWQAVEYANVPAGGTVAVLGLGPIGQMAARIALHRGAERVFGIDRVPERLTMAARHGVDVFNLTEHPDITADLRQRTGGRGPDSVIDAVGMEAHGSAPAKAAQAFVGLLPDVIAGKLMERAGIDRLAALLAGIEIVRRGGTISISGVYGGMLDPLPMLTMFDKQLTIRMGQANVKRWIDDLLPLLGDDDPLGVEDLRTHRVPLAEAPAAYAMFQKKQDGAIKVVFAP

Samples

Sample ID Description Type Environment
1 2501939600 Micromonospora sp. L5 Isolate Unclassified
2 2537561592 Arthrobacter crystallopoietes BAB-32 Isolate Rhizosphere
3 2547132111 Streptomyces sp. TOR3209 Isolate Rhizosphere
4 2554235005 Streptomyces violaceusniger SPC6 Isolate Rhizosphere
5 2565956761 Rhodococcus qingshengii BKS 20-40 Isolate Rhizosphere
6 2582580736 Prauserella sp. Am3 Isolate Unclassified
7 2585427649 Amycolatopsis japonica MG417-CF17, DSM 44213 Isolate Unclassified
8 2622736626 Micromonospora rhizosphaerae DSM 45431 Isolate Rhizosphere
9 2643221566 Microbacterium sp. Root166 Isolate Unclassified
10 2643221572 Leifsonia sp. Root60 Isolate Unclassified
11 2643221624 Phycicoccus sp. Root101 Isolate Unclassified
12 2643221641 Nocardioides sp. Root122 Isolate Unclassified
13 2643221669 Leifsonia sp. Root1293 Isolate Unclassified
14 2643221679 Angustibacter sp. Root456 Isolate Unclassified
15 2643221681 Aeromicrobium sp. Root472D3 Isolate Unclassified
16 2643221697 Aeromicrobium sp. Root495 Isolate Unclassified
17 2643221715 Mycobacterium sp. Root265 Isolate Unclassified
18 2643221961 Aeromicrobium sp. Root236 Isolate Unclassified
19 2643221962 Aeromicrobium sp. Root344 Isolate Unclassified
20 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
21 2675903058 Actinopolymorpha cephalotaxi CPCC 202808 Isolate Rhizosphere
22 2721755702 Agromyces sp. AR33 Isolate Rhizosphere
23 2738541308 Rhodococcus sp. OK551 Isolate Unclassified
24 2738543005 Rhodococcus sp. OK519 Isolate Unclassified
25 2739367898 Nocardioides sp. CF479 Isolate Unclassified
26 2751185725 Microbispora sp. NRRL B-24597 Isolate Unclassified
27 2751185734 Saccharothrix sp. NRRL B-16314 Isolate Rhizosphere
28 2751185788 Curtobacterium pusillum AA3 Isolate Unclassified
29 2751185792 Kitasatospora arboriphila NRRL B-24581 Isolate Unclassified
30 2757320536 Microbacterium sp. NFIX05 Isolate Unclassified
31 2758568522 Promicromonospora thailandica SAI-039 Isolate Unclassified
32 2758568621 Promicromonospora sukumoe SAI-064 Isolate Unclassified
33 2767802112 Streptomyces avicenniae NRRL B-24776 Isolate Rhizosphere
34 2772190715 Micromonospora chokoriensis NRRL B-24750 Isolate Unclassified
35 2773857758 Microbacterium chocolatum 1320 Isolate Unclassified
36 2773857762 Nocardioides sp. SAI-095 Isolate Unclassified
37 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
38 2775506735 Arthrobacter sp. S95 1704 Isolate Unclassified
39 2775506925 Saccharopolyspora phatthalungensis NRRL B-24798 Isolate Rhizosphere
40 2784746763 Streptomyces ossamyceticus SAI-001 Isolate Unclassified
41 2791354901 Actinophytocola xanthii 11-183 Isolate Rhizosphere
42 2808606365 Phycicoccus sp. SLBN-51 Isolate Unclassified
43 2808606366 Arthrobacter sp. SLBN-83 Isolate Unclassified
44 2808606370 Arthrobacter sp. SLBN-100 Isolate Unclassified
45 2808606371 Arthrobacter sp. SLBN-53 Isolate Unclassified
46 2808606394 Promicromonospora sp. C35 Isolate Unclassified
47 2808606439 Nocardioides sp. SLBN-172 Isolate Unclassified
48 2811994871 Arthrobacter sp. SLBN-179 Isolate Unclassified
49 2811994878 Nocardioides sp. SLBN-169 Isolate Unclassified
50 2818991463 Streptomyces argenteolus 3259 Isolate Rhizosphere
51 2821268502 Microbacterium sp. YT0620BN Isolate Unclassified
52 2827628540 Actinopolymorpha cephalotaxi DSM 45117 Isolate Rhizosphere
53 2833709550 Microbacterium sp. 3290 Isolate Rhizosphere
54 2839986021 Cellulosimicrobium cellulans JZ5 Isolate Unclassified
55 2844852863 Herbiconiux flava DSM 26474 Isolate Rhizosphere
56 2852643534 Leifsonia sp. AK011 Isolate Rhizosphere
57 2852677369 Pseudoclavibacter sp. JAI123 Isolate Rhizosphere
58 2855386786 Nocardioides ferulae EGI 63112 Isolate Unclassified
59 2855670206 Micromonospora noduli Lupac 07 Isolate Nodule
60 2855676851 Micromonospora saelicesensis GAR05 Isolate Unclassified
61 2856858025 Micromonospora aurantiaca 110B(2018) Isolate Unclassified
62 2857288857 Micromonospora noduli ONO23 Isolate Unclassified
63 2857481737 Nocardioides sp. R-74106 Isolate Unclassified
64 2857720070 Microbacterium sp. R-72113 Isolate Unclassified
65 2857723135 Microbacterium sp. R-72356 Isolate Unclassified
66 2857727296 Kocuria sp. R-72562 Isolate Unclassified
67 2857729791 Plantibacter sp. R-72288 Isolate Unclassified
68 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
69 2857740372 Paenarthrobacter sp. R-74611 Isolate Unclassified
70 2858868258 Micromonospora sp. MH33 Isolate Unclassified
71 2862281513 Streptomyces sp. Act143 Isolate Rhizosphere
72 2862993130 Planctomonas deserti 13S1-3 v2 Isolate Rhizosphere
73 2863067949 Saccharopolyspora phatthalungensis DSM 45584 (Annotation) (version 2) Isolate Rhizosphere
74 2863404153 Streptomyces scabiei SAI-025 (Annotation) (version 2) Isolate Unclassified
75 2867369537 Streptomyces sp. Z26 Isolate Unclassified
76 2868088558 Phytoactinopolyspora endophytica EGI 60009 Isolate Unclassified
77 2870721527 Saccharothrix ecbatanensis DSM 45486 Isolate Rhizosphere
78 2870801768 Micrococcus endophyticus DSM 17945 Isolate Unclassified
79 2873151551 Streptomyces silaceus ACCC40021 Isolate Rhizosphere
80 2883821847 Microlunatus elymi KUDC0627 Isolate Rhizosphere
81 2884994152 Cellulomonas sp. H30R-01 Isolate Rhizosphere
82 2891968417 Nocardioides luteus SAI-037 Isolate Unclassified
83 2893684298 Kocuria palustris DSM 11925 Isolate Rhizosphere
84 2895660088 Leifsonia flava SYP-B2174 Isolate Rhizosphere
85 2897561785 Pseudoclavibacter endophyticus EGI 60007 Isolate Unclassified
86 2899359706 Amycolatopsis anabasis EGI 650086 Isolate Unclassified
87 2902582711 Micromonospora sp. AP08 Isolate Unclassified
88 2902810491 Mycolicibacterium sp. P9-22 Isolate Unclassified
89 2902837492 Mycolicibacterium sp. P1-18 Isolate Unclassified
90 2904497146 Arthrobacter sp. 1276 Isolate Rhizosphere
91 2904509784 Microbacterium sp. 1676 Isolate Rhizosphere
92 2904535858 Rhodococcus erythropolis 2017 Isolate Unclassified
93 2904765812 Rhodococcus fascians 1590 Isolate Rhizosphere
94 2904770941 Rhodococcus fascians 1339 Isolate Rhizosphere
95 2908678064 Microbacterium sp. 1518 Isolate Rhizosphere
96 2908811453 Rhodococcus sp. 1R11 Isolate Unclassified
97 2912723979 Streptomyces sp. NEAU-sy36 Isolate Rhizosphere
98 2912757875 Streptomyces sp. S4.7 Isolate Rhizosphere
99 2917736166 Amycolatopsis dendrobii DR6-1 Isolate Unclassified
100 2919034639 Paenarthrobacter nitroguajacolicus 247 Isolate Rhizosphere
101 2919042368 Curtobacterium sp. 320 Isolate Rhizosphere
102 2919055335 Leifsonia sp. 1010 Isolate Rhizosphere
103 2919059106 Arthrobacter sp. 1088 Isolate Rhizosphere
104 2919069694 Microbacterium sp. 1154 Isolate Unclassified
105 2919391150 Arthrobacter ipis 2973 Isolate Unclassified
106 2919420072 Rhodococcus fascians 3241 Isolate Rhizosphere
107 2919432681 Rhodococcus sp. 3258 Isolate Rhizosphere
108 2919538618 Paenarthrobacter nitroguajacolicus 3945 Isolate Unclassified
109 2920879853 Kocuria salina CV6 Isolate Unclassified
110 2922554459 Rhodococcus sp. 66b Isolate Unclassified
111 2928090899 Microbacterium sp. 1262 Isolate Rhizosphere
112 2928104781 Curtobacterium sp. 1544 Isolate Rhizosphere
113 2928121344 Plantibacter flavus 1756 Isolate Rhizosphere
114 2928142448 Prescottella equi DPS 2018 Isolate Unclassified
115 2929219909 Micromonospora sp. R-75348 Hybrid assembly Isolate Unclassified
116 2933418574 Jeotgalibacillus campisalis 4120 Isolate Rhizosphere
117 2935890801 Oerskovia enterophila 3230 Isolate Rhizosphere
118 2939582691 Mycolicibacterium sp. 624 Isolate Rhizosphere
119 2939598168 Arthrobacter sp. 754 Isolate Rhizosphere
120 2939647034 Arthrobacter sp. 2762 Isolate Rhizosphere
121 2939657138 Conyzicola nivalis 2857 Isolate Rhizosphere
122 2939660829 Mycetocola sp. 2940 Isolate Rhizosphere
123 2939674588 Arthrobacter bambusae 3552 Isolate Rhizosphere
124 2945916053 Arthrobacter ulcerisalmonis W1I2 Isolate Rhizosphere
125 2945956166 Arthrobacter globiformus W2I3 Isolate Rhizosphere
126 2946059875 Arthrobacter sp. SLBN-112 Isolate Rhizosphere
127 2946080515 Microbacterium sp. W4I20 Isolate Rhizosphere
128 2947224130 Streptomyces afghaniensis W1I20 Isolate Rhizosphere
129 2953998280 Pseudarthrobacter sp. W1I19 Isolate Rhizosphere
130 2966921586 Rathayibacter agropyri 617 Isolate Rhizosphere
131 2966924647 Frigoribacterium sp. 2355 Isolate Rhizosphere
132 2974294766 Microbacterium proteolyticum SORGH_AS 209 Isolate Unclassified
133 2974315732 Rhodococcus sp. SORGH_AS 301 Isolate Unclassified
134 2974324384 Microbacterium sp. SORGH_AS 344 Isolate Unclassified
135 2977228692 Microbacterium sp. SORGH_AS 421 Isolate Unclassified
136 2977236895 Microbacterium testaceum SORGH_AS 426 Isolate Unclassified
137 2977264416 Microbacterium testaceum SORGH_AS 594 Isolate Unclassified
138 2984523437 Rhodococcus sp. SORGH_AS303 Isolate Aerial Root
139 2984542743 Microbacterium sp. SORGH_AS454 Isolate Aerial Root
140 2984551494 Curtobacterium sp. SORGH_AS776 Isolate Aerial Root
141 2984576629 Nocardioides zeae SORGH_AS913 Isolate Aerial Root
142 2984580707 Microbacterium paludicola SORGH_AS919 Isolate Aerial Root
143 2984592036 Aeromicrobium sp. SORGH_AS981 Isolate Aerial Root
144 2990044586 Streptomyces sedi JCM 16909 Isolate Unclassified
145 2990088156 Streptomyces albidus CAP 215 Isolate Unclassified
146 2990256926 Nocardioides zeae SORGH_AS885 Isolate Aerial Root
147 2996221748 Micromonospora veneta CAP181 Isolate Unclassified
148 2997600082 Streptomyces coffeae CA1R205 Isolate Unclassified
149 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
150 3006486233 Streptomyces sp. BR123 Isolate Rhizosphere
151 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
152 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
153 3300002073 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 Metagenome Rhizosphere
154 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
155 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
156 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
157 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
158 3300003285 Grassland soil microbial communities from Hopland, California, USA - Sample H3_Rhizo_39 (Metagenome Metatranscriptome, Counting Only) Metatranscriptome Rhizosphere
159 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
160 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
161 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
162 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
163 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
164 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
165 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
166 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
167 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
168 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
169 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
170 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
171 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
172 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
173 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
174 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
175 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
176 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
177 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
178 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
179 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
180 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
181 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
182 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
183 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
184 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
185 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
186 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
187 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
188 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
189 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
190 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
191 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
192 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
193 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
194 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
195 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
196 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
197 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
198 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
199 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
200 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
201 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
202 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
203 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
204 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
205 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
206 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
207 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
208 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
209 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
210 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
211 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
212 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
213 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
214 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
215 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
216 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
217 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
218 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
219 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
220 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
221 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
222 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
223 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
224 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
225 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
226 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
227 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
228 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
229 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
230 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
231 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
232 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
233 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
234 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
235 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
236 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
237 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
238 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
239 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
240 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
241 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
242 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
243 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
244 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
245 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
246 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
247 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
248 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
249 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
250 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
251 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
252 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
253 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
254 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
255 3300015688 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_G01 Metagenome Rhizosphere
256 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
257 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
258 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
259 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
260 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
261 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
262 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
263 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
264 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
265 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
266 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
267 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
268 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
269 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
270 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
271 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
272 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
273 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
274 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
275 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
276 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
277 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
278 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
279 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
280 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
281 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
282 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
283 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
284 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
285 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
286 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
287 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
288 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
289 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
290 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
291 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
292 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
293 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
294 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
295 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
296 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
297 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
298 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
299 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
300 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
301 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
302 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
303 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
304 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
305 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
306 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
307 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
308 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
309 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
310 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
311 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
312 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
313 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
314 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
315 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
316 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
317 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
318 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
319 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
320 3300030522 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 14_EM Metagenome Unclassified
321 3300030732 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 1 Metagenome Rhizosphere
322 3300030733 Rhizosphere soil microbial communities in infected wheat plant from Wellcamp field in Toowoomba, Australia - sample 2 Metagenome Rhizosphere
323 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
324 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
325 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
326 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
327 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
328 3300031691 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J5-7_160517rDrA Metagenome Rhizosphere
329 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
330 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
331 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
332 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
333 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
334 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
335 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
336 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
337 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
338 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
339 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
340 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
341 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
342 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
343 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
344 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
345 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
346 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
347 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
348 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
349 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
350 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
351 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
352 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
353 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
354 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
355 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
356 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
357 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
358 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
359 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
360 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
361 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
362 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
363 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
364 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
365 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
366 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
367 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
368 3300042126 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218F_E14_070516_87 Metagenome Rhizosphere
369 3300042131 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0225D_E14_070716_130 Metagenome Rhizosphere
370 3300042133 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB1023D_E14_070716_134 Metagenome Rhizosphere
371 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
372 3300042135 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_070716_127 Metagenome Rhizosphere
373 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
374 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
375 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
376 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
377 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
378 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
379 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
380 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
381 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
382 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
383 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
384 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
385 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
386 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
387 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
388 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
389 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
390 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
391 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
392 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
393 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
394 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
395 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
396 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
397 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
398 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
399 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
400 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
401 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
402 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
403 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
404 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
405 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
406 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
407 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
408 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
409 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
410 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
411 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
412 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
413 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
414 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
415 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
416 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
417 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
418 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
419 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
420 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
421 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
422 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
423 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
424 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
425 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
426 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
427 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
428 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
429 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
430 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
431 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
432 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
433 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
434 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
435 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
436 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
437 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
438 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
439 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
440 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
441 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
442 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
443 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
444 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
445 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
446 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
447 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
448 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
449 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
450 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
451 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
452 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
453 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
454 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
455 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
456 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
457 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
458 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
459 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
460 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
461 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
462 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
463 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
464 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
465 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
466 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
467 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
468 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
469 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
470 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
471 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
472 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
473 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
474 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
475 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
476 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
477 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
478 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
479 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
480 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
481 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
482 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
483 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
484 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
485 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
486 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
487 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
488 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
489 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
490 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
491 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
492 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
493 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
494 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
495 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
496 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
497 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
498 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
499 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
500 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
501 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
502 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
503 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
504 3300053099 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 endosphere Metagenome Endosphere
505 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
506 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
507 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
508 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
509 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
510 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
511 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
512 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
513 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
514 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
515 3300053143 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 endosphere Metagenome Endosphere
516 3300053149 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 endosphere Metagenome Endosphere
517 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
518 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
519 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
520 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
521 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
522 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
523 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
524 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
525 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
526 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
527 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
528 649633069 Micromonospora sp. L5 Isolate Unclassified
529 8003314358 Amycolatopsis sp. MtRt-6 Isolate Unclassified
530 8003856774 Micromonospora echinofusca MPMI6 Isolate Unclassified
531 8003870546 Micromonospora tarensis STR1s_6 Isolate Rhizosphere
532 8016254467 Microbacterium sp. SLBN-111 (version 3) Isolate Rhizosphere
533 8023623736 Streptomyces sp. 111WW2 Isolate Unclassified
534 8048406513 Streptomyces heilongjiangensis NEAU-W2 Isolate Unclassified
535 8054609563 Nocardioides astragali CGMCC 4.7327 Isolate Nodule
536 8056037122 Herbiconiux gentiana CPCC 205716 Isolate Rhizosphere
537 8056579771 Promicromonospora iranensis UTMC 00792 Isolate Rhizosphere
538 8056667051 Streptomyces sichuanensis SCA3-4 Isolate Rhizosphere
539 8057345674 Herbiconiux aconitum CPCC 205763 Isolate Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 87.54
Metatranscriptomes 0.72
Isolates 11.74

Biome Distribution

Category Percentage (%)
Aerial Root 0.5
Bulb 0
Endosphere 4.97
Nodule 0.29
Rhizoplane 7.49
Rhizosphere 73.78
Stem 0
Stem Tuber 0
Unclassified 12.97

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24739J22299_10025361 3300001989 Bacteria 2085
2 JGI24750J21931_1003136 3300002070 Bacteria 1984
3 JGI24745J21846_1001043 3300002073 Bacteria 2605
4 JGI24744J21845_10000747 3300002077 Bacteria 6047
5 JGI24742J22300_10000552 3300002244 Bacteria 5614
6 JGI24751J29686_10008504 3300002459 Bacteria 2101
7 JGI25154J39366_1001513 3300002738 Bacteria 8114
8 Ga0007423J48922_100507 3300003285 Bacteria 1902
9 JGI25407J50210_10002623 3300003373 Bacteria 4262
10 JGI25407J50210_10008814 3300003373 Bacteria 2547
11 JGI25407J50210_10008888 3300003373 Bacteria 2537
12 JGI25407J50210_10016808 3300003373 Bacteria 1896
13 JGI25407J50210_10028442 3300003373 Bacteria 1450
14 Ga0055540_1004708 3300003792 Bacteria 6041
15 Ga0070683_100003804 3300005329 Bacteria 12331
16 Ga0070683_100005916 3300005329 Bacteria 10236
17 Ga0070683_100020145 3300005329 Bacteria 5934
18 Ga0070683_100034199 3300005329 Unclassified 4641
19 Ga0070683_100034709 3300005329 Bacteria 4609
20 Ga0070683_100054259 3300005329 Bacteria 3716
21 Ga0070683_100129345 3300005329 Bacteria 2389
22 Ga0070683_100142231 3300005329 Bacteria 2273
23 Ga0070683_100229985 3300005329 Bacteria 1763
24 Ga0070670_100025495 3300005331 Bacteria 5086
25 Ga0070677_10000016 3300005333 Bacteria 52044
26 Ga0068869_100217826 3300005334 Bacteria 1512
27 Ga0070680_100001433 3300005336 Bacteria 17269
28 Ga0070682_100000026 3300005337 Bacteria 191388
29 Ga0070682_100000102 3300005337 Bacteria 76457
30 Ga0068868_100000095 3300005338 Bacteria 54537
31 Ga0068868_100016586 3300005338 Bacteria 5475
32 Ga0070660_100030855 3300005339 Bacteria 4022
33 Ga0070660_100035296 3300005339 Bacteria 3784
34 Ga0070660_100055871 3300005339 Bacteria 3052
35 Ga0070689_100085733 3300005340 Bacteria 2477
36 Ga0070687_100008171 3300005343 Bacteria 4415
37 Ga0070687_100103097 3300005343 Bacteria 1601
38 Ga0070661_100126664 3300005344 Bacteria 1916
39 Ga0070692_10006462 3300005345 Bacteria 5091
40 Ga0070692_10018200 3300005345 Bacteria 3373
41 Ga0070692_10049589 3300005345 Bacteria 2178
42 Ga0070668_100051436 3300005347 Bacteria 3174
43 Ga0070669_100000724 3300005353 Bacteria 24104
44 Ga0070669_100258650 3300005353 Bacteria 1388
45 Ga0070675_100008907 3300005354 Bacteria 7799
46 Ga0070675_100159192 3300005354 Bacteria 1941
47 Ga0070671_100085805 3300005355 Bacteria 2634
48 Ga0070674_100031722 3300005356 Bacteria 3504
49 Ga0070673_100259721 3300005364 Bacteria 1517
50 Ga0070688_100042528 3300005365 Bacteria 2796
51 Ga0070659_100000003 3300005366 Bacteria 309142
52 Ga0070659_100006123 3300005366 Bacteria 8682
53 Ga0070659_100250868 3300005366 Bacteria 1467
54 Ga0070667_100000348 3300005367 Bacteria 51378
55 Ga0070714_100000008 3300005435 Bacteria 278734
56 Ga0070714_100318648 3300005435 Bacteria 1453
57 Ga0070710_10002117 3300005437 Bacteria 9404
58 Ga0070711_100210395 3300005439 Bacteria 1506
59 Ga0070700_100000010 3300005441 Bacteria 176885
60 Ga0070700_100025112 3300005441 Bacteria 3506
61 Ga0070700_100040445 3300005441 Bacteria 2854
62 Ga0070700_100064543 3300005441 Bacteria 2319
63 Ga0070700_100132958 3300005441 Bacteria 1681
64 Ga0070663_100000875 3300005455 Bacteria 16391
65 Ga0070681_10000392 3300005458 Bacteria 35459
66 Ga0070681_10108480 3300005458 Bacteria 2716
67 Ga0068867_100007238 3300005459 Bacteria 7846
68 Ga0068867_100286113 3300005459 Bacteria 1353
69 Ga0070707_100036233 3300005468 Bacteria 4707
70 Ga0070679_100000436 3300005530 Bacteria 35464
71 Ga0070679_100001646 3300005530 Bacteria 20121
72 Ga0070679_100036653 3300005530 Bacteria 4868
73 Ga0070679_100067981 3300005530 Bacteria 3554
74 Ga0070679_100141718 3300005530 Bacteria 2383
75 Ga0070684_100000739 3300005535 Bacteria 22643
76 Ga0070684_100009867 3300005535 Bacteria 7545
77 Ga0070684_100055302 3300005535 Bacteria 3459
78 Ga0070684_100222087 3300005535 Unclassified 1724
79 Ga0070684_100262145 3300005535 Bacteria 1581
80 Ga0068853_100004539 3300005539 Bacteria 10774
81 Ga0070672_100211679 3300005543 Bacteria 1624
82 Ga0070686_100033209 3300005544 Bacteria 3169
83 Ga0070693_100160321 3300005547 Bacteria 1432
84 Ga0070665_100000604 3300005548 Bacteria 49409
85 Ga0070665_100005553 3300005548 Bacteria 12968
86 Ga0070665_100137429 3300005548 Bacteria 2447
87 Ga0070665_100145946 3300005548 Bacteria 2369
88 Ga0070665_100308931 3300005548 Bacteria 1585
89 Ga0068855_100025137 3300005563 Bacteria 7129
90 Ga0070664_100006006 3300005564 Bacteria 9817
91 Ga0070664_100073166 3300005564 Bacteria 2940
92 Ga0068857_100016356 3300005577 Bacteria 6500
93 Ga0068854_100000268 3300005578 Bacteria 35449
94 Ga0068856_100059240 3300005614 Bacteria 3782
95 Ga0068856_100069456 3300005614 Bacteria 3483
96 Ga0070702_100056620 3300005615 Bacteria 2265
97 Ga0070702_100114748 3300005615 Bacteria 1676
98 Ga0070702_100141710 3300005615 Bacteria 1532
99 Ga0068852_100118893 3300005616 Bacteria 2415
100 Ga0068859_100068937 3300005617 Bacteria 3571
101 Ga0068859_100411576 3300005617 Bacteria 1448
102 Ga0068864_100000043 3300005618 Bacteria 162928
103 Ga0068861_100047467 3300005719 Bacteria 3241
104 Ga0068861_100104504 3300005719 Bacteria 2260
105 Ga0068861_100158406 3300005719 Bacteria 1865
106 Ga0068851_10023965 3300005834 Bacteria 2986
107 Ga0068870_10039879 3300005840 Bacteria 2432
108 Ga0068863_100021476 3300005841 Bacteria 6160
109 Ga0068863_100307358 3300005841 Bacteria 1538
110 Ga0068858_100000343 3300005842 Bacteria 49409
111 Ga0068858_100029655 3300005842 Bacteria 5081
112 Ga0068860_100000021 3300005843 Bacteria 282612
113 Ga0068860_100073212 3300005843 Bacteria 3257
114 Ga0068860_100130697 3300005843 Bacteria 2409
115 Ga0068862_100002408 3300005844 Bacteria 16609
116 Ga0068862_100019291 3300005844 Bacteria 5690
117 Ga0081455_10002903 3300005937 Bacteria 20129
118 Ga0081455_10003801 3300005937 Bacteria 17227
119 Ga0081455_10029884 3300005937 Bacteria 4962
120 Ga0081455_10035796 3300005937 Bacteria 4430
121 Ga0081538_10000027 3300005981 Bacteria 125924
122 Ga0081538_10000412 3300005981 Bacteria 48367
123 Ga0081538_10000743 3300005981 Bacteria 35508
124 Ga0081538_10001001 3300005981 Bacteria 30067
125 Ga0081538_10001378 3300005981 Bacteria 24925
126 Ga0081538_10002106 3300005981 Bacteria 19846
127 Ga0081538_10006330 3300005981 Bacteria 10451
128 Ga0081538_10008176 3300005981 Bacteria 8927
129 Ga0081538_10008278 3300005981 Bacteria 8858
130 Ga0081538_10008904 3300005981 Bacteria 8444
131 Ga0081538_10009285 3300005981 Bacteria 8229
132 Ga0081538_10014946 3300005981 Bacteria 6044
133 Ga0081538_10018941 3300005981 Bacteria 5143
134 Ga0081540_1004477 3300005983 Bacteria 10633
135 Ga0081539_10000057 3300005985 Bacteria 256264
136 Ga0081539_10000637 3300005985 Bacteria 70993
137 Ga0081539_10002491 3300005985 Bacteria 25867
138 Ga0070717_10008781 3300006028 Bacteria 7566
139 Ga0070717_10325067 3300006028 Bacteria 1371
140 Ga0075365_10013852 3300006038 Bacteria 4838
141 Ga0075365_10019093 3300006038 Bacteria 4225
142 Ga0075365_10077005 3300006038 Bacteria 2253
143 Ga0075363_100001122 3300006048 Bacteria 9738
144 Ga0075363_100001397 3300006048 Bacteria 9121
145 Ga0075363_100002877 3300006048 Bacteria 7169
146 Ga0075363_100025695 3300006048 Bacteria 3007
147 Ga0075364_10000874 3300006051 Bacteria 15891
148 Ga0075364_10006675 3300006051 Bacteria 6803
149 Ga0075364_10015796 3300006051 Bacteria 4686
150 Ga0075364_10022860 3300006051 Bacteria 3954
151 Ga0075364_10033804 3300006051 Bacteria 3295
152 Ga0075364_10042098 3300006051 Bacteria 2967
153 Ga0075364_10064434 3300006051 Bacteria 2405
154 Ga0075364_10090286 3300006051 Bacteria 2032
155 Ga0070715_10019321 3300006163 Bacteria 2611
156 Ga0075369_10011565 3300006186 Bacteria 3474
157 Ga0075366_10053903 3300006195 Bacteria 2389
158 Ga0075428_100158275 3300006844 Bacteria 2459
159 Ga0075428_100340662 3300006844 Bacteria 1610
160 Ga0075430_100003116 3300006846 Bacteria 13865
161 Ga0075431_100054450 3300006847 Bacteria 4125
162 Ga0068865_100057585 3300006881 Bacteria 2711
163 Ga0075436_100082547 3300006914 Bacteria 2229
164 Ga0097620_100068935 3300006931 Bacteria 3571
165 Ga0097620_100411615 3300006931 Bacteria 1448
166 Ga0105244_10006258 3300009036 Bacteria 7751
167 Ga0105244_10027877 3300009036 Bacteria 3037
168 Ga0105244_10038469 3300009036 Bacteria 2495
169 Ga0105240_10194307 3300009093 Bacteria 2384
170 Ga0111539_10000749 3300009094 Bacteria 42208
171 Ga0111539_10119322 3300009094 Bacteria 3091
172 Ga0111539_10173719 3300009094 Bacteria 2517
173 Ga0111539_10410703 3300009094 Bacteria 1577
174 Ga0105245_10000049 3300009098 Bacteria 128277
175 Ga0105245_10004336 3300009098 Bacteria 12563
176 Ga0105245_10148660 3300009098 Bacteria 2213
177 Ga0105245_10235555 3300009098 Bacteria 1772
178 Ga0105247_10000035 3300009101 Bacteria 178167
179 Ga0105247_10000352 3300009101 Bacteria 39975
180 Ga0105247_10126814 3300009101 Bacteria 1659
181 Ga0114129_10273007 3300009147 Bacteria 2262
182 Ga0105243_10006577 3300009148 Bacteria 8980
183 Ga0105243_10014818 3300009148 Bacteria 5899
184 Ga0105243_10094611 3300009148 Bacteria 2467
185 Ga0105242_10096802 3300009176 Bacteria 2494
186 Ga0105248_10000085 3300009177 Bacteria 108204
187 Ga0105248_10000198 3300009177 Bacteria 69508
188 Ga0105248_10002694 3300009177 Bacteria 19727
189 Ga0105248_10097779 3300009177 Bacteria 3307
190 Ga0105248_10317268 3300009177 Bacteria 1755
191 Ga0105237_10018571 3300009545 Bacteria 7194
192 Ga0105238_10145056 3300009551 Bacteria 2350
193 Ga0105238_10307090 3300009551 Bacteria 1571
194 Ga0105249_10000039 3300009553 Bacteria 196325
195 Ga0105249_10000051 3300009553 Bacteria 169445
196 Ga0105249_10012666 3300009553 Bacteria 7438
197 Ga0105249_10058816 3300009553 Bacteria 3524
198 Ga0105249_10079532 3300009553 Bacteria 3043
199 Ga0105239_10020081 3300010375 Bacteria 7371
200 Ga0105239_10040595 3300010375 Bacteria 5098
201 Ga0105239_10052158 3300010375 Bacteria 4485
202 Ga0105239_10052515 3300010375 Bacteria 4470
203 Ga0157373_10107609 3300013100 Bacteria 1960
204 Ga0157370_10057979 3300013104 Bacteria 3680
205 Ga0157370_10106259 3300013104 Bacteria 2627
206 Ga0157369_10002406 3300013105 Bacteria 22492
207 Ga0157369_10029840 3300013105 Bacteria 6022
208 Ga0157369_10083384 3300013105 Bacteria 3419
209 Ga0157369_10111243 3300013105 Bacteria 2911
210 Ga0171462_1002 3300013250 Bacteria 1052134
211 Ga0157378_10001472 3300013297 Bacteria 21262
212 Ga0163162_10034645 3300013306 Bacteria 5025
213 Ga0163162_10149165 3300013306 Bacteria 2455
214 Ga0157372_10023108 3300013307 Bacteria 6738
215 Ga0157372_10253034 3300013307 Bacteria 2045
216 Ga0157375_10030942 3300013308 Bacteria 5052
217 Ga0157375_10062162 3300013308 Bacteria 3710
218 Ga0157375_10375659 3300013308 Bacteria 1588
219 Ga0163163_10028469 3300014325 Bacteria 5365
220 Ga0163163_10048421 3300014325 Bacteria 4180
221 Ga0157380_10006393 3300014326 Bacteria 8295
222 Ga0157380_10186497 3300014326 Bacteria 1827
223 Ga0157377_10001519 3300014745 Bacteria 10067
224 Ga0157377_10013595 3300014745 Bacteria 4124
225 Ga0157379_10006549 3300014968 Bacteria 10046
226 Ga0157379_10010098 3300014968 Bacteria 8230
227 Ga0157379_10046415 3300014968 Bacteria 3875
228 Ga0157379_10064797 3300014968 Bacteria 3265
229 Ga0183367_1001 3300015688 Bacteria 1225545
230 Ga0163161_10017735 3300017792 Bacteria 4987
231 Ga0163161_10089976 3300017792 Bacteria 2271
232 Ga0197907_11178498 3300020069 Bacteria 2503
233 Ga0206350_10298294 3300020080 Bacteria 1352
234 Ga0206350_10716424 3300020080 Bacteria 1947
235 Ga0206353_10016796 3300020082 Bacteria 3249
236 Ga0154015_1669549 3300020610 Bacteria 1466
237 Ga0213874_10001077 3300021377 Bacteria 5600
238 Ga0213876_10002674 3300021384 Bacteria 10409
239 Ga0213876_10004579 3300021384 Bacteria 7711
240 Ga0213875_10025168 3300021388 Bacteria 2837
241 Ga0224712_10007122 3300022467 Bacteria 3236
242 Ga0224712_10019664 3300022467 Unclassified 2281
243 Ga0224712_10024635 3300022467 Bacteria 2105
244 Ga0224712_10046376 3300022467 Bacteria 1668
245 Ga0209646_1000030 3300025246 Bacteria 384216
246 Ga0207666_1001612 3300025271 Bacteria 2670
247 Ga0209673_1021036 3300025273 Bacteria 2292
248 Ga0209051_1002056 3300025303 Bacteria 15254
249 Ga0209051_1002381 3300025303 Bacteria 13561
250 Ga0207653_10018985 3300025885 Bacteria 2166
251 Ga0207682_10015672 3300025893 Bacteria 2952
252 Ga0207692_10000004 3300025898 Bacteria 413600
253 Ga0207692_10000047 3300025898 Bacteria 36334
254 Ga0207710_10000056 3300025900 Bacteria 178147
255 Ga0207710_10000298 3300025900 Bacteria 39983
256 Ga0207710_10084551 3300025900 Bacteria 1477
257 Ga0207688_10003444 3300025901 Bacteria 8629
258 Ga0207688_10051506 3300025901 Bacteria 2306
259 Ga0207647_10008840 3300025904 Bacteria 7187
260 Ga0207647_10044175 3300025904 Bacteria 2786
261 Ga0207645_10013599 3300025907 Bacteria 5478
262 Ga0207645_10118658 3300025907 Bacteria 1716
263 Ga0207643_10005024 3300025908 Bacteria 7087
264 Ga0207643_10028614 3300025908 Bacteria 3096
265 Ga0207643_10150919 3300025908 Bacteria 1393
266 Ga0207705_10181135 3300025909 Bacteria 1590
267 Ga0207707_10000295 3300025912 Bacteria 53118
268 Ga0207707_10026309 3300025912 Bacteria 5085
269 Ga0207707_10046326 3300025912 Bacteria 3787
270 Ga0207707_10075438 3300025912 Bacteria 2942
271 Ga0207707_10255733 3300025912 Bacteria 1521
272 Ga0207660_10001344 3300025917 Bacteria 16465
273 Ga0207660_10072832 3300025917 Bacteria 2503
274 Ga0207660_10230878 3300025917 Bacteria 1455
275 Ga0207662_10013120 3300025918 Bacteria 4630
276 Ga0207662_10030987 3300025918 Bacteria 3107
277 Ga0207662_10068268 3300025918 Bacteria 2147
278 Ga0207662_10127073 3300025918 Bacteria 1604
279 Ga0207657_10045882 3300025919 Bacteria 3831
280 Ga0207657_10152913 3300025919 Bacteria 1878
281 Ga0207657_10200396 3300025919 Bacteria 1606
282 Ga0207649_10045606 3300025920 Bacteria 2688
283 Ga0207652_10000148 3300025921 Bacteria 75801
284 Ga0207652_10033048 3300025921 Bacteria 4354
285 Ga0207652_10069041 3300025921 Bacteria 3067
286 Ga0207652_10100390 3300025921 Bacteria 2555
287 Ga0207652_10121850 3300025921 Bacteria 2321
288 Ga0207646_10011128 3300025922 Bacteria 8735
289 Ga0207681_10004806 3300025923 Bacteria 8310
290 Ga0207681_10133123 3300025923 Bacteria 1841
291 Ga0207650_10144595 3300025925 Bacteria 1872
292 Ga0207687_10122523 3300025927 Bacteria 1947
293 Ga0207687_10226378 3300025927 Bacteria 1475
294 Ga0207664_10000002 3300025929 Bacteria 657053
295 Ga0207664_10000554 3300025929 Bacteria 26217
296 Ga0207690_10000306 3300025932 Bacteria 33820
297 Ga0207706_10045256 3300025933 Bacteria 3900
298 Ga0207706_10057441 3300025933 Bacteria 3428
299 Ga0207686_10112074 3300025934 Bacteria 1842
300 Ga0207669_10128732 3300025937 Bacteria 1735
301 Ga0207665_10078551 3300025939 Bacteria 2267
302 Ga0207691_10023705 3300025940 Bacteria 5777
303 Ga0207691_10126011 3300025940 Bacteria 2266
304 Ga0207711_10000360 3300025941 Bacteria 48298
305 Ga0207711_10001181 3300025941 Bacteria 24852
306 Ga0207711_10003065 3300025941 Bacteria 14591
307 Ga0207689_10027280 3300025942 Bacteria 4782
308 Ga0207689_10220327 3300025942 Bacteria 1568
309 Ga0207661_10000958 3300025944 Bacteria 18986
310 Ga0207661_10003600 3300025944 Bacteria 10777
311 Ga0207661_10007452 3300025944 Bacteria 7785
312 Ga0207661_10064349 3300025944 Bacteria 2973
313 Ga0207661_10100393 3300025944 Bacteria 2429
314 Ga0207661_10127618 3300025944 Bacteria 2174
315 Ga0207661_10230755 3300025944 Bacteria 1639
316 Ga0207679_10017870 3300025945 Bacteria 4741
317 Ga0207679_10027539 3300025945 Bacteria 3932
318 Ga0207679_10051438 3300025945 Bacteria 3016
319 Ga0207679_10084222 3300025945 Bacteria 2439
320 Ga0207712_10000003 3300025961 Bacteria 615314
321 Ga0207712_10000043 3300025961 Bacteria 173580
322 Ga0207712_10006039 3300025961 Bacteria 7639
323 Ga0207712_10051613 3300025961 Bacteria 2877
324 Ga0207668_10010420 3300025972 Bacteria 5614
325 Ga0207668_10045528 3300025972 Bacteria 2993
326 Ga0207640_10000054 3300025981 Bacteria 95136
327 Ga0207640_10050623 3300025981 Bacteria 2696
328 Ga0207658_10003518 3300025986 Bacteria 11055
329 Ga0207677_10000246 3300026023 Bacteria 41847
330 Ga0207677_10006227 3300026023 Bacteria 6526
331 Ga0207677_10061194 3300026023 Bacteria 2606
332 Ga0207677_10164292 3300026023 Bacteria 1729
333 Ga0207677_10187517 3300026023 Bacteria 1633
334 Ga0207703_10000338 3300026035 Bacteria 50980
335 Ga0207703_10034899 3300026035 Bacteria 3994
336 Ga0207703_10385596 3300026035 Bacteria 1297
337 Ga0207639_10003357 3300026041 Bacteria 10766
338 Ga0207639_10256642 3300026041 Bacteria 1527
339 Ga0207678_10007942 3300026067 Bacteria 9359
340 Ga0207678_10023795 3300026067 Bacteria 5356
341 Ga0207678_10033197 3300026067 Bacteria 4497
342 Ga0207678_10181983 3300026067 Bacteria 1795
343 Ga0207708_10000006 3300026075 Bacteria 266916
344 Ga0207708_10022916 3300026075 Bacteria 4717
345 Ga0207708_10054107 3300026075 Bacteria 3059
346 Ga0207708_10080853 3300026075 Bacteria 2497
347 Ga0207708_10172494 3300026075 Bacteria 1714
348 Ga0207702_10008664 3300026078 Bacteria 8581
349 Ga0207702_10053322 3300026078 Bacteria 3423
350 Ga0207641_10015808 3300026088 Bacteria 6181
351 Ga0207641_10359347 3300026088 Bacteria 1390
352 Ga0207676_10000042 3300026095 Bacteria 163475
353 Ga0207674_10003976 3300026116 Bacteria 17969
354 Ga0207674_10192673 3300026116 Bacteria 1988
355 Ga0207675_100019134 3300026118 Bacteria 6393
356 Ga0207675_100054785 3300026118 Bacteria 3720
357 Ga0207675_100075287 3300026118 Bacteria 3160
358 Ga0207675_100092945 3300026118 Bacteria 2837
359 Ga0207683_10070136 3300026121 Bacteria 3096
360 Ga0207698_10051445 3300026142 Bacteria 3150
361 Ga0207698_10138431 3300026142 Bacteria 2093
362 Ga0207428_10040233 3300027907 Bacteria 3794
363 Ga0268266_10000020 3300028379 Bacteria 527065
364 Ga0268266_10011746 3300028379 Bacteria 7596
365 Ga0268266_10105595 3300028379 Bacteria 2489
366 Ga0268266_10238786 3300028379 Bacteria 1676
367 Ga0268266_10269965 3300028379 Bacteria 1579
368 Ga0268265_10000027 3300028380 Bacteria 240507
369 Ga0268265_10036031 3300028380 Bacteria 3621
370 Ga0268265_10051054 3300028380 Bacteria 3120
371 Ga0268264_10000352 3300028381 Bacteria 69518
372 Ga0268264_10115744 3300028381 Bacteria 2356
373 Ga0307515_10057727 3300028794 Bacteria 5611
374 Ga0307512_10008471 3300030522 Bacteria 10020
375 Ga0307512_10025385 3300030522 Bacteria 5251
376 Ga0307512_10169288 3300030522 Bacteria 1257
377 Ga0316176_1097926 3300030732 Bacteria 5468
378 Ga0314311_1104940 3300030733 Bacteria 1659
379 Ga0314311_1187566 3300030733 Bacteria 3476
380 Ga0265327_10002365 3300031251 Bacteria 20094
381 Ga0307513_10011334 3300031456 Bacteria 11084
382 Ga0307408_100070877 3300031548 Bacteria 2575
383 Ga0307408_100181614 3300031548 Bacteria 1688
384 Ga0307408_100193741 3300031548 Bacteria 1639
385 Ga0307408_100245687 3300031548 Bacteria 1473
386 Ga0307408_100275017 3300031548 Bacteria 1400
387 Ga0307508_10020231 3300031616 Bacteria 6044
388 Ga0307514_10004261 3300031649 Bacteria 13220
389 Ga0307514_10037092 3300031649 Bacteria 3869
390 Ga0316579_10077290 3300031691 Bacteria 1582
391 Ga0316576_10005643 3300031727 Bacteria 7683
392 Ga0316578_10002638 3300031728 Bacteria 7954
393 Ga0307405_10003699 3300031731 Bacteria 7094
394 Ga0307405_10010320 3300031731 Bacteria 4831
395 Ga0307405_10063607 3300031731 Bacteria 2341
396 Ga0307413_10005109 3300031824 Bacteria 5808
397 Ga0307413_10018705 3300031824 Bacteria 3643
398 Ga0307413_10174172 3300031824 Bacteria 1526
399 Ga0307410_10010378 3300031852 Bacteria 5271
400 Ga0307410_10029539 3300031852 Bacteria 3492
401 Ga0307410_10033224 3300031852 Bacteria 3329
402 Ga0307410_10129271 3300031852 Bacteria 1853
403 Ga0307410_10138060 3300031852 Bacteria 1800
404 Ga0307410_10237027 3300031852 Bacteria 1412
405 Ga0307406_10000401 3300031901 Bacteria 25092
406 Ga0307406_10015862 3300031901 Bacteria 4368
407 Ga0307406_10040785 3300031901 Bacteria 2889
408 Ga0307406_10066691 3300031901 Bacteria 2344
409 Ga0307406_10233601 3300031901 Bacteria 1375
410 Ga0307407_10006041 3300031903 Bacteria 5336
411 Ga0307407_10030859 3300031903 Bacteria 2896
412 Ga0307407_10070039 3300031903 Bacteria 2083
413 Ga0307412_10015943 3300031911 Bacteria 4465
414 Ga0307412_10043731 3300031911 Bacteria 2919
415 Ga0307412_10101877 3300031911 Bacteria 2032
416 Ga0307412_10160234 3300031911 Bacteria 1670
417 Ga0307409_100009038 3300031995 Bacteria 6095
418 Ga0307409_100010559 3300031995 Bacteria 5753
419 Ga0307409_100015595 3300031995 Bacteria 4993
420 Ga0307409_100025604 3300031995 Bacteria 4141
421 Ga0307409_100085876 3300031995 Bacteria 2559
422 Ga0307409_100096606 3300031995 Bacteria 2438
423 Ga0307409_100179278 3300031995 Bacteria 1874
424 Ga0307409_100180243 3300031995 Bacteria 1869
425 Ga0307416_100001040 3300032002 Bacteria 14752
426 Ga0307416_100015905 3300032002 Bacteria 5211
427 Ga0307416_100031388 3300032002 Bacteria 3999
428 Ga0307416_100035808 3300032002 Bacteria 3797
429 Ga0307416_100043775 3300032002 Bacteria 3509
430 Ga0307416_100067334 3300032002 Bacteria 2953
431 Ga0307416_100107235 3300032002 Bacteria 2451
432 Ga0307416_100122470 3300032002 Bacteria 2321
433 Ga0307416_100266516 3300032002 Bacteria 1678
434 Ga0307416_100454197 3300032002 Bacteria 1334
435 Ga0307414_10006960 3300032004 Bacteria 6338
436 Ga0307414_10057528 3300032004 Bacteria 2734
437 Ga0307414_10151488 3300032004 Bacteria 1830
438 Ga0307414_10238083 3300032004 Bacteria 1505
439 Ga0307411_10036355 3300032005 Bacteria 3085
440 Ga0307411_10041564 3300032005 Bacteria 2926
441 Ga0307411_10141104 3300032005 Bacteria 1777
442 Ga0307411_10267752 3300032005 Bacteria 1353
443 Ga0307415_100000098 3300032126 Bacteria 36905
444 Ga0307415_100000812 3300032126 Bacteria 14224
445 Ga0307415_100018084 3300032126 Bacteria 4246
446 Ga0307415_100026518 3300032126 Bacteria 3657
447 Ga0307415_100035822 3300032126 Bacteria 3245
448 Ga0307415_100043117 3300032126 Bacteria 3007
449 Ga0307415_100057149 3300032126 Bacteria 2679
450 Ga0307415_100121195 3300032126 Bacteria 1961
451 Ga0307415_100169684 3300032126 Bacteria 1700
452 Ga0307415_100225486 3300032126 Bacteria 1505
453 Ga0373952_0011727 3300035092 Bacteria 1714
454 Ga0373923_0048180 3300035111 Bacteria 1778
455 Ga0373960_0021769 3300035121 Bacteria 1709
456 Ga0373935_0258927 3300035692 Bacteria 1220
457 Ga0316582_0088905 3300036647 Bacteria 2030
458 Ga0316584_0003131 3300036712 Bacteria 10694
459 Ga0395899_0010069 3300037312 Bacteria 7248
460 Ga0395899_0033706 3300037312 Bacteria 3846
461 Ga0395899_0070024 3300037312 Bacteria 2567
462 Ga0395899_0158638 3300037312 Bacteria 1599
463 Ga0395899_0162202 3300037312 Bacteria 1578
464 Ga0395900_0026549 3300037418 Bacteria 5929
465 Ga0395900_0026971 3300037418 Bacteria 5880
466 Ga0395900_0038243 3300037418 Bacteria 4946
467 Ga0395900_0043146 3300037418 Bacteria 4648
468 Ga0395900_0077226 3300037418 Bacteria 3421
469 Ga0395900_0234411 3300037418 Bacteria 1844
470 Ga0395900_0288130 3300037418 Bacteria 1632
471 Ga0395898_0022403 3300037466 Bacteria 6398
472 Ga0395898_0055793 3300037466 Bacteria 3853
473 Ga0395898_0095164 3300037466 Bacteria 2862
474 Ga0395898_0107797 3300037466 Bacteria 2671
475 Ga0395898_0202226 3300037466 Bacteria 1896
476 Ga0395898_0270324 3300037466 Bacteria 1621
477 Ga0395905_0204849 3300037471 Bacteria 1849
478 Ga0436364_0447671 3300037853 Bacteria 1746
479 Ga0436364_0568441 3300037853 Bacteria 3278
480 Ga0436364_0945699 3300037853 Bacteria 8067
481 Ga0436364_1074429 3300037853 Bacteria 13126
482 Ga0395901_0008071 3300038443 Bacteria 10636
483 Ga0395901_0034055 3300038443 Bacteria 5259
484 Ga0395901_0038508 3300038443 Bacteria 4946
485 Ga0395901_0043317 3300038443 Bacteria 4669
486 Ga0395901_0084316 3300038443 Bacteria 3321
487 Ga0436365_0128836 3300039437 Bacteria 8744
488 Ga0436365_0943767 3300039437 Bacteria 12284
489 Ga0436365_1318964 3300039437 Bacteria 13827
490 Ga0436365_1371614 3300039437 Bacteria 11157
491 Ga0436365_1701975 3300039437 Bacteria 4722
492 Ga0436365_1823845 3300039437 Bacteria 75216
493 Ga0436363_1096342 3300039450 Bacteria 55301
494 Ga0436363_1701714 3300039450 Bacteria 1246
495 Ga0439436_0002323 3300041404 Bacteria 5699
496 Ga0439436_0005085 3300041404 Bacteria 4029
497 Ga0439439_0007568 3300041406 Bacteria 2544
498 Ga0439439_0011938 3300041406 Bacteria 2095
499 Ga0439465_0011071 3300041413 Bacteria 2830
500 Ga0451791_1136519 3300041451 Bacteria 1231
501 Ga0451837_0590686 3300041494 Bacteria 2638
502 Ga0451837_1126097 3300041494 Bacteria 1666
503 Ga0451839_0206517 3300041496 Bacteria 1194
504 Ga0451843_1155741 3300041509 Bacteria 3741
505 Ga0451853_0008187 3300041512 Bacteria 2395
506 Ga0451853_0908799 3300041512 Bacteria 13693
507 Ga0451853_1848652 3300041512 Bacteria 1743
508 Ga0451853_3251545 3300041512 Bacteria 17977
509 Ga0451853_4095459 3300041512 Bacteria 1491
510 Ga0439445_0017563 3300042004 Bacteria 1769
511 Ga0439445_0034299 3300042004 Bacteria 1329
512 Ga0439448_0019572 3300042005 Bacteria 2086
513 Ga0439457_001791 3300042014 Bacteria 6348
514 Ga0439463_007686 3300042016 Bacteria 2662
515 Ga0450888_001867 3300042126 Bacteria 2039
516 Ga0450894_000038 3300042131 Bacteria 19456
517 Ga0450896_000383 3300042133 Bacteria 4418
518 Ga0450898_000548 3300042134 Bacteria 4425
519 Ga0450899_001035 3300042135 Bacteria 3159
520 Ga0450900_004646 3300042136 Bacteria 1587
521 Ga0450906_000899 3300042145 Bacteria 6494
522 Ga0439434_0003117 3300042435 Bacteria 4872
523 Ga0439464_0002536 3300042439 Bacteria 4508
524 Ga0439440_0006706 3300042993 Bacteria 2325
525 Ga0466969_0003721 3300044656 Bacteria 8107
526 Ga0466969_0017298 3300044656 Bacteria 3767
527 Ga0466969_0018174 3300044656 Bacteria 3666
528 Ga0466969_0024661 3300044656 Bacteria 3094
529 Ga0466972_0001874 3300044658 Bacteria 10312
530 Ga0466972_0031999 3300044658 Bacteria 2584
531 Ga0466972_0083384 3300044658 Bacteria 1521
532 Ga0466965_0000010 3300044683 Bacteria 112032
533 Ga0466965_0017178 3300044683 Bacteria 3455
534 Ga0466965_0022558 3300044683 Bacteria 3035
535 Ga0466965_0042885 3300044683 Bacteria 2232
536 Ga0466965_0053117 3300044683 Bacteria 2013
537 Ga0466965_0053220 3300044683 Bacteria 2012
538 Ga0466966_0007695 3300044684 Bacteria 7138
539 Ga0466966_0019354 3300044684 Bacteria 4479
540 Ga0466966_0081489 3300044684 Bacteria 2015
541 Ga0466961_0006247 3300044693 Bacteria 7566
542 Ga0466961_0011389 3300044693 Bacteria 5689
543 Ga0466961_0030681 3300044693 Bacteria 3454
544 Ga0466961_0033783 3300044693 Bacteria 3286
545 Ga0466961_0047998 3300044693 Bacteria 2729
546 Ga0466961_0164002 3300044693 Bacteria 1384
547 Ga0466961_0179448 3300044693 Bacteria 1315
548 Ga0466963_0000786 3300044694 Bacteria 15785
549 Ga0466963_0001599 3300044694 Bacteria 12312
550 Ga0466963_0002204 3300044694 Bacteria 10771
551 Ga0466963_0002353 3300044694 Bacteria 10548
552 Ga0466963_0006217 3300044694 Bacteria 7051
553 Ga0466963_0006912 3300044694 Bacteria 6749
554 Ga0466963_0017511 3300044694 Bacteria 4467
555 Ga0466963_0018630 3300044694 Bacteria 4344
556 Ga0466963_0019638 3300044694 Bacteria 4241
557 Ga0466963_0020110 3300044694 Bacteria 4196
558 Ga0466963_0021562 3300044694 Bacteria 4067
559 Ga0466963_0035570 3300044694 Bacteria 3245
560 Ga0466963_0040989 3300044694 Bacteria 3035
561 Ga0466963_0043773 3300044694 Bacteria 2945
562 Ga0466963_0045251 3300044694 Bacteria 2899
563 Ga0466963_0089482 3300044694 Bacteria 2094
564 Ga0466964_0001016 3300044706 Bacteria 9320
565 Ga0466964_0013146 3300044706 Bacteria 3138
566 Ga0466964_0052214 3300044706 Bacteria 1680
567 Ga0466964_0069190 3300044706 Bacteria 1488
568 Ga0466964_0073576 3300044706 Bacteria 1451
569 Ga0466964_0080898 3300044706 Bacteria 1394
570 Ga0466971_0005561 3300044719 Bacteria 5475
571 Ga0466971_0007675 3300044719 Bacteria 4704
572 Ga0466971_0014840 3300044719 Bacteria 3429
573 Ga0466971_0030173 3300044719 Bacteria 2426
574 Ga0466971_0040862 3300044719 Bacteria 2083
575 Ga0466971_0040902 3300044719 Bacteria 2082
576 Ga0466971_0043389 3300044719 Bacteria 2021
577 Ga0466971_0044480 3300044719 Bacteria 1994
578 Ga0466971_0048932 3300044719 Bacteria 1901
579 Ga0466968_0007552 3300044735 Bacteria 4137
580 Ga0466968_0009623 3300044735 Bacteria 3721
581 Ga0466968_0010855 3300044735 Bacteria 3539
582 Ga0466968_0016089 3300044735 Bacteria 2973
583 Ga0466968_0057599 3300044735 Bacteria 1671
584 Ga0466970_0001965 3300044765 Bacteria 9940
585 Ga0466970_0003700 3300044765 Bacteria 7473
586 Ga0466970_0004970 3300044765 Bacteria 6569
587 Ga0466970_0042153 3300044765 Bacteria 2427
588 Ga0466970_0070126 3300044765 Bacteria 1884
589 Ga0466970_0084230 3300044765 Bacteria 1721
590 Ga0466970_0093829 3300044765 Bacteria 1630
591 Ga0466970_0125218 3300044765 Bacteria 1409
592 Ga0466957_0002104 3300044842 Bacteria 10647
593 Ga0466957_0002299 3300044842 Bacteria 10240
594 Ga0466957_0009341 3300044842 Bacteria 5597
595 Ga0466957_0015808 3300044842 Bacteria 4409
596 Ga0466957_0026777 3300044842 Bacteria 3422
597 Ga0466957_0070728 3300044842 Bacteria 2156
598 Ga0466957_0327275 3300044842 Bacteria 1035
599 Ga0466960_0001461 3300044901 Bacteria 8615
600 Ga0466960_0002483 3300044901 Bacteria 6940
601 Ga0466960_0007395 3300044901 Bacteria 4461
602 Ga0466960_0011396 3300044901 Bacteria 3720
603 Ga0466960_0014883 3300044901 Bacteria 3342
604 Ga0466960_0016843 3300044901 Bacteria 3177
605 Ga0466960_0029854 3300044901 Bacteria 2504
606 Ga0466960_0036966 3300044901 Bacteria 2289
607 Ga0466960_0041665 3300044901 Bacteria 2176
608 Ga0466960_0065561 3300044901 Bacteria 1794
609 Ga0466960_0106558 3300044901 Bacteria 1450
610 Ga0466959_0002904 3300045049 Bacteria 11056
611 Ga0466959_0004094 3300045049 Bacteria 9708
612 Ga0466959_0006152 3300045049 Bacteria 8294
613 Ga0466959_0019737 3300045049 Bacteria 4958
614 Ga0466959_0035995 3300045049 Bacteria 3658
615 Ga0466959_0050868 3300045049 Bacteria 3041
616 Ga0466959_0072348 3300045049 Bacteria 2495
617 Ga0466959_0101535 3300045049 Bacteria 2059
618 Ga0466959_0256051 3300045049 Bacteria 1206
619 Ga0466958_0000838 3300045836 Bacteria 13611
620 Ga0466958_0001618 3300045836 Bacteria 10841
621 Ga0466958_0002091 3300045836 Bacteria 9888
622 Ga0466958_0010619 3300045836 Bacteria 5162
623 Ga0466958_0032901 3300045836 Bacteria 3087
624 Ga0466958_0035663 3300045836 Bacteria 2971
625 Ga0466958_0108650 3300045836 Bacteria 1730
626 Ga0466958_0110189 3300045836 Bacteria 1718
627 Ga0466958_0116678 3300045836 Bacteria 1669
628 Ga0466958_0138168 3300045836 Bacteria 1533
629 Ga0466958_0163412 3300045836 Bacteria 1408
630 Ga0466967_0000459 3300045976 Bacteria 19611
631 Ga0466967_0000531 3300045976 Bacteria 18523
632 Ga0466967_0003729 3300045976 Bacteria 10041
633 Ga0466967_0003792 3300045976 Bacteria 9990
634 Ga0466967_0003823 3300045976 Bacteria 9963
635 Ga0466967_0005090 3300045976 Bacteria 9024
636 Ga0466967_0005282 3300045976 Bacteria 8911
637 Ga0466967_0015603 3300045976 Bacteria 5958
638 Ga0466967_0017824 3300045976 Bacteria 5654
639 Ga0466967_0018107 3300045976 Bacteria 5620
640 Ga0466967_0022045 3300045976 Bacteria 5188
641 Ga0466967_0023502 3300045976 Bacteria 5052
642 Ga0466967_0023807 3300045976 Bacteria 5024
643 Ga0466967_0024371 3300045976 Bacteria 4973
644 Ga0466967_0026125 3300045976 Bacteria 4830
645 Ga0466967_0026394 3300045976 Bacteria 4811
646 Ga0466967_0035581 3300045976 Bacteria 4241
647 Ga0466967_0043969 3300045976 Bacteria 3870
648 Ga0466967_0046183 3300045976 Bacteria 3790
649 Ga0466967_0050893 3300045976 Bacteria 3628
650 Ga0466967_0052435 3300045976 Bacteria 3580
651 Ga0466967_0075613 3300045976 Bacteria 3027
652 Ga0466967_0075783 3300045976 Bacteria 3024
653 Ga0466967_0077072 3300045976 Bacteria 3000
654 Ga0466967_0083486 3300045976 Bacteria 2889
655 Ga0466967_0085941 3300045976 Bacteria 2849
656 Ga0466967_0103417 3300045976 Bacteria 2606
657 Ga0466967_0108016 3300045976 Bacteria 2553
658 Ga0466967_0113244 3300045976 Bacteria 2495
659 Ga0466967_0118606 3300045976 Bacteria 2441
660 Ga0466967_0142277 3300045976 Bacteria 2235
661 Ga0466967_0142584 3300045976 Bacteria 2233
662 Ga0466967_0232364 3300045976 Bacteria 1756
663 Ga0466967_0383973 3300045976 Bacteria 1364
664 Ga0495592_0046066 3300046454 Bacteria 3251
665 Ga0495629_0001345 3300046459 Bacteria 19361
666 Ga0495629_0043163 3300046459 Bacteria 3167
667 Ga0495641_0000001 3300046461 Bacteria 485224
668 Ga0495651_0038699 3300046462 Bacteria 3714
669 Ga0495653_0057907 3300046463 Bacteria 2947
670 Ga0495653_0145146 3300046463 Bacteria 1664
671 Ga0495653_0203391 3300046463 Bacteria 1342
672 Ga0495664_0137673 3300046477 Bacteria 1480
673 Ga0495585_0023017 3300046492 Bacteria 3575
674 Ga0495606_0001904 3300046507 Bacteria 25978
675 Ga0495628_0067564 3300046516 Bacteria 2791
676 Ga0495643_0002259 3300046522 Bacteria 15625
677 Ga0495644_0003311 3300046523 Bacteria 6369
678 Ga0495648_0021917 3300046524 Bacteria 4412
679 Ga0495652_0201366 3300046529 Bacteria 1510
680 Ga0495586_0001003 3300046535 Bacteria 15977
681 Ga0495633_0080322 3300046558 Bacteria 1518
682 Ga0495668_0000157 3300046616 Bacteria 103626
683 Ga0495668_0009185 3300046616 Bacteria 6085
684 Ga0495634_0044728 3300046642 Bacteria 2995
685 Ga0495625_0000032 3300046660 Bacteria 233135
686 Ga0495625_0001768 3300046660 Bacteria 24970
687 Ga0495658_0054952 3300046683 Bacteria 2267
688 Ga0495613_0173256 3300046689 Bacteria 1530
689 Ga0495649_0002010 3300046694 Bacteria 14734
690 Ga0495600_0134678 3300046809 Bacteria 1605
691 Ga0495604_0079955 3300047317 Bacteria 2450
692 Ga0495604_0104372 3300047317 Bacteria 2077
693 Ga0495672_0004055 3300047320 Bacteria 12234
694 Ga0495672_0020993 3300047320 Bacteria 4267
695 Ga0495676_0000878 3300047321 Bacteria 25093
696 Ga0495676_0001012 3300047321 Bacteria 23711
697 Ga0495687_008272 3300047443 Bacteria 5982
698 Ga0495685_002659 3300047447 Bacteria 5632
699 Ga0495673_0011435 3300047469 Bacteria 4771
700 Ga0495681_0008002 3300047470 Bacteria 6674
701 Ga0495686_0047331 3300047472 Bacteria 2716
702 Ga0495626_0000291 3300048091 Bacteria 54131
703 Ga0495626_0006570 3300048091 Bacteria 6597
704 Ga0496100_0000049 3300048903 Bacteria 75590
705 Ga0496100_0003260 3300048903 Bacteria 8436
706 Ga0496100_0016762 3300048903 Bacteria 4309
707 Ga0496100_0079693 3300048903 Bacteria 2207
708 Ga0496101_0000010 3300048904 Bacteria 281990
709 Ga0496101_0012828 3300048904 Bacteria 5603
710 Ga0496101_0014756 3300048904 Bacteria 5256
711 Ga0496101_0020366 3300048904 Bacteria 4539
712 Ga0496101_0040585 3300048904 Bacteria 3314
713 Ga0496101_0055181 3300048904 Bacteria 2869
714 Ga0496102_0000658 3300048905 Bacteria 34590
715 Ga0496102_0057354 3300048905 Bacteria 3556
716 Ga0496102_0118692 3300048905 Bacteria 2469
717 Ga0496102_0385408 3300048905 Bacteria 1319
718 Ga0496103_0000749 3300048906 Bacteria 23921
719 Ga0496104_0000003 3300048907 Bacteria 669219
720 Ga0496104_0000010 3300048907 Bacteria 475255
721 Ga0496104_0002873 3300048907 Bacteria 14850
722 Ga0496104_0068980 3300048907 Bacteria 3360
723 Ga0496104_0108146 3300048907 Bacteria 2665
724 Ga0496104_0202321 3300048907 Bacteria 1898
725 Ga0496104_0209233 3300048907 Bacteria 1862
726 Ga0496105_0000003 3300048908 Bacteria 713251
727 Ga0496105_0000005 3300048908 Bacteria 475797
728 Ga0496105_0001228 3300048908 Bacteria 17859
729 Ga0496105_0067957 3300048908 Bacteria 2943
730 Ga0496105_0088947 3300048908 Bacteria 2551
731 Ga0496105_0270250 3300048908 Bacteria 1373
732 Ga0496105_0411967 3300048908 Bacteria 1071
733 Ga0496106_0000554 3300048909 Bacteria 26600
734 Ga0496106_0016600 3300048909 Bacteria 5449
735 Ga0496106_0038244 3300048909 Bacteria 3590
736 Ga0496106_0073131 3300048909 Bacteria 2622
737 Ga0496106_0123664 3300048909 Bacteria 2024
738 Ga0496106_0124343 3300048909 Bacteria 2019
739 Ga0496106_0145998 3300048909 Bacteria 1863
740 Ga0496107_0000032 3300048910 Bacteria 99848
741 Ga0496107_0025887 3300048910 Bacteria 4157
742 Ga0496107_0047751 3300048910 Bacteria 3083
743 Ga0496107_0067476 3300048910 Bacteria 2595
744 Ga0496107_0092342 3300048910 Bacteria 2213
745 Ga0496108_0000055 3300048911 Bacteria 125202
746 Ga0496108_0000266 3300048911 Bacteria 44912
747 Ga0496108_0003741 3300048911 Bacteria 12203
748 Ga0496108_0008375 3300048911 Bacteria 8389
749 Ga0496108_0008381 3300048911 Bacteria 8387
750 Ga0496108_0023418 3300048911 Bacteria 5082
751 Ga0496108_0030620 3300048911 Bacteria 4459
752 Ga0496108_0064963 3300048911 Bacteria 3075
753 Ga0496108_0069663 3300048911 Bacteria 2968
754 Ga0496108_0238423 3300048911 Bacteria 1582
755 Ga0496109_0000043 3300048912 Bacteria 134649
756 Ga0496109_0001540 3300048912 Bacteria 19168
757 Ga0496109_0007616 3300048912 Bacteria 9182
758 Ga0496109_0011010 3300048912 Bacteria 7752
759 Ga0496109_0011940 3300048912 Bacteria 7479
760 Ga0496109_0015695 3300048912 Bacteria 6607
761 Ga0496109_0022770 3300048912 Bacteria 5551
762 Ga0496109_0051504 3300048912 Bacteria 3750
763 Ga0496109_0055041 3300048912 Bacteria 3629
764 Ga0496109_0071268 3300048912 Bacteria 3190
765 Ga0496109_0093809 3300048912 Bacteria 2778
766 Ga0496109_0101897 3300048912 Bacteria 2665
767 Ga0496109_0346087 3300048912 Bacteria 1404
768 Ga0496110_0000853 3300048913 Bacteria 21488
769 Ga0496110_0018185 3300048913 Bacteria 5889
770 Ga0496110_0137102 3300048913 Bacteria 2212
771 Ga0496110_0149908 3300048913 Bacteria 2111
772 Ga0496110_0214949 3300048913 Bacteria 1748
773 Ga0496111_0002660 3300048914 Bacteria 10835
774 Ga0496111_0006857 3300048914 Bacteria 7434
775 Ga0496111_0011810 3300048914 Bacteria 5897
776 Ga0496111_0016959 3300048914 Bacteria 5028
777 Ga0496111_0028625 3300048914 Bacteria 3950
778 Ga0496111_0028700 3300048914 Bacteria 3944
779 Ga0496111_0184786 3300048914 Bacteria 1550
780 Ga0496112_0000091 3300048915 Bacteria 59685
781 Ga0496112_0000408 3300048915 Bacteria 28228
782 Ga0496112_0008049 3300048915 Bacteria 9407
783 Ga0496112_0014574 3300048915 Bacteria 7303
784 Ga0496112_0059774 3300048915 Bacteria 3756
785 Ga0496112_0070887 3300048915 Bacteria 3444
786 Ga0496113_0000001 3300048916 Bacteria 224977
787 Ga0496113_0000892 3300048916 Bacteria 15731
788 Ga0496113_0039379 3300048916 Bacteria 3479
789 Ga0496113_0078361 3300048916 Bacteria 2528
790 Ga0496113_0090451 3300048916 Bacteria 2358
791 Ga0496113_0152361 3300048916 Bacteria 1825
792 Ga0496113_0183883 3300048916 Bacteria 1657
793 Ga0496114_0001646 3300048917 Bacteria 16951
794 Ga0496114_0007876 3300048917 Bacteria 8430
795 Ga0496114_0013262 3300048917 Bacteria 6607
796 Ga0496114_0013727 3300048917 Bacteria 6493
797 Ga0496114_0035190 3300048917 Bacteria 4135
798 Ga0496114_0077463 3300048917 Bacteria 2803
799 Ga0496114_0124091 3300048917 Bacteria 2224
800 Ga0496114_0177299 3300048917 Bacteria 1860
801 Ga0496115_0004944 3300048918 Bacteria 9685
802 Ga0496115_0024021 3300048918 Bacteria 4735
803 Ga0496115_0068572 3300048918 Bacteria 2872
804 Ga0496115_0119613 3300048918 Bacteria 2166
805 Ga0496115_0247687 3300048918 Bacteria 1468
806 Ga0496115_0272312 3300048918 Bacteria 1391
807 Ga0496116_0036741 3300048919 Bacteria 3423
808 Ga0496117_0000216 3300048920 Bacteria 111598
809 Ga0496117_0000510 3300048920 Bacteria 64253
810 Ga0496117_0001045 3300048920 Bacteria 42245
811 Ga0496117_0001139 3300048920 Bacteria 40044
812 Ga0496117_0120497 3300048920 Bacteria 1613
813 Ga0496118_0000348 3300048921 Bacteria 78668
814 Ga0496118_0000931 3300048921 Bacteria 45727
815 Ga0496118_0002405 3300048921 Bacteria 25275
816 Ga0496118_0002564 3300048921 Bacteria 24280
817 Ga0496118_0002771 3300048921 Bacteria 22960
818 Ga0496118_0011318 3300048921 Bacteria 8720
819 Ga0496118_0032547 3300048921 Bacteria 4292
820 Ga0496118_0053762 3300048921 Bacteria 3057
821 Ga0496119_0000565 3300048922 Bacteria 49872
822 Ga0496119_0003258 3300048922 Bacteria 16981
823 Ga0496119_0004363 3300048922 Bacteria 14113
824 Ga0496119_0009429 3300048922 Bacteria 8381
825 Ga0496119_0017940 3300048922 Bacteria 5295
826 Ga0496119_0019038 3300048922 Bacteria 5077
827 Ga0496119_0026628 3300048922 Bacteria 4003
828 Ga0496119_0147680 3300048922 Bacteria 1263
829 Ga0496120_0000683 3300048923 Bacteria 49873
830 Ga0496120_0003305 3300048923 Bacteria 14824
831 Ga0496120_0007452 3300048923 Bacteria 8135
832 Ga0496120_0009064 3300048923 Bacteria 7106
833 Ga0496120_0021115 3300048923 Bacteria 4119
834 Ga0496121_0000380 3300048924 Bacteria 90959
835 Ga0496121_0001481 3300048924 Bacteria 39559
836 Ga0496121_0015682 3300048924 Bacteria 7906
837 Ga0496122_0000036 3300048925 Bacteria 312598
838 Ga0496122_0006657 3300048925 Bacteria 13171
839 Ga0496122_0015027 3300048925 Bacteria 7434
840 Ga0496122_0018427 3300048925 Bacteria 6450
841 Ga0496122_0022308 3300048925 Bacteria 5633
842 Ga0496122_0059835 3300048925 Bacteria 2810
843 Ga0496122_0065012 3300048925 Bacteria 2649
844 Ga0496123_0000011 3300048926 Bacteria 493925
845 Ga0496123_0006839 3300048926 Bacteria 10931
846 Ga0496123_0008754 3300048926 Bacteria 9238
847 Ga0496123_0045166 3300048926 Bacteria 3004
848 Ga0496123_0069611 3300048926 Bacteria 2208
849 Ga0496124_0000075 3300048927 Bacteria 218086
850 Ga0496124_0001716 3300048927 Bacteria 30900
851 Ga0496124_0002154 3300048927 Bacteria 26446
852 Ga0496124_0005024 3300048927 Bacteria 15123
853 Ga0496124_0150806 3300048927 Bacteria 1824
854 Ga0496124_0244071 3300048927 Bacteria 1333
855 Ga0496125_0001936 3300048928 Bacteria 28297
856 Ga0496125_0013945 3300048928 Bacteria 7860
857 Ga0496125_0020290 3300048928 Bacteria 6239
858 Ga0496125_0024807 3300048928 Bacteria 5505
859 Ga0496125_0034919 3300048928 Bacteria 4422
860 Ga0496125_0055526 3300048928 Bacteria 3226
861 Ga0496125_0076027 3300048928 Bacteria 2595
862 Ga0496126_0000039 3300048929 Bacteria 347353
863 Ga0496126_0008479 3300048929 Bacteria 11084
864 Ga0496126_0011727 3300048929 Bacteria 9030
865 Ga0496126_0015593 3300048929 Bacteria 7636
866 Ga0501031_0000187 3300049568 Bacteria 34809
867 Ga0501031_0000793 3300049568 Bacteria 19025
868 Ga0501031_0020737 3300049568 Bacteria 4284
869 Ga0501031_0033160 3300049568 Bacteria 3367
870 Ga0501031_0106110 3300049568 Bacteria 1833
871 Ga0501031_0110434 3300049568 Bacteria 1795
872 Ga0501032_0000285 3300049569 Bacteria 42486
873 Ga0501032_0000382 3300049569 Bacteria 36613
874 Ga0501032_0001086 3300049569 Bacteria 21698
875 Ga0501032_0001794 3300049569 Bacteria 16946
876 Ga0501032_0007193 3300049569 Bacteria 8140
877 Ga0501032_0012590 3300049569 Bacteria 6039
878 Ga0501032_0013466 3300049569 Bacteria 5815
879 Ga0501032_0015090 3300049569 Bacteria 5456
880 Ga0501032_0022621 3300049569 Bacteria 4356
881 Ga0501032_0031796 3300049569 Bacteria 3618
882 Ga0501032_0054831 3300049569 Bacteria 2682
883 Ga0501032_0129855 3300049569 Bacteria 1663
884 Ga0501032_0142191 3300049569 Bacteria 1580
885 Ga0501032_0193950 3300049569 Bacteria 1327
886 Ga0501033_0001052 3300049570 Bacteria 25193
887 Ga0501033_0002164 3300049570 Bacteria 16995
888 Ga0501033_0002467 3300049570 Bacteria 15692
889 Ga0501033_0002624 3300049570 Bacteria 15129
890 Ga0501033_0016951 3300049570 Bacteria 5506
891 Ga0501033_0018404 3300049570 Bacteria 5277
892 Ga0501033_0023472 3300049570 Bacteria 4651
893 Ga0501033_0026382 3300049570 Bacteria 4373
894 Ga0501033_0035363 3300049570 Bacteria 3745
895 Ga0501033_0154255 3300049570 Bacteria 1655
896 Ga0501034_0000823 3300049571 Bacteria 46187
897 Ga0501034_0001867 3300049571 Bacteria 26738
898 Ga0501034_0003834 3300049571 Bacteria 16943
899 Ga0501034_0008772 3300049571 Bacteria 10643
900 Ga0501034_0009367 3300049571 Bacteria 10260
901 Ga0501034_0010489 3300049571 Bacteria 9648
902 Ga0501034_0011606 3300049571 Bacteria 9124
903 Ga0501034_0015366 3300049571 Bacteria 7867
904 Ga0501034_0015838 3300049571 Bacteria 7742
905 Ga0501034_0021803 3300049571 Bacteria 6526
906 Ga0501034_0029571 3300049571 Bacteria 5570
907 Ga0501034_0033671 3300049571 Bacteria 5196
908 Ga0501034_0034411 3300049571 Bacteria 5135
909 Ga0501034_0042366 3300049571 Bacteria 4608
910 Ga0501034_0043310 3300049571 Bacteria 4556
911 Ga0501034_0057831 3300049571 Bacteria 3898
912 Ga0501034_0072645 3300049571 Bacteria 3449
913 Ga0501034_0180896 3300049571 Bacteria 2073
914 Ga0501034_0203954 3300049571 Bacteria 1934
915 Ga0501034_0315181 3300049571 Bacteria 1498
916 Ga0501036_0001015 3300049572 Bacteria 21193
917 Ga0501036_0006053 3300049572 Bacteria 9811
918 Ga0501036_0018374 3300049572 Bacteria 5856
919 Ga0501036_0024978 3300049572 Bacteria 5039
920 Ga0501036_0026465 3300049572 Bacteria 4896
921 Ga0501036_0037324 3300049572 Bacteria 4111
922 Ga0501036_0037617 3300049572 Bacteria 4093
923 Ga0501036_0040731 3300049572 Bacteria 3930
924 Ga0501036_0042569 3300049572 Bacteria 3845
925 Ga0501036_0049879 3300049572 Bacteria 3545
926 Ga0501036_0051373 3300049572 Bacteria 3490
927 Ga0501036_0055542 3300049572 Bacteria 3355
928 Ga0501036_0092359 3300049572 Bacteria 2557
929 Ga0501036_0108990 3300049572 Bacteria 2340
930 Ga0501036_0109265 3300049572 Bacteria 2337
931 Ga0501036_0344768 3300049572 Bacteria 1244
932 Ga0501037_0000339 3300049573 Bacteria 39491
933 Ga0501037_0000543 3300049573 Bacteria 30170
934 Ga0501037_0000693 3300049573 Bacteria 25670
935 Ga0501037_0005845 3300049573 Bacteria 8985
936 Ga0501037_0008444 3300049573 Bacteria 7552
937 Ga0501037_0022521 3300049573 Bacteria 4661
938 Ga0501037_0028003 3300049573 Bacteria 4163
939 Ga0501037_0031382 3300049573 Bacteria 3923
940 Ga0501037_0055108 3300049573 Bacteria 2907
941 Ga0501037_0108575 3300049573 Bacteria 1999
942 Ga0501037_0196207 3300049573 Bacteria 1428
943 Ga0501038_0000223 3300049574 Bacteria 48354
944 Ga0501038_0000388 3300049574 Bacteria 38054
945 Ga0501038_0001452 3300049574 Bacteria 21777
946 Ga0501038_0004081 3300049574 Bacteria 13582
947 Ga0501038_0005026 3300049574 Bacteria 12284
948 Ga0501038_0005695 3300049574 Bacteria 11558
949 Ga0501038_0011274 3300049574 Bacteria 8162
950 Ga0501038_0015469 3300049574 Bacteria 6934
951 Ga0501038_0015633 3300049574 Bacteria 6898
952 Ga0501038_0020398 3300049574 Bacteria 5958
953 Ga0501038_0038278 3300049574 Bacteria 4201
954 Ga0501038_0070120 3300049574 Bacteria 2977
955 Ga0501038_0154489 3300049574 Bacteria 1869
956 Ga0501038_0189991 3300049574 Bacteria 1653
957 Ga0501039_0002928 3300049575 Bacteria 12774
958 Ga0501039_0006242 3300049575 Bacteria 9056
959 Ga0501039_0016747 3300049575 Bacteria 5617
960 Ga0501039_0019744 3300049575 Bacteria 5167
961 Ga0501039_0022978 3300049575 Bacteria 4783
962 Ga0501040_0026207 3300049576 Bacteria 3921
963 Ga0501040_0055284 3300049576 Bacteria 2722
964 Ga0501041_0016787 3300049577 Bacteria 4357
965 Ga0501041_0035171 3300049577 Bacteria 3035
966 Ga0501041_0102592 3300049577 Bacteria 1771
967 Ga0501042_0016064 3300049578 Bacteria 5135
968 Ga0501042_0045614 3300049578 Bacteria 3124
969 Ga0501042_0071679 3300049578 Bacteria 2479
970 Ga0501042_0090062 3300049578 Bacteria 2202
971 Ga0501042_0095861 3300049578 Bacteria 2131
972 Ga0501042_0111252 3300049578 Bacteria 1972
973 Ga0501042_0114138 3300049578 Bacteria 1945
974 Ga0501043_0000335 3300049579 Bacteria 42702
975 Ga0501043_0002464 3300049579 Bacteria 15655
976 Ga0501043_0002686 3300049579 Bacteria 14905
977 Ga0501043_0010324 3300049579 Bacteria 7321
978 Ga0501043_0021933 3300049579 Bacteria 5008
979 Ga0501043_0048035 3300049579 Bacteria 3355
980 Ga0501043_0050927 3300049579 Bacteria 3255
981 Ga0501043_0051580 3300049579 Bacteria 3232
982 Ga0501043_0108175 3300049579 Bacteria 2184
983 Ga0501043_0157266 3300049579 Bacteria 1777
984 Ga0501043_0213415 3300049579 Bacteria 1495
985 Ga0501043_0242290 3300049579 Bacteria 1390
986 Ga0501043_0243219 3300049579 Bacteria 1387
987 Ga0501046_0000574 3300049580 Bacteria 36310
988 Ga0501046_0000879 3300049580 Bacteria 29216
989 Ga0501046_0002639 3300049580 Bacteria 16749
990 Ga0501046_0003736 3300049580 Bacteria 13934
991 Ga0501046_0008225 3300049580 Bacteria 9108
992 Ga0501046_0010318 3300049580 Bacteria 8031
993 Ga0501046_0019550 3300049580 Bacteria 5616
994 Ga0501046_0021943 3300049580 Bacteria 5262
995 Ga0501046_0063704 3300049580 Bacteria 2878
996 Ga0501047_0000023 3300049581 Bacteria 240478
997 Ga0501047_0000120 3300049581 Bacteria 95976
998 Ga0501047_0000433 3300049581 Bacteria 46523
999 Ga0501047_0004021 3300049581 Bacteria 13822
1000 Ga0501047_0005870 3300049581 Bacteria 11554
1001 Ga0501047_0010343 3300049581 Bacteria 8824
1002 Ga0501047_0011986 3300049581 Bacteria 8203
1003 Ga0501047_0014869 3300049581 Bacteria 7408
1004 Ga0501047_0023292 3300049581 Bacteria 5946
1005 Ga0501047_0031145 3300049581 Bacteria 5145
1006 Ga0501047_0039719 3300049581 Bacteria 4551
1007 Ga0501047_0057557 3300049581 Bacteria 3758
1008 Ga0501047_0069747 3300049581 Bacteria 3385
1009 Ga0501047_0078384 3300049581 Bacteria 3177
1010 Ga0501047_0081646 3300049581 Bacteria 3107
1011 Ga0501047_0104102 3300049581 Bacteria 2718
1012 Ga0501047_0112008 3300049581 Bacteria 2611
1013 Ga0501047_0236296 3300049581 Bacteria 1679
1014 Ga0501047_0257928 3300049581 Bacteria 1591
1015 Ga0501048_0000158 3300049582 Bacteria 41905
1016 Ga0501048_0000544 3300049582 Bacteria 26539
1017 Ga0501048_0000697 3300049582 Bacteria 24452
1018 Ga0501048_0001941 3300049582 Bacteria 15695
1019 Ga0501048_0009711 3300049582 Bacteria 7219
1020 Ga0501048_0017362 3300049582 Bacteria 5303
1021 Ga0501048_0032203 3300049582 Bacteria 3789
1022 Ga0501067_0000366 3300049583 Bacteria 24727
1023 Ga0501067_0003026 3300049583 Bacteria 9284
1024 Ga0501067_0078203 3300049583 Bacteria 1833
1025 Ga0501068_0002536 3300049584 Bacteria 9694
1026 Ga0501068_0031686 3300049584 Bacteria 3140
1027 Ga0501068_0042659 3300049584 Bacteria 2728
1028 Ga0501068_0044617 3300049584 Bacteria 2670
1029 Ga0501068_0144053 3300049584 Bacteria 1495
1030 Ga0501069_0002998 3300049585 Bacteria 8697
1031 Ga0501069_0009647 3300049585 Bacteria 5100
1032 Ga0501069_0021619 3300049585 Bacteria 3494
1033 Ga0501069_0023420 3300049585 Bacteria 3367
1034 Ga0501070_0000039 3300049586 Bacteria 114215
1035 Ga0501070_0000551 3300049586 Bacteria 34237
1036 Ga0501070_0002128 3300049586 Bacteria 17380
1037 Ga0501070_0002341 3300049586 Bacteria 16632
1038 Ga0501070_0005907 3300049586 Bacteria 10439
1039 Ga0501070_0006294 3300049586 Bacteria 10106
1040 Ga0501070_0009786 3300049586 Bacteria 8110
1041 Ga0501070_0013856 3300049586 Bacteria 6791
1042 Ga0501070_0017923 3300049586 Bacteria 5945
1043 Ga0501070_0030785 3300049586 Bacteria 4494
1044 Ga0501070_0045070 3300049586 Bacteria 3668
1045 Ga0501070_0076233 3300049586 Bacteria 2776
1046 Ga0501070_0082466 3300049586 Bacteria 2661
1047 Ga0501070_0096821 3300049586 Bacteria 2441
1048 Ga0501070_0293279 3300049586 Bacteria 1326
1049 Ga0501071_0012621 3300049587 Bacteria 5737
1050 Ga0501072_0007567 3300049588 Bacteria 8242
1051 Ga0501072_0038949 3300049588 Bacteria 3731
1052 Ga0501072_0083001 3300049588 Bacteria 2540
1053 Ga0501072_0167501 3300049588 Bacteria 1753
1054 Ga0501072_0309109 3300049588 Bacteria 1257
1055 Ga0501073_0009010 3300049589 Bacteria 7368
1056 Ga0501073_0019699 3300049589 Bacteria 4869
1057 Ga0501073_0043766 3300049589 Bacteria 3156
1058 Ga0501073_0231619 3300049589 Bacteria 1276
1059 Ga0501074_0002352 3300049590 Bacteria 13157
1060 Ga0501074_0013532 3300049590 Bacteria 5930
1061 Ga0501074_0021037 3300049590 Bacteria 4737
1062 Ga0501074_0034267 3300049590 Bacteria 3681
1063 Ga0501074_0047928 3300049590 Bacteria 3087
1064 Ga0501075_0049571 3300049591 Bacteria 3157
1065 Ga0501075_0075862 3300049591 Bacteria 2542
1066 Ga0501075_0087688 3300049591 Bacteria 2359
1067 Ga0501075_0143660 3300049591 Bacteria 1819
1068 Ga0501076_0022734 3300049592 Bacteria 4822
1069 Ga0501076_0046054 3300049592 Bacteria 3445
1070 Ga0501076_0092363 3300049592 Bacteria 2435
1071 Ga0501077_0008189 3300049593 Bacteria 6465
1072 Ga0501077_0067441 3300049593 Bacteria 2269
1073 Ga0501077_0118627 3300049593 Bacteria 1676
1074 Ga0501077_0125684 3300049593 Bacteria 1625
1075 Ga0501079_0030796 3300049741 Bacteria 4123
1076 Ga0501079_0115061 3300049741 Bacteria 2090
1077 Ga0501079_0147053 3300049741 Bacteria 1837
1078 Ga0501080_0000125 3300049742 Bacteria 54161
1079 Ga0501080_0000420 3300049742 Bacteria 32621
1080 Ga0501080_0002818 3300049742 Bacteria 15279
1081 Ga0501080_0023078 3300049742 Bacteria 5769
1082 Ga0501080_0025286 3300049742 Bacteria 5510
1083 Ga0501080_0028060 3300049742 Bacteria 5234
1084 Ga0501080_0077842 3300049742 Bacteria 3084
1085 Ga0501080_0109022 3300049742 Bacteria 2566
1086 Ga0501080_0202454 3300049742 Bacteria 1822
1087 Ga0501083_0008473 3300049744 Bacteria 7265
1088 Ga0501083_0025939 3300049744 Bacteria 4055
1089 Ga0501083_0045570 3300049744 Bacteria 2966
1090 Ga0501083_0075918 3300049744 Bacteria 2231
1091 Ga0501035_0000257 3300049822 Bacteria 63434
1092 Ga0501035_0000385 3300049822 Bacteria 50730
1093 Ga0501035_0000498 3300049822 Bacteria 44178
1094 Ga0501035_0001723 3300049822 Bacteria 22095
1095 Ga0501035_0001747 3300049822 Bacteria 21950
1096 Ga0501035_0002891 3300049822 Bacteria 16550
1097 Ga0501035_0005716 3300049822 Bacteria 11730
1098 Ga0501035_0006459 3300049822 Bacteria 11010
1099 Ga0501035_0010245 3300049822 Bacteria 8697
1100 Ga0501035_0010988 3300049822 Bacteria 8382
1101 Ga0501035_0013198 3300049822 Bacteria 7625
1102 Ga0501035_0018779 3300049822 Bacteria 6368
1103 Ga0501035_0026556 3300049822 Bacteria 5297
1104 Ga0501035_0029465 3300049822 Bacteria 5005
1105 Ga0501035_0068566 3300049822 Bacteria 3144
1106 Ga0501035_0233168 3300049822 Bacteria 1568
1107 Ga0501035_0272059 3300049822 Bacteria 1433
1108 Ga0501035_0355618 3300049822 Bacteria 1225
1109 Ga0501044_0000110 3300049823 Bacteria 100116
1110 Ga0501044_0001479 3300049823 Bacteria 27556
1111 Ga0501044_0002484 3300049823 Bacteria 21031
1112 Ga0501044_0003392 3300049823 Bacteria 17949
1113 Ga0501044_0003831 3300049823 Bacteria 16880
1114 Ga0501044_0008291 3300049823 Bacteria 11392
1115 Ga0501044_0008752 3300049823 Bacteria 11073
1116 Ga0501044_0017747 3300049823 Bacteria 7634
1117 Ga0501044_0023907 3300049823 Bacteria 6494
1118 Ga0501044_0036079 3300049823 Bacteria 5174
1119 Ga0501044_0059281 3300049823 Bacteria 3922
1120 Ga0501044_0067692 3300049823 Bacteria 3638
1121 Ga0501044_0067847 3300049823 Bacteria 3634
1122 Ga0501044_0092442 3300049823 Bacteria 3051
1123 Ga0501044_0106584 3300049823 Bacteria 2814
1124 Ga0501044_0108942 3300049823 Bacteria 2779
1125 Ga0501044_0130604 3300049823 Bacteria 2506
1126 Ga0501044_0185922 3300049823 Bacteria 2042
1127 Ga0501044_0212502 3300049823 Bacteria 1888
1128 Ga0501044_0273379 3300049823 Bacteria 1625
1129 Ga0501045_0006364 3300049824 Bacteria 8172
1130 Ga0501045_0008074 3300049824 Bacteria 7331
1131 Ga0501045_0020288 3300049824 Bacteria 4747
1132 Ga0501045_0069185 3300049824 Bacteria 2594
1133 Ga0501045_0151550 3300049824 Bacteria 1725
1134 Ga0501045_0264301 3300049824 Bacteria 1281
1135 nmdc:mga03683_21844_c1 3300050489 Bacteria 2473
1136 nmdc:mga03n38_12429_c1 3300050490 Bacteria 3204
1137 nmdc:mga03n38_15533_c1 3300050490 Bacteria 2942
1138 nmdc:mga03n38_7187_c1 3300050490 Bacteria 3924
1139 nmdc:mga00v17_21703_c2 3300050491 Bacteria 3384
1140 nmdc:mga00v17_706_c1 3300050491 Bacteria 18264
1141 nmdc:mga00v17_7532_c1 3300050491 Bacteria 5812
1142 nmdc:mga0yw44_120893_c1 3300050492 Bacteria 1687
1143 nmdc:mga0yw44_227344_c1 3300050492 Bacteria 1238
1144 nmdc:mga0yw44_55262_c1 3300050492 Bacteria 2415
1145 nmdc:mga0k408_78322_c1 3300050493 Unclassified 1933
1146 nmdc:mga07m45_17165_c1 3300050496 Bacteria 3882
1147 nmdc:mga07m45_69277_c1 3300050496 Bacteria 2005
1148 nmdc:mga05p37_195530_c1 3300050507 Bacteria 2452
1149 nmdc:mga05p37_7528_c1 3300050507 Bacteria 12836
1150 nmdc:mga09592_81492_c1 3300050508 Bacteria 2757
1151 nmdc:mga0qj67_11064_c1 3300050509 Bacteria 6756
1152 nmdc:mga06r32_125522_c1 3300050510 Bacteria 2534
1153 nmdc:mga06r32_17950_c1 3300050510 Bacteria 6469
1154 nmdc:mga08y16_16353_c1 3300050511 Bacteria 7798
1155 nmdc:mga08y16_203520_c1 3300050511 Bacteria 2051
1156 nmdc:mga08y16_326919_c1 3300050511 Bacteria 1578
1157 nmdc:mga08y16_5873_c1 3300050511 Bacteria 12860
1158 nmdc:mga08y16_627135_c1 3300050511 Bacteria 1081
1159 nmdc:mga0n895_279618_c1 3300050512 Bacteria 1692
1160 nmdc:mga0n895_280157_c1 3300050512 Bacteria 1691
1161 nmdc:mga0n895_383948_c1 3300050512 Bacteria 1421
1162 nmdc:mga0n895_411962_c1 3300050512 Bacteria 1366
1163 nmdc:mga0rr50_175951_c1 3300050513 Bacteria 1746
1164 nmdc:mga0a205_68194_c1 3300050515 Bacteria 3435
1165 nmdc:mga0sz30_32533_c1 3300050516 Bacteria 2163
1166 Ga0495612_0009308 3300053078 Bacteria 3985
1167 Ga0500635_0000147 3300053080 Bacteria 39795
1168 Ga0495655_0000004 3300053083 Bacteria 293683
1169 Ga0500578_0037783 3300053086 Bacteria 3100
1170 Ga0500644_0000029 3300053088 Bacteria 90532
1171 Ga0500566_0000572 3300053094 Bacteria 20728
1172 Ga0500654_061432 3300053099 Bacteria 1920
1173 Ga0500556_0000020 3300053104 Bacteria 185929
1174 Ga0500614_000420 3300053123 Bacteria 11046
1175 Ga0500628_000049 3300053129 Bacteria 41425
1176 Ga0500652_004270 3300053131 Bacteria 4410
1177 Ga0500658_0001695 3300053134 Bacteria 8730
1178 Ga0500559_0000129 3300053136 Bacteria 58778
1179 Ga0500559_0001268 3300053136 Bacteria 14773
1180 Ga0500559_0002883 3300053136 Bacteria 8669
1181 Ga0500559_0062678 3300053136 Bacteria 1661
1182 Ga0500561_0000886 3300053137 Bacteria 4790
1183 Ga0500568_0000012 3300053139 Bacteria 225711
1184 Ga0500568_0000037 3300053139 Bacteria 135208
1185 Ga0500568_0000672 3300053139 Bacteria 24750
1186 Ga0500568_0049026 3300053139 Bacteria 1668
1187 Ga0500573_0003338 3300053140 Bacteria 8290
1188 Ga0500573_0052561 3300053140 Bacteria 2342
1189 Ga0500573_0091969 3300053140 Bacteria 1713
1190 Ga0500577_0000398 3300053142 Bacteria 11115
1191 Ga0500577_0040568 3300053142 Bacteria 1694
1192 Ga0500579_028880 3300053143 Bacteria 3568
1193 Ga0500600_0001675 3300053149 Bacteria 11940
1194 Ga0500616_0000021 3300053153 Bacteria 484527
1195 Ga0500616_0000275 3300053153 Bacteria 76811
1196 Ga0500616_0000785 3300053153 Bacteria 36439
1197 Ga0500616_0001580 3300053153 Bacteria 21272
1198 Ga0500616_0006099 3300053153 Bacteria 7977
1199 Ga0500633_0017132 3300053160 Bacteria 2118
1200 Ga0500634_0004417 3300053161 Bacteria 6494
1201 Ga0500645_000029 3300053730 Bacteria 122362
1202 Ga0501084_0000418 3300054114 Bacteria 32906
1203 Ga0501084_0000506 3300054114 Bacteria 29862
1204 Ga0501084_0005291 3300054114 Bacteria 10562
1205 Ga0501084_0015816 3300054114 Bacteria 6257
1206 Ga0501084_0154318 3300054114 Bacteria 1936
1207 Ga0590071_004338 3300059421 Bacteria 3450
1208 Ga0590075_002958 3300059424 Bacteria 4044
1209 Ga0590077_003215 3300059426 Bacteria 3401
1210 Ga0501082_0010274 3300060353 Bacteria 8059
1211 Ga0501082_0029807 3300060353 Bacteria 4700
1212 Ga0501082_0056731 3300060353 Bacteria 3375
1213 Ga0501082_0175446 3300060353 Bacteria 1863
1214 Ga0466962_0003037 3300061719 Bacteria 8003
1215 Ga0466962_0003627 3300061719 Bacteria 7360
1216 Ga0466962_0003835 3300061719 Bacteria 7185
1217 Ga0466962_0006097 3300061719 Bacteria 5794
1218 Ga0466962_0010713 3300061719 Bacteria 4408
1219 Ga0466962_0021585 3300061719 Bacteria 3091
1220 Ga0466962_0033096 3300061719 Bacteria 2473
1221 Ga0466962_0051352 3300061719 Bacteria 1971
1222 Ga0466962_0056753 3300061719 Bacteria 1870
1223 Ga0530510_0021816 3300061734 Bacteria 4558
1224 Ga0530510_0046232 3300061734 Bacteria 3145
1225 Ga0530510_0210937 3300061734 Bacteria 1443

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Sample Scaffold Protein Protein Length
1 3300044842 Ga0466957_0327275 Ga0466957_0327275_64_1023 301
2 3300050511 nmdc:mga08y16_627135_c1 nmdc:mga08y16_627135_c1_26_1039 306
3 3300050512 nmdc:mga0n895_383948_c1 nmdc:mga0n895_383948_c1_109_1122 306
4 3300037466 Ga0395898_0202226 Ga0395898_0202226_869_1858 309
5 3300041406 Ga0439439_0007568 Ga0439439_0007568_25_1014 309
6 3300048926 Ga0496123_0045166 Ga0496123_0045166_1981_2988 310
7 3300049589 Ga0501073_0231619 Ga0501073_0231619_30_1034 311
8 3300031691 Ga0316579_10077290 Ga0316579_100772902 312
9 3300049588 Ga0501072_0309109 Ga0501072_0309109_228_1244 312
10 3300041496 Ga0451839_0206517 Ga0451839_0206517_181_1179 313
11 3300042004 Ga0439445_0017563 Ga0439445_0017563_41_1036 313
12 3300045049 Ga0466959_0101535 Ga0466959_0101535_29_1027 314
13 3300045049 Ga0466959_0256051 Ga0466959_0256051_43_1041 314
14 3300045836 Ga0466958_0163412 Ga0466958_0163412_389_1387 314
15 3300048912 Ga0496109_0051504 Ga0496109_0051504_24_1034 314
16 3300048908 Ga0496105_0411967 Ga0496105_0411967_22_1050 317
17 3300028380 Ga0268265_10036031 Ga0268265_100360312 319
18 3300046463 Ga0495653_0203391 Ga0495653_0203391_77_1099 320
19 3300046558 Ga0495633_0080322 Ga0495633_0080322_477_1499 320
20 3300048909 Ga0496106_0145998 Ga0496106_0145998_26_1048 320
21 3300048916 Ga0496113_0152361 Ga0496113_0152361_706_1734 320
22 3300048903 Ga0496100_0079693 Ga0496100_0079693_1142_2170 324
23 3300049575 Ga0501039_0016747 Ga0501039_0016747_32_1060 324
24 3300049822 Ga0501035_0355618 Ga0501035_0355618_38_1066 324
25 3300050492 nmdc:mga0yw44_55262_c1 nmdc:mga0yw44_55262_c1_38_1084 328
26 3300041451 Ga0451791_1136519 Ga0451791_1136519_33_1082 329
27 3300044658 Ga0466972_0083384 Ga0466972_0083384_447_1496 329
28 3300047321 Ga0495676_0000878 Ga0495676_0000878_6892_7944 330
29 3300005468 Ga0070707_100036233 Ga0070707_1000362333 339
30 3300025922 Ga0207646_10011128 Ga0207646_100111283 339
31 3300005539 Ga0068853_100004539 Ga0068853_1000045397 347
32 3300026041 Ga0207639_10003357 Ga0207639_100033575 347
33 iso_pu_bacteria 2858868258 2858871002 347
34 3300005329 Ga0070683_100003804 Ga0070683_10000380413 348
35 3300005535 Ga0070684_100009867 Ga0070684_1000098672 348
36 3300025944 Ga0207661_10003600 Ga0207661_1000360011 348
37 3300044656 Ga0466969_0017298 Ga0466969_0017298_2267_3367 348
38 3300049824 Ga0501045_0264301 Ga0501045_0264301_12_1175 349
39 3300046492 Ga0495585_0023017 Ga0495585_0023017_613_1803 353
40 3300047317 Ga0495604_0104372 Ga0495604_0104372_46_1236 353
41 3300005337 Ga0070682_100000102 Ga0070682_10000010219 354
42 3300048928 Ga0496125_0076027 Ga0496125_0076027_1260_2444 354
43 3300006028 Ga0070717_10325067 Ga0070717_103250671 356
44 iso_pu_bacteria 2919059106 2919060336 356
45 3300005329 Ga0070683_100034199 Ga0070683_1000341994 357
46 3300005535 Ga0070684_100222087 Ga0070684_1002220872 357
47 3300006844 Ga0075428_100158275 Ga0075428_1001582752 357
48 3300006844 Ga0075428_100340662 Ga0075428_1003406622 357
49 3300009147 Ga0114129_10273007 Ga0114129_102730072 357
50 3300022467 Ga0224712_10019664 Ga0224712_100196642 357
51 3300044683 Ga0466965_0017178 Ga0466965_0017178_2001_3134 357
52 3300044694 Ga0466963_0021562 Ga0466963_0021562_2619_3764 357
53 3300048925 Ga0496122_0018427 Ga0496122_0018427_3287_4465 357
54 3300048926 Ga0496123_0006839 Ga0496123_0006839_6674_7852 357
55 3300050507 nmdc:mga05p37_7528_c1 nmdc:mga05p37_7528_c1_890_2056 357
56 3300050508 nmdc:mga09592_81492_c1 nmdc:mga09592_81492_c1_1223_2389 357
57 3300013105 Ga0157369_10111243 Ga0157369_101112432 358
58 3300031852 Ga0307410_10010378 Ga0307410_100103785 358
59 3300031901 Ga0307406_10015862 Ga0307406_100158625 358
60 3300031903 Ga0307407_10070039 Ga0307407_100700392 358
61 3300031911 Ga0307412_10160234 Ga0307412_101602342 358
62 3300037312 Ga0395899_0158638 Ga0395899_0158638_15_1157 358
63 3300037418 Ga0395900_0026971 Ga0395900_0026971_1054_2196 358
64 3300037466 Ga0395898_0022403 Ga0395898_0022403_931_2073 358
65 3300038443 Ga0395901_0084316 Ga0395901_0084316_1810_2952 358
66 3300048911 Ga0496108_0064963 Ga0496108_0064963_617_1801 358
67 3300048912 Ga0496109_0015695 Ga0496109_0015695_2009_3193 358
68 3300048920 Ga0496117_0120497 Ga0496117_0120497_25_1272 358
69 3300049571 Ga0501034_0315181 Ga0501034_0315181_289_1473 358
70 3300053139 Ga0500568_0000037 Ga0500568_0000037_99966_101144 358
71 3300037312 Ga0395899_0070024 Ga0395899_0070024_1048_2247 359
72 3300037418 Ga0395900_0234411 Ga0395900_0234411_16_1215 359
73 3300048921 Ga0496118_0053762 Ga0496118_0053762_525_1718 359
74 3300049568 Ga0501031_0000187 Ga0501031_0000187_5665_7050 359
75 3300049569 Ga0501032_0000382 Ga0501032_0000382_7457_8842 359
76 3300049570 Ga0501033_0002164 Ga0501033_0002164_4487_5872 359
77 3300049571 Ga0501034_0029571 Ga0501034_0029571_1657_3042 359
78 3300049572 Ga0501036_0006053 Ga0501036_0006053_6003_7388 359
79 3300049573 Ga0501037_0000543 Ga0501037_0000543_6846_8231 359
80 3300049574 Ga0501038_0000388 Ga0501038_0000388_18744_20129 359
81 3300049575 Ga0501039_0006242 Ga0501039_0006242_1785_3170 359
82 3300049579 Ga0501043_0048035 Ga0501043_0048035_1657_3042 359
83 3300049580 Ga0501046_0000574 Ga0501046_0000574_5051_6436 359
84 3300049581 Ga0501047_0010343 Ga0501047_0010343_5655_7040 359
85 3300049582 Ga0501048_0000158 Ga0501048_0000158_13377_14762 359
86 3300049583 Ga0501067_0003026 Ga0501067_0003026_4641_6026 359
87 3300049585 Ga0501069_0002998 Ga0501069_0002998_4795_6180 359
88 3300049586 Ga0501070_0002128 Ga0501070_0002128_4872_6257 359
89 3300049590 Ga0501074_0002352 Ga0501074_0002352_6001_7386 359
90 3300049742 Ga0501080_0000125 Ga0501080_0000125_27270_28655 359
91 3300049744 Ga0501083_0025939 Ga0501083_0025939_962_2347 359
92 3300049822 Ga0501035_0000498 Ga0501035_0000498_1785_3170 359
93 3300049823 Ga0501044_0001479 Ga0501044_0001479_4201_5586 359
94 3300054114 Ga0501084_0000506 Ga0501084_0000506_6003_7388 359
95 3300035111 Ga0373923_0048180 Ga0373923_0048180_16_1170 360
96 3300038443 Ga0395901_0038508 Ga0395901_0038508_144_1286 360
97 3300048927 Ga0496124_0244071 Ga0496124_0244071_165_1322 361
98 3300049586 Ga0501070_0076233 Ga0501070_0076233_1550_2743 361
99 3300006846 Ga0075430_100003116 Ga0075430_1000031164 362
100 3300006847 Ga0075431_100054450 Ga0075431_1000544502 362
101 3300044765 Ga0466970_0070126 Ga0466970_0070126_48_1190 362
102 3300044842 Ga0466957_0026777 Ga0466957_0026777_1127_2269 362
103 3300045976 Ga0466967_0075613 Ga0466967_0075613_720_1862 362
104 3300048920 Ga0496117_0000216 Ga0496117_0000216_84386_85534 362
105 3300048925 Ga0496122_0006657 Ga0496122_0006657_3873_5021 362
106 3300049591 Ga0501075_0049571 Ga0501075_0049571_135_1289 362
107 3300050509 nmdc:mga0qj67_11064_c1 nmdc:mga0qj67_11064_c1_538_1731 362
108 3300050510 nmdc:mga06r32_17950_c1 nmdc:mga06r32_17950_c1_2775_3968 362
109 3300050516 nmdc:mga0sz30_32533_c1 nmdc:mga0sz30_32533_c1_261_1403 362
110 3300049570 Ga0501033_0154255 Ga0501033_0154255_494_1645 363
111 3300049571 Ga0501034_0033671 Ga0501034_0033671_307_1458 363
112 3300044693 Ga0466961_0179448 Ga0466961_0179448_21_1169 364
113 3300044765 Ga0466970_0004970 Ga0466970_0004970_2764_3915 364
114 3300044901 Ga0466960_0041665 Ga0466960_0041665_354_1505 364
115 3300045976 Ga0466967_0103417 Ga0466967_0103417_256_1407 364
116 3300045976 Ga0466967_0232364 Ga0466967_0232364_14_1165 364
117 3300049583 Ga0501067_0078203 Ga0501067_0078203_629_1795 364
118 3300014326 Ga0157380_10186497 Ga0157380_101864971 365
119 3300035692 Ga0373935_0258927 Ga0373935_0258927_55_1206 365
120 3300044706 Ga0466964_0052214 Ga0466964_0052214_38_1225 365
121 3300045976 Ga0466967_0043969 Ga0466967_0043969_2378_3565 365
122 3300061719 Ga0466962_0010713 Ga0466962_0010713_1403_2554 365
123 iso_pu_bacteria 2857727296 2857728632 365
124 iso_pu_bacteria 2883821847 2883825478 365
125 3300032002 Ga0307416_100035808 Ga0307416_1000358083 366
126 iso_pu_bacteria 2897561785 2897564060 366
127 3300049569 Ga0501032_0015090 Ga0501032_0015090_50_1240 367
128 3300049571 Ga0501034_0000823 Ga0501034_0000823_32464_33648 367
129 3300049571 Ga0501034_0008772 Ga0501034_0008772_1542_2732 367
130 3300049572 Ga0501036_0049879 Ga0501036_0049879_418_1608 367
131 3300049573 Ga0501037_0055108 Ga0501037_0055108_792_1982 367
132 3300049574 Ga0501038_0015633 Ga0501038_0015633_1375_2565 367
133 3300049586 Ga0501070_0006294 Ga0501070_0006294_4703_5893 367
134 3300049822 Ga0501035_0006459 Ga0501035_0006459_4973_6163 367
135 3300049823 Ga0501044_0017747 Ga0501044_0017747_1238_2428 367
136 3300049823 Ga0501044_0185922 Ga0501044_0185922_116_1306 367
137 3300053140 Ga0500573_0003338 Ga0500573_0003338_5911_7107 367
138 iso_pu_bacteria 2537561592 2537900706 367
139 iso_pu_bacteria 2643221566 2643849264 367
140 iso_pu_bacteria 2643221572 2643876081 367
141 iso_pu_bacteria 2643221669 2644383136 367
142 iso_pu_bacteria 2643221681 2644455873 367
143 iso_pu_bacteria 2721755702 2723642201 367
144 iso_pu_bacteria 2757320536 2758225680 367
145 iso_pu_bacteria 2773857758 2774379785 367
146 iso_pu_bacteria 2775506735 2775658175 367
147 iso_pu_bacteria 2808606366 2808877632 367
148 iso_pu_bacteria 2808606371 2808899088 367
149 iso_pu_bacteria 2811994871 2812319762 367
150 iso_pu_bacteria 2821268502 2821268719 367
151 iso_pu_bacteria 2833709550 2833712360 367
152 iso_pu_bacteria 2844852863 2844854128 367
153 iso_pu_bacteria 2852643534 2852643787 367
154 iso_pu_bacteria 2852677369 2852679673 367
155 iso_pu_bacteria 2857720070 2857720779 367
156 iso_pu_bacteria 2857723135 2857726140 367
157 iso_pu_bacteria 2857729791 2857731154 367
158 iso_pu_bacteria 2857733635 2857736412 367
159 iso_pu_bacteria 2857740372 2857740767 367
160 iso_pu_bacteria 2862993130 2862993916 367
161 iso_pu_bacteria 2893684298 2893686567 367
162 iso_pu_bacteria 2895660088 2895660284 367
163 iso_pu_bacteria 2904497146 2904499186 367
164 iso_pu_bacteria 2904509784 2904512576 367
165 iso_pu_bacteria 2908678064 2908679183 367
166 iso_pu_bacteria 2919034639 2919035636 367
167 iso_pu_bacteria 2919055335 2919057348 367
168 iso_pu_bacteria 2919069694 2919069825 367
169 iso_pu_bacteria 2919538618 2919539172 367
170 iso_pu_bacteria 2920879853 2920880478 367
171 iso_pu_bacteria 2928090899 2928092855 367
172 iso_pu_bacteria 2928121344 2928122279 367
173 iso_pu_bacteria 2933418574 2933418683 367
174 iso_pu_bacteria 2939598168 2939601932 367
175 iso_pu_bacteria 2939647034 2939650139 367
176 iso_pu_bacteria 2939657138 2939659641 367
177 iso_pu_bacteria 2939660829 2939661136 367
178 iso_pu_bacteria 2939674588 2939677625 367
179 iso_pu_bacteria 2945916053 2945917508 367
180 iso_pu_bacteria 2945956166 2945960659 367
181 iso_pu_bacteria 2946080515 2946083004 367
182 iso_pu_bacteria 2953998280 2953998807 367
183 iso_pu_bacteria 2966921586 2966923754 367
184 iso_pu_bacteria 2966924647 2966925082 367
185 iso_pu_bacteria 2974294766 2974296010 367
186 iso_pu_bacteria 2974324384 2974327725 367
187 iso_pu_bacteria 2977228692 2977229384 367
188 iso_pu_bacteria 2977236895 2977238572 367
189 iso_pu_bacteria 2977264416 2977264582 367
190 iso_pu_bacteria 2984542743 2984543646 367
191 iso_pu_bacteria 2984580707 2984583592 367
192 iso_pu_bacteria 2984592036 2984593410 367
193 iso_pu_bacteria 8016254467 8016256189 367
194 iso_pu_bacteria 8056037122 8056040054 367
195 iso_pu_bacteria 8057345674 8057348607 367
196 3300005367 Ga0070667_100000348 Ga0070667_10000034851 368
197 3300005617 Ga0068859_100068937 Ga0068859_1000689371 368
198 3300005841 Ga0068863_100021476 Ga0068863_1000214761 368
199 3300005843 Ga0068860_100000021 Ga0068860_100000021199 368
200 3300006931 Ga0097620_100068935 Ga0097620_1000689353 368
201 3300009177 Ga0105248_10000198 Ga0105248_1000019822 368
202 3300025941 Ga0207711_10000360 Ga0207711_1000036042 368
203 3300025986 Ga0207658_10003518 Ga0207658_100035182 368
204 3300026088 Ga0207641_10015808 Ga0207641_100158081 368
205 3300028381 Ga0268264_10000352 Ga0268264_1000035248 368
206 3300048905 Ga0496102_0000658 Ga0496102_0000658_18746_19927 368
207 3300048906 Ga0496103_0000749 Ga0496103_0000749_10491_11672 368
208 3300048920 Ga0496117_0000510 Ga0496117_0000510_21209_22390 368
209 3300048921 Ga0496118_0000931 Ga0496118_0000931_41674_42855 368
210 3300048927 Ga0496124_0001716 Ga0496124_0001716_6741_7922 368
211 iso_pu_bacteria 2751185788 2753300446 368
212 iso_pu_bacteria 2773857762 2774391966 368
213 iso_pu_bacteria 2808606439 2809197242 368
214 iso_pu_bacteria 2811994878 2812352088 368
215 iso_pu_bacteria 2870801768 2870801974 368
216 iso_pu_bacteria 2891968417 2891970209 368
217 iso_pu_bacteria 2919042368 2919044122 368
218 iso_pu_bacteria 2928104781 2928107615 368
219 iso_pu_bacteria 2928142448 2928146492 368
220 iso_pu_bacteria 2984551494 2984552566 368
221 iso_pu_bacteria 2984576629 2984579900 368
222 iso_pu_bacteria 2990256926 2990260421 368
223 3300048917 Ga0496114_0035190 Ga0496114_0035190_1685_2869 369
224 3300053136 Ga0500559_0062678 Ga0500559_0062678_243_1439 369
225 iso_pu_bacteria 2767802112 2768645503 369
226 iso_pu_bacteria 2884994152 2884996195 369
227 3300005339 Ga0070660_100030855 Ga0070660_1000308552 370
228 3300031901 Ga0307406_10000401 Ga0307406_100004014 370
229 3300048925 Ga0496122_0022308 Ga0496122_0022308_852_2024 370
230 3300048926 Ga0496123_0069611 Ga0496123_0069611_950_2122 370
231 iso_pu_bacteria 2751185734 2753071206 370
232 iso_pu_bacteria 2758568522 2760308389 370
233 iso_pu_bacteria 2758568621 2760622968 370
234 iso_pu_bacteria 2775506925 2776370380 370
235 iso_pu_bacteria 2808606394 2809028094 370
236 iso_pu_bacteria 2839986021 2839988085 370
237 iso_pu_bacteria 2863067949 2863072496 370
238 iso_pu_bacteria 2868088558 2868091586 370
239 iso_pu_bacteria 2870721527 2870721990 370
240 iso_pu_bacteria 2935890801 2935890928 370
241 iso_pu_bacteria 2990044586 2990046262 370
242 iso_pu_bacteria 8056579771 8056581930 370
243 3300002738 JGI25154J39366_1001513 JGI25154J39366_10015133 371
244 3300005548 Ga0070665_100145946 Ga0070665_1001459462 371
245 3300006051 Ga0075364_10000874 Ga0075364_1000087410 371
246 3300006051 Ga0075364_10042098 Ga0075364_100420981 371
247 3300009036 Ga0105244_10006258 Ga0105244_100062586 371
248 3300009036 Ga0105244_10027877 Ga0105244_100278773 371
249 3300013105 Ga0157369_10002406 Ga0157369_100024063 371
250 3300013105 Ga0157369_10029840 Ga0157369_100298402 371
251 3300013250 Ga0171462_1002 Ga0171462_1002889 371
252 3300025246 Ga0209646_1000030 Ga0209646_1000030277 371
253 3300028379 Ga0268266_10105595 Ga0268266_101055952 371
254 3300031548 Ga0307408_100193741 Ga0307408_1001937412 371
255 3300031649 Ga0307514_10037092 Ga0307514_100370924 371
256 3300031901 Ga0307406_10040785 Ga0307406_100407852 371
257 3300031995 Ga0307409_100180243 Ga0307409_1001802432 371
258 3300032002 Ga0307416_100067334 Ga0307416_1000673342 371
259 3300032002 Ga0307416_100454197 Ga0307416_1004541971 371
260 3300041404 Ga0439436_0002323 Ga0439436_0002323_2984_4159 371
261 3300041494 Ga0451837_1126097 Ga0451837_1126097_306_1496 371
262 3300044683 Ga0466965_0000010 Ga0466965_0000010_43870_45045 371
263 3300044765 Ga0466970_0084230 Ga0466970_0084230_524_1705 371
264 3300044765 Ga0466970_0093829 Ga0466970_0093829_13_1194 371
265 3300047472 Ga0495686_0047331 Ga0495686_0047331_526_1701 371
266 3300048908 Ga0496105_0270250 Ga0496105_0270250_145_1326 371
267 3300048918 Ga0496115_0004944 Ga0496115_0004944_7755_8930 371
268 3300048920 Ga0496117_0001139 Ga0496117_0001139_28703_29878 371
269 3300048921 Ga0496118_0002405 Ga0496118_0002405_8774_9949 371
270 3300048921 Ga0496118_0011318 Ga0496118_0011318_4378_5553 371
271 3300048922 Ga0496119_0003258 Ga0496119_0003258_12483_13658 371
272 3300048922 Ga0496119_0004363 Ga0496119_0004363_6549_7730 371
273 3300048922 Ga0496119_0009429 Ga0496119_0009429_5482_6666 371
274 3300048922 Ga0496119_0147680 Ga0496119_0147680_32_1222 371
275 3300048923 Ga0496120_0003305 Ga0496120_0003305_8697_9878 371
276 3300048923 Ga0496120_0007452 Ga0496120_0007452_3574_4758 371
277 3300048924 Ga0496121_0000380 Ga0496121_0000380_24526_25707 371
278 3300048925 Ga0496122_0000036 Ga0496122_0000036_125327_126502 371
279 3300048925 Ga0496122_0015027 Ga0496122_0015027_1953_3137 371
280 3300048926 Ga0496123_0000011 Ga0496123_0000011_125403_126578 371
281 3300048927 Ga0496124_0005024 Ga0496124_0005024_13328_14503 371
282 3300048927 Ga0496124_0150806 Ga0496124_0150806_324_1499 371
283 3300048928 Ga0496125_0013945 Ga0496125_0013945_5980_7164 371
284 3300048928 Ga0496125_0024807 Ga0496125_0024807_1119_2294 371
285 3300048928 Ga0496125_0055526 Ga0496125_0055526_1813_2997 371
286 3300048929 Ga0496126_0015593 Ga0496126_0015593_3756_4931 371
287 3300049568 Ga0501031_0033160 Ga0501031_0033160_1418_2593 371
288 3300049569 Ga0501032_0000285 Ga0501032_0000285_36132_37307 371
289 3300049571 Ga0501034_0015838 Ga0501034_0015838_5652_6851 371
290 3300049571 Ga0501034_0034411 Ga0501034_0034411_2759_3934 371
291 3300049571 Ga0501034_0043310 Ga0501034_0043310_3246_4421 371
292 3300049571 Ga0501034_0072645 Ga0501034_0072645_372_1556 371
293 3300049571 Ga0501034_0203954 Ga0501034_0203954_401_1576 371
294 3300049572 Ga0501036_0344768 Ga0501036_0344768_28_1203 371
295 3300049573 Ga0501037_0022521 Ga0501037_0022521_2144_3319 371
296 3300049573 Ga0501037_0028003 Ga0501037_0028003_2309_3484 371
297 3300049574 Ga0501038_0020398 Ga0501038_0020398_1368_2567 371
298 3300049574 Ga0501038_0070120 Ga0501038_0070120_332_1531 371
299 3300049579 Ga0501043_0108175 Ga0501043_0108175_146_1321 371
300 3300049579 Ga0501043_0242290 Ga0501043_0242290_158_1357 371
301 3300049581 Ga0501047_0005870 Ga0501047_0005870_8997_10172 371
302 3300049581 Ga0501047_0236296 Ga0501047_0236296_390_1565 371
303 3300049586 Ga0501070_0000551 Ga0501070_0000551_585_1760 371
304 3300049822 Ga0501035_0018779 Ga0501035_0018779_3983_5158 371
305 3300049823 Ga0501044_0008752 Ga0501044_0008752_2585_3760 371
306 3300050491 nmdc:mga00v17_21703_c2 nmdc:mga00v17_21703_c2_1381_2598 371
307 3300050491 nmdc:mga00v17_706_c1 nmdc:mga00v17_706_c1_8659_9837 371
308 3300053080 Ga0500635_0000147 Ga0500635_0000147_11662_12837 371
309 3300053104 Ga0500556_0000020 Ga0500556_0000020_58783_59958 371
310 3300053136 Ga0500559_0000129 Ga0500559_0000129_7686_8870 371
311 3300053136 Ga0500559_0001268 Ga0500559_0001268_12982_14157 371
312 3300053136 Ga0500559_0002883 Ga0500559_0002883_6596_7771 371
313 3300053139 Ga0500568_0000012 Ga0500568_0000012_162986_164161 371
314 3300053139 Ga0500568_0000672 Ga0500568_0000672_342_1517 371
315 3300053140 Ga0500573_0052561 Ga0500573_0052561_339_1523 371
316 3300053140 Ga0500573_0091969 Ga0500573_0091969_440_1636 371
317 3300053142 Ga0500577_0000398 Ga0500577_0000398_8724_9938 371
318 3300053142 Ga0500577_0040568 Ga0500577_0040568_58_1254 371
319 3300053153 Ga0500616_0000021 Ga0500616_0000021_186621_187796 371
320 iso_pu_bacteria 2565956761 2566996321 371
321 iso_pu_bacteria 2643221641 2644229562 371
322 iso_pu_bacteria 2643221697 2644539727 371
323 iso_pu_bacteria 2643221715 2644638108 371
324 iso_pu_bacteria 2643221961 2645720727 371
325 iso_pu_bacteria 2643221962 2645723743 371
326 iso_pu_bacteria 2675902999 2676201830 371
327 iso_pu_bacteria 2675903058 2676474773 371
328 iso_pu_bacteria 2738541308 2738892566 371
329 iso_pu_bacteria 2738543005 2739203743 371
330 iso_pu_bacteria 2739367898 2740168421 371
331 iso_pu_bacteria 2751185725 2753036731 371
332 iso_pu_bacteria 2751185792 2753324601 371
333 iso_pu_bacteria 2773857921 2774846406 371
334 iso_pu_bacteria 2808606365 2808875363 371
335 iso_pu_bacteria 2808606370 2808892745 371
336 iso_pu_bacteria 2827628540 2827631059 371
337 iso_pu_bacteria 2855386786 2855389853 371
338 iso_pu_bacteria 2857481737 2857484217 371
339 iso_pu_bacteria 2902810491 2902816333 371
340 iso_pu_bacteria 2902837492 2902839693 371
341 iso_pu_bacteria 2904535858 2904540960 371
342 iso_pu_bacteria 2904765812 2904766255 371
343 iso_pu_bacteria 2904770941 2904772320 371
344 iso_pu_bacteria 2908811453 2908811982 371
345 iso_pu_bacteria 2919391150 2919394243 371
346 iso_pu_bacteria 2919420072 2919421319 371
347 iso_pu_bacteria 2919432681 2919432923 371
348 iso_pu_bacteria 2922554459 2922555044 371
349 iso_pu_bacteria 2939582691 2939586974 371
350 iso_pu_bacteria 2946059875 2946061333 371
351 iso_pu_bacteria 2974315732 2974319307 371
352 iso_pu_bacteria 2984523437 2984527519 371
353 iso_pu_bacteria 8054609563 8054614197 371
354 3300005329 Ga0070683_100229985 Ga0070683_1002299852 372
355 3300005719 Ga0068861_100158406 Ga0068861_1001584062 372
356 3300006186 Ga0075369_10011565 Ga0075369_100115652 372
357 3300009101 Ga0105247_10126814 Ga0105247_101268142 372
358 3300031616 Ga0307508_10020231 Ga0307508_100202312 372
359 3300037418 Ga0395900_0038243 Ga0395900_0038243_1669_2850 372
360 3300041512 Ga0451853_0908799 Ga0451853_0908799_8444_9622 372
361 3300042131 Ga0450894_000038 Ga0450894_000038_9434_10624 372
362 3300042133 Ga0450896_000383 Ga0450896_000383_1216_2406 372
363 3300042134 Ga0450898_000548 Ga0450898_000548_2751_3941 372
364 3300042135 Ga0450899_001035 Ga0450899_001035_132_1322 372
365 3300042145 Ga0450906_000899 Ga0450906_000899_4641_5831 372
366 3300044765 Ga0466970_0042153 Ga0466970_0042153_63_1244 372
367 3300045049 Ga0466959_0035995 Ga0466959_0035995_547_1728 372
368 3300046522 Ga0495643_0002259 Ga0495643_0002259_2740_3930 372
369 3300047443 Ga0495687_008272 Ga0495687_008272_2123_3313 372
370 3300047447 Ga0495685_002659 Ga0495685_002659_3953_5143 372
371 3300047470 Ga0495681_0008002 Ga0495681_0008002_3605_4795 372
372 3300048091 Ga0495626_0006570 Ga0495626_0006570_3045_4238 372
373 3300048918 Ga0496115_0247687 Ga0496115_0247687_219_1397 372
374 3300048920 Ga0496117_0001045 Ga0496117_0001045_3306_4499 372
375 3300048921 Ga0496118_0002564 Ga0496118_0002564_16928_18121 372
376 3300048922 Ga0496119_0026628 Ga0496119_0026628_2167_3360 372
377 3300048923 Ga0496120_0021115 Ga0496120_0021115_108_1301 372
378 3300048925 Ga0496122_0065012 Ga0496122_0065012_1223_2416 372
379 3300048927 Ga0496124_0000075 Ga0496124_0000075_131360_132553 372
380 3300048927 Ga0496124_0002154 Ga0496124_0002154_15065_16258 372
381 3300048928 Ga0496125_0034919 Ga0496125_0034919_1987_3165 372
382 3300049572 Ga0501036_0109265 Ga0501036_0109265_532_1767 372
383 3300050512 nmdc:mga0n895_279618_c1 nmdc:mga0n895_279618_c1_400_1572 372
384 3300053086 Ga0500578_0037783 Ga0500578_0037783_1421_2611 372
385 3300053099 Ga0500654_061432 Ga0500654_061432_242_1432 372
386 3300053131 Ga0500652_004270 Ga0500652_004270_1468_2658 372
387 3300053134 Ga0500658_0001695 Ga0500658_0001695_3974_5164 372
388 3300053137 Ga0500561_0000886 Ga0500561_0000886_2653_3843 372
389 3300053143 Ga0500579_028880 Ga0500579_028880_2328_3518 372
390 3300053149 Ga0500600_0001675 Ga0500600_0001675_4025_5215 372
391 3300053153 Ga0500616_0006099 Ga0500616_0006099_3188_4378 372
392 3300053160 Ga0500633_0017132 Ga0500633_0017132_833_2023 372
393 3300053161 Ga0500634_0004417 Ga0500634_0004417_2043_3233 372
394 iso_pu_bacteria 2501939600 2501940898 372
395 iso_pu_bacteria 2547132111 2547412119 372
396 iso_pu_bacteria 2554235005 2554260105 372
397 iso_pu_bacteria 2582580736 2583151753 372
398 iso_pu_bacteria 2585427649 2586062080 372
399 iso_pu_bacteria 2622736626 2623587779 372
400 iso_pu_bacteria 2643221624 2644136115 372
401 iso_pu_bacteria 2643221679 2644446865 372
402 iso_pu_bacteria 2772190715 2772644473 372
403 iso_pu_bacteria 2784746763 2785339843 372
404 iso_pu_bacteria 2791354901 2791914422 372
405 iso_pu_bacteria 2818991463 2819698817 372
406 iso_pu_bacteria 2856858025 2856861799 372
407 iso_pu_bacteria 2862281513 2862283144 372
408 iso_pu_bacteria 2863404153 2863410179 372
409 iso_pu_bacteria 2867369537 2867370116 372
410 iso_pu_bacteria 2873151551 2873152515 372
411 iso_pu_bacteria 2899359706 2899361879 372
412 iso_pu_bacteria 2902582711 2902586912 372
413 iso_pu_bacteria 2912723979 2912729036 372
414 iso_pu_bacteria 2912757875 2912764129 372
415 iso_pu_bacteria 2917736166 2917744470 372
416 iso_pu_bacteria 2929219909 2929221885 372
417 iso_pu_bacteria 2947224130 2947225508 372
418 iso_pu_bacteria 2990088156 2990091867 372
419 iso_pu_bacteria 2996221748 2996221761 372
420 iso_pu_bacteria 2997600082 2997602525 372
421 iso_pu_bacteria 3006321560 3006323435 372
422 iso_pu_bacteria 3006486233 3006491245 372
423 iso_pu_bacteria 649633069 649812397 372
424 iso_pu_bacteria 8003314358 8003321219 372
425 iso_pu_bacteria 8003856774 8003863534 372
426 iso_pu_bacteria 8003870546 8003875255 372
427 iso_pu_bacteria 8023623736 8023624138 372
428 iso_pu_bacteria 8048406513 8048409698 372
429 iso_pu_bacteria 8056667051 8056668542 372
430 3300006048 Ga0075363_100001122 Ga0075363_1000011226 373
431 3300006051 Ga0075364_10033804 Ga0075364_100338042 373
432 3300009101 Ga0105247_10000352 Ga0105247_1000035222 373
433 3300009177 Ga0105248_10000085 Ga0105248_1000008547 373
434 3300009177 Ga0105248_10002694 Ga0105248_100026946 373
435 3300009545 Ga0105237_10018571 Ga0105237_100185713 373
436 3300010375 Ga0105239_10040595 Ga0105239_100405953 373
437 3300014325 Ga0163163_10048421 Ga0163163_100484212 373
438 3300014968 Ga0157379_10010098 Ga0157379_100100987 373
439 3300020082 Ga0206353_10016796 Ga0206353_100167963 373
440 3300025900 Ga0207710_10000298 Ga0207710_1000029811 373
441 3300025941 Ga0207711_10001181 Ga0207711_1000118113 373
442 3300025941 Ga0207711_10003065 Ga0207711_100030651 373
443 3300030732 Ga0316176_1097926 Ga0316176_10979264 373
444 3300030733 Ga0314311_1187566 Ga0314311_11875663 373
445 3300031251 Ga0265327_10002365 Ga0265327_1000236515 373
446 3300041404 Ga0439436_0005085 Ga0439436_0005085_1544_2734 373
447 3300041406 Ga0439439_0011938 Ga0439439_0011938_124_1314 373
448 3300042014 Ga0439457_001791 Ga0439457_001791_1300_2490 373
449 3300044694 Ga0466963_0000786 Ga0466963_0000786_23_1204 373
450 3300044694 Ga0466963_0043773 Ga0466963_0043773_80_1261 373
451 3300044694 Ga0466963_0045251 Ga0466963_0045251_271_1458 373
452 3300044706 Ga0466964_0069190 Ga0466964_0069190_23_1204 373
453 3300044719 Ga0466971_0043389 Ga0466971_0043389_352_1533 373
454 3300045836 Ga0466958_0000838 Ga0466958_0000838_8388_9569 373
455 3300045976 Ga0466967_0015603 Ga0466967_0015603_3950_5131 373
456 3300045976 Ga0466967_0023502 Ga0466967_0023502_2767_3948 373
457 3300045976 Ga0466967_0023807 Ga0466967_0023807_2556_3737 373
458 3300048909 Ga0496106_0124343 Ga0496106_0124343_541_1752 373
459 3300048921 Ga0496118_0002771 Ga0496118_0002771_15672_16883 373
460 3300048922 Ga0496119_0000565 Ga0496119_0000565_34638_35849 373
461 3300048923 Ga0496120_0000683 Ga0496120_0000683_14024_15235 373
462 3300048929 Ga0496126_0000039 Ga0496126_0000039_255739_256920 373
463 3300049568 Ga0501031_0020737 Ga0501031_0020737_48_1238 373
464 3300049569 Ga0501032_0022621 Ga0501032_0022621_2995_4185 373
465 3300049570 Ga0501033_0035363 Ga0501033_0035363_184_1374 373
466 3300049572 Ga0501036_0108990 Ga0501036_0108990_24_1214 373
467 3300049573 Ga0501037_0108575 Ga0501037_0108575_130_1320 373
468 3300049579 Ga0501043_0002686 Ga0501043_0002686_3049_4239 373
469 3300049579 Ga0501043_0051580 Ga0501043_0051580_303_1493 373
470 3300049581 Ga0501047_0078384 Ga0501047_0078384_1022_2212 373
471 3300049582 Ga0501048_0009711 Ga0501048_0009711_1864_3054 373
472 3300049586 Ga0501070_0045070 Ga0501070_0045070_70_1269 373
473 3300049588 Ga0501072_0083001 Ga0501072_0083001_1255_2454 373
474 3300049590 Ga0501074_0034267 Ga0501074_0034267_1599_2798 373
475 3300049742 Ga0501080_0109022 Ga0501080_0109022_740_1930 373
476 3300049822 Ga0501035_0005716 Ga0501035_0005716_7457_8647 373
477 3300049822 Ga0501035_0013198 Ga0501035_0013198_1793_2983 373
478 3300049822 Ga0501035_0026556 Ga0501035_0026556_4027_5217 373
479 3300049823 Ga0501044_0023907 Ga0501044_0023907_2335_3525 373
480 3300049823 Ga0501044_0130604 Ga0501044_0130604_961_2151 373
481 3300050489 nmdc:mga03683_21844_c1 nmdc:mga03683_21844_c1_135_1316 373
482 3300050490 nmdc:mga03n38_7187_c1 nmdc:mga03n38_7187_c1_1930_3120 373
483 3300050492 nmdc:mga0yw44_120893_c1 nmdc:mga0yw44_120893_c1_441_1622 373
484 3300061719 Ga0466962_0051352 Ga0466962_0051352_27_1208 373
485 3300003285 Ga0007423J48922_100507 Ga0007423J48922_1005071 374
486 3300005530 Ga0070679_100001646 Ga0070679_1000016463 374
487 3300005530 Ga0070679_100141718 Ga0070679_1001417182 374
488 3300005937 Ga0081455_10002903 Ga0081455_1000290311 374
489 3300005937 Ga0081455_10029884 Ga0081455_100298844 374
490 3300006038 Ga0075365_10013852 Ga0075365_100138524 374
491 3300006048 Ga0075363_100002877 Ga0075363_1000028772 374
492 3300006048 Ga0075363_100025695 Ga0075363_1000256953 374
493 3300006051 Ga0075364_10015796 Ga0075364_100157963 374
494 3300006195 Ga0075366_10053903 Ga0075366_100539032 374
495 3300013104 Ga0157370_10106259 Ga0157370_101062592 374
496 3300013308 Ga0157375_10062162 Ga0157375_100621623 374
497 3300025904 Ga0207647_10008840 Ga0207647_100088404 374
498 3300025912 Ga0207707_10026309 Ga0207707_100263095 374
499 3300025912 Ga0207707_10255733 Ga0207707_102557331 374
500 3300025921 Ga0207652_10033048 Ga0207652_100330484 374
501 3300025921 Ga0207652_10100390 Ga0207652_101003901 374
502 3300025944 Ga0207661_10230755 Ga0207661_102307551 374
503 3300030733 Ga0314311_1104940 Ga0314311_11049402 374
504 3300031548 Ga0307408_100070877 Ga0307408_1000708772 374
505 3300031727 Ga0316576_10005643 Ga0316576_100056436 374
506 3300031728 Ga0316578_10002638 Ga0316578_100026382 374
507 3300031824 Ga0307413_10174172 Ga0307413_101741722 374
508 3300031852 Ga0307410_10138060 Ga0307410_101380602 374
509 3300031995 Ga0307409_100085876 Ga0307409_1000858762 374
510 3300032004 Ga0307414_10238083 Ga0307414_102380831 374
511 3300036647 Ga0316582_0088905 Ga0316582_0088905_310_1488 374
512 3300036712 Ga0316584_0003131 Ga0316584_0003131_2878_4056 374
513 3300037418 Ga0395900_0043146 Ga0395900_0043146_3224_4423 374
514 3300037466 Ga0395898_0055793 Ga0395898_0055793_1350_2540 374
515 3300038443 Ga0395901_0034055 Ga0395901_0034055_1709_2908 374
516 3300044719 Ga0466971_0044480 Ga0466971_0044480_233_1447 374
517 3300044901 Ga0466960_0065561 Ga0466960_0065561_24_1205 374
518 3300045976 Ga0466967_0018107 Ga0466967_0018107_3271_4452 374
519 3300045976 Ga0466967_0026394 Ga0466967_0026394_2597_3784 374
520 3300045976 Ga0466967_0142584 Ga0466967_0142584_146_1333 374
521 3300046463 Ga0495653_0145146 Ga0495653_0145146_25_1221 374
522 3300046507 Ga0495606_0001904 Ga0495606_0001904_20406_21587 374
523 3300046616 Ga0495668_0000157 Ga0495668_0000157_71099_72280 374
524 3300046660 Ga0495625_0001768 Ga0495625_0001768_7841_9022 374
525 3300048091 Ga0495626_0000291 Ga0495626_0000291_21587_22768 374
526 3300048921 Ga0496118_0032547 Ga0496118_0032547_2393_3583 374
527 3300048928 Ga0496125_0020290 Ga0496125_0020290_2439_3629 374
528 3300049574 Ga0501038_0004081 Ga0501038_0004081_7271_8470 374
529 3300049581 Ga0501047_0069747 Ga0501047_0069747_977_2158 374
530 3300049586 Ga0501070_0293279 Ga0501070_0293279_53_1252 374
531 3300050490 nmdc:mga03n38_15533_c1 nmdc:mga03n38_15533_c1_114_1304 374
532 3300050493 nmdc:mga0k408_78322_c1 nmdc:mga0k408_78322_c1_165_1349 374
533 3300060353 Ga0501082_0175446 Ga0501082_0175446_264_1463 374
534 3300061719 Ga0466962_0056753 Ga0466962_0056753_457_1638 374
535 iso_pu_bacteria 2935890801 2935892615 374
536 3300002070 JGI24750J21931_1003136 JGI24750J21931_10031362 375
537 3300002073 JGI24745J21846_1001043 JGI24745J21846_10010432 375
538 3300002077 JGI24744J21845_10000747 JGI24744J21845_100007475 375
539 3300002244 JGI24742J22300_10000552 JGI24742J22300_100005528 375
540 3300003373 JGI25407J50210_10002623 JGI25407J50210_100026232 375
541 3300003373 JGI25407J50210_10028442 JGI25407J50210_100284422 375
542 3300003792 Ga0055540_1004708 Ga0055540_10047083 375
543 3300005329 Ga0070683_100005916 Ga0070683_1000059165 375
544 3300005329 Ga0070683_100034709 Ga0070683_1000347092 375
545 3300005329 Ga0070683_100129345 Ga0070683_1001293452 375
546 3300005329 Ga0070683_100142231 Ga0070683_1001422311 375
547 3300005339 Ga0070660_100035296 Ga0070660_1000352964 375
548 3300005339 Ga0070660_100055871 Ga0070660_1000558713 375
549 3300005340 Ga0070689_100085733 Ga0070689_1000857333 375
550 3300005343 Ga0070687_100008171 Ga0070687_1000081714 375
551 3300005345 Ga0070692_10018200 Ga0070692_100182004 375
552 3300005353 Ga0070669_100000724 Ga0070669_10000072415 375
553 3300005353 Ga0070669_100258650 Ga0070669_1002586501 375
554 3300005355 Ga0070671_100085805 Ga0070671_1000858053 375
555 3300005365 Ga0070688_100042528 Ga0070688_1000425282 375
556 3300005435 Ga0070714_100318648 Ga0070714_1003186481 375
557 3300005437 Ga0070710_10002117 Ga0070710_100021173 375
558 3300005439 Ga0070711_100210395 Ga0070711_1002103951 375
559 3300005441 Ga0070700_100025112 Ga0070700_1000251124 375
560 3300005458 Ga0070681_10108480 Ga0070681_101084803 375
561 3300005459 Ga0068867_100286113 Ga0068867_1002861132 375
562 3300005530 Ga0070679_100036653 Ga0070679_1000366532 375
563 3300005530 Ga0070679_100067981 Ga0070679_1000679814 375
564 3300005535 Ga0070684_100055302 Ga0070684_1000553024 375
565 3300005544 Ga0070686_100033209 Ga0070686_1000332091 375
566 3300005563 Ga0068855_100025137 Ga0068855_10002513712 375
567 3300005614 Ga0068856_100059240 Ga0068856_1000592405 375
568 3300005615 Ga0070702_100114748 Ga0070702_1001147482 375
569 3300005615 Ga0070702_100141710 Ga0070702_1001417102 375
570 3300005834 Ga0068851_10023965 Ga0068851_100239653 375
571 3300005840 Ga0068870_10039879 Ga0068870_100398793 375
572 3300005841 Ga0068863_100307358 Ga0068863_1003073582 375
573 3300005842 Ga0068858_100029655 Ga0068858_1000296554 375
574 3300005844 Ga0068862_100002408 Ga0068862_1000024083 375
575 3300005937 Ga0081455_10035796 Ga0081455_100357964 375
576 3300005981 Ga0081538_10000027 Ga0081538_1000002797 375
577 3300005981 Ga0081538_10000743 Ga0081538_1000074313 375
578 3300005981 Ga0081538_10008278 Ga0081538_100082787 375
579 3300005985 Ga0081539_10000057 Ga0081539_10000057216 375
580 3300005985 Ga0081539_10002491 Ga0081539_1000249122 375
581 3300006028 Ga0070717_10008781 Ga0070717_100087817 375
582 3300006038 Ga0075365_10019093 Ga0075365_100190932 375
583 3300006038 Ga0075365_10077005 Ga0075365_100770051 375
584 3300006048 Ga0075363_100001397 Ga0075363_10000139711 375
585 3300006051 Ga0075364_10006675 Ga0075364_100066755 375
586 3300006051 Ga0075364_10064434 Ga0075364_100644341 375
587 3300006051 Ga0075364_10090286 Ga0075364_100902862 375
588 3300006163 Ga0070715_10019321 Ga0070715_100193211 375
589 3300006881 Ga0068865_100057585 Ga0068865_1000575853 375
590 3300009036 Ga0105244_10038469 Ga0105244_100384692 375
591 3300009093 Ga0105240_10194307 Ga0105240_101943072 375
592 3300009094 Ga0111539_10119322 Ga0111539_101193222 375
593 3300009094 Ga0111539_10173719 Ga0111539_101737191 375
594 3300009094 Ga0111539_10410703 Ga0111539_104107031 375
595 3300009098 Ga0105245_10235555 Ga0105245_102355552 375
596 3300009101 Ga0105247_10000035 Ga0105247_1000003549 375
597 3300009148 Ga0105243_10006577 Ga0105243_100065777 375
598 3300009148 Ga0105243_10094611 Ga0105243_100946112 375
599 3300009177 Ga0105248_10317268 Ga0105248_103172681 375
600 3300009551 Ga0105238_10145056 Ga0105238_101450562 375
601 3300009553 Ga0105249_10000051 Ga0105249_100000515 375
602 3300009553 Ga0105249_10012666 Ga0105249_100126665 375
603 3300009553 Ga0105249_10079532 Ga0105249_100795322 375
604 3300010375 Ga0105239_10020081 Ga0105239_100200817 375
605 3300010375 Ga0105239_10052158 Ga0105239_100521587 375
606 3300013100 Ga0157373_10107609 Ga0157373_101076091 375
607 3300013104 Ga0157370_10057979 Ga0157370_100579793 375
608 3300013105 Ga0157369_10083384 Ga0157369_100833843 375
609 3300013306 Ga0163162_10034645 Ga0163162_100346455 375
610 3300013307 Ga0157372_10253034 Ga0157372_102530342 375
611 3300013308 Ga0157375_10030942 Ga0157375_100309424 375
612 3300013308 Ga0157375_10375659 Ga0157375_103756592 375
613 3300014745 Ga0157377_10013595 Ga0157377_100135952 375
614 3300014968 Ga0157379_10046415 Ga0157379_100464152 375
615 3300017792 Ga0163161_10089976 Ga0163161_100899762 375
616 3300020080 Ga0206350_10716424 Ga0206350_107164242 375
617 3300020610 Ga0154015_1669549 Ga0154015_16695492 375
618 3300021384 Ga0213876_10002674 Ga0213876_100026747 375
619 3300021388 Ga0213875_10025168 Ga0213875_100251682 375
620 3300022467 Ga0224712_10024635 Ga0224712_100246352 375
621 3300022467 Ga0224712_10046376 Ga0224712_100463762 375
622 3300025273 Ga0209673_1021036 Ga0209673_10210362 375
623 3300025303 Ga0209051_1002056 Ga0209051_10020566 375
624 3300025303 Ga0209051_1002381 Ga0209051_100238114 375
625 3300025885 Ga0207653_10018985 Ga0207653_100189852 375
626 3300025893 Ga0207682_10015672 Ga0207682_100156723 375
627 3300025898 Ga0207692_10000047 Ga0207692_1000004722 375
628 3300025900 Ga0207710_10000056 Ga0207710_10000056125 375
629 3300025900 Ga0207710_10084551 Ga0207710_100845511 375
630 3300025901 Ga0207688_10003444 Ga0207688_100034446 375
631 3300025904 Ga0207647_10044175 Ga0207647_100441752 375
632 3300025907 Ga0207645_10013599 Ga0207645_100135994 375
633 3300025908 Ga0207643_10005024 Ga0207643_100050242 375
634 3300025908 Ga0207643_10028614 Ga0207643_100286142 375
635 3300025908 Ga0207643_10150919 Ga0207643_101509191 375
636 3300025909 Ga0207705_10181135 Ga0207705_101811352 375
637 3300025912 Ga0207707_10046326 Ga0207707_100463264 375
638 3300025912 Ga0207707_10075438 Ga0207707_100754383 375
639 3300025917 Ga0207660_10072832 Ga0207660_100728323 375
640 3300025918 Ga0207662_10030987 Ga0207662_100309872 375
641 3300025918 Ga0207662_10068268 Ga0207662_100682681 375
642 3300025919 Ga0207657_10045882 Ga0207657_100458822 375
643 3300025919 Ga0207657_10152913 Ga0207657_101529132 375
644 3300025919 Ga0207657_10200396 Ga0207657_102003962 375
645 3300025921 Ga0207652_10069041 Ga0207652_100690412 375
646 3300025921 Ga0207652_10121850 Ga0207652_101218503 375
647 3300025923 Ga0207681_10004806 Ga0207681_100048066 375
648 3300025925 Ga0207650_10144595 Ga0207650_101445952 375
649 3300025927 Ga0207687_10122523 Ga0207687_101225233 375
650 3300025933 Ga0207706_10045256 Ga0207706_100452563 375
651 3300025933 Ga0207706_10057441 Ga0207706_100574413 375
652 3300025934 Ga0207686_10112074 Ga0207686_101120742 375
653 3300025939 Ga0207665_10078551 Ga0207665_100785512 375
654 3300025940 Ga0207691_10023705 Ga0207691_100237053 375
655 3300025940 Ga0207691_10126011 Ga0207691_101260113 375
656 3300025942 Ga0207689_10220327 Ga0207689_102203271 375
657 3300025944 Ga0207661_10100393 Ga0207661_101003932 375
658 3300025961 Ga0207712_10000043 Ga0207712_10000043167 375
659 3300025961 Ga0207712_10006039 Ga0207712_100060392 375
660 3300025981 Ga0207640_10050623 Ga0207640_100506233 375
661 3300026023 Ga0207677_10061194 Ga0207677_100611942 375
662 3300026023 Ga0207677_10187517 Ga0207677_101875171 375
663 3300026035 Ga0207703_10034899 Ga0207703_100348992 375
664 3300026067 Ga0207678_10023795 Ga0207678_100237952 375
665 3300026067 Ga0207678_10033197 Ga0207678_100331972 375
666 3300026067 Ga0207678_10181983 Ga0207678_101819832 375
667 3300026075 Ga0207708_10172494 Ga0207708_101724942 375
668 3300026118 Ga0207675_100075287 Ga0207675_1000752873 375
669 3300026118 Ga0207675_100092945 Ga0207675_1000929453 375
670 3300028380 Ga0268265_10000027 Ga0268265_100000273 375
671 3300028381 Ga0268264_10115744 Ga0268264_101157442 375
672 3300031548 Ga0307408_100181614 Ga0307408_1001816142 375
673 3300031548 Ga0307408_100245687 Ga0307408_1002456871 375
674 3300031548 Ga0307408_100275017 Ga0307408_1002750171 375
675 3300031731 Ga0307405_10003699 Ga0307405_100036994 375
676 3300031731 Ga0307405_10010320 Ga0307405_100103203 375
677 3300031824 Ga0307413_10005109 Ga0307413_100051094 375
678 3300031824 Ga0307413_10018705 Ga0307413_100187054 375
679 3300031852 Ga0307410_10237027 Ga0307410_102370271 375
680 3300031901 Ga0307406_10233601 Ga0307406_102336011 375
681 3300031911 Ga0307412_10043731 Ga0307412_100437311 375
682 3300031911 Ga0307412_10101877 Ga0307412_101018772 375
683 3300031995 Ga0307409_100010559 Ga0307409_1000105593 375
684 3300031995 Ga0307409_100015595 Ga0307409_1000155953 375
685 3300031995 Ga0307409_100096606 Ga0307409_1000966062 375
686 3300031995 Ga0307409_100179278 Ga0307409_1001792782 375
687 3300032002 Ga0307416_100001040 Ga0307416_10000104012 375
688 3300032002 Ga0307416_100107235 Ga0307416_1001072352 375
689 3300032004 Ga0307414_10057528 Ga0307414_100575282 375
690 3300032005 Ga0307411_10041564 Ga0307411_100415642 375
691 3300032005 Ga0307411_10141104 Ga0307411_101411043 375
692 3300032005 Ga0307411_10267752 Ga0307411_102677521 375
693 3300032126 Ga0307415_100000098 Ga0307415_10000009821 375
694 3300032126 Ga0307415_100026518 Ga0307415_1000265184 375
695 3300032126 Ga0307415_100035822 Ga0307415_1000358223 375
696 3300035092 Ga0373952_0011727 Ga0373952_0011727_310_1491 375
697 3300035121 Ga0373960_0021769 Ga0373960_0021769_73_1254 375
698 3300037312 Ga0395899_0033706 Ga0395899_0033706_1900_3081 375
699 3300037418 Ga0395900_0026549 Ga0395900_0026549_3406_4587 375
700 3300037471 Ga0395905_0204849 Ga0395905_0204849_349_1533 375
701 3300037853 Ga0436364_0447671 Ga0436364_0447671_63_1244 375
702 3300037853 Ga0436364_0568441 Ga0436364_0568441_1909_3090 375
703 3300037853 Ga0436364_1074429 Ga0436364_1074429_4712_5893 375
704 3300038443 Ga0395901_0008071 Ga0395901_0008071_8786_9970 375
705 3300038443 Ga0395901_0043317 Ga0395901_0043317_1866_3047 375
706 3300039437 Ga0436365_1318964 Ga0436365_1318964_484_1665 375
707 3300039437 Ga0436365_1701975 Ga0436365_1701975_783_1970 375
708 3300039437 Ga0436365_1823845 Ga0436365_1823845_30667_31848 375
709 3300041413 Ga0439465_0011071 Ga0439465_0011071_296_1477 375
710 3300041512 Ga0451853_3251545 Ga0451853_3251545_4325_5665 375
711 3300041512 Ga0451853_4095459 Ga0451853_4095459_103_1290 375
712 3300042004 Ga0439445_0034299 Ga0439445_0034299_117_1298 375
713 3300042435 Ga0439434_0003117 Ga0439434_0003117_3352_4533 375
714 3300044656 Ga0466969_0003721 Ga0466969_0003721_2179_3360 375
715 3300044658 Ga0466972_0001874 Ga0466972_0001874_7528_8709 375
716 3300044658 Ga0466972_0031999 Ga0466972_0031999_794_1975 375
717 3300044683 Ga0466965_0022558 Ga0466965_0022558_850_2031 375
718 3300044683 Ga0466965_0042885 Ga0466965_0042885_17_1198 375
719 3300044683 Ga0466965_0053117 Ga0466965_0053117_667_1848 375
720 3300044684 Ga0466966_0019354 Ga0466966_0019354_1851_3032 375
721 3300044684 Ga0466966_0081489 Ga0466966_0081489_58_1239 375
722 3300044693 Ga0466961_0006247 Ga0466961_0006247_6162_7343 375
723 3300044693 Ga0466961_0011389 Ga0466961_0011389_3231_4412 375
724 3300044693 Ga0466961_0030681 Ga0466961_0030681_1684_2865 375
725 3300044693 Ga0466961_0033783 Ga0466961_0033783_1391_2572 375
726 3300044694 Ga0466963_0002204 Ga0466963_0002204_2892_4073 375
727 3300044694 Ga0466963_0002353 Ga0466963_0002353_7346_8527 375
728 3300044694 Ga0466963_0006217 Ga0466963_0006217_4670_5851 375
729 3300044694 Ga0466963_0006912 Ga0466963_0006912_1599_2780 375
730 3300044694 Ga0466963_0017511 Ga0466963_0017511_278_1459 375
731 3300044694 Ga0466963_0018630 Ga0466963_0018630_2872_4053 375
732 3300044694 Ga0466963_0020110 Ga0466963_0020110_1571_2755 375
733 3300044694 Ga0466963_0035570 Ga0466963_0035570_1571_2752 375
734 3300044706 Ga0466964_0001016 Ga0466964_0001016_5799_6980 375
735 3300044706 Ga0466964_0013146 Ga0466964_0013146_1095_2276 375
736 3300044706 Ga0466964_0073576 Ga0466964_0073576_206_1387 375
737 3300044706 Ga0466964_0080898 Ga0466964_0080898_46_1227 375
738 3300044719 Ga0466971_0005561 Ga0466971_0005561_2495_3676 375
739 3300044719 Ga0466971_0014840 Ga0466971_0014840_571_1752 375
740 3300044719 Ga0466971_0040862 Ga0466971_0040862_625_1806 375
741 3300044735 Ga0466968_0007552 Ga0466968_0007552_1633_2814 375
742 3300044735 Ga0466968_0009623 Ga0466968_0009623_690_1871 375
743 3300044735 Ga0466968_0010855 Ga0466968_0010855_2250_3431 375
744 3300044735 Ga0466968_0016089 Ga0466968_0016089_819_2006 375
745 3300044735 Ga0466968_0057599 Ga0466968_0057599_408_1589 375
746 3300044765 Ga0466970_0001965 Ga0466970_0001965_2767_3948 375
747 3300044765 Ga0466970_0125218 Ga0466970_0125218_80_1261 375
748 3300044842 Ga0466957_0002104 Ga0466957_0002104_6631_7812 375
749 3300044842 Ga0466957_0002299 Ga0466957_0002299_8224_9405 375
750 3300044842 Ga0466957_0009341 Ga0466957_0009341_652_1833 375
751 3300044842 Ga0466957_0015808 Ga0466957_0015808_1832_3013 375
752 3300044842 Ga0466957_0070728 Ga0466957_0070728_697_1878 375
753 3300044901 Ga0466960_0002483 Ga0466960_0002483_1891_3072 375
754 3300044901 Ga0466960_0007395 Ga0466960_0007395_2299_3480 375
755 3300044901 Ga0466960_0011396 Ga0466960_0011396_2501_3682 375
756 3300044901 Ga0466960_0029854 Ga0466960_0029854_933_2114 375
757 3300044901 Ga0466960_0036966 Ga0466960_0036966_872_2053 375
758 3300045049 Ga0466959_0002904 Ga0466959_0002904_4892_6079 375
759 3300045049 Ga0466959_0004094 Ga0466959_0004094_5866_7047 375
760 3300045049 Ga0466959_0019737 Ga0466959_0019737_2039_3220 375
761 3300045049 Ga0466959_0072348 Ga0466959_0072348_657_1838 375
762 3300045836 Ga0466958_0010619 Ga0466958_0010619_1677_2858 375
763 3300045836 Ga0466958_0035663 Ga0466958_0035663_524_1705 375
764 3300045836 Ga0466958_0110189 Ga0466958_0110189_367_1548 375
765 3300045976 Ga0466967_0000459 Ga0466967_0000459_1744_2925 375
766 3300045976 Ga0466967_0000531 Ga0466967_0000531_6203_7384 375
767 3300045976 Ga0466967_0003729 Ga0466967_0003729_1926_3107 375
768 3300045976 Ga0466967_0003823 Ga0466967_0003823_6318_7499 375
769 3300045976 Ga0466967_0005090 Ga0466967_0005090_694_1875 375
770 3300045976 Ga0466967_0005282 Ga0466967_0005282_5631_6812 375
771 3300045976 Ga0466967_0017824 Ga0466967_0017824_2617_3798 375
772 3300045976 Ga0466967_0035581 Ga0466967_0035581_82_1266 375
773 3300045976 Ga0466967_0050893 Ga0466967_0050893_2075_3256 375
774 3300045976 Ga0466967_0052435 Ga0466967_0052435_456_1637 375
775 3300045976 Ga0466967_0075783 Ga0466967_0075783_1613_2797 375
776 3300045976 Ga0466967_0077072 Ga0466967_0077072_542_1723 375
777 3300045976 Ga0466967_0083486 Ga0466967_0083486_1440_2621 375
778 3300045976 Ga0466967_0085941 Ga0466967_0085941_365_1549 375
779 3300045976 Ga0466967_0108016 Ga0466967_0108016_1357_2541 375
780 3300045976 Ga0466967_0113244 Ga0466967_0113244_430_1611 375
781 3300045976 Ga0466967_0118606 Ga0466967_0118606_884_2065 375
782 3300045976 Ga0466967_0142277 Ga0466967_0142277_1026_2207 375
783 3300046459 Ga0495629_0001345 Ga0495629_0001345_14170_15357 375
784 3300046463 Ga0495653_0057907 Ga0495653_0057907_1332_2519 375
785 3300046477 Ga0495664_0137673 Ga0495664_0137673_165_1346 375
786 3300046516 Ga0495628_0067564 Ga0495628_0067564_680_1864 375
787 3300046523 Ga0495644_0003311 Ga0495644_0003311_2334_3521 375
788 3300046524 Ga0495648_0021917 Ga0495648_0021917_2164_3345 375
789 3300046535 Ga0495586_0001003 Ga0495586_0001003_14417_15598 375
790 3300046616 Ga0495668_0009185 Ga0495668_0009185_283_1464 375
791 3300047320 Ga0495672_0004055 Ga0495672_0004055_1095_2276 375
792 3300047469 Ga0495673_0011435 Ga0495673_0011435_2243_3424 375
793 3300048903 Ga0496100_0000049 Ga0496100_0000049_22717_23904 375
794 3300048904 Ga0496101_0000010 Ga0496101_0000010_76656_77843 375
795 3300048904 Ga0496101_0012828 Ga0496101_0012828_490_1671 375
796 3300048904 Ga0496101_0040585 Ga0496101_0040585_2066_3247 375
797 3300048904 Ga0496101_0055181 Ga0496101_0055181_1292_2473 375
798 3300048905 Ga0496102_0057354 Ga0496102_0057354_1932_3119 375
799 3300048907 Ga0496104_0108146 Ga0496104_0108146_1202_2383 375
800 3300048907 Ga0496104_0202321 Ga0496104_0202321_494_1675 375
801 3300048907 Ga0496104_0209233 Ga0496104_0209233_668_1849 375
802 3300048908 Ga0496105_0001228 Ga0496105_0001228_8246_9427 375
803 3300048908 Ga0496105_0067957 Ga0496105_0067957_511_1692 375
804 3300048908 Ga0496105_0088947 Ga0496105_0088947_418_1599 375
805 3300048909 Ga0496106_0000554 Ga0496106_0000554_22041_23228 375
806 3300048909 Ga0496106_0038244 Ga0496106_0038244_1269_2450 375
807 3300048910 Ga0496107_0000032 Ga0496107_0000032_22054_23241 375
808 3300048910 Ga0496107_0025887 Ga0496107_0025887_792_1973 375
809 3300048911 Ga0496108_0003741 Ga0496108_0003741_6002_7183 375
810 3300048911 Ga0496108_0008375 Ga0496108_0008375_4007_5191 375
811 3300048911 Ga0496108_0008381 Ga0496108_0008381_5518_6699 375
812 3300048911 Ga0496108_0023418 Ga0496108_0023418_2973_4154 375
813 3300048911 Ga0496108_0030620 Ga0496108_0030620_2866_4047 375
814 3300048912 Ga0496109_0007616 Ga0496109_0007616_6598_7779 375
815 3300048912 Ga0496109_0011010 Ga0496109_0011010_752_1933 375
816 3300048912 Ga0496109_0011940 Ga0496109_0011940_2786_3967 375
817 3300048912 Ga0496109_0022770 Ga0496109_0022770_4140_5321 375
818 3300048912 Ga0496109_0055041 Ga0496109_0055041_1254_2435 375
819 3300048912 Ga0496109_0071268 Ga0496109_0071268_140_1324 375
820 3300048912 Ga0496109_0093809 Ga0496109_0093809_1125_2318 375
821 3300048912 Ga0496109_0101897 Ga0496109_0101897_604_1785 375
822 3300048913 Ga0496110_0149908 Ga0496110_0149908_727_1941 375
823 3300048913 Ga0496110_0214949 Ga0496110_0214949_284_1468 375
824 3300048914 Ga0496111_0028625 Ga0496111_0028625_945_2126 375
825 3300048914 Ga0496111_0184786 Ga0496111_0184786_65_1246 375
826 3300048915 Ga0496112_0008049 Ga0496112_0008049_6541_7722 375
827 3300048915 Ga0496112_0014574 Ga0496112_0014574_6098_7279 375
828 3300048915 Ga0496112_0059774 Ga0496112_0059774_461_1642 375
829 3300048915 Ga0496112_0070887 Ga0496112_0070887_864_2045 375
830 3300048916 Ga0496113_0090451 Ga0496113_0090451_481_1665 375
831 3300048916 Ga0496113_0183883 Ga0496113_0183883_443_1624 375
832 3300048917 Ga0496114_0013262 Ga0496114_0013262_3982_5163 375
833 3300048917 Ga0496114_0077463 Ga0496114_0077463_825_2006 375
834 3300048917 Ga0496114_0177299 Ga0496114_0177299_89_1270 375
835 3300048918 Ga0496115_0068572 Ga0496115_0068572_778_1959 375
836 3300048918 Ga0496115_0119613 Ga0496115_0119613_298_1479 375
837 3300048918 Ga0496115_0272312 Ga0496115_0272312_124_1305 375
838 3300048919 Ga0496116_0036741 Ga0496116_0036741_1898_3079 375
839 3300048921 Ga0496118_0000348 Ga0496118_0000348_17011_18198 375
840 3300048922 Ga0496119_0019038 Ga0496119_0019038_2001_3182 375
841 3300048923 Ga0496120_0009064 Ga0496120_0009064_4929_6110 375
842 3300048924 Ga0496121_0001481 Ga0496121_0001481_17893_19074 375
843 3300048924 Ga0496121_0015682 Ga0496121_0015682_1881_3092 375
844 3300048925 Ga0496122_0059835 Ga0496122_0059835_1215_2396 375
845 3300048926 Ga0496123_0008754 Ga0496123_0008754_4850_6031 375
846 3300048928 Ga0496125_0001936 Ga0496125_0001936_7209_8390 375
847 3300048929 Ga0496126_0008479 Ga0496126_0008479_8016_9197 375
848 3300048929 Ga0496126_0011727 Ga0496126_0011727_922_2106 375
849 3300049568 Ga0501031_0110434 Ga0501031_0110434_428_1612 375
850 3300049569 Ga0501032_0001794 Ga0501032_0001794_4552_5736 375
851 3300049569 Ga0501032_0007193 Ga0501032_0007193_4259_5446 375
852 3300049569 Ga0501032_0012590 Ga0501032_0012590_2434_3615 375
853 3300049569 Ga0501032_0142191 Ga0501032_0142191_171_1352 375
854 3300049569 Ga0501032_0193950 Ga0501032_0193950_113_1294 375
855 3300049570 Ga0501033_0002624 Ga0501033_0002624_10375_11559 375
856 3300049570 Ga0501033_0026382 Ga0501033_0026382_1101_2282 375
857 3300049571 Ga0501034_0001867 Ga0501034_0001867_19252_20433 375
858 3300049571 Ga0501034_0010489 Ga0501034_0010489_7967_9151 375
859 3300049571 Ga0501034_0042366 Ga0501034_0042366_3186_4367 375
860 3300049571 Ga0501034_0057831 Ga0501034_0057831_259_1440 375
861 3300049572 Ga0501036_0018374 Ga0501036_0018374_1162_2346 375
862 3300049572 Ga0501036_0040731 Ga0501036_0040731_1358_2539 375
863 3300049572 Ga0501036_0051373 Ga0501036_0051373_572_1759 375
864 3300049572 Ga0501036_0055542 Ga0501036_0055542_823_2010 375
865 3300049572 Ga0501036_0092359 Ga0501036_0092359_250_1431 375
866 3300049573 Ga0501037_0008444 Ga0501037_0008444_166_1347 375
867 3300049573 Ga0501037_0196207 Ga0501037_0196207_109_1290 375
868 3300049574 Ga0501038_0005695 Ga0501038_0005695_5488_6675 375
869 3300049574 Ga0501038_0015469 Ga0501038_0015469_5311_6495 375
870 3300049576 Ga0501040_0055284 Ga0501040_0055284_1218_2405 375
871 3300049577 Ga0501041_0035171 Ga0501041_0035171_1650_2837 375
872 3300049579 Ga0501043_0010324 Ga0501043_0010324_4217_5404 375
873 3300049579 Ga0501043_0021933 Ga0501043_0021933_3522_4706 375
874 3300049579 Ga0501043_0157266 Ga0501043_0157266_581_1765 375
875 3300049579 Ga0501043_0213415 Ga0501043_0213415_14_1195 375
876 3300049580 Ga0501046_0000879 Ga0501046_0000879_9846_11030 375
877 3300049580 Ga0501046_0003736 Ga0501046_0003736_11211_12395 375
878 3300049580 Ga0501046_0008225 Ga0501046_0008225_6065_7246 375
879 3300049580 Ga0501046_0021943 Ga0501046_0021943_1310_2491 375
880 3300049581 Ga0501047_0004021 Ga0501047_0004021_7148_8335 375
881 3300049581 Ga0501047_0014869 Ga0501047_0014869_2856_4037 375
882 3300049581 Ga0501047_0057557 Ga0501047_0057557_290_1471 375
883 3300049581 Ga0501047_0081646 Ga0501047_0081646_553_1737 375
884 3300049581 Ga0501047_0104102 Ga0501047_0104102_156_1337 375
885 3300049581 Ga0501047_0257928 Ga0501047_0257928_350_1537 375
886 3300049582 Ga0501048_0000697 Ga0501048_0000697_2058_3245 375
887 3300049582 Ga0501048_0017362 Ga0501048_0017362_2017_3204 375
888 3300049582 Ga0501048_0032203 Ga0501048_0032203_1667_2851 375
889 3300049584 Ga0501068_0031686 Ga0501068_0031686_84_1265 375
890 3300049584 Ga0501068_0042659 Ga0501068_0042659_138_1322 375
891 3300049585 Ga0501069_0009647 Ga0501069_0009647_1914_3095 375
892 3300049586 Ga0501070_0005907 Ga0501070_0005907_6159_7340 375
893 3300049586 Ga0501070_0009786 Ga0501070_0009786_4746_5927 375
894 3300049586 Ga0501070_0017923 Ga0501070_0017923_4201_5388 375
895 3300049586 Ga0501070_0030785 Ga0501070_0030785_1715_2896 375
896 3300049586 Ga0501070_0096821 Ga0501070_0096821_902_2089 375
897 3300049588 Ga0501072_0038949 Ga0501072_0038949_2194_3375 375
898 3300049589 Ga0501073_0043766 Ga0501073_0043766_1508_2689 375
899 3300049591 Ga0501075_0087688 Ga0501075_0087688_539_1726 375
900 3300049592 Ga0501076_0092363 Ga0501076_0092363_1169_2350 375
901 3300049593 Ga0501077_0067441 Ga0501077_0067441_785_1978 375
902 3300049742 Ga0501080_0000420 Ga0501080_0000420_9230_10411 375
903 3300049742 Ga0501080_0025286 Ga0501080_0025286_2052_3233 375
904 3300049742 Ga0501080_0028060 Ga0501080_0028060_2231_3412 375
905 3300049742 Ga0501080_0202454 Ga0501080_0202454_80_1264 375
906 3300049744 Ga0501083_0075918 Ga0501083_0075918_493_1674 375
907 3300049822 Ga0501035_0000257 Ga0501035_0000257_56772_57953 375
908 3300049822 Ga0501035_0000385 Ga0501035_0000385_2102_3289 375
909 3300049822 Ga0501035_0002891 Ga0501035_0002891_13318_14499 375
910 3300049822 Ga0501035_0010245 Ga0501035_0010245_2643_3830 375
911 3300049822 Ga0501035_0068566 Ga0501035_0068566_1022_2206 375
912 3300049822 Ga0501035_0233168 Ga0501035_0233168_93_1280 375
913 3300049823 Ga0501044_0002484 Ga0501044_0002484_18428_19609 375
914 3300049823 Ga0501044_0003392 Ga0501044_0003392_8101_9288 375
915 3300049823 Ga0501044_0067692 Ga0501044_0067692_442_1629 375
916 3300049823 Ga0501044_0106584 Ga0501044_0106584_1540_2724 375
917 3300049823 Ga0501044_0273379 Ga0501044_0273379_176_1363 375
918 3300049824 Ga0501045_0020288 Ga0501045_0020288_1038_2225 375
919 3300050490 nmdc:mga03n38_12429_c1 nmdc:mga03n38_12429_c1_889_2070 375
920 3300050491 nmdc:mga00v17_7532_c1 nmdc:mga00v17_7532_c1_3247_4428 375
921 3300050492 nmdc:mga0yw44_227344_c1 nmdc:mga0yw44_227344_c1_12_1202 375
922 3300050496 nmdc:mga07m45_17165_c1 nmdc:mga07m45_17165_c1_1849_3036 375
923 3300050496 nmdc:mga07m45_69277_c1 nmdc:mga07m45_69277_c1_42_1232 375
924 3300050511 nmdc:mga08y16_203520_c1 nmdc:mga08y16_203520_c1_662_1855 375
925 3300050511 nmdc:mga08y16_326919_c1 nmdc:mga08y16_326919_c1_26_1204 375
926 3300050512 nmdc:mga0n895_411962_c1 nmdc:mga0n895_411962_c1_100_1281 375
927 3300053083 Ga0495655_0000004 Ga0495655_0000004_31019_32203 375
928 3300053088 Ga0500644_0000029 Ga0500644_0000029_59654_60841 375
929 3300053094 Ga0500566_0000572 Ga0500566_0000572_14368_15555 375
930 3300053129 Ga0500628_000049 Ga0500628_000049_30959_32143 375
931 3300053139 Ga0500568_0049026 Ga0500568_0049026_402_1583 375
932 3300053153 Ga0500616_0001580 Ga0500616_0001580_7767_8948 375
933 3300053730 Ga0500645_000029 Ga0500645_000029_52256_53437 375
934 3300060353 Ga0501082_0056731 Ga0501082_0056731_1070_2263 375
935 3300061719 Ga0466962_0003627 Ga0466962_0003627_4227_5408 375
936 3300061719 Ga0466962_0003835 Ga0466962_0003835_1505_2686 375
937 3300061719 Ga0466962_0006097 Ga0466962_0006097_2143_3324 375
938 3300061719 Ga0466962_0021585 Ga0466962_0021585_597_1778 375
939 iso_pu_bacteria 2855670206 2855674639 375
940 iso_pu_bacteria 2855676851 2855678348 375
941 iso_pu_bacteria 2857288857 2857294787 375
942 3300001989 JGI24739J22299_10025361 JGI24739J22299_100253611 376
943 3300002459 JGI24751J29686_10008504 JGI24751J29686_100085042 376
944 3300003373 JGI25407J50210_10008814 JGI25407J50210_100088142 376
945 3300003373 JGI25407J50210_10008888 JGI25407J50210_100088883 376
946 3300003373 JGI25407J50210_10016808 JGI25407J50210_100168082 376
947 3300005329 Ga0070683_100020145 Ga0070683_1000201454 376
948 3300005329 Ga0070683_100054259 Ga0070683_1000542592 376
949 3300005331 Ga0070670_100025495 Ga0070670_1000254951 376
950 3300005333 Ga0070677_10000016 Ga0070677_1000001656 376
951 3300005334 Ga0068869_100217826 Ga0068869_1002178262 376
952 3300005336 Ga0070680_100001433 Ga0070680_1000014339 376
953 3300005337 Ga0070682_100000026 Ga0070682_10000002684 376
954 3300005338 Ga0068868_100000095 Ga0068868_10000009524 376
955 3300005338 Ga0068868_100016586 Ga0068868_1000165864 376
956 3300005343 Ga0070687_100103097 Ga0070687_1001030972 376
957 3300005344 Ga0070661_100126664 Ga0070661_1001266643 376
958 3300005345 Ga0070692_10006462 Ga0070692_100064622 376
959 3300005345 Ga0070692_10049589 Ga0070692_100495892 376
960 3300005347 Ga0070668_100051436 Ga0070668_1000514361 376
961 3300005354 Ga0070675_100008907 Ga0070675_1000089072 376
962 3300005354 Ga0070675_100159192 Ga0070675_1001591922 376
963 3300005356 Ga0070674_100031722 Ga0070674_1000317223 376
964 3300005364 Ga0070673_100259721 Ga0070673_1002597212 376
965 3300005366 Ga0070659_100000003 Ga0070659_10000000360 376
966 3300005366 Ga0070659_100006123 Ga0070659_10000612310 376
967 3300005366 Ga0070659_100250868 Ga0070659_1002508681 376
968 3300005435 Ga0070714_100000008 Ga0070714_100000008207 376
969 3300005441 Ga0070700_100000010 Ga0070700_100000010160 376
970 3300005441 Ga0070700_100040445 Ga0070700_1000404452 376
971 3300005441 Ga0070700_100064543 Ga0070700_1000645431 376
972 3300005441 Ga0070700_100132958 Ga0070700_1001329581 376
973 3300005455 Ga0070663_100000875 Ga0070663_10000087517 376
974 3300005458 Ga0070681_10000392 Ga0070681_100003928 376
975 3300005459 Ga0068867_100007238 Ga0068867_1000072385 376
976 3300005530 Ga0070679_100000436 Ga0070679_1000004368 376
977 3300005535 Ga0070684_100000739 Ga0070684_10000073914 376
978 3300005535 Ga0070684_100262145 Ga0070684_1002621451 376
979 3300005543 Ga0070672_100211679 Ga0070672_1002116792 376
980 3300005547 Ga0070693_100160321 Ga0070693_1001603211 376
981 3300005548 Ga0070665_100000604 Ga0070665_10000060441 376
982 3300005548 Ga0070665_100005553 Ga0070665_1000055534 376
983 3300005548 Ga0070665_100137429 Ga0070665_1001374291 376
984 3300005548 Ga0070665_100308931 Ga0070665_1003089312 376
985 3300005564 Ga0070664_100006006 Ga0070664_1000060065 376
986 3300005564 Ga0070664_100073166 Ga0070664_1000731662 376
987 3300005577 Ga0068857_100016356 Ga0068857_1000163567 376
988 3300005578 Ga0068854_100000268 Ga0068854_1000002688 376
989 3300005614 Ga0068856_100069456 Ga0068856_1000694563 376
990 3300005615 Ga0070702_100056620 Ga0070702_1000566202 376
991 3300005616 Ga0068852_100118893 Ga0068852_1001188932 376
992 3300005617 Ga0068859_100411576 Ga0068859_1004115762 376
993 3300005618 Ga0068864_100000043 Ga0068864_10000004316 376
994 3300005719 Ga0068861_100047467 Ga0068861_1000474671 376
995 3300005719 Ga0068861_100104504 Ga0068861_1001045042 376
996 3300005842 Ga0068858_100000343 Ga0068858_10000034341 376
997 3300005843 Ga0068860_100073212 Ga0068860_1000732122 376
998 3300005843 Ga0068860_100130697 Ga0068860_1001306971 376
999 3300005844 Ga0068862_100019291 Ga0068862_1000192912 376
1000 3300005937 Ga0081455_10003801 Ga0081455_100038016 376
1001 3300005981 Ga0081538_10000412 Ga0081538_1000041245 376
1002 3300005981 Ga0081538_10001001 Ga0081538_1000100121 376
1003 3300005981 Ga0081538_10001378 Ga0081538_100013788 376
1004 3300005981 Ga0081538_10002106 Ga0081538_100021069 376
1005 3300005981 Ga0081538_10006330 Ga0081538_100063303 376
1006 3300005981 Ga0081538_10008176 Ga0081538_100081764 376
1007 3300005981 Ga0081538_10008904 Ga0081538_100089044 376
1008 3300005981 Ga0081538_10009285 Ga0081538_100092855 376
1009 3300005981 Ga0081538_10014946 Ga0081538_100149463 376
1010 3300005981 Ga0081538_10018941 Ga0081538_100189415 376
1011 3300005983 Ga0081540_1004477 Ga0081540_10044777 376
1012 3300005985 Ga0081539_10000637 Ga0081539_100006372 376
1013 3300006051 Ga0075364_10022860 Ga0075364_100228602 376
1014 3300006914 Ga0075436_100082547 Ga0075436_1000825472 376
1015 3300006931 Ga0097620_100411615 Ga0097620_1004116152 376
1016 3300009094 Ga0111539_10000749 Ga0111539_1000074919 376
1017 3300009098 Ga0105245_10000049 Ga0105245_1000004929 376
1018 3300009098 Ga0105245_10004336 Ga0105245_1000433612 376
1019 3300009098 Ga0105245_10148660 Ga0105245_101486601 376
1020 3300009148 Ga0105243_10014818 Ga0105243_100148185 376
1021 3300009176 Ga0105242_10096802 Ga0105242_100968022 376
1022 3300009177 Ga0105248_10097779 Ga0105248_100977792 376
1023 3300009551 Ga0105238_10307090 Ga0105238_103070901 376
1024 3300009553 Ga0105249_10000039 Ga0105249_10000039194 376
1025 3300009553 Ga0105249_10058816 Ga0105249_100588162 376
1026 3300010375 Ga0105239_10052515 Ga0105239_100525154 376
1027 3300013297 Ga0157378_10001472 Ga0157378_100014723 376
1028 3300013306 Ga0163162_10149165 Ga0163162_101491652 376
1029 3300013307 Ga0157372_10023108 Ga0157372_100231085 376
1030 3300014325 Ga0163163_10028469 Ga0163163_100284695 376
1031 3300014326 Ga0157380_10006393 Ga0157380_100063933 376
1032 3300014745 Ga0157377_10001519 Ga0157377_100015195 376
1033 3300014968 Ga0157379_10006549 Ga0157379_100065498 376
1034 3300014968 Ga0157379_10064797 Ga0157379_100647973 376
1035 3300015688 Ga0183367_1001 Ga0183367_1001806 376
1036 3300017792 Ga0163161_10017735 Ga0163161_100177355 376
1037 3300020069 Ga0197907_11178498 Ga0197907_111784982 376
1038 3300020080 Ga0206350_10298294 Ga0206350_102982941 376
1039 3300021377 Ga0213874_10001077 Ga0213874_100010775 376
1040 3300021384 Ga0213876_10004579 Ga0213876_100045797 376
1041 3300022467 Ga0224712_10007122 Ga0224712_100071221 376
1042 3300025271 Ga0207666_1001612 Ga0207666_10016121 376
1043 3300025898 Ga0207692_10000004 Ga0207692_10000004320 376
1044 3300025901 Ga0207688_10051506 Ga0207688_100515062 376
1045 3300025907 Ga0207645_10118658 Ga0207645_101186582 376
1046 3300025912 Ga0207707_10000295 Ga0207707_1000029527 376
1047 3300025917 Ga0207660_10001344 Ga0207660_100013448 376
1048 3300025917 Ga0207660_10230878 Ga0207660_102308781 376
1049 3300025918 Ga0207662_10013120 Ga0207662_100131202 376
1050 3300025918 Ga0207662_10127073 Ga0207662_101270732 376
1051 3300025920 Ga0207649_10045606 Ga0207649_100456063 376
1052 3300025921 Ga0207652_10000148 Ga0207652_1000014830 376
1053 3300025923 Ga0207681_10133123 Ga0207681_101331232 376
1054 3300025927 Ga0207687_10226378 Ga0207687_102263782 376
1055 3300025929 Ga0207664_10000002 Ga0207664_10000002292 376
1056 3300025929 Ga0207664_10000554 Ga0207664_100005545 376
1057 3300025932 Ga0207690_10000306 Ga0207690_1000030620 376
1058 3300025937 Ga0207669_10128732 Ga0207669_101287321 376
1059 3300025942 Ga0207689_10027280 Ga0207689_100272805 376
1060 3300025944 Ga0207661_10000958 Ga0207661_1000095815 376
1061 3300025944 Ga0207661_10007452 Ga0207661_100074525 376
1062 3300025944 Ga0207661_10064349 Ga0207661_100643492 376
1063 3300025944 Ga0207661_10127618 Ga0207661_101276182 376
1064 3300025945 Ga0207679_10017870 Ga0207679_100178704 376
1065 3300025945 Ga0207679_10027539 Ga0207679_100275394 376
1066 3300025945 Ga0207679_10051438 Ga0207679_100514382 376
1067 3300025945 Ga0207679_10084222 Ga0207679_100842222 376
1068 3300025961 Ga0207712_10000003 Ga0207712_100000038 376
1069 3300025961 Ga0207712_10051613 Ga0207712_100516132 376
1070 3300025972 Ga0207668_10010420 Ga0207668_100104204 376
1071 3300025972 Ga0207668_10045528 Ga0207668_100455282 376
1072 3300025981 Ga0207640_10000054 Ga0207640_10000054109 376
1073 3300026023 Ga0207677_10000246 Ga0207677_1000024625 376
1074 3300026023 Ga0207677_10006227 Ga0207677_100062275 376
1075 3300026023 Ga0207677_10164292 Ga0207677_101642921 376
1076 3300026035 Ga0207703_10000338 Ga0207703_1000033830 376
1077 3300026035 Ga0207703_10385596 Ga0207703_103855962 376
1078 3300026041 Ga0207639_10256642 Ga0207639_102566421 376
1079 3300026067 Ga0207678_10007942 Ga0207678_100079428 376
1080 3300026075 Ga0207708_10000006 Ga0207708_10000006187 376
1081 3300026075 Ga0207708_10022916 Ga0207708_100229164 376
1082 3300026075 Ga0207708_10054107 Ga0207708_100541073 376
1083 3300026075 Ga0207708_10080853 Ga0207708_100808532 376
1084 3300026078 Ga0207702_10008664 Ga0207702_100086648 376
1085 3300026078 Ga0207702_10053322 Ga0207702_100533222 376
1086 3300026088 Ga0207641_10359347 Ga0207641_103593471 376
1087 3300026095 Ga0207676_10000042 Ga0207676_10000042150 376
1088 3300026116 Ga0207674_10003976 Ga0207674_1000397618 376
1089 3300026116 Ga0207674_10192673 Ga0207674_101926733 376
1090 3300026118 Ga0207675_100019134 Ga0207675_1000191347 376
1091 3300026118 Ga0207675_100054785 Ga0207675_1000547852 376
1092 3300026121 Ga0207683_10070136 Ga0207683_100701362 376
1093 3300026142 Ga0207698_10051445 Ga0207698_100514453 376
1094 3300026142 Ga0207698_10138431 Ga0207698_101384312 376
1095 3300027907 Ga0207428_10040233 Ga0207428_100402333 376
1096 3300028379 Ga0268266_10000020 Ga0268266_10000020484 376
1097 3300028379 Ga0268266_10011746 Ga0268266_100117464 376
1098 3300028379 Ga0268266_10238786 Ga0268266_102387861 376
1099 3300028379 Ga0268266_10269965 Ga0268266_102699652 376
1100 3300028380 Ga0268265_10051054 Ga0268265_100510542 376
1101 3300028794 Ga0307515_10057727 Ga0307515_100577277 376
1102 3300030522 Ga0307512_10008471 Ga0307512_100084719 376
1103 3300030522 Ga0307512_10025385 Ga0307512_100253857 376
1104 3300030522 Ga0307512_10169288 Ga0307512_101692881 376
1105 3300031456 Ga0307513_10011334 Ga0307513_1001133411 376
1106 3300031649 Ga0307514_10004261 Ga0307514_1000426110 376
1107 3300031731 Ga0307405_10063607 Ga0307405_100636072 376
1108 3300031852 Ga0307410_10029539 Ga0307410_100295392 376
1109 3300031852 Ga0307410_10033224 Ga0307410_100332243 376
1110 3300031852 Ga0307410_10129271 Ga0307410_101292711 376
1111 3300031901 Ga0307406_10066691 Ga0307406_100666913 376
1112 3300031903 Ga0307407_10006041 Ga0307407_100060415 376
1113 3300031903 Ga0307407_10030859 Ga0307407_100308592 376
1114 3300031911 Ga0307412_10015943 Ga0307412_100159433 376
1115 3300031995 Ga0307409_100009038 Ga0307409_1000090385 376
1116 3300031995 Ga0307409_100025604 Ga0307409_1000256042 376
1117 3300032002 Ga0307416_100015905 Ga0307416_1000159053 376
1118 3300032002 Ga0307416_100031388 Ga0307416_1000313883 376
1119 3300032002 Ga0307416_100043775 Ga0307416_1000437754 376
1120 3300032002 Ga0307416_100122470 Ga0307416_1001224702 376
1121 3300032002 Ga0307416_100266516 Ga0307416_1002665162 376
1122 3300032004 Ga0307414_10006960 Ga0307414_100069606 376
1123 3300032004 Ga0307414_10151488 Ga0307414_101514882 376
1124 3300032005 Ga0307411_10036355 Ga0307411_100363552 376
1125 3300032126 Ga0307415_100000812 Ga0307415_10000081215 376
1126 3300032126 Ga0307415_100018084 Ga0307415_1000180843 376
1127 3300032126 Ga0307415_100043117 Ga0307415_1000431175 376
1128 3300032126 Ga0307415_100057149 Ga0307415_1000571494 376
1129 3300032126 Ga0307415_100121195 Ga0307415_1001211951 376
1130 3300032126 Ga0307415_100169684 Ga0307415_1001696842 376
1131 3300032126 Ga0307415_100225486 Ga0307415_1002254861 376
1132 3300037312 Ga0395899_0010069 Ga0395899_0010069_1219_2433 376
1133 3300037312 Ga0395899_0162202 Ga0395899_0162202_41_1225 376
1134 3300037418 Ga0395900_0077226 Ga0395900_0077226_1451_2635 376
1135 3300037418 Ga0395900_0288130 Ga0395900_0288130_122_1306 376
1136 3300037466 Ga0395898_0095164 Ga0395898_0095164_781_1965 376
1137 3300037466 Ga0395898_0107797 Ga0395898_0107797_755_1939 376
1138 3300037466 Ga0395898_0270324 Ga0395898_0270324_154_1341 376
1139 3300037853 Ga0436364_0945699 Ga0436364_0945699_4562_5746 376
1140 3300039437 Ga0436365_0128836 Ga0436365_0128836_4196_5380 376
1141 3300039437 Ga0436365_0943767 Ga0436365_0943767_7961_9145 376
1142 3300039437 Ga0436365_1371614 Ga0436365_1371614_3765_4949 376
1143 3300039450 Ga0436363_1096342 Ga0436363_1096342_38266_39453 376
1144 3300039450 Ga0436363_1701714 Ga0436363_1701714_37_1221 376
1145 3300041494 Ga0451837_0590686 Ga0451837_0590686_1319_2509 376
1146 3300041509 Ga0451843_1155741 Ga0451843_1155741_2150_3334 376
1147 3300041512 Ga0451853_0008187 Ga0451853_0008187_992_2182 376
1148 3300041512 Ga0451853_1848652 Ga0451853_1848652_284_1468 376
1149 3300042005 Ga0439448_0019572 Ga0439448_0019572_692_1876 376
1150 3300042016 Ga0439463_007686 Ga0439463_007686_516_1697 376
1151 3300042126 Ga0450888_001867 Ga0450888_001867_518_1705 376
1152 3300042136 Ga0450900_004646 Ga0450900_004646_46_1227 376
1153 3300042439 Ga0439464_0002536 Ga0439464_0002536_3279_4460 376
1154 3300042993 Ga0439440_0006706 Ga0439440_0006706_859_2043 376
1155 3300044656 Ga0466969_0018174 Ga0466969_0018174_1688_2872 376
1156 3300044656 Ga0466969_0024661 Ga0466969_0024661_916_2100 376
1157 3300044683 Ga0466965_0053220 Ga0466965_0053220_683_1867 376
1158 3300044684 Ga0466966_0007695 Ga0466966_0007695_632_1816 376
1159 3300044693 Ga0466961_0047998 Ga0466961_0047998_1041_2225 376
1160 3300044693 Ga0466961_0164002 Ga0466961_0164002_161_1342 376
1161 3300044694 Ga0466963_0001599 Ga0466963_0001599_2834_4018 376
1162 3300044694 Ga0466963_0019638 Ga0466963_0019638_158_1348 376
1163 3300044694 Ga0466963_0040989 Ga0466963_0040989_580_1761 376
1164 3300044694 Ga0466963_0089482 Ga0466963_0089482_830_2014 376
1165 3300044719 Ga0466971_0007675 Ga0466971_0007675_1377_2561 376
1166 3300044719 Ga0466971_0030173 Ga0466971_0030173_973_2154 376
1167 3300044719 Ga0466971_0040902 Ga0466971_0040902_26_1210 376
1168 3300044719 Ga0466971_0048932 Ga0466971_0048932_662_1852 376
1169 3300044765 Ga0466970_0003700 Ga0466970_0003700_2021_3211 376
1170 3300044901 Ga0466960_0001461 Ga0466960_0001461_2491_3675 376
1171 3300044901 Ga0466960_0014883 Ga0466960_0014883_1447_2631 376
1172 3300044901 Ga0466960_0016843 Ga0466960_0016843_631_1812 376
1173 3300044901 Ga0466960_0106558 Ga0466960_0106558_11_1195 376
1174 3300045049 Ga0466959_0006152 Ga0466959_0006152_1309_2493 376
1175 3300045049 Ga0466959_0050868 Ga0466959_0050868_506_1687 376
1176 3300045836 Ga0466958_0001618 Ga0466958_0001618_9336_10523 376
1177 3300045836 Ga0466958_0002091 Ga0466958_0002091_363_1544 376
1178 3300045836 Ga0466958_0032901 Ga0466958_0032901_1830_3014 376
1179 3300045836 Ga0466958_0108650 Ga0466958_0108650_533_1717 376
1180 3300045836 Ga0466958_0116678 Ga0466958_0116678_269_1453 376
1181 3300045836 Ga0466958_0138168 Ga0466958_0138168_131_1315 376
1182 3300045976 Ga0466967_0003792 Ga0466967_0003792_382_1566 376
1183 3300045976 Ga0466967_0022045 Ga0466967_0022045_2320_3504 376
1184 3300045976 Ga0466967_0024371 Ga0466967_0024371_3557_4741 376
1185 3300045976 Ga0466967_0026125 Ga0466967_0026125_645_1829 376
1186 3300045976 Ga0466967_0046183 Ga0466967_0046183_591_1775 376
1187 3300045976 Ga0466967_0383973 Ga0466967_0383973_60_1244 376
1188 3300046454 Ga0495592_0046066 Ga0495592_0046066_1245_2435 376
1189 3300046459 Ga0495629_0043163 Ga0495629_0043163_13_1203 376
1190 3300046461 Ga0495641_0000001 Ga0495641_0000001_406397_407584 376
1191 3300046462 Ga0495651_0038699 Ga0495651_0038699_2239_3429 376
1192 3300046529 Ga0495652_0201366 Ga0495652_0201366_25_1215 376
1193 3300046642 Ga0495634_0044728 Ga0495634_0044728_1587_2777 376
1194 3300046660 Ga0495625_0000032 Ga0495625_0000032_22461_23651 376
1195 3300046683 Ga0495658_0054952 Ga0495658_0054952_689_1873 376
1196 3300046689 Ga0495613_0173256 Ga0495613_0173256_327_1517 376
1197 3300046694 Ga0495649_0002010 Ga0495649_0002010_12603_13790 376
1198 3300046809 Ga0495600_0134678 Ga0495600_0134678_403_1593 376
1199 3300047317 Ga0495604_0079955 Ga0495604_0079955_888_2078 376
1200 3300047320 Ga0495672_0020993 Ga0495672_0020993_2588_3778 376
1201 3300047321 Ga0495676_0001012 Ga0495676_0001012_10287_11501 376
1202 3300048903 Ga0496100_0003260 Ga0496100_0003260_5511_6695 376
1203 3300048903 Ga0496100_0016762 Ga0496100_0016762_256_1449 376
1204 3300048904 Ga0496101_0014756 Ga0496101_0014756_3958_5151 376
1205 3300048904 Ga0496101_0020366 Ga0496101_0020366_989_2188 376
1206 3300048905 Ga0496102_0118692 Ga0496102_0118692_428_1612 376
1207 3300048905 Ga0496102_0385408 Ga0496102_0385408_35_1219 376
1208 3300048907 Ga0496104_0000003 Ga0496104_0000003_623460_624647 376
1209 3300048907 Ga0496104_0000010 Ga0496104_0000010_352281_353471 376
1210 3300048907 Ga0496104_0002873 Ga0496104_0002873_13047_14246 376
1211 3300048907 Ga0496104_0068980 Ga0496104_0068980_1512_2708 376
1212 3300048908 Ga0496105_0000003 Ga0496105_0000003_561474_562661 376
1213 3300048908 Ga0496105_0000005 Ga0496105_0000005_352281_353471 376
1214 3300048909 Ga0496106_0016600 Ga0496106_0016600_3889_5082 376
1215 3300048909 Ga0496106_0073131 Ga0496106_0073131_1292_2491 376
1216 3300048909 Ga0496106_0123664 Ga0496106_0123664_637_1821 376
1217 3300048910 Ga0496107_0047751 Ga0496107_0047751_1375_2574 376
1218 3300048910 Ga0496107_0067476 Ga0496107_0067476_1217_2410 376
1219 3300048910 Ga0496107_0092342 Ga0496107_0092342_911_2095 376
1220 3300048911 Ga0496108_0000055 Ga0496108_0000055_77810_78997 376
1221 3300048911 Ga0496108_0000266 Ga0496108_0000266_12886_14070 376
1222 3300048911 Ga0496108_0069663 Ga0496108_0069663_152_1348 376
1223 3300048911 Ga0496108_0238423 Ga0496108_0238423_99_1295 376
1224 3300048912 Ga0496109_0000043 Ga0496109_0000043_83185_84372 376
1225 3300048912 Ga0496109_0001540 Ga0496109_0001540_8316_9500 376
1226 3300048912 Ga0496109_0346087 Ga0496109_0346087_21_1205 376
1227 3300048913 Ga0496110_0000853 Ga0496110_0000853_12299_13495 376
1228 3300048913 Ga0496110_0018185 Ga0496110_0018185_4564_5748 376
1229 3300048913 Ga0496110_0137102 Ga0496110_0137102_527_1723 376
1230 3300048914 Ga0496111_0002660 Ga0496111_0002660_6055_7239 376
1231 3300048914 Ga0496111_0006857 Ga0496111_0006857_1868_3064 376
1232 3300048914 Ga0496111_0011810 Ga0496111_0011810_3277_4473 376
1233 3300048914 Ga0496111_0016959 Ga0496111_0016959_2915_4114 376
1234 3300048914 Ga0496111_0028700 Ga0496111_0028700_1806_2990 376
1235 3300048915 Ga0496112_0000091 Ga0496112_0000091_21270_22454 376
1236 3300048915 Ga0496112_0000408 Ga0496112_0000408_5244_6431 376
1237 3300048916 Ga0496113_0000001 Ga0496113_0000001_208844_210031 376
1238 3300048916 Ga0496113_0000892 Ga0496113_0000892_756_1940 376
1239 3300048916 Ga0496113_0039379 Ga0496113_0039379_108_1292 376
1240 3300048916 Ga0496113_0078361 Ga0496113_0078361_1195_2379 376
1241 3300048917 Ga0496114_0001646 Ga0496114_0001646_13385_14590 376
1242 3300048917 Ga0496114_0007876 Ga0496114_0007876_3567_4760 376
1243 3300048917 Ga0496114_0013727 Ga0496114_0013727_4095_5291 376
1244 3300048917 Ga0496114_0124091 Ga0496114_0124091_641_1846 376
1245 3300048918 Ga0496115_0024021 Ga0496115_0024021_1144_2337 376
1246 3300048922 Ga0496119_0017940 Ga0496119_0017940_799_1989 376
1247 3300049568 Ga0501031_0000793 Ga0501031_0000793_8700_9899 376
1248 3300049568 Ga0501031_0106110 Ga0501031_0106110_41_1231 376
1249 3300049569 Ga0501032_0001086 Ga0501032_0001086_9024_10223 376
1250 3300049569 Ga0501032_0013466 Ga0501032_0013466_2900_4081 376
1251 3300049569 Ga0501032_0031796 Ga0501032_0031796_659_1849 376
1252 3300049569 Ga0501032_0054831 Ga0501032_0054831_167_1357 376
1253 3300049569 Ga0501032_0129855 Ga0501032_0129855_390_1577 376
1254 3300049570 Ga0501033_0001052 Ga0501033_0001052_10647_11855 376
1255 3300049570 Ga0501033_0002467 Ga0501033_0002467_11467_12666 376
1256 3300049570 Ga0501033_0016951 Ga0501033_0016951_2984_4174 376
1257 3300049570 Ga0501033_0018404 Ga0501033_0018404_1517_2722 376
1258 3300049570 Ga0501033_0023472 Ga0501033_0023472_183_1373 376
1259 3300049571 Ga0501034_0003834 Ga0501034_0003834_1549_2739 376
1260 3300049571 Ga0501034_0009367 Ga0501034_0009367_2226_3425 376
1261 3300049571 Ga0501034_0011606 Ga0501034_0011606_6515_7699 376
1262 3300049571 Ga0501034_0015366 Ga0501034_0015366_393_1586 376
1263 3300049571 Ga0501034_0021803 Ga0501034_0021803_1833_3017 376
1264 3300049571 Ga0501034_0180896 Ga0501034_0180896_20_1210 376
1265 3300049572 Ga0501036_0001015 Ga0501036_0001015_1446_2636 376
1266 3300049572 Ga0501036_0024978 Ga0501036_0024978_357_1565 376
1267 3300049572 Ga0501036_0026465 Ga0501036_0026465_3669_4859 376
1268 3300049572 Ga0501036_0037324 Ga0501036_0037324_1833_3023 376
1269 3300049572 Ga0501036_0037617 Ga0501036_0037617_13_1212 376
1270 3300049572 Ga0501036_0042569 Ga0501036_0042569_752_1945 376
1271 3300049573 Ga0501037_0000339 Ga0501037_0000339_26814_28013 376
1272 3300049573 Ga0501037_0000693 Ga0501037_0000693_18283_19473 376
1273 3300049573 Ga0501037_0005845 Ga0501037_0005845_4863_6044 376
1274 3300049573 Ga0501037_0031382 Ga0501037_0031382_2317_3525 376
1275 3300049574 Ga0501038_0000223 Ga0501038_0000223_36420_37610 376
1276 3300049574 Ga0501038_0001452 Ga0501038_0001452_9108_10307 376
1277 3300049574 Ga0501038_0005026 Ga0501038_0005026_7242_8432 376
1278 3300049574 Ga0501038_0011274 Ga0501038_0011274_5369_6550 376
1279 3300049574 Ga0501038_0038278 Ga0501038_0038278_2891_4096 376
1280 3300049574 Ga0501038_0154489 Ga0501038_0154489_20_1228 376
1281 3300049574 Ga0501038_0189991 Ga0501038_0189991_284_1468 376
1282 3300049575 Ga0501039_0002928 Ga0501039_0002928_11052_12260 376
1283 3300049575 Ga0501039_0019744 Ga0501039_0019744_1093_2298 376
1284 3300049575 Ga0501039_0022978 Ga0501039_0022978_2260_3444 376
1285 3300049576 Ga0501040_0026207 Ga0501040_0026207_1010_2200 376
1286 3300049577 Ga0501041_0016787 Ga0501041_0016787_2170_3354 376
1287 3300049577 Ga0501041_0102592 Ga0501041_0102592_56_1246 376
1288 3300049578 Ga0501042_0016064 Ga0501042_0016064_1628_2818 376
1289 3300049578 Ga0501042_0045614 Ga0501042_0045614_1648_2835 376
1290 3300049578 Ga0501042_0071679 Ga0501042_0071679_459_1658 376
1291 3300049578 Ga0501042_0090062 Ga0501042_0090062_656_1846 376
1292 3300049578 Ga0501042_0095861 Ga0501042_0095861_791_1984 376
1293 3300049578 Ga0501042_0111252 Ga0501042_0111252_724_1914 376
1294 3300049578 Ga0501042_0114138 Ga0501042_0114138_102_1286 376
1295 3300049579 Ga0501043_0000335 Ga0501043_0000335_16110_17318 376
1296 3300049579 Ga0501043_0002464 Ga0501043_0002464_2989_4188 376
1297 3300049579 Ga0501043_0050927 Ga0501043_0050927_1613_2794 376
1298 3300049579 Ga0501043_0243219 Ga0501043_0243219_31_1221 376
1299 3300049580 Ga0501046_0002639 Ga0501046_0002639_9148_10347 376
1300 3300049580 Ga0501046_0010318 Ga0501046_0010318_1677_2867 376
1301 3300049580 Ga0501046_0019550 Ga0501046_0019550_3227_4432 376
1302 3300049580 Ga0501046_0063704 Ga0501046_0063704_1428_2636 376
1303 3300049581 Ga0501047_0000023 Ga0501047_0000023_1535_2725 376
1304 3300049581 Ga0501047_0000120 Ga0501047_0000120_9477_10676 376
1305 3300049581 Ga0501047_0000433 Ga0501047_0000433_8915_10105 376
1306 3300049581 Ga0501047_0011986 Ga0501047_0011986_2489_3679 376
1307 3300049581 Ga0501047_0023292 Ga0501047_0023292_3984_5174 376
1308 3300049581 Ga0501047_0031145 Ga0501047_0031145_1279_2469 376
1309 3300049581 Ga0501047_0039719 Ga0501047_0039719_1243_2427 376
1310 3300049581 Ga0501047_0112008 Ga0501047_0112008_1181_2389 376
1311 3300049582 Ga0501048_0000544 Ga0501048_0000544_19612_20802 376
1312 3300049582 Ga0501048_0001941 Ga0501048_0001941_11457_12656 376
1313 3300049583 Ga0501067_0000366 Ga0501067_0000366_15524_16714 376
1314 3300049584 Ga0501068_0002536 Ga0501068_0002536_8345_9535 376
1315 3300049584 Ga0501068_0044617 Ga0501068_0044617_1149_2357 376
1316 3300049584 Ga0501068_0144053 Ga0501068_0144053_17_1210 376
1317 3300049585 Ga0501069_0021619 Ga0501069_0021619_1831_3021 376
1318 3300049585 Ga0501069_0023420 Ga0501069_0023420_728_1927 376
1319 3300049586 Ga0501070_0000039 Ga0501070_0000039_86251_87450 376
1320 3300049586 Ga0501070_0002341 Ga0501070_0002341_831_2039 376
1321 3300049586 Ga0501070_0013856 Ga0501070_0013856_4261_5442 376
1322 3300049586 Ga0501070_0082466 Ga0501070_0082466_267_1457 376
1323 3300049587 Ga0501071_0012621 Ga0501071_0012621_346_1536 376
1324 3300049588 Ga0501072_0007567 Ga0501072_0007567_6958_8148 376
1325 3300049588 Ga0501072_0167501 Ga0501072_0167501_288_1472 376
1326 3300049589 Ga0501073_0009010 Ga0501073_0009010_3247_4446 376
1327 3300049589 Ga0501073_0019699 Ga0501073_0019699_2475_3665 376
1328 3300049590 Ga0501074_0013532 Ga0501074_0013532_2608_3798 376
1329 3300049590 Ga0501074_0021037 Ga0501074_0021037_362_1561 376
1330 3300049590 Ga0501074_0047928 Ga0501074_0047928_450_1658 376
1331 3300049591 Ga0501075_0075862 Ga0501075_0075862_372_1565 376
1332 3300049591 Ga0501075_0143660 Ga0501075_0143660_490_1674 376
1333 3300049592 Ga0501076_0022734 Ga0501076_0022734_1056_2255 376
1334 3300049592 Ga0501076_0046054 Ga0501076_0046054_154_1344 376
1335 3300049593 Ga0501077_0008189 Ga0501077_0008189_1125_2315 376
1336 3300049593 Ga0501077_0118627 Ga0501077_0118627_60_1253 376
1337 3300049593 Ga0501077_0125684 Ga0501077_0125684_112_1317 376
1338 3300049741 Ga0501079_0030796 Ga0501079_0030796_37_1242 376
1339 3300049741 Ga0501079_0115061 Ga0501079_0115061_92_1282 376
1340 3300049741 Ga0501079_0147053 Ga0501079_0147053_278_1465 376
1341 3300049742 Ga0501080_0002818 Ga0501080_0002818_2858_4057 376
1342 3300049742 Ga0501080_0023078 Ga0501080_0023078_3303_4484 376
1343 3300049742 Ga0501080_0077842 Ga0501080_0077842_1628_2818 376
1344 3300049744 Ga0501083_0008473 Ga0501083_0008473_3148_4347 376
1345 3300049744 Ga0501083_0045570 Ga0501083_0045570_298_1488 376
1346 3300049822 Ga0501035_0001723 Ga0501035_0001723_9413_10612 376
1347 3300049822 Ga0501035_0001747 Ga0501035_0001747_18711_19919 376
1348 3300049822 Ga0501035_0010988 Ga0501035_0010988_6198_7388 376
1349 3300049822 Ga0501035_0029465 Ga0501035_0029465_698_1888 376
1350 3300049822 Ga0501035_0272059 Ga0501035_0272059_221_1411 376
1351 3300049823 Ga0501044_0000110 Ga0501044_0000110_85301_86500 376
1352 3300049823 Ga0501044_0003831 Ga0501044_0003831_9327_10517 376
1353 3300049823 Ga0501044_0008291 Ga0501044_0008291_8007_9197 376
1354 3300049823 Ga0501044_0036079 Ga0501044_0036079_1045_2235 376
1355 3300049823 Ga0501044_0059281 Ga0501044_0059281_1407_2615 376
1356 3300049823 Ga0501044_0067847 Ga0501044_0067847_162_1346 376
1357 3300049823 Ga0501044_0092442 Ga0501044_0092442_554_1747 376
1358 3300049823 Ga0501044_0108942 Ga0501044_0108942_1310_2491 376
1359 3300049823 Ga0501044_0212502 Ga0501044_0212502_467_1645 376
1360 3300049824 Ga0501045_0006364 Ga0501045_0006364_5127_6326 376
1361 3300049824 Ga0501045_0008074 Ga0501045_0008074_2991_4196 376
1362 3300049824 Ga0501045_0069185 Ga0501045_0069185_1239_2429 376
1363 3300049824 Ga0501045_0151550 Ga0501045_0151550_271_1461 376
1364 3300050507 nmdc:mga05p37_195530_c1 nmdc:mga05p37_195530_c1_985_2184 376
1365 3300050510 nmdc:mga06r32_125522_c1 nmdc:mga06r32_125522_c1_1255_2469 376
1366 3300050511 nmdc:mga08y16_16353_c1 nmdc:mga08y16_16353_c1_769_1983 376
1367 3300050511 nmdc:mga08y16_5873_c1 nmdc:mga08y16_5873_c1_8930_10114 376
1368 3300050512 nmdc:mga0n895_280157_c1 nmdc:mga0n895_280157_c1_234_1448 376
1369 3300050513 nmdc:mga0rr50_175951_c1 nmdc:mga0rr50_175951_c1_355_1569 376
1370 3300050515 nmdc:mga0a205_68194_c1 nmdc:mga0a205_68194_c1_1761_2975 376
1371 3300053078 Ga0495612_0009308 Ga0495612_0009308_2686_3873 376
1372 3300053123 Ga0500614_000420 Ga0500614_000420_357_1544 376
1373 3300053153 Ga0500616_0000275 Ga0500616_0000275_55117_56301 376
1374 3300053153 Ga0500616_0000785 Ga0500616_0000785_13854_15038 376
1375 3300054114 Ga0501084_0000418 Ga0501084_0000418_19718_20902 376
1376 3300054114 Ga0501084_0005291 Ga0501084_0005291_1163_2368 376
1377 3300054114 Ga0501084_0015816 Ga0501084_0015816_3273_4463 376
1378 3300054114 Ga0501084_0154318 Ga0501084_0154318_713_1906 376
1379 3300059421 Ga0590071_004338 Ga0590071_004338_1890_3071 376
1380 3300059424 Ga0590075_002958 Ga0590075_002958_248_1429 376
1381 3300059426 Ga0590077_003215 Ga0590077_003215_1884_3065 376
1382 3300060353 Ga0501082_0010274 Ga0501082_0010274_1773_2972 376
1383 3300060353 Ga0501082_0029807 Ga0501082_0029807_117_1307 376
1384 3300061719 Ga0466962_0003037 Ga0466962_0003037_5024_6208 376
1385 3300061719 Ga0466962_0033096 Ga0466962_0033096_1064_2245 376
1386 3300061734 Ga0530510_0021816 Ga0530510_0021816_2524_3717 376
1387 3300061734 Ga0530510_0046232 Ga0530510_0046232_353_1537 376
1388 3300061734 Ga0530510_0210937 Ga0530510_0210937_164_1354 376

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00107

ADH_zinc_N

Zinc-binding dehydrogenase

262

343

0.93

PF08240

ADH_N

Alcohol dehydrogenase GroES-like domain

97

223

0.89

Structural Annotation

Top 5 Hits

ID Description Score Start End
6pvi-assembly1.cif.gz_A crystal structure of phqk in complex with paraherquamide l 0.9542 165 199
6sek-assembly1.cif.gz_B crystal structure of ancestral flavin-containing monooxygenase (fmo) 5 0.9237 165 198
2y6q-assembly4.cif.gz_D structure of the tetx monooxygenase in complex with the substrate 7- iodtetracycline 0.9156 164 196
4cpd-assembly2.cif.gz_C alcohol dehydrogenase tadh from thermus sp. atn1 0.8876 1 376
4cpd-assembly1.cif.gz_D alcohol dehydrogenase tadh from thermus sp. atn1 0.8853 1 375
ID Description Score Start End Superfamily
af_Q54H99_9_164_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9843 165 194 3.50.50.60
af_Q54H02_2_246_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.982 166 195 3.50.50.60
af_A4HWA7_1_176_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9773 166 198 3.50.50.60
af_A0A1D6FXS3_113_271_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.9639 166 195 3.50.50.60
af_F6P928_26_379_3.50.50.60 Alpha Beta;3-Layer(bba) Sandwich;FAD/NAD(P)-binding domain;FAD/NAD(P)-binding domain 0.958 168 198 3.50.50.60
ID Description Score Start End GO Terms
AF-A0A1G7B847-F1-model_v4 Threonine dehydrogenase 0.9825 1 376 GO:0008270
GO:0016491
AF-A0A1G7B847-F1-model_v4 Threonine dehydrogenase 0.9799 1 376 GO:0008270
GO:0016491
AF-A0A7V9MI07-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9627 1 195 GO:0008270
GO:0016491
AF-A0A1H4NA69-F1-model_v4 deleted 0.9614 1 236
AF-A0A7V9R1A2-F1-model_v4 Alcohol dehydrogenase catalytic domain-containing protein 0.9599 1 215 GO:0008270
GO:0016491

Feature Viewer

pLDDT pTM Quality
85.7 0.86 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar
Download PDB Download HMM

Map