F493476

General Info

Members Datasets Scaffolds Average Seq Length
1376 385 2752 77

Family's Representative Sequence

Representative Sequence 3300049572|Ga0501036_1397973|Ga0501036_1397973_253_519
Length 88
Sequence MDRPDIAEALEQLLGPGRPEVGCEECFAQLDRYVELELTGGDADAAIPGMRAHLLGCPACREEHESLRALVERGRTPRPAWRLIRLEP

Samples

Sample ID Description Type Environment
1 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
2 3300000041 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere Metagenome Rhizosphere
3 3300000044 Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old Metagenome Rhizosphere
4 3300000652 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA Metagenome Rhizosphere
5 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
6 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
7 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
8 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
9 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
10 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
11 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
12 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
13 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
14 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
15 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
16 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
17 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
18 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
19 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
20 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
21 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
22 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
23 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
24 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
25 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
26 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
27 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
28 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
29 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
30 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
31 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
32 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
33 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
34 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
35 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
36 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
37 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
38 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
39 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
40 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
41 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
42 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
43 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
44 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
45 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
46 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
47 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
48 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
49 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
50 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
51 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
52 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
53 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
54 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
55 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
56 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
57 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
58 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
59 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
60 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
61 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
62 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
63 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
64 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
65 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
66 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
67 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
68 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
69 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
70 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
71 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
72 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
73 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
74 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
75 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
76 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
77 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
78 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
79 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
80 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
81 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
82 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
83 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
84 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
85 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
86 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
87 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
88 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
89 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
90 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
91 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
92 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
93 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
94 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
95 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
96 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
97 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
98 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
99 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
100 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
101 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
102 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
103 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
104 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
105 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
106 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
107 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
108 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
109 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
110 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
111 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
112 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
113 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
114 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
115 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
116 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
117 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
118 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
119 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
120 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
121 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
122 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
123 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
124 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
130 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
132 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
133 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
136 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
137 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
177 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
179 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
183 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
186 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
187 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
190 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
191 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300030735 Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 Metagenome Rhizosphere
195 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
196 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
197 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
198 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
199 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
200 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
201 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
202 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
203 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
204 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
205 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
206 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
207 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
208 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
209 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
210 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
211 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
212 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
213 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
214 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
215 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
216 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
217 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
218 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
219 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
220 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
221 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
222 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
223 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
224 3300041404 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 Metagenome Rhizosphere
225 3300041405 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 Metagenome Rhizosphere
226 3300041406 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 Metagenome Rhizosphere
227 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
228 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
229 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
230 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
231 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
232 3300041997 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 Metagenome Rhizosphere
233 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
234 3300042000 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 Metagenome Rhizosphere
235 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
236 3300042002 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 Metagenome Rhizosphere
237 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
238 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
239 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
240 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
241 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
242 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
243 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
244 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
245 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
246 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
247 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
248 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
249 3300042125 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 Metagenome Rhizosphere
250 3300042127 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 Metagenome Rhizosphere
251 3300042136 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 Metagenome Rhizosphere
252 3300042137 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 Metagenome Rhizosphere
253 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
254 3300042146 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 Metagenome Rhizosphere
255 3300042147 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 Metagenome Rhizosphere
256 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
257 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
258 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
259 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
260 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
261 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
262 3300042531 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 Metagenome Rhizosphere
263 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
264 3300044658 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R Metagenome Rhizosphere
265 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
266 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
267 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
268 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
269 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
270 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
271 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
272 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
273 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
274 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
275 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
276 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
277 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
282 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
283 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
284 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
287 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
288 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
289 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
290 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
291 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
292 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
293 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
294 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
295 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
296 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
297 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
298 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
299 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
300 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
301 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
302 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
303 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
304 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
305 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
306 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
307 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
308 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
309 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
310 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
311 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
312 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
313 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
314 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
315 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
316 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
317 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
318 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
319 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
320 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
321 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
322 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
323 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
324 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
325 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
326 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
327 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
328 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
329 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
330 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
331 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
332 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
333 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
334 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
335 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
336 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
337 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
338 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
339 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
340 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
342 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
343 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
344 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
345 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
346 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
347 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
348 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
349 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
350 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
351 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
352 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
353 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
354 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
355 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
356 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
357 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
358 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
359 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
360 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
361 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
362 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
363 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
364 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
365 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
366 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
367 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
368 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
369 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
370 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
371 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
372 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
373 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
374 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
375 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
376 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
377 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
378 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
379 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
380 3300059423 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
381 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
382 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
384 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
385 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.91
Metatranscriptomes 1.09
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 1.09
Nodule 0
Rhizoplane 5.09
Rhizosphere 93.75
Stem 0
Stem Tuber 0
Unclassified 16.21

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0501036_1397973 3300049572 Bacteria 567
2 ARcpr5oldR_c001197 3300000041 Bacteria 2666
3 ARSoilOldRDRAFT_c000964 3300000044 Bacteria 2797
4 ARCol0yngRDRAFT_1000704 3300000652 Bacteria 3321
5 JGI24737J22298_10044293 3300001990 Bacteria 1361
6 JGI25406J46586_10238588 3300003203 Unclassified 533
7 JGI25407J50210_10000051 3300003373 Bacteria 13670
8 JGI25407J50210_10001892 3300003373 Bacteria 4853
9 JGI25407J50210_10050240 3300003373 Bacteria 1058
10 JGI25407J50210_10052063 3300003373 Bacteria 1036
11 JGI25407J50210_10073606 3300003373 Bacteria 852
12 JGI25407J50210_10136414 3300003373 Archaea 604
13 Ga0070658_10067133 3300005327 Unclassified 2930
14 Ga0070658_10096535 3300005327 Bacteria 2440
15 Ga0070658_10922781 3300005327 Bacteria 759
16 Ga0070658_11181920 3300005327 Unclassified 665
17 Ga0070683_100002922 3300005329 Bacteria 13693
18 Ga0070683_100003946 3300005329 Bacteria 12140
19 Ga0070683_100075110 3300005329 Unclassified 3158
20 Ga0070683_100113353 3300005329 Bacteria 2559
21 Ga0070683_100139593 3300005329 Bacteria 2296
22 Ga0070683_101011265 3300005329 Bacteria 798
23 Ga0070683_101653964 3300005329 Bacteria 616
24 Ga0070683_102334236 3300005329 Bacteria 513
25 Ga0070690_100185030 3300005330 Bacteria 1441
26 Ga0070690_100578423 3300005330 Unclassified 850
27 Ga0068869_100105026 3300005334 Bacteria 2142
28 Ga0068869_100358993 3300005334 Bacteria 1189
29 Ga0068869_100409896 3300005334 Unclassified 1116
30 Ga0068869_101826727 3300005334 Unclassified 544
31 Ga0070666_11434258 3300005335 Bacteria 516
32 Ga0070680_100029316 3300005336 Bacteria 4420
33 Ga0070680_100038162 3300005336 Bacteria 3884
34 Ga0070680_100136905 3300005336 Bacteria 2052
35 Ga0070682_100028671 3300005337 Bacteria 3349
36 Ga0070682_100038659 3300005337 Unclassified 2928
37 Ga0070682_100063128 3300005337 Bacteria 2348
38 Ga0070682_100525841 3300005337 Bacteria 921
39 Ga0070682_100780754 3300005337 Bacteria 774
40 Ga0070682_101557456 3300005337 Bacteria 570
41 Ga0068868_101066079 3300005338 Bacteria 742
42 Ga0070660_100029567 3300005339 Bacteria 4107
43 Ga0070660_100033678 3300005339 Bacteria 3864
44 Ga0070660_100070080 3300005339 Bacteria 2735
45 Ga0070660_100090129 3300005339 Bacteria 2417
46 Ga0070660_100376033 3300005339 Unclassified 1172
47 Ga0070660_101880718 3300005339 Bacteria 510
48 Ga0070660_101933191 3300005339 Unclassified 503
49 Ga0070689_100148630 3300005340 Bacteria 1888
50 Ga0070689_102162115 3300005340 Unclassified 510
51 Ga0070691_10219406 3300005341 Bacteria 1007
52 Ga0070691_10539284 3300005341 Bacteria 680
53 Ga0070687_100891862 3300005343 Bacteria 637
54 Ga0070661_100039491 3300005344 Bacteria 3439
55 Ga0070661_100066266 3300005344 Unclassified 2653
56 Ga0070661_100393914 3300005344 Bacteria 1094
57 Ga0070661_101430362 3300005344 Unclassified 582
58 Ga0070692_10003070 3300005345 Bacteria 6675
59 Ga0070692_10276299 3300005345 Bacteria 1016
60 Ga0070692_10770992 3300005345 Unclassified 654
61 Ga0070668_101273232 3300005347 Bacteria 668
62 Ga0070669_101646237 3300005353 Bacteria 559
63 Ga0070669_101657833 3300005353 Bacteria 557
64 Ga0070675_100035132 3300005354 Bacteria 4072
65 Ga0070675_100075867 3300005354 Bacteria 2795
66 Ga0070675_100394605 3300005354 Bacteria 1233
67 Ga0070671_100886356 3300005355 Bacteria 779
68 Ga0070671_101002264 3300005355 Bacteria 732
69 Ga0070674_100006549 3300005356 Bacteria 6804
70 Ga0070674_100036551 3300005356 Bacteria 3298
71 Ga0070674_100068963 3300005356 Bacteria 2493
72 Ga0070674_101983043 3300005356 Bacteria 530
73 Ga0070673_101257628 3300005364 Bacteria 694
74 Ga0070673_101405644 3300005364 Unclassified 657
75 Ga0070688_100368837 3300005365 Unclassified 1055
76 Ga0070659_100003810 3300005366 Bacteria 10756
77 Ga0070659_100052021 3300005366 Bacteria 3220
78 Ga0070659_100325336 3300005366 Bacteria 1286
79 Ga0070659_100654860 3300005366 Unclassified 906
80 Ga0070659_100986470 3300005366 Unclassified 739
81 Ga0070659_101034086 3300005366 Bacteria 722
82 Ga0070667_100818349 3300005367 Unclassified 865
83 Ga0070667_101833007 3300005367 Bacteria 571
84 Ga0070709_10070396 3300005434 Bacteria 2254
85 Ga0070709_10350030 3300005434 Bacteria 1091
86 Ga0070714_100033558 3300005435 Bacteria 4291
87 Ga0070713_100130497 3300005436 Bacteria 2215
88 Ga0070713_101859447 3300005436 Unclassified 584
89 Ga0070701_10336951 3300005438 Bacteria 938
90 Ga0070701_10603621 3300005438 Bacteria 727
91 Ga0070711_100097642 3300005439 Bacteria 2131
92 Ga0070700_100051473 3300005441 Bacteria 2563
93 Ga0070700_100067837 3300005441 Bacteria 2267
94 Ga0070694_100017086 3300005444 Bacteria 4580
95 Ga0070708_100010667 3300005445 Bacteria 7453
96 Ga0070708_100495144 3300005445 Unclassified 1153
97 Ga0070708_101748524 3300005445 Unclassified 578
98 Ga0070663_100257211 3300005455 Bacteria 1384
99 Ga0070663_100746905 3300005455 Unclassified 835
100 Ga0070663_101103297 3300005455 Bacteria 694
101 Ga0070678_100011103 3300005456 Bacteria 5540
102 Ga0070678_100362826 3300005456 Bacteria 1249
103 Ga0070678_101043070 3300005456 Unclassified 753
104 Ga0070678_102217799 3300005456 Bacteria 521
105 Ga0070662_100046211 3300005457 Bacteria 3128
106 Ga0070681_10006371 3300005458 Bacteria 11472
107 Ga0070681_10043297 3300005458 Bacteria 4510
108 Ga0070681_10058451 3300005458 Bacteria 3836
109 Ga0070681_10081367 3300005458 Bacteria 3194
110 Ga0070681_10087399 3300005458 Bacteria 3070
111 Ga0070681_10139091 3300005458 Bacteria 2358
112 Ga0070681_10251194 3300005458 Bacteria 1681
113 Ga0068867_100222865 3300005459 Bacteria 1521
114 Ga0068867_100290909 3300005459 Bacteria 1343
115 Ga0068867_101124008 3300005459 Unclassified 718
116 Ga0070706_100037349 3300005467 Bacteria 4486
117 Ga0070706_100239114 3300005467 Bacteria 1695
118 Ga0070706_100953063 3300005467 Unclassified 792
119 Ga0070707_100023151 3300005468 Bacteria 5876
120 Ga0070707_100053172 3300005468 Unclassified 3882
121 Ga0070707_100097602 3300005468 Unclassified 2846
122 Ga0070707_101431489 3300005468 Bacteria 658
123 Ga0070698_100010517 3300005471 Bacteria 9864
124 Ga0070698_100070889 3300005471 Bacteria 3496
125 Ga0070698_100147483 3300005471 Bacteria 2301
126 Ga0070698_100242948 3300005471 Bacteria 1734
127 Ga0070699_100023793 3300005518 Bacteria 5278
128 Ga0070699_100029327 3300005518 Bacteria 4744
129 Ga0070699_100110527 3300005518 Bacteria 2413
130 Ga0070699_100113020 3300005518 Bacteria 2385
131 Ga0070699_100361888 3300005518 Unclassified 1308
132 Ga0070679_100024083 3300005530 Bacteria 5963
133 Ga0070679_100039163 3300005530 Bacteria 4712
134 Ga0070679_100075853 3300005530 Unclassified 3352
135 Ga0070679_100168219 3300005530 Bacteria 2165
136 Ga0070679_100172137 3300005530 Unclassified 2138
137 Ga0070679_100459577 3300005530 Bacteria 1218
138 Ga0070684_100000721 3300005535 Bacteria 22898
139 Ga0070684_100004187 3300005535 Bacteria 10926
140 Ga0070684_100023303 3300005535 Bacteria 5175
141 Ga0070684_100037347 3300005535 Bacteria 4166
142 Ga0070684_100041130 3300005535 Bacteria 3983
143 Ga0070684_100481704 3300005535 Bacteria 1148
144 Ga0070684_101540386 3300005535 Bacteria 627
145 Ga0070684_102252561 3300005535 Bacteria 514
146 Ga0068853_100034734 3300005539 Bacteria 4281
147 Ga0068853_102199335 3300005539 Bacteria 535
148 Ga0068853_102354407 3300005539 Bacteria 516
149 Ga0070672_100251939 3300005543 Bacteria 1487
150 Ga0070672_100370834 3300005543 Bacteria 1223
151 Ga0070686_100907634 3300005544 Bacteria 717
152 Ga0070695_100222586 3300005545 Bacteria 1360
153 Ga0070696_100485766 3300005546 Bacteria 980
154 Ga0070693_100004452 3300005547 Bacteria 6626
155 Ga0070693_100029782 3300005547 Bacteria 2980
156 Ga0070665_100077581 3300005548 Bacteria 3328
157 Ga0070665_100334223 3300005548 Unclassified 1520
158 Ga0070665_101153957 3300005548 Bacteria 786
159 Ga0070704_100187177 3300005549 Bacteria 1661
160 Ga0068855_100012928 3300005563 Bacteria 10071
161 Ga0068855_100070685 3300005563 Bacteria 4060
162 Ga0068855_100080812 3300005563 Bacteria 3769
163 Ga0068855_100177663 3300005563 Bacteria 2408
164 Ga0068855_100467085 3300005563 Bacteria 1375
165 Ga0070664_100062485 3300005564 Bacteria 3175
166 Ga0070664_100191546 3300005564 Bacteria 1822
167 Ga0070664_100488272 3300005564 Bacteria 1134
168 Ga0070664_101111172 3300005564 Unclassified 745
169 Ga0070664_102306881 3300005564 Unclassified 510
170 Ga0068857_100001170 3300005577 Bacteria 20459
171 Ga0068857_100025316 3300005577 Bacteria 5225
172 Ga0068857_100057707 3300005577 Bacteria 3446
173 Ga0068857_100281438 3300005577 Bacteria 1530
174 Ga0068857_100423786 3300005577 Bacteria 1241
175 Ga0068857_101651492 3300005577 Bacteria 626
176 Ga0068856_100039848 3300005614 Bacteria 4613
177 Ga0068856_100071819 3300005614 Unclassified 3426
178 Ga0068856_100287903 3300005614 Bacteria 1660
179 Ga0068856_101863173 3300005614 Bacteria 613
180 Ga0070702_100016250 3300005615 Bacteria 3815
181 Ga0070702_100100120 3300005615 Bacteria 1776
182 Ga0070702_100190333 3300005615 Bacteria 1350
183 Ga0070702_101393924 3300005615 Bacteria 573
184 Ga0068852_100033490 3300005616 Unclassified 4267
185 Ga0068852_100259612 3300005616 Bacteria 1668
186 Ga0068852_100433884 3300005616 Unclassified 1298
187 Ga0068852_100537678 3300005616 Bacteria 1168
188 Ga0068852_101589722 3300005616 Bacteria 676
189 Ga0068852_101711642 3300005616 Bacteria 651
190 Ga0068852_102435327 3300005616 Unclassified 544
191 Ga0068852_102443178 3300005616 Bacteria 543
192 Ga0068859_100296254 3300005617 Bacteria 1711
193 Ga0068864_100012754 3300005618 Bacteria 6947
194 Ga0068866_11314208 3300005718 Bacteria 526
195 Ga0068861_100215960 3300005719 Bacteria 1618
196 Ga0068861_100296781 3300005719 Bacteria 1398
197 Ga0068861_100398226 3300005719 Bacteria 1221
198 Ga0068861_100461604 3300005719 Bacteria 1140
199 Ga0068861_100745019 3300005719 Bacteria 915
200 Ga0068870_10162064 3300005840 Bacteria 1327
201 Ga0068870_10235083 3300005840 Unclassified 1129
202 Ga0068863_100930777 3300005841 Unclassified 870
203 Ga0068863_101214227 3300005841 Bacteria 760
204 Ga0068860_100672318 3300005843 Unclassified 1044
205 Ga0068860_100702038 3300005843 Bacteria 1021
206 Ga0068862_101598155 3300005844 Bacteria 659
207 Ga0081455_10003318 3300005937 Bacteria 18593
208 Ga0081455_10046116 3300005937 Bacteria 3785
209 Ga0081455_10054960 3300005937 Bacteria 3389
210 Ga0081455_10062783 3300005937 Bacteria 3121
211 Ga0081455_10085605 3300005937 Bacteria 2570
212 Ga0081455_10182159 3300005937 Bacteria 1589
213 Ga0081455_10268805 3300005937 Bacteria 1238
214 Ga0081538_10000116 3300005981 Bacteria 80435
215 Ga0081538_10000148 3300005981 Bacteria 73051
216 Ga0081538_10000505 3300005981 Bacteria 43641
217 Ga0081538_10001447 3300005981 Bacteria 24396
218 Ga0081538_10001820 3300005981 Bacteria 21461
219 Ga0081538_10003248 3300005981 Bacteria 15449
220 Ga0081538_10009165 3300005981 Bacteria 8301
221 Ga0081538_10021860 3300005981 Bacteria 4654
222 Ga0081538_10023620 3300005981 Bacteria 4412
223 Ga0081538_10039742 3300005981 Bacteria 3011
224 Ga0081538_10042059 3300005981 Bacteria 2889
225 Ga0081538_10062030 3300005981 Unclassified 2135
226 Ga0081538_10063697 3300005981 Bacteria 2091
227 Ga0081538_10073932 3300005981 Bacteria 1859
228 Ga0081538_10369407 3300005981 Unclassified 518
229 Ga0081540_1003276 3300005983 Bacteria 12877
230 Ga0081540_1007593 3300005983 Bacteria 7703
231 Ga0081539_10000639 3300005985 Bacteria 70847
232 Ga0070717_10254571 3300006028 Bacteria 1552
233 Ga0070717_10499540 3300006028 Bacteria 1099
234 Ga0075365_10086983 3300006038 Bacteria 2124
235 Ga0075365_10412379 3300006038 Bacteria 953
236 Ga0075368_10342944 3300006042 Bacteria 649
237 Ga0075363_100435578 3300006048 Bacteria 773
238 Ga0075364_10159160 3300006051 Archaea 1524
239 Ga0075364_10253123 3300006051 Bacteria 1197
240 Ga0075432_10000924 3300006058 Bacteria 9268
241 Ga0075432_10101068 3300006058 Bacteria 1065
242 Ga0075432_10121224 3300006058 Bacteria 983
243 Ga0070715_10069363 3300006163 Bacteria 1571
244 Ga0070716_100033529 3300006173 Bacteria 2809
245 Ga0070712_101172496 3300006175 Unclassified 668
246 Ga0070712_101533997 3300006175 Bacteria 582
247 Ga0070712_101875843 3300006175 Bacteria 525
248 Ga0075367_10227435 3300006178 Bacteria 1168
249 Ga0097621_100214345 3300006237 Unclassified 1676
250 Ga0097621_100958124 3300006237 Bacteria 799
251 Ga0097621_101044043 3300006237 Unclassified 766
252 Ga0075370_10306338 3300006353 Bacteria 945
253 Ga0068871_100728734 3300006358 Bacteria 910
254 Ga0075428_100001400 3300006844 Bacteria 25647
255 Ga0075428_100005170 3300006844 Bacteria 14493
256 Ga0075428_100013379 3300006844 Bacteria 9128
257 Ga0075428_100103049 3300006844 Bacteria 3112
258 Ga0075428_100709004 3300006844 Bacteria 1072
259 Ga0075428_100960266 3300006844 Bacteria 905
260 Ga0075428_101296586 3300006844 Bacteria 766
261 Ga0075428_102086197 3300006844 Unclassified 586
262 Ga0075430_100009893 3300006846 Bacteria 8065
263 Ga0075430_100012099 3300006846 Bacteria 7347
264 Ga0075430_100731754 3300006846 Bacteria 815
265 Ga0075431_100004744 3300006847 Bacteria 13368
266 Ga0075431_100109734 3300006847 Bacteria 2848
267 Ga0075431_100183442 3300006847 Bacteria 2147
268 Ga0075431_100215094 3300006847 Bacteria 1962
269 Ga0075431_100310978 3300006847 Unclassified 1590
270 Ga0075433_10082629 3300006852 Bacteria 2833
271 Ga0075433_10085696 3300006852 Bacteria 2781
272 Ga0075433_10189581 3300006852 Unclassified 1829
273 Ga0075434_100975855 3300006871 Unclassified 861
274 Ga0075434_101618478 3300006871 Bacteria 656
275 Ga0075434_102291266 3300006871 Unclassified 543
276 Ga0075429_100014330 3300006880 Bacteria 6876
277 Ga0075429_100030367 3300006880 Bacteria 4694
278 Ga0075429_100065939 3300006880 Bacteria 3152
279 Ga0075429_100076770 3300006880 Bacteria 2910
280 Ga0075429_100436940 3300006880 Unclassified 1147
281 Ga0075429_100778855 3300006880 Bacteria 838
282 Ga0068865_100114158 3300006881 Bacteria 1997
283 Ga0068865_100320455 3300006881 Bacteria 1247
284 Ga0068865_101113835 3300006881 Bacteria 696
285 Ga0068865_101306814 3300006881 Unclassified 645
286 Ga0068865_102128460 3300006881 Bacteria 510
287 Ga0075436_100062001 3300006914 Bacteria 2584
288 Ga0097620_100296253 3300006931 Bacteria 1711
289 Ga0075435_100056047 3300007076 Bacteria 3185
290 Ga0075435_100136767 3300007076 Bacteria 2053
291 Ga0075435_100218804 3300007076 Bacteria 1617
292 Ga0075435_101027038 3300007076 Unclassified 720
293 Ga0075435_101282161 3300007076 Unclassified 641
294 Ga0105240_10011292 3300009093 Bacteria 12445
295 Ga0105240_10105580 3300009093 Bacteria 3419
296 Ga0105240_10169655 3300009093 Bacteria 2585
297 Ga0105240_10270077 3300009093 Bacteria 1958
298 Ga0105240_10500852 3300009093 Unclassified 1351
299 Ga0105240_10798408 3300009093 Bacteria 1022
300 Ga0105240_12381464 3300009093 Unclassified 548
301 Ga0111539_10004138 3300009094 Bacteria 19026
302 Ga0111539_10021844 3300009094 Bacteria 7869
303 Ga0111539_10309929 3300009094 Bacteria 1837
304 Ga0111539_10348906 3300009094 Bacteria 1722
305 Ga0111539_10395316 3300009094 Bacteria 1610
306 Ga0111539_10693269 3300009094 Bacteria 1186
307 Ga0111539_10788939 3300009094 Bacteria 1105
308 Ga0111539_11188620 3300009094 Bacteria 886
309 Ga0111539_11734596 3300009094 Unclassified 724
310 Ga0111539_12010975 3300009094 Bacteria 670
311 Ga0105245_10000886 3300009098 Bacteria 27215
312 Ga0105245_10003680 3300009098 Bacteria 13689
313 Ga0105245_10029442 3300009098 Bacteria 4851
314 Ga0105245_10096577 3300009098 Unclassified 2727
315 Ga0105245_10422763 3300009098 Unclassified 1336
316 Ga0105245_10655181 3300009098 Bacteria 1080
317 Ga0105245_11422771 3300009098 Unclassified 744
318 Ga0105245_11622039 3300009098 Bacteria 699
319 Ga0105247_11336416 3300009101 Unclassified 577
320 Ga0114129_10001306 3300009147 Bacteria 33269
321 Ga0114129_10004745 3300009147 Bacteria 19205
322 Ga0114129_10060029 3300009147 Bacteria 5317
323 Ga0114129_10117963 3300009147 Bacteria 3656
324 Ga0114129_10157782 3300009147 Bacteria 3102
325 Ga0114129_10175291 3300009147 Bacteria 2921
326 Ga0114129_10207515 3300009147 Bacteria 2650
327 Ga0114129_10806765 3300009147 Bacteria 1197
328 Ga0114129_10983327 3300009147 Bacteria 1064
329 Ga0114129_12971012 3300009147 Bacteria 558
330 Ga0114129_13303454 3300009147 Bacteria 521
331 Ga0105243_10007867 3300009148 Bacteria 8189
332 Ga0105243_10347639 3300009148 Bacteria 1360
333 Ga0105243_10684120 3300009148 Bacteria 998
334 Ga0105243_10772467 3300009148 Bacteria 944
335 Ga0105243_10808579 3300009148 Bacteria 925
336 Ga0105243_11603431 3300009148 Unclassified 677
337 Ga0105243_11817996 3300009148 Unclassified 641
338 Ga0105243_13117989 3300009148 Bacteria 502
339 Ga0105241_10517835 3300009174 Bacteria 1066
340 Ga0105241_10698857 3300009174 Unclassified 925
341 Ga0105241_11685254 3300009174 Unclassified 615
342 Ga0105242_10092001 3300009176 Bacteria 2555
343 Ga0105242_10158422 3300009176 Bacteria 1980
344 Ga0105242_10348818 3300009176 Bacteria 1366
345 Ga0105242_10395019 3300009176 Bacteria 1289
346 Ga0105242_11039884 3300009176 Bacteria 829
347 Ga0105242_11568508 3300009176 Bacteria 691
348 Ga0105242_12877103 3300009176 Bacteria 532
349 Ga0105248_10512026 3300009177 Unclassified 1353
350 Ga0105248_11714397 3300009177 Unclassified 712
351 Ga0105248_12734531 3300009177 Bacteria 563
352 Ga0105237_10029726 3300009545 Bacteria 5552
353 Ga0105238_10005537 3300009551 Bacteria 12469
354 Ga0105238_10082931 3300009551 Bacteria 3195
355 Ga0105238_11474779 3300009551 Bacteria 709
356 Ga0105249_10119056 3300009553 Bacteria 2507
357 Ga0105249_10228376 3300009553 Bacteria 1835
358 Ga0105249_10455900 3300009553 Bacteria 1318
359 Ga0105249_12115257 3300009553 Unclassified 636
360 Ga0105249_12543544 3300009553 Unclassified 584
361 Ga0105249_12981378 3300009553 Bacteria 543
362 Ga0105239_10069838 3300010375 Bacteria 3858
363 Ga0105239_10071496 3300010375 Unclassified 3812
364 Ga0105239_10652117 3300010375 Bacteria 1202
365 Ga0105239_11015929 3300010375 Bacteria 954
366 Ga0105239_11298584 3300010375 Bacteria 839
367 Ga0105246_10075384 3300011119 Bacteria 2388
368 Ga0105246_10213239 3300011119 Bacteria 1508
369 Ga0105246_11227281 3300011119 Bacteria 691
370 Ga0105246_11555414 3300011119 Bacteria 623
371 Ga0157373_10108751 3300013100 Bacteria 1949
372 Ga0157373_10467221 3300013100 Bacteria 909
373 Ga0157373_11552324 3300013100 Bacteria 506
374 Ga0157371_10133484 3300013102 Bacteria 1767
375 Ga0157370_10006231 3300013104 Bacteria 13214
376 Ga0157370_10011092 3300013104 Bacteria 9447
377 Ga0157370_10072016 3300013104 Bacteria 3261
378 Ga0157370_11767980 3300013104 Bacteria 555
379 Ga0157369_10076037 3300013105 Unclassified 3600
380 Ga0157369_10124296 3300013105 Bacteria 2736
381 Ga0157369_10220188 3300013105 Bacteria 1987
382 Ga0157374_10020848 3300013296 Bacteria 5822
383 Ga0157374_10032162 3300013296 Bacteria 4775
384 Ga0157374_10935198 3300013296 Unclassified 885
385 Ga0157374_11843171 3300013296 Bacteria 630
386 Ga0157378_10232212 3300013297 Bacteria 1758
387 Ga0163162_10123397 3300013306 Unclassified 2695
388 Ga0163162_11098518 3300013306 Unclassified 901
389 Ga0163162_11250366 3300013306 Unclassified 843
390 Ga0163162_13231238 3300013306 Unclassified 523
391 Ga0157372_10032357 3300013307 Bacteria 5734
392 Ga0157372_10354980 3300013307 Bacteria 1708
393 Ga0157372_10527035 3300013307 Bacteria 1377
394 Ga0157372_10581949 3300013307 Unclassified 1305
395 Ga0157372_10589938 3300013307 Bacteria 1295
396 Ga0157375_10008169 3300013308 Bacteria 9161
397 Ga0157375_10086746 3300013308 Bacteria 3181
398 Ga0157375_10165580 3300013308 Bacteria 2355
399 Ga0157375_10175128 3300013308 Bacteria 2294
400 Ga0157375_10849351 3300013308 Bacteria 1059
401 Ga0163163_10013246 3300014325 Bacteria 7542
402 Ga0163163_10728768 3300014325 Bacteria 1055
403 Ga0163163_10989421 3300014325 Bacteria 904
404 Ga0163163_11028904 3300014325 Bacteria 887
405 Ga0163163_11369443 3300014325 Bacteria 769
406 Ga0157380_10045621 3300014326 Bacteria 3440
407 Ga0157380_10101798 3300014326 Bacteria 2394
408 Ga0157380_11480021 3300014326 Bacteria 731
409 Ga0182008_10081683 3300014497 Bacteria 1591
410 Ga0182008_10168586 3300014497 Bacteria 1105
411 Ga0157377_10045170 3300014745 Bacteria 2460
412 Ga0157377_10165178 3300014745 Unclassified 1380
413 Ga0157377_10973849 3300014745 Bacteria 640
414 Ga0157379_10000361 3300014968 Bacteria 36481
415 Ga0157376_10064988 3300014969 Bacteria 3078
416 Ga0157376_10152620 3300014969 Bacteria 2085
417 Ga0157376_10285770 3300014969 Bacteria 1555
418 Ga0157376_10311233 3300014969 Bacteria 1494
419 Ga0157376_10443772 3300014969 Bacteria 1264
420 Ga0157376_10463480 3300014969 Bacteria 1239
421 Ga0157376_11587313 3300014969 Bacteria 688
422 Ga0157376_11758130 3300014969 Bacteria 656
423 Ga0182005_1103315 3300015265 Bacteria 800
424 Ga0197907_10128593 3300020069 Unclassified 885
425 Ga0197907_10773643 3300020069 Bacteria 585
426 Ga0206356_10183135 3300020070 Bacteria 3085
427 Ga0206356_10997765 3300020070 Bacteria 3409
428 Ga0206356_11336474 3300020070 Bacteria 3014
429 Ga0206356_11817704 3300020070 Bacteria 1779
430 Ga0206355_1017289 3300020076 Bacteria 1107
431 Ga0206354_10073080 3300020081 Bacteria 2277
432 Ga0206354_10559490 3300020081 Bacteria 2572
433 Ga0206353_10317175 3300020082 Bacteria 1232
434 Ga0206353_10581558 3300020082 Bacteria 12890
435 Ga0206353_11350363 3300020082 Bacteria 1172
436 Ga0206353_11565494 3300020082 Bacteria 800
437 Ga0206353_11806520 3300020082 Bacteria 4115
438 Ga0224712_10022161 3300022467 Bacteria 2186
439 Ga0207682_10413214 3300025893 Unclassified 638
440 Ga0207642_10098040 3300025899 Bacteria 1465
441 Ga0207688_10008356 3300025901 Bacteria 5630
442 Ga0207688_10038126 3300025901 Bacteria 2666
443 Ga0207688_10041035 3300025901 Bacteria 2573
444 Ga0207685_10066592 3300025905 Bacteria 1446
445 Ga0207699_10050165 3300025906 Bacteria 2459
446 Ga0207643_10023866 3300025908 Bacteria 3375
447 Ga0207643_10933476 3300025908 Unclassified 562
448 Ga0207643_11030105 3300025908 Bacteria 532
449 Ga0207705_10016223 3300025909 Bacteria 5342
450 Ga0207705_10056247 3300025909 Unclassified 2836
451 Ga0207705_10144660 3300025909 Unclassified 1778
452 Ga0207705_10438496 3300025909 Bacteria 1012
453 Ga0207705_10676112 3300025909 Bacteria 803
454 Ga0207684_10026539 3300025910 Bacteria 4938
455 Ga0207684_10153369 3300025910 Bacteria 1982
456 Ga0207684_10216272 3300025910 Bacteria 1653
457 Ga0207654_10336270 3300025911 Bacteria 1036
458 Ga0207654_10921708 3300025911 Unclassified 634
459 Ga0207707_10020785 3300025912 Bacteria 5733
460 Ga0207707_10076468 3300025912 Bacteria 2921
461 Ga0207707_10118432 3300025912 Unclassified 2315
462 Ga0207707_10173475 3300025912 Bacteria 1884
463 Ga0207707_10313980 3300025912 Unclassified 1354
464 Ga0207707_10421550 3300025912 Bacteria 1144
465 Ga0207707_10824724 3300025912 Bacteria 771
466 Ga0207695_10458629 3300025913 Bacteria 1158
467 Ga0207695_10504546 3300025913 Unclassified 1092
468 Ga0207695_10886840 3300025913 Bacteria 772
469 Ga0207695_10932919 3300025913 Bacteria 748
470 Ga0207695_11466669 3300025913 Unclassified 563
471 Ga0207671_10935083 3300025914 Unclassified 685
472 Ga0207693_10928761 3300025915 Unclassified 667
473 Ga0207693_11389590 3300025915 Bacteria 522
474 Ga0207660_10027421 3300025917 Bacteria 3886
475 Ga0207660_10053922 3300025917 Bacteria 2868
476 Ga0207660_10099336 3300025917 Bacteria 2172
477 Ga0207660_10155654 3300025917 Bacteria 1759
478 Ga0207660_10171518 3300025917 Bacteria 1679
479 Ga0207662_10347454 3300025918 Bacteria 995
480 Ga0207657_10002271 3300025919 Bacteria 20838
481 Ga0207657_10002341 3300025919 Bacteria 20536
482 Ga0207657_10005771 3300025919 Bacteria 12908
483 Ga0207657_10052514 3300025919 Unclassified 3537
484 Ga0207657_10070595 3300025919 Bacteria 2960
485 Ga0207657_10753786 3300025919 Unclassified 754
486 Ga0207657_10773756 3300025919 Bacteria 743
487 Ga0207649_10044264 3300025920 Bacteria 2725
488 Ga0207649_10079695 3300025920 Bacteria 2116
489 Ga0207649_10692769 3300025920 Bacteria 790
490 Ga0207649_10985842 3300025920 Unclassified 663
491 Ga0207652_10069691 3300025921 Bacteria 3053
492 Ga0207652_10111375 3300025921 Bacteria 2427
493 Ga0207652_10137647 3300025921 Bacteria 2182
494 Ga0207652_10147034 3300025921 Bacteria 2109
495 Ga0207652_10355828 3300025921 Bacteria 1321
496 Ga0207646_10011178 3300025922 Bacteria 8716
497 Ga0207646_10083727 3300025922 Unclassified 2853
498 Ga0207646_10293128 3300025922 Bacteria 1470
499 Ga0207646_10344556 3300025922 Bacteria 1346
500 Ga0207694_10035943 3300025924 Unclassified 3800
501 Ga0207694_10440572 3300025924 Bacteria 1087
502 Ga0207694_10817412 3300025924 Unclassified 787
503 Ga0207650_10180996 3300025925 Bacteria 1679
504 Ga0207650_11740919 3300025925 Bacteria 528
505 Ga0207659_10084574 3300025926 Bacteria 2355
506 Ga0207659_10099852 3300025926 Bacteria 2186
507 Ga0207659_10750438 3300025926 Bacteria 837
508 Ga0207687_10006981 3300025927 Bacteria 7440
509 Ga0207687_10013050 3300025927 Bacteria 5429
510 Ga0207687_10156910 3300025927 Bacteria 1742
511 Ga0207687_10607656 3300025927 Unclassified 922
512 Ga0207687_10839940 3300025927 Unclassified 784
513 Ga0207687_11388977 3300025927 Bacteria 604
514 Ga0207687_11512732 3300025927 Bacteria 576
515 Ga0207700_10000001 3300025928 Bacteria 1122509
516 Ga0207700_10980553 3300025928 Unclassified 756
517 Ga0207700_11428561 3300025928 Unclassified 615
518 Ga0207644_10726284 3300025931 Bacteria 829
519 Ga0207690_10024421 3300025932 Unclassified 3786
520 Ga0207690_10057275 3300025932 Bacteria 2632
521 Ga0207690_10581731 3300025932 Unclassified 913
522 Ga0207690_11850909 3300025932 Bacteria 504
523 Ga0207706_10007492 3300025933 Bacteria 10095
524 Ga0207706_10246842 3300025933 Bacteria 1560
525 Ga0207686_10185027 3300025934 Bacteria 1480
526 Ga0207686_10252929 3300025934 Unclassified 1288
527 Ga0207686_10429413 3300025934 Unclassified 1012
528 Ga0207686_11112687 3300025934 Bacteria 644
529 Ga0207709_10065462 3300025935 Bacteria 2286
530 Ga0207709_10115360 3300025935 Bacteria 1804
531 Ga0207709_10266962 3300025935 Bacteria 1258
532 Ga0207709_11010050 3300025935 Bacteria 680
533 Ga0207709_11060552 3300025935 Bacteria 664
534 Ga0207709_11222926 3300025935 Bacteria 619
535 Ga0207670_10258611 3300025936 Unclassified 1348
536 Ga0207669_10044252 3300025937 Unclassified 2614
537 Ga0207669_10513681 3300025937 Bacteria 961
538 Ga0207669_10773853 3300025937 Bacteria 794
539 Ga0207669_10977404 3300025937 Bacteria 710
540 Ga0207704_10112490 3300025938 Bacteria 1844
541 Ga0207704_10396011 3300025938 Bacteria 1088
542 Ga0207704_10950444 3300025938 Bacteria 725
543 Ga0207704_11276668 3300025938 Unclassified 627
544 Ga0207665_10004897 3300025939 Bacteria 8923
545 Ga0207665_10439138 3300025939 Bacteria 1000
546 Ga0207665_10689806 3300025939 Bacteria 802
547 Ga0207665_11142926 3300025939 Unclassified 621
548 Ga0207691_10203085 3300025940 Bacteria 1724
549 Ga0207691_10443851 3300025940 Bacteria 1104
550 Ga0207691_10893532 3300025940 Bacteria 744
551 Ga0207689_10303893 3300025942 Bacteria 1322
552 Ga0207689_10366670 3300025942 Unclassified 1198
553 Ga0207689_10824971 3300025942 Bacteria 783
554 Ga0207661_10007449 3300025944 Bacteria 7788
555 Ga0207661_10008791 3300025944 Bacteria 7226
556 Ga0207661_10051729 3300025944 Bacteria 3278
557 Ga0207661_10130319 3300025944 Bacteria 2153
558 Ga0207661_10178160 3300025944 Bacteria 1855
559 Ga0207661_10494199 3300025944 Bacteria 1118
560 Ga0207661_10514653 3300025944 Bacteria 1094
561 Ga0207661_11081058 3300025944 Bacteria 739
562 Ga0207661_12036713 3300025944 Bacteria 520
563 Ga0207679_10523627 3300025945 Unclassified 1061
564 Ga0207679_11114661 3300025945 Unclassified 724
565 Ga0207679_11244087 3300025945 Bacteria 683
566 Ga0207667_10077710 3300025949 Bacteria 3442
567 Ga0207667_10094279 3300025949 Bacteria 3090
568 Ga0207667_10506430 3300025949 Unclassified 1224
569 Ga0207651_10715573 3300025960 Bacteria 883
570 Ga0207651_10956080 3300025960 Bacteria 764
571 Ga0207712_10052342 3300025961 Bacteria 2860
572 Ga0207712_10339945 3300025961 Bacteria 1244
573 Ga0207668_10009738 3300025972 Bacteria 5770
574 Ga0207668_10188431 3300025972 Bacteria 1633
575 Ga0207668_10588814 3300025972 Bacteria 968
576 Ga0207668_10679050 3300025972 Bacteria 904
577 Ga0207640_10812919 3300025981 Bacteria 811
578 Ga0207677_10726142 3300026023 Unclassified 883
579 Ga0207677_10825521 3300026023 Bacteria 831
580 Ga0207677_11291240 3300026023 Unclassified 670
581 Ga0207703_10464866 3300026035 Archaea 1184
582 Ga0207639_10037858 3300026041 Bacteria 3586
583 Ga0207639_10313465 3300026041 Bacteria 1391
584 Ga0207678_10408754 3300026067 Bacteria 1176
585 Ga0207678_10547149 3300026067 Bacteria 1012
586 Ga0207678_11170749 3300026067 Bacteria 681
587 Ga0207708_10067909 3300026075 Bacteria 2728
588 Ga0207708_10077414 3300026075 Bacteria 2552
589 Ga0207708_11473922 3300026075 Bacteria 598
590 Ga0207708_11518936 3300026075 Bacteria 588
591 Ga0207702_10004098 3300026078 Bacteria 13072
592 Ga0207702_10065246 3300026078 Unclassified 3118
593 Ga0207702_10619801 3300026078 Bacteria 1062
594 Ga0207702_10811067 3300026078 Bacteria 925
595 Ga0207702_11078791 3300026078 Bacteria 797
596 Ga0207641_10898051 3300026088 Unclassified 880
597 Ga0207641_11841514 3300026088 Bacteria 607
598 Ga0207641_12328347 3300026088 Unclassified 535
599 Ga0207648_10029509 3300026089 Bacteria 4863
600 Ga0207648_10226366 3300026089 Bacteria 1663
601 Ga0207648_10248860 3300026089 Bacteria 1584
602 Ga0207676_10184195 3300026095 Bacteria 1831
603 Ga0207674_10001150 3300026116 Bacteria 34275
604 Ga0207674_10019690 3300026116 Bacteria 7306
605 Ga0207674_10045789 3300026116 Bacteria 4497
606 Ga0207674_10134684 3300026116 Bacteria 2433
607 Ga0207674_10277288 3300026116 Bacteria 1624
608 Ga0207674_10345643 3300026116 Bacteria 1438
609 Ga0207675_100192496 3300026118 Bacteria 1956
610 Ga0207675_100385654 3300026118 Unclassified 1378
611 Ga0207683_10010822 3300026121 Bacteria 7778
612 Ga0207683_10114313 3300026121 Bacteria 2418
613 Ga0207683_10288195 3300026121 Bacteria 1501
614 Ga0207698_10223582 3300026142 Bacteria 1703
615 Ga0207698_10436443 3300026142 Bacteria 1261
616 Ga0207698_10591646 3300026142 Bacteria 1093
617 Ga0207698_10592366 3300026142 Bacteria 1092
618 Ga0207698_11082165 3300026142 Bacteria 814
619 Ga0207698_11410675 3300026142 Bacteria 712
620 Ga0207698_12705961 3300026142 Unclassified 505
621 Ga0207428_10000536 3300027907 Bacteria 45269
622 Ga0207428_10012230 3300027907 Bacteria 7549
623 Ga0207428_10026570 3300027907 Bacteria 4831
624 Ga0207428_10044535 3300027907 Bacteria 3580
625 Ga0207428_10333954 3300027907 Bacteria 1117
626 Ga0207428_10596396 3300027907 Bacteria 796
627 Ga0207428_11190180 3300027907 Bacteria 530
628 Ga0268266_10036563 3300028379 Bacteria 4181
629 Ga0268266_10090416 3300028379 Bacteria 2683
630 Ga0268266_10944596 3300028379 Bacteria 834
631 Ga0268266_11205453 3300028379 Bacteria 732
632 Ga0268265_10910345 3300028380 Unclassified 864
633 Ga0268264_10486763 3300028381 Unclassified 1201
634 Ga0268264_10860024 3300028381 Unclassified 909
635 Ga0316178_1037630 3300030735 Unclassified 630
636 Ga0307408_101684150 3300031548 Bacteria 604
637 Ga0307408_102061275 3300031548 Bacteria 549
638 Ga0307408_102278527 3300031548 Bacteria 524
639 Ga0307408_102290394 3300031548 Unclassified 523
640 Ga0307405_10048936 3300031731 Bacteria 2610
641 Ga0307405_10102728 3300031731 Bacteria 1921
642 Ga0307405_10935387 3300031731 Bacteria 735
643 Ga0307405_11037297 3300031731 Unclassified 702
644 Ga0307405_11152827 3300031731 Unclassified 668
645 Ga0307413_10007066 3300031824 Bacteria 5179
646 Ga0307413_10254537 3300031824 Bacteria 1305
647 Ga0307410_10015876 3300031852 Bacteria 4476
648 Ga0307410_11447158 3300031852 Unclassified 604
649 Ga0307406_10095538 3300031901 Unclassified 2011
650 Ga0307406_10168082 3300031901 Bacteria 1584
651 Ga0307406_11121042 3300031901 Bacteria 680
652 Ga0307407_10003349 3300031903 Bacteria 6554
653 Ga0307407_10175804 3300031903 Unclassified 1414
654 Ga0307407_10233446 3300031903 Bacteria 1251
655 Ga0307407_10631261 3300031903 Bacteria 801
656 Ga0307407_11141684 3300031903 Bacteria 607
657 Ga0307412_10091827 3300031911 Bacteria 2126
658 Ga0307412_10093161 3300031911 Bacteria 2113
659 Ga0307412_10329700 3300031911 Bacteria 1218
660 Ga0307409_100003896 3300031995 Bacteria 8253
661 Ga0307409_100045038 3300031995 Bacteria 3328
662 Ga0307409_100115250 3300031995 Bacteria 2262
663 Ga0307409_100206755 3300031995 Unclassified 1761
664 Ga0307409_100311664 3300031995 Bacteria 1469
665 Ga0307409_100384618 3300031995 Bacteria 1335
666 Ga0307409_100517677 3300031995 Bacteria 1165
667 Ga0307409_100588855 3300031995 Bacteria 1098
668 Ga0307409_101527753 3300031995 Bacteria 695
669 Ga0307409_102839468 3300031995 Bacteria 512
670 Ga0307416_100029210 3300032002 Bacteria 4114
671 Ga0307416_100032968 3300032002 Bacteria 3921
672 Ga0307416_100153538 3300032002 Bacteria 2116
673 Ga0307416_100516232 3300032002 Bacteria 1262
674 Ga0307416_100566591 3300032002 Bacteria 1211
675 Ga0307416_100687956 3300032002 Unclassified 1111
676 Ga0307416_100985989 3300032002 Bacteria 945
677 Ga0307416_100997313 3300032002 Bacteria 940
678 Ga0307416_101166592 3300032002 Bacteria 876
679 Ga0307416_101267778 3300032002 Bacteria 843
680 Ga0307416_103312202 3300032002 Bacteria 539
681 Ga0307414_10113787 3300032004 Bacteria 2066
682 Ga0307414_10658948 3300032004 Bacteria 944
683 Ga0307414_11577395 3300032004 Bacteria 612
684 Ga0307411_10073410 3300032005 Bacteria 2327
685 Ga0307411_10166703 3300032005 Bacteria 1657
686 Ga0307411_11589718 3300032005 Unclassified 603
687 Ga0307411_12212169 3300032005 Bacteria 516
688 Ga0307415_100001530 3300032126 Bacteria 11099
689 Ga0307415_100017904 3300032126 Bacteria 4261
690 Ga0307415_100054831 3300032126 Bacteria 2724
691 Ga0307415_100699011 3300032126 Bacteria 915
692 Ga0373930_0121727 3300034816 Bacteria 636
693 Ga0373944_0293153 3300035089 Unclassified 609
694 Ga0373951_0263284 3300035091 Bacteria 521
695 Ga0373932_0187110 3300035112 Bacteria 730
696 Ga0373939_0395136 3300035114 Bacteria 572
697 Ga0373954_0428778 3300035118 Unclassified 654
698 Ga0373960_0400001 3300035121 Bacteria 530
699 Ga0373942_0335848 3300035207 Bacteria 531
700 Ga0373961_0095177 3300035241 Bacteria 957
701 Ga0373931_0053746 3300035691 Bacteria 2150
702 Ga0373931_1169192 3300035691 Unclassified 526
703 Ga0373935_1101432 3300035692 Bacteria 591
704 Ga0373947_0728286 3300035725 Unclassified 677
705 Ga0395899_0007828 3300037312 Bacteria 8236
706 Ga0395899_0008491 3300037312 Bacteria 7913
707 Ga0395899_0012697 3300037312 Bacteria 6455
708 Ga0395899_0014207 3300037312 Bacteria 6076
709 Ga0395899_0021696 3300037312 Bacteria 4870
710 Ga0395899_0033808 3300037312 Bacteria 3840
711 Ga0395899_0050107 3300037312 Bacteria 3101
712 Ga0395899_0145003 3300037312 Bacteria 1687
713 Ga0395899_0145331 3300037312 Bacteria 1684
714 Ga0395899_0166908 3300037312 Unclassified 1552
715 Ga0395899_0316534 3300037312 Unclassified 1052
716 Ga0395899_0531307 3300037312 Bacteria 759
717 Ga0395899_0540227 3300037312 Unclassified 751
718 Ga0395900_0001553 3300037418 Bacteria 27276
719 Ga0395900_0012790 3300037418 Bacteria 8578
720 Ga0395900_0021952 3300037418 Bacteria 6527
721 Ga0395900_0022614 3300037418 Bacteria 6434
722 Ga0395900_0023193 3300037418 Bacteria 6352
723 Ga0395900_0050981 3300037418 Bacteria 4263
724 Ga0395900_0052104 3300037418 Bacteria 4213
725 Ga0395900_0055656 3300037418 Bacteria 4073
726 Ga0395900_0070049 3300037418 Unclassified 3605
727 Ga0395900_0075062 3300037418 Bacteria 3475
728 Ga0395900_0115199 3300037418 Bacteria 2758
729 Ga0395900_0145035 3300037418 Bacteria 2428
730 Ga0395900_0202017 3300037418 Bacteria 2010
731 Ga0395900_0219935 3300037418 Bacteria 1915
732 Ga0395900_0289524 3300037418 Unclassified 1627
733 Ga0395900_0378820 3300037418 Bacteria 1383
734 Ga0395900_0492682 3300037418 Bacteria 1177
735 Ga0395900_0532422 3300037418 Bacteria 1121
736 Ga0395900_0589808 3300037418 Bacteria 1053
737 Ga0395900_0781683 3300037418 Bacteria 883
738 Ga0395900_0925434 3300037418 Bacteria 794
739 Ga0395900_1034123 3300037418 Bacteria 740
740 Ga0395900_1270813 3300037418 Bacteria 650
741 Ga0395900_1277452 3300037418 Bacteria 648
742 Ga0395900_1409215 3300037418 Bacteria 610
743 Ga0395900_1519988 3300037418 Bacteria 581
744 Ga0395900_1669698 3300037418 Unclassified 548
745 Ga0395900_1870118 3300037418 Unclassified 511
746 Ga0395898_0002858 3300037466 Bacteria 19705
747 Ga0395898_0021795 3300037466 Bacteria 6492
748 Ga0395898_0025590 3300037466 Bacteria 5944
749 Ga0395898_0027149 3300037466 Bacteria 5750
750 Ga0395898_0037487 3300037466 Bacteria 4808
751 Ga0395898_0041969 3300037466 Bacteria 4516
752 Ga0395898_0093507 3300037466 Bacteria 2889
753 Ga0395898_0096225 3300037466 Bacteria 2844
754 Ga0395898_0234996 3300037466 Bacteria 1748
755 Ga0395898_0381341 3300037466 Bacteria 1344
756 Ga0395898_0508228 3300037466 Bacteria 1146
757 Ga0395898_0648023 3300037466 Unclassified 999
758 Ga0395898_0766874 3300037466 Bacteria 905
759 Ga0395898_0974239 3300037466 Unclassified 784
760 Ga0395898_1090281 3300037466 Bacteria 732
761 Ga0395898_1316919 3300037466 Bacteria 651
762 Ga0395898_1730324 3300037466 Bacteria 547
763 Ga0395905_0002826 3300037471 Bacteria 19022
764 Ga0395905_0005069 3300037471 Bacteria 13555
765 Ga0395905_0006393 3300037471 Bacteria 11872
766 Ga0395905_0012073 3300037471 Bacteria 8324
767 Ga0395905_0018558 3300037471 Bacteria 6600
768 Ga0395905_0029705 3300037471 Bacteria 5151
769 Ga0395905_0033462 3300037471 Bacteria 4828
770 Ga0395905_0064347 3300037471 Bacteria 3432
771 Ga0395905_0101391 3300037471 Bacteria 2702
772 Ga0395905_0107338 3300037471 Bacteria 2621
773 Ga0395905_0113689 3300037471 Bacteria 2543
774 Ga0395905_0114990 3300037471 Unclassified 2528
775 Ga0395905_0147772 3300037471 Bacteria 2211
776 Ga0395905_0150369 3300037471 Unclassified 2190
777 Ga0395905_0159763 3300037471 Bacteria 2118
778 Ga0395905_0188991 3300037471 Bacteria 1932
779 Ga0395905_0698388 3300037471 Unclassified 917
780 Ga0395905_0799838 3300037471 Bacteria 846
781 Ga0395905_0807432 3300037471 Unclassified 841
782 Ga0395905_1176322 3300037471 Bacteria 670
783 Ga0395905_1270012 3300037471 Bacteria 640
784 Ga0395905_1444153 3300037471 Unclassified 592
785 Ga0395905_1583378 3300037471 Bacteria 560
786 Ga0395901_0003414 3300038443 Bacteria 16004
787 Ga0395901_0006478 3300038443 Bacteria 11853
788 Ga0395901_0007417 3300038443 Bacteria 11065
789 Ga0395901_0009653 3300038443 Bacteria 9789
790 Ga0395901_0010617 3300038443 Bacteria 9331
791 Ga0395901_0022705 3300038443 Bacteria 6433
792 Ga0395901_0033632 3300038443 Bacteria 5293
793 Ga0395901_0045082 3300038443 Bacteria 4575
794 Ga0395901_0066857 3300038443 Bacteria 3743
795 Ga0395901_0078559 3300038443 Bacteria 3445
796 Ga0395901_0135207 3300038443 Bacteria 2591
797 Ga0395901_0173151 3300038443 Bacteria 2264
798 Ga0395901_0237332 3300038443 Unclassified 1902
799 Ga0395901_0321267 3300038443 Unclassified 1601
800 Ga0395901_0344220 3300038443 Bacteria 1540
801 Ga0395901_0367390 3300038443 Bacteria 1482
802 Ga0395901_0382551 3300038443 Bacteria 1448
803 Ga0395901_0405310 3300038443 Unclassified 1400
804 Ga0395901_0434487 3300038443 Bacteria 1345
805 Ga0395901_0451648 3300038443 Bacteria 1314
806 Ga0395901_0593840 3300038443 Bacteria 1117
807 Ga0395901_0603207 3300038443 Bacteria 1107
808 Ga0395901_0611251 3300038443 Bacteria 1098
809 Ga0395901_0674757 3300038443 Unclassified 1034
810 Ga0395901_0821798 3300038443 Unclassified 917
811 Ga0395901_0929463 3300038443 Bacteria 850
812 Ga0395901_0963153 3300038443 Unclassified 831
813 Ga0395901_0968798 3300038443 Bacteria 828
814 Ga0395901_0996210 3300038443 Unclassified 814
815 Ga0395901_1336957 3300038443 Bacteria 677
816 Ga0395901_1570188 3300038443 Bacteria 612
817 Ga0395901_1870151 3300038443 Bacteria 548
818 Ga0439436_0218924 3300041404 Unclassified 547
819 Ga0439438_130960 3300041405 Bacteria 601
820 Ga0439439_0006255 3300041406 Unclassified 2748
821 Ga0439453_0002223 3300041408 Bacteria 2645
822 Ga0439453_0005720 3300041408 Bacteria 1905
823 Ga0439461_0031942 3300041410 Unclassified 1102
824 Ga0439466_0088650 3300041411 Unclassified 971
825 Ga0451800_0309535 3300041459 Unclassified 606
826 Ga0451853_2179209 3300041512 Unclassified 677
827 Ga0439431_0111550 3300041997 Bacteria 758
828 Ga0439431_0138589 3300041997 Bacteria 686
829 Ga0439433_0023140 3300041999 Unclassified 1397
830 Ga0439437_015360 3300042000 Bacteria 899
831 Ga0439441_017373 3300042001 Bacteria 1291
832 Ga0439442_006866 3300042002 Bacteria 2285
833 Ga0439442_023510 3300042002 Bacteria 1281
834 Ga0439445_0178903 3300042004 Unclassified 623
835 Ga0439448_0003027 3300042005 Bacteria 4618
836 Ga0439448_0061733 3300042005 Unclassified 1239
837 Ga0439449_0058128 3300042007 Unclassified 1428
838 Ga0439450_049964 3300042008 Bacteria 991
839 Ga0439451_016636 3300042009 Bacteria 1481
840 Ga0439451_024833 3300042009 Bacteria 1207
841 Ga0439452_088132 3300042010 Bacteria 672
842 Ga0439454_081731 3300042011 Bacteria 586
843 Ga0439455_0217342 3300042012 Bacteria 555
844 Ga0439455_0240557 3300042012 Unclassified 529
845 Ga0439462_0004580 3300042015 Bacteria 3384
846 Ga0439463_120763 3300042016 Bacteria 677
847 Ga0439463_175103 3300042016 Bacteria 557
848 Ga0450914_021871 3300042118 Bacteria 718
849 Ga0450920_089665 3300042122 Bacteria 634
850 Ga0450923_173904 3300042125 Unclassified 528
851 Ga0450890_023110 3300042127 Bacteria 853
852 Ga0450900_011248 3300042136 Bacteria 1160
853 Ga0450902_029791 3300042137 Bacteria 917
854 Ga0450905_015382 3300042142 Bacteria 1097
855 Ga0450907_005941 3300042146 Bacteria 2049
856 Ga0450910_036354 3300042147 Bacteria 787
857 Ga0450910_056967 3300042147 Bacteria 654
858 Ga0439446_0021133 3300042156 Bacteria 1838
859 Ga0439458_0021478 3300042157 Bacteria 1495
860 Ga0439458_0205994 3300042157 Bacteria 539
861 Ga0450908_006627 3300042184 Bacteria 2194
862 Ga0439434_0026709 3300042435 Unclassified 1744
863 Ga0439434_0038317 3300042435 Bacteria 1469
864 Ga0439435_0034455 3300042436 Bacteria 1392
865 Ga0439435_0295357 3300042436 Bacteria 554
866 Ga0439464_0099723 3300042439 Bacteria 882
867 Ga0450918_009019 3300042531 Bacteria 1750
868 Ga0439440_0231308 3300042993 Unclassified 557
869 Ga0466972_0168827 3300044658 Unclassified 1027
870 Ga0466965_0339077 3300044683 Bacteria 821
871 Ga0466966_0029678 3300044684 Bacteria 3556
872 Ga0466961_0017470 3300044693 Bacteria 4609
873 Ga0466961_0064374 3300044693 Unclassified 2330
874 Ga0466961_0488804 3300044693 Bacteria 744
875 Ga0466963_0013473 3300044694 Bacteria 5021
876 Ga0466963_0015435 3300044694 Bacteria 4730
877 Ga0466963_0063986 3300044694 Bacteria 2463
878 Ga0466963_0079946 3300044694 Bacteria 2212
879 Ga0466963_0225724 3300044694 Bacteria 1312
880 Ga0466963_0589795 3300044694 Bacteria 785
881 Ga0466963_0856809 3300044694 Bacteria 641
882 Ga0466963_1196040 3300044694 Bacteria 534
883 Ga0466964_0028639 3300044706 Bacteria 2196
884 Ga0466964_0188501 3300044706 Bacteria 982
885 Ga0466964_0269470 3300044706 Bacteria 847
886 Ga0466964_0327517 3300044706 Bacteria 780
887 Ga0466971_0000831 3300044719 Bacteria 12521
888 Ga0466968_0032855 3300044735 Unclassified 2160
889 Ga0466968_0485567 3300044735 Unclassified 614
890 Ga0466968_0505392 3300044735 Bacteria 603
891 Ga0466970_0177592 3300044765 Unclassified 1181
892 Ga0466957_0001330 3300044842 Bacteria 12901
893 Ga0466960_0101107 3300044901 Bacteria 1485
894 Ga0466960_0268311 3300044901 Bacteria 953
895 Ga0466960_0470536 3300044901 Bacteria 733
896 Ga0466960_0537309 3300044901 Bacteria 688
897 Ga0466959_0015047 3300045049 Bacteria 5635
898 Ga0451576_0510263 3300045051 Bacteria 1263
899 Ga0451576_1146877 3300045051 Bacteria 813
900 Ga0466958_0008659 3300045836 Bacteria 5650
901 Ga0466958_0011986 3300045836 Bacteria 4898
902 Ga0466967_0011587 3300045976 Bacteria 6692
903 Ga0466967_0038525 3300045976 Bacteria 4100
904 Ga0466967_0074894 3300045976 Bacteria 3042
905 Ga0466967_0100598 3300045976 Bacteria 2641
906 Ga0466967_0116897 3300045976 Bacteria 2457
907 Ga0466967_0152767 3300045976 Bacteria 2159
908 Ga0466967_0168181 3300045976 Bacteria 2061
909 Ga0466967_0211307 3300045976 Bacteria 1840
910 Ga0466967_0628889 3300045976 Bacteria 1060
911 Ga0466967_0641626 3300045976 Bacteria 1050
912 Ga0466967_0660269 3300045976 Bacteria 1034
913 Ga0466967_0865924 3300045976 Bacteria 898
914 Ga0466967_0899719 3300045976 Unclassified 880
915 Ga0466967_1025621 3300045976 Bacteria 822
916 Ga0466967_1038663 3300045976 Bacteria 816
917 Ga0466967_2491659 3300045976 Bacteria 512
918 Ga0495627_070290 3300046453 Bacteria 1024
919 Ga0495603_0144422 3300046455 Unclassified 1384
920 Ga0495590_0374008 3300046457 Bacteria 544
921 Ga0495629_0428947 3300046459 Bacteria 897
922 Ga0495582_0532604 3300046473 Bacteria 679
923 Ga0495582_0557761 3300046473 Bacteria 663
924 Ga0495605_0310537 3300046474 Unclassified 666
925 Ga0495584_0520786 3300046491 Bacteria 606
926 Ga0495596_0081125 3300046500 Bacteria 1259
927 Ga0495596_0451081 3300046500 Unclassified 502
928 Ga0495607_0497972 3300046501 Bacteria 541
929 Ga0495620_0065799 3300046515 Bacteria 1495
930 Ga0495628_0100958 3300046516 Unclassified 2227
931 Ga0495630_0052439 3300046517 Bacteria 3054
932 Ga0495630_0226607 3300046517 Bacteria 1427
933 Ga0495630_0342463 3300046517 Bacteria 1144
934 Ga0495663_0144823 3300046525 Bacteria 808
935 Ga0495640_0229753 3300046533 Bacteria 1167
936 Ga0495587_0089926 3300046536 Bacteria 1774
937 Ga0495621_0027072 3300046539 Bacteria 1939
938 Ga0495667_0173584 3300046559 Bacteria 1385
939 Ga0495656_0254606 3300046615 Bacteria 888
940 Ga0495656_0419928 3300046615 Bacteria 702
941 Ga0495668_0188362 3300046616 Bacteria 1130
942 Ga0495625_0280710 3300046660 Bacteria 1072
943 Ga0495635_0667308 3300046663 Bacteria 676
944 Ga0495657_0164444 3300046675 Bacteria 1371
945 Ga0495623_0283267 3300046679 Bacteria 921
946 Ga0495647_0615142 3300046681 Bacteria 510
947 Ga0495613_0285627 3300046689 Bacteria 1145
948 Ga0495613_0794556 3300046689 Bacteria 618
949 Ga0495600_0115691 3300046809 Bacteria 1746
950 Ga0495581_0474673 3300047315 Bacteria 728
951 Ga0495674_0418827 3300047319 Bacteria 1079
952 Ga0495676_0205592 3300047321 Unclassified 1366
953 Ga0495676_0760623 3300047321 Unclassified 625
954 Ga0495680_0368245 3300047322 Bacteria 997
955 Ga0495680_0497478 3300047322 Bacteria 828
956 Ga0495675_0212780 3300047444 Bacteria 1173
957 Ga0495679_211766 3300047446 Unclassified 508
958 Ga0495684_0470105 3300047471 Bacteria 870
959 Ga0495614_0583253 3300048089 Bacteria 536
960 Ga0496100_0058352 3300048903 Bacteria 2532
961 Ga0496100_0125907 3300048903 Bacteria 1798
962 Ga0496100_1102817 3300048903 Unclassified 625
963 Ga0496100_1376458 3300048903 Bacteria 557
964 Ga0496101_0063660 3300048904 Bacteria 2685
965 Ga0496101_0081843 3300048904 Bacteria 2389
966 Ga0496101_0091651 3300048904 Bacteria 2262
967 Ga0496101_0197564 3300048904 Bacteria 1554
968 Ga0496101_0331030 3300048904 Bacteria 1195
969 Ga0496102_0022571 3300048905 Bacteria 5577
970 Ga0496102_0023009 3300048905 Bacteria 5529
971 Ga0496102_0031090 3300048905 Bacteria 4785
972 Ga0496102_0252706 3300048905 Unclassified 1662
973 Ga0496102_0323854 3300048905 Bacteria 1452
974 Ga0496103_0007091 3300048906 Bacteria 6691
975 Ga0496103_0069723 3300048906 Bacteria 2198
976 Ga0496103_0712851 3300048906 Bacteria 636
977 Ga0496104_0012670 3300048907 Bacteria 7593
978 Ga0496104_0233141 3300048907 Bacteria 1753
979 Ga0496104_0324386 3300048907 Bacteria 1453
980 Ga0496104_1174299 3300048907 Bacteria 671
981 Ga0496105_0996113 3300048908 Bacteria 627
982 Ga0496106_0020914 3300048909 Bacteria 4856
983 Ga0496106_0118474 3300048909 Bacteria 2067
984 Ga0496106_0216819 3300048909 Bacteria 1525
985 Ga0496106_1205921 3300048909 Bacteria 590
986 Ga0496107_0077631 3300048910 Bacteria 2419
987 Ga0496107_0159994 3300048910 Bacteria 1668
988 Ga0496107_0214404 3300048910 Bacteria 1432
989 Ga0496108_0263078 3300048911 Bacteria 1501
990 Ga0496108_0379032 3300048911 Bacteria 1235
991 Ga0496108_0503910 3300048911 Bacteria 1057
992 Ga0496109_0103463 3300048912 Bacteria 2643
993 Ga0496109_0215223 3300048912 Bacteria 1807
994 Ga0496109_0244829 3300048912 Bacteria 1688
995 Ga0496109_1722827 3300048912 Bacteria 560
996 Ga0496110_0009650 3300048913 Bacteria 7815
997 Ga0496110_0011731 3300048913 Bacteria 7190
998 Ga0496110_0189259 3300048913 Bacteria 1869
999 Ga0496110_0208339 3300048913 Bacteria 1777
1000 Ga0496110_0230674 3300048913 Bacteria 1684
1001 Ga0496110_0271396 3300048913 Bacteria 1544
1002 Ga0496110_0410081 3300048913 Bacteria 1235
1003 Ga0496110_0555096 3300048913 Bacteria 1044
1004 Ga0496110_0767124 3300048913 Bacteria 868
1005 Ga0496111_0045231 3300048914 Bacteria 3167
1006 Ga0496111_0049657 3300048914 Bacteria 3025
1007 Ga0496111_0059509 3300048914 Bacteria 2768
1008 Ga0496111_0146490 3300048914 Bacteria 1751
1009 Ga0496111_0169093 3300048914 Bacteria 1624
1010 Ga0496111_0199124 3300048914 Bacteria 1489
1011 Ga0496111_0742926 3300048914 Bacteria 712
1012 Ga0496111_0822427 3300048914 Unclassified 672
1013 Ga0496111_1100938 3300048914 Unclassified 566
1014 Ga0496112_0003611 3300048915 Bacteria 12880
1015 Ga0496112_0047768 3300048915 Bacteria 4199
1016 Ga0496112_0094601 3300048915 Bacteria 2958
1017 Ga0496112_0110992 3300048915 Bacteria 2712
1018 Ga0496112_0146267 3300048915 Unclassified 2332
1019 Ga0496112_1476198 3300048915 Bacteria 594
1020 Ga0496113_0265442 3300048916 Bacteria 1372
1021 Ga0496113_1123001 3300048916 Bacteria 616
1022 Ga0496114_0000442 3300048917 Bacteria 30535
1023 Ga0496114_0066590 3300048917 Bacteria 3020
1024 Ga0496114_0142410 3300048917 Bacteria 2077
1025 Ga0496114_0765749 3300048917 Unclassified 843
1026 Ga0496114_1526629 3300048917 Unclassified 556
1027 Ga0496114_1665284 3300048917 Archaea 526
1028 Ga0496115_1209130 3300048918 Bacteria 567
1029 Ga0501031_0000143 3300049568 Bacteria 40199
1030 Ga0501031_0010987 3300049568 Bacteria 5900
1031 Ga0501031_0093994 3300049568 Bacteria 1956
1032 Ga0501031_0211263 3300049568 Bacteria 1264
1033 Ga0501031_0649800 3300049568 Bacteria 678
1034 Ga0501031_0734714 3300049568 Bacteria 633
1035 Ga0501032_0009219 3300049569 Bacteria 7156
1036 Ga0501032_0545993 3300049569 Bacteria 739
1037 Ga0501032_0585018 3300049569 Bacteria 711
1038 Ga0501032_0691671 3300049569 Bacteria 646
1039 Ga0501032_0834809 3300049569 Unclassified 581
1040 Ga0501033_0002376 3300049570 Bacteria 16028
1041 Ga0501033_0022460 3300049570 Bacteria 4759
1042 Ga0501033_0066278 3300049570 Unclassified 2655
1043 Ga0501033_0494914 3300049570 Bacteria 846
1044 Ga0501033_1154416 3300049570 Bacteria 514
1045 Ga0501034_0014167 3300049571 Bacteria 8218
1046 Ga0501034_0049959 3300049571 Bacteria 4219
1047 Ga0501034_1679246 3300049571 Bacteria 508
1048 Ga0501036_0000767 3300049572 Bacteria 23813
1049 Ga0501036_0007871 3300049572 Bacteria 8717
1050 Ga0501036_0040462 3300049572 Bacteria 3942
1051 Ga0501036_0161358 3300049572 Bacteria 1890
1052 Ga0501036_0268483 3300049572 Bacteria 1429
1053 Ga0501036_0304389 3300049572 Unclassified 1333
1054 Ga0501036_0789500 3300049572 Bacteria 782
1055 Ga0501036_0826123 3300049572 Unclassified 762
1056 Ga0501036_0919297 3300049572 Bacteria 718
1057 Ga0501036_1235105 3300049572 Bacteria 608
1058 Ga0501037_0000558 3300049573 Bacteria 29625
1059 Ga0501037_0249679 3300049573 Bacteria 1242
1060 Ga0501037_0509819 3300049573 Bacteria 815
1061 Ga0501037_1022604 3300049573 Bacteria 537
1062 Ga0501038_0001974 3300049574 Bacteria 18950
1063 Ga0501038_0258729 3300049574 Unclassified 1376
1064 Ga0501038_0349151 3300049574 Bacteria 1152
1065 Ga0501038_0425750 3300049574 Bacteria 1023
1066 Ga0501038_0889508 3300049574 Bacteria 658
1067 Ga0501038_0890600 3300049574 Bacteria 657
1068 Ga0501038_1003975 3300049574 Bacteria 613
1069 Ga0501038_1014378 3300049574 Bacteria 609
1070 Ga0501039_0003385 3300049575 Bacteria 11921
1071 Ga0501039_0011636 3300049575 Bacteria 6700
1072 Ga0501039_0013440 3300049575 Bacteria 6261
1073 Ga0501039_0016294 3300049575 Bacteria 5694
1074 Ga0501039_0109933 3300049575 Bacteria 2155
1075 Ga0501039_0161148 3300049575 Bacteria 1763
1076 Ga0501039_0361031 3300049575 Bacteria 1141
1077 Ga0501039_0810018 3300049575 Bacteria 730
1078 Ga0501039_1569589 3300049575 Bacteria 505
1079 Ga0501040_0001835 3300049576 Bacteria 13646
1080 Ga0501040_0029984 3300049576 Bacteria 3671
1081 Ga0501040_0035697 3300049576 Bacteria 3372
1082 Ga0501040_0079269 3300049576 Bacteria 2273
1083 Ga0501040_0335680 3300049576 Bacteria 1082
1084 Ga0501040_0422684 3300049576 Bacteria 958
1085 Ga0501040_0601621 3300049576 Bacteria 794
1086 Ga0501040_0929063 3300049576 Bacteria 630
1087 Ga0501040_1144958 3300049576 Bacteria 564
1088 Ga0501041_0011657 3300049577 Bacteria 5201
1089 Ga0501041_0020444 3300049577 Bacteria 3958
1090 Ga0501041_0025444 3300049577 Bacteria 3556
1091 Ga0501041_0154948 3300049577 Bacteria 1431
1092 Ga0501041_0193988 3300049577 Bacteria 1272
1093 Ga0501041_0271990 3300049577 Bacteria 1066
1094 Ga0501041_0484353 3300049577 Bacteria 786
1095 Ga0501041_0743683 3300049577 Bacteria 628
1096 Ga0501041_0751927 3300049577 Bacteria 624
1097 Ga0501041_0854362 3300049577 Bacteria 584
1098 Ga0501041_0870367 3300049577 Bacteria 578
1099 Ga0501041_0901216 3300049577 Bacteria 568
1100 Ga0501042_0000785 3300049578 Bacteria 17383
1101 Ga0501042_0007018 3300049578 Bacteria 7354
1102 Ga0501042_0018547 3300049578 Bacteria 4819
1103 Ga0501042_0020334 3300049578 Bacteria 4619
1104 Ga0501042_0024913 3300049578 Bacteria 4200
1105 Ga0501042_0114240 3300049578 Bacteria 1944
1106 Ga0501042_0240505 3300049578 Bacteria 1306
1107 Ga0501042_0365805 3300049578 Bacteria 1044
1108 Ga0501042_0696913 3300049578 Unclassified 738
1109 Ga0501042_0701218 3300049578 Unclassified 736
1110 Ga0501042_0887674 3300049578 Bacteria 649
1111 Ga0501042_1420390 3300049578 Bacteria 506
1112 Ga0501042_1456793 3300049578 Bacteria 500
1113 Ga0501043_0003153 3300049579 Bacteria 13646
1114 Ga0501043_0021083 3300049579 Bacteria 5108
1115 Ga0501043_0166122 3300049579 Bacteria 1723
1116 Ga0501043_0260959 3300049579 Unclassified 1332
1117 Ga0501043_0700312 3300049579 Bacteria 740
1118 Ga0501043_1118921 3300049579 Bacteria 556
1119 Ga0501046_0004710 3300049580 Bacteria 12302
1120 Ga0501046_0024951 3300049580 Bacteria 4898
1121 Ga0501046_0036430 3300049580 Bacteria 3958
1122 Ga0501046_0040701 3300049580 Bacteria 3712
1123 Ga0501046_0400863 3300049580 Bacteria 991
1124 Ga0501047_0004536 3300049581 Bacteria 13058
1125 Ga0501047_0009861 3300049581 Bacteria 9026
1126 Ga0501047_0017625 3300049581 Bacteria 6843
1127 Ga0501047_0324560 3300049581 Bacteria 1379
1128 Ga0501048_0010994 3300049582 Bacteria 6752
1129 Ga0501048_0012448 3300049582 Bacteria 6328
1130 Ga0501048_0083807 3300049582 Bacteria 2248
1131 Ga0501048_0085103 3300049582 Bacteria 2230
1132 Ga0501048_0149585 3300049582 Bacteria 1651
1133 Ga0501048_0469530 3300049582 Bacteria 901
1134 Ga0501048_0779465 3300049582 Bacteria 687
1135 Ga0501048_0819044 3300049582 Bacteria 669
1136 Ga0501048_0972170 3300049582 Bacteria 611
1137 Ga0501048_1203066 3300049582 Bacteria 545
1138 Ga0501048_1363443 3300049582 Bacteria 510
1139 Ga0501067_0019282 3300049583 Bacteria 3774
1140 Ga0501067_0124766 3300049583 Bacteria 1433
1141 Ga0501067_0226862 3300049583 Bacteria 1040
1142 Ga0501068_0001101 3300049584 Bacteria 14316
1143 Ga0501068_0040130 3300049584 Bacteria 2809
1144 Ga0501068_0052025 3300049584 Bacteria 2478
1145 Ga0501068_0067805 3300049584 Bacteria 2175
1146 Ga0501068_0174555 3300049584 Bacteria 1357
1147 Ga0501068_0508255 3300049584 Bacteria 782
1148 Ga0501068_0774028 3300049584 Bacteria 629
1149 Ga0501068_0972736 3300049584 Bacteria 560
1150 Ga0501068_1031316 3300049584 Bacteria 543
1151 Ga0501069_0000164 3300049585 Bacteria 29328
1152 Ga0501069_0023440 3300049585 Bacteria 3365
1153 Ga0501069_0215970 3300049585 Unclassified 1114
1154 Ga0501069_0832628 3300049585 Bacteria 560
1155 Ga0501069_0960562 3300049585 Bacteria 521
1156 Ga0501070_0002617 3300049586 Bacteria 15721
1157 Ga0501070_0042381 3300049586 Bacteria 3791
1158 Ga0501070_0056977 3300049586 Bacteria 3239
1159 Ga0501070_0214798 3300049586 Bacteria 1578
1160 Ga0501070_0332187 3300049586 Bacteria 1235
1161 Ga0501070_0405193 3300049586 Bacteria 1103
1162 Ga0501071_0016948 3300049587 Bacteria 5014
1163 Ga0501071_0017070 3300049587 Bacteria 5000
1164 Ga0501071_0096348 3300049587 Bacteria 2178
1165 Ga0501071_0100489 3300049587 Bacteria 2132
1166 Ga0501071_0138296 3300049587 Bacteria 1813
1167 Ga0501071_0140288 3300049587 Bacteria 1799
1168 Ga0501071_0166109 3300049587 Bacteria 1651
1169 Ga0501071_0278305 3300049587 Bacteria 1266
1170 Ga0501071_0440523 3300049587 Bacteria 997
1171 Ga0501071_0602744 3300049587 Bacteria 844
1172 Ga0501071_0862869 3300049587 Bacteria 698
1173 Ga0501071_1086846 3300049587 Unclassified 618
1174 Ga0501071_1332673 3300049587 Unclassified 554
1175 Ga0501072_0001470 3300049588 Bacteria 17651
1176 Ga0501072_0009619 3300049588 Bacteria 7352
1177 Ga0501072_0019421 3300049588 Bacteria 5252
1178 Ga0501072_0023181 3300049588 Bacteria 4820
1179 Ga0501072_0084089 3300049588 Bacteria 2523
1180 Ga0501072_0117400 3300049588 Bacteria 2119
1181 Ga0501072_0175855 3300049588 Bacteria 1708
1182 Ga0501072_0293216 3300049588 Bacteria 1293
1183 Ga0501072_0681809 3300049588 Unclassified 808
1184 Ga0501073_0009164 3300049589 Bacteria 7301
1185 Ga0501073_0414304 3300049589 Bacteria 931
1186 Ga0501073_0604090 3300049589 Bacteria 757
1187 Ga0501074_0000321 3300049590 Bacteria 27781
1188 Ga0501074_0004627 3300049590 Bacteria 9850
1189 Ga0501074_0017499 3300049590 Bacteria 5202
1190 Ga0501074_0081844 3300049590 Bacteria 2315
1191 Ga0501074_0102912 3300049590 Bacteria 2044
1192 Ga0501074_0286052 3300049590 Bacteria 1172
1193 Ga0501074_0615671 3300049590 Bacteria 768
1194 Ga0501074_0729675 3300049590 Bacteria 699
1195 Ga0501074_0751243 3300049590 Bacteria 688
1196 Ga0501074_1217296 3300049590 Bacteria 528
1197 Ga0501075_0008772 3300049591 Bacteria 7045
1198 Ga0501075_0018372 3300049591 Bacteria 5061
1199 Ga0501075_0026422 3300049591 Bacteria 4273
1200 Ga0501075_0048433 3300049591 Bacteria 3194
1201 Ga0501075_0083694 3300049591 Bacteria 2416
1202 Ga0501075_0086806 3300049591 Bacteria 2370
1203 Ga0501075_0097392 3300049591 Bacteria 2232
1204 Ga0501075_0168701 3300049591 Bacteria 1670
1205 Ga0501075_0214544 3300049591 Bacteria 1468
1206 Ga0501075_0364206 3300049591 Bacteria 1102
1207 Ga0501075_0524572 3300049591 Bacteria 904
1208 Ga0501075_1135085 3300049591 Unclassified 593
1209 Ga0501075_1144968 3300049591 Unclassified 590
1210 Ga0501076_0001569 3300049592 Bacteria 15334
1211 Ga0501076_0006475 3300049592 Bacteria 8502
1212 Ga0501076_0024647 3300049592 Bacteria 4652
1213 Ga0501076_0083688 3300049592 Bacteria 2562
1214 Ga0501076_0139579 3300049592 Bacteria 1968
1215 Ga0501076_0241625 3300049592 Unclassified 1477
1216 Ga0501076_0537836 3300049592 Bacteria 963
1217 Ga0501076_1703826 3300049592 Unclassified 517
1218 Ga0501076_1784323 3300049592 Bacteria 504
1219 Ga0501077_0003418 3300049593 Bacteria 9545
1220 Ga0501077_0013074 3300049593 Bacteria 5201
1221 Ga0501077_0044271 3300049593 Bacteria 2827
1222 Ga0501077_0047941 3300049593 Bacteria 2714
1223 Ga0501077_0082928 3300049593 Bacteria 2031
1224 Ga0501077_0139190 3300049593 Bacteria 1539
1225 Ga0501077_0331697 3300049593 Bacteria 970
1226 Ga0501077_0855705 3300049593 Bacteria 585
1227 Ga0501079_0005337 3300049741 Bacteria 9566
1228 Ga0501079_0007496 3300049741 Bacteria 8252
1229 Ga0501079_0011148 3300049741 Bacteria 6855
1230 Ga0501079_0046731 3300049741 Bacteria 3340
1231 Ga0501079_0076880 3300049741 Bacteria 2582
1232 Ga0501079_0130774 3300049741 Bacteria 1953
1233 Ga0501079_0277555 3300049741 Bacteria 1310
1234 Ga0501079_0293013 3300049741 Bacteria 1273
1235 Ga0501079_0443844 3300049741 Bacteria 1019
1236 Ga0501079_0550364 3300049741 Bacteria 907
1237 Ga0501079_0562517 3300049741 Bacteria 897
1238 Ga0501079_1095758 3300049741 Bacteria 627
1239 Ga0501080_0003261 3300049742 Bacteria 14318
1240 Ga0501080_0027125 3300049742 Bacteria 5326
1241 Ga0501080_0039151 3300049742 Bacteria 4424
1242 Ga0501080_0071955 3300049742 Bacteria 3217
1243 Ga0501080_0233236 3300049742 Bacteria 1682
1244 Ga0501080_0425533 3300049742 Bacteria 1192
1245 Ga0501080_0513821 3300049742 Bacteria 1069
1246 Ga0501080_0679836 3300049742 Bacteria 909
1247 Ga0501081_0000852 3300049743 Bacteria 18010
1248 Ga0501081_0013748 3300049743 Bacteria 5324
1249 Ga0501081_0020952 3300049743 Bacteria 4362
1250 Ga0501081_0088976 3300049743 Bacteria 2169
1251 Ga0501081_0205441 3300049743 Bacteria 1429
1252 Ga0501081_0312597 3300049743 Bacteria 1154
1253 Ga0501081_0536495 3300049743 Bacteria 873
1254 Ga0501081_0571988 3300049743 Unclassified 845
1255 Ga0501083_0000179 3300049744 Bacteria 40905
1256 Ga0501083_0063508 3300049744 Bacteria 2463
1257 Ga0501083_0105067 3300049744 Bacteria 1860
1258 Ga0501083_0142078 3300049744 Unclassified 1572
1259 Ga0501083_0354626 3300049744 Bacteria 954
1260 Ga0501083_0380088 3300049744 Bacteria 918
1261 Ga0501035_0000493 3300049822 Bacteria 44347
1262 Ga0501035_0046718 3300049822 Bacteria 3894
1263 Ga0501035_0135555 3300049822 Bacteria 2144
1264 Ga0501035_0320886 3300049822 Bacteria 1301
1265 Ga0501035_0609809 3300049822 Bacteria 889
1266 Ga0501035_0951722 3300049822 Bacteria 677
1267 Ga0501035_1136146 3300049822 Bacteria 609
1268 Ga0501044_0005307 3300049823 Bacteria 14331
1269 Ga0501044_0028152 3300049823 Bacteria 5931
1270 Ga0501044_0921305 3300049823 Bacteria 748
1271 Ga0501045_0003079 3300049824 Bacteria 11400
1272 Ga0501045_0008250 3300049824 Bacteria 7252
1273 Ga0501045_0019287 3300049824 Bacteria 4859
1274 Ga0501045_0034329 3300049824 Bacteria 3682
1275 Ga0501045_0127396 3300049824 Bacteria 1892
1276 Ga0501045_0168697 3300049824 Bacteria 1630
1277 Ga0501045_0228615 3300049824 Bacteria 1385
1278 Ga0501045_0281803 3300049824 Bacteria 1237
1279 Ga0501045_0328195 3300049824 Bacteria 1138
1280 Ga0501045_0435934 3300049824 Bacteria 974
1281 Ga0501045_0459118 3300049824 Bacteria 947
1282 Ga0501045_0514471 3300049824 Bacteria 889
1283 Ga0501045_0903800 3300049824 Bacteria 649
1284 Ga0501045_1116487 3300049824 Unclassified 576
1285 nmdc:mga00v17_149912_c1 3300050491 Bacteria 1498
1286 nmdc:mga00v17_189156_c1 3300050491 Archaea 1329
1287 nmdc:mga00v17_786027_c1 3300050491 Bacteria 607
1288 nmdc:mga0yw44_205301_c1 3300050492 Bacteria 1302
1289 nmdc:mga0yw44_73030_c1 3300050492 Bacteria 1224
1290 nmdc:mga0yw44_915491_c1 3300050492 Bacteria 594
1291 nmdc:mga06z11_196941_c1 3300050494 Bacteria 1168
1292 nmdc:mga05p37_1353856_c1 3300050507 Bacteria 721
1293 nmdc:mga05p37_1705496_c1 3300050507 Unclassified 614
1294 nmdc:mga05p37_37852_c1 3300050507 Bacteria 5916
1295 nmdc:mga05p37_43526_c1 3300050507 Bacteria 5524
1296 nmdc:mga05p37_5072_c1 3300050507 Bacteria 15436
1297 nmdc:mga05p37_51869_c1 3300050507 Bacteria 5044
1298 nmdc:mga05p37_74185_c2 3300050507 Bacteria 2793
1299 nmdc:mga09592_1177227_c1 3300050508 Bacteria 634
1300 nmdc:mga09592_250955_c1 3300050508 Bacteria 1534
1301 nmdc:mga09592_316899_c1 3300050508 Bacteria 1351
1302 nmdc:mga09592_33257_c1 3300050508 Bacteria 4303
1303 nmdc:mga09592_365435_c1 3300050508 Bacteria 1248
1304 nmdc:mga09592_926770_c1 3300050508 Bacteria 731
1305 nmdc:mga09592_9396_c1 3300050508 Bacteria 7947
1306 nmdc:mga0qj67_24510_c1 3300050509 Bacteria 4651
1307 nmdc:mga0qj67_27445_c1 3300050509 Bacteria 4414
1308 nmdc:mga0qj67_545164_c1 3300050509 Bacteria 930
1309 nmdc:mga06r32_246155_c1 3300050510 Bacteria 1775
1310 nmdc:mga06r32_249817_c1 3300050510 Unclassified 1761
1311 nmdc:mga06r32_250934_c1 3300050510 Bacteria 1757
1312 nmdc:mga06r32_42785_c2 3300050510 Bacteria 1912
1313 nmdc:mga06r32_70669_c1 3300050510 Bacteria 3377
1314 nmdc:mga08y16_10615_c1 3300050511 Bacteria 9663
1315 nmdc:mga08y16_1191710_c1 3300050511 Bacteria 733
1316 nmdc:mga08y16_1268522_c1 3300050511 Bacteria 705
1317 nmdc:mga08y16_239100_c1 3300050511 Bacteria 1877
1318 nmdc:mga08y16_254234_c1 3300050511 Bacteria 1815
1319 nmdc:mga08y16_375557_c1 3300050511 Bacteria 1458
1320 nmdc:mga08y16_700565_c1 3300050511 Bacteria 1013
1321 nmdc:mga08y16_7569_c1 3300050511 Bacteria 11374
1322 nmdc:mga0n895_1559789_c1 3300050512 Unclassified 625
1323 nmdc:mga0n895_1898045_c1 3300050512 Unclassified 555
1324 nmdc:mga0n895_237729_c1 3300050512 Unclassified 1849
1325 nmdc:mga0n895_644502_c1 3300050512 Bacteria 1059
1326 nmdc:mga0rr50_122082_c1 3300050513 Bacteria 2075
1327 nmdc:mga0rr50_31543_c1 3300050513 Bacteria 3765
1328 nmdc:mga0rr50_434532_c1 3300050513 Bacteria 1111
1329 nmdc:mga0rr50_737801_c1 3300050513 Unclassified 841
1330 nmdc:mga08x19_370067_c1 3300050514 Bacteria 1003
1331 nmdc:mga0a205_1255921_c1 3300050515 Unclassified 588
1332 nmdc:mga0a205_185262_c1 3300050515 Bacteria 1975
1333 nmdc:mga0a205_336070_c1 3300050515 Bacteria 1380
1334 nmdc:mga0a205_42279_c1 3300050515 Bacteria 4391
1335 Ga0495601_1055382 3300053077 Bacteria 510
1336 Ga0495612_0341833 3300053078 Bacteria 675
1337 Ga0495655_0016976 3300053083 Unclassified 1578
1338 Ga0495595_0186503 3300053084 Bacteria 1030
1339 Ga0495619_0073266 3300053085 Bacteria 2295
1340 Ga0501084_0003960 3300054114 Bacteria 12062
1341 Ga0501084_0013123 3300054114 Bacteria 6855
1342 Ga0501084_0022244 3300054114 Bacteria 5290
1343 Ga0501084_0029841 3300054114 Bacteria 4560
1344 Ga0501084_0049147 3300054114 Bacteria 3531
1345 Ga0501084_0063448 3300054114 Bacteria 3093
1346 Ga0501084_0174137 3300054114 Bacteria 1816
1347 Ga0501084_0218404 3300054114 Bacteria 1608
1348 Ga0501084_0287116 3300054114 Bacteria 1389
1349 Ga0501084_0646006 3300054114 Bacteria 893
1350 Ga0501084_1128307 3300054114 Unclassified 658
1351 Ga0590071_140484 3300059421 Unclassified 623
1352 Ga0590074_021865 3300059423 Bacteria 1104
1353 Ga0590075_076056 3300059424 Bacteria 868
1354 Ga0590075_162340 3300059424 Bacteria 589
1355 Ga0590077_126921 3300059426 Bacteria 605
1356 Ga0501082_0001562 3300060353 Bacteria 20162
1357 Ga0501082_0002174 3300060353 Bacteria 17191
1358 Ga0501082_0017729 3300060353 Bacteria 6132
1359 Ga0501082_0033004 3300060353 Bacteria 4464
1360 Ga0501082_0085042 3300060353 Bacteria 2728
1361 Ga0501082_0130072 3300060353 Bacteria 2184
1362 Ga0501082_0310713 3300060353 Bacteria 1373
1363 Ga0501082_0727691 3300060353 Unclassified 868
1364 Ga0501082_0793969 3300060353 Bacteria 828
1365 Ga0466962_0000400 3300061719 Bacteria 18718
1366 Ga0466962_0545547 3300061719 Bacteria 589
1367 Ga0530510_0001510 3300061734 Bacteria 15648
1368 Ga0530510_0003823 3300061734 Bacteria 10383
1369 Ga0530510_0009903 3300061734 Bacteria 6689
1370 Ga0530510_0010034 3300061734 Bacteria 6642
1371 Ga0530510_0091257 3300061734 Bacteria 2222
1372 Ga0530510_0331399 3300061734 Bacteria 1142
1373 Ga0530510_0606255 3300061734 Bacteria 833
1374 Ga0530510_1037444 3300061734 Bacteria 628
1375 Ga0530510_1208846 3300061734 Unclassified 579
1376 Ga0530510_1346892 3300061734 Bacteria 548
1377 Ga0501036_1397973
1378 ARcpr5oldR_c001197
1379 ARSoilOldRDRAFT_c000964
1380 ARCol0yngRDRAFT_1000704
1381 JGI24737J22298_10044293
1382 JGI25406J46586_10238588
1383 JGI25407J50210_10000051
1384 JGI25407J50210_10001892
1385 JGI25407J50210_10050240
1386 JGI25407J50210_10052063
1387 JGI25407J50210_10073606
1388 JGI25407J50210_10136414
1389 Ga0070658_10067133
1390 Ga0070658_10096535
1391 Ga0070658_10922781
1392 Ga0070658_11181920
1393 Ga0070683_100002922
1394 Ga0070683_100003946
1395 Ga0070683_100075110
1396 Ga0070683_100113353
1397 Ga0070683_100139593
1398 Ga0070683_101011265
1399 Ga0070683_101653964
1400 Ga0070683_102334236
1401 Ga0070690_100185030
1402 Ga0070690_100578423
1403 Ga0068869_100105026
1404 Ga0068869_100358993
1405 Ga0068869_100409896
1406 Ga0068869_101826727
1407 Ga0070666_11434258
1408 Ga0070680_100029316
1409 Ga0070680_100038162
1410 Ga0070680_100136905
1411 Ga0070682_100028671
1412 Ga0070682_100038659
1413 Ga0070682_100063128
1414 Ga0070682_100525841
1415 Ga0070682_100780754
1416 Ga0070682_101557456
1417 Ga0068868_101066079
1418 Ga0070660_100029567
1419 Ga0070660_100033678
1420 Ga0070660_100070080
1421 Ga0070660_100090129
1422 Ga0070660_100376033
1423 Ga0070660_101880718
1424 Ga0070660_101933191
1425 Ga0070689_100148630
1426 Ga0070689_102162115
1427 Ga0070691_10219406
1428 Ga0070691_10539284
1429 Ga0070687_100891862
1430 Ga0070661_100039491
1431 Ga0070661_100066266
1432 Ga0070661_100393914
1433 Ga0070661_101430362
1434 Ga0070692_10003070
1435 Ga0070692_10276299
1436 Ga0070692_10770992
1437 Ga0070668_101273232
1438 Ga0070669_101646237
1439 Ga0070669_101657833
1440 Ga0070675_100035132
1441 Ga0070675_100075867
1442 Ga0070675_100394605
1443 Ga0070671_100886356
1444 Ga0070671_101002264
1445 Ga0070674_100006549
1446 Ga0070674_100036551
1447 Ga0070674_100068963
1448 Ga0070674_101983043
1449 Ga0070673_101257628
1450 Ga0070673_101405644
1451 Ga0070688_100368837
1452 Ga0070659_100003810
1453 Ga0070659_100052021
1454 Ga0070659_100325336
1455 Ga0070659_100654860
1456 Ga0070659_100986470
1457 Ga0070659_101034086
1458 Ga0070667_100818349
1459 Ga0070667_101833007
1460 Ga0070709_10070396
1461 Ga0070709_10350030
1462 Ga0070714_100033558
1463 Ga0070713_100130497
1464 Ga0070713_101859447
1465 Ga0070701_10336951
1466 Ga0070701_10603621
1467 Ga0070711_100097642
1468 Ga0070700_100051473
1469 Ga0070700_100067837
1470 Ga0070694_100017086
1471 Ga0070708_100010667
1472 Ga0070708_100495144
1473 Ga0070708_101748524
1474 Ga0070663_100257211
1475 Ga0070663_100746905
1476 Ga0070663_101103297
1477 Ga0070678_100011103
1478 Ga0070678_100362826
1479 Ga0070678_101043070
1480 Ga0070678_102217799
1481 Ga0070662_100046211
1482 Ga0070681_10006371
1483 Ga0070681_10043297
1484 Ga0070681_10058451
1485 Ga0070681_10081367
1486 Ga0070681_10087399
1487 Ga0070681_10139091
1488 Ga0070681_10251194
1489 Ga0068867_100222865
1490 Ga0068867_100290909
1491 Ga0068867_101124008
1492 Ga0070706_100037349
1493 Ga0070706_100239114
1494 Ga0070706_100953063
1495 Ga0070707_100023151
1496 Ga0070707_100053172
1497 Ga0070707_100097602
1498 Ga0070707_101431489
1499 Ga0070698_100010517
1500 Ga0070698_100070889
1501 Ga0070698_100147483
1502 Ga0070698_100242948
1503 Ga0070699_100023793
1504 Ga0070699_100029327
1505 Ga0070699_100110527
1506 Ga0070699_100113020
1507 Ga0070699_100361888
1508 Ga0070679_100024083
1509 Ga0070679_100039163
1510 Ga0070679_100075853
1511 Ga0070679_100168219
1512 Ga0070679_100172137
1513 Ga0070679_100459577
1514 Ga0070684_100000721
1515 Ga0070684_100004187
1516 Ga0070684_100023303
1517 Ga0070684_100037347
1518 Ga0070684_100041130
1519 Ga0070684_100481704
1520 Ga0070684_101540386
1521 Ga0070684_102252561
1522 Ga0068853_100034734
1523 Ga0068853_102199335
1524 Ga0068853_102354407
1525 Ga0070672_100251939
1526 Ga0070672_100370834
1527 Ga0070686_100907634
1528 Ga0070695_100222586
1529 Ga0070696_100485766
1530 Ga0070693_100004452
1531 Ga0070693_100029782
1532 Ga0070665_100077581
1533 Ga0070665_100334223
1534 Ga0070665_101153957
1535 Ga0070704_100187177
1536 Ga0068855_100012928
1537 Ga0068855_100070685
1538 Ga0068855_100080812
1539 Ga0068855_100177663
1540 Ga0068855_100467085
1541 Ga0070664_100062485
1542 Ga0070664_100191546
1543 Ga0070664_100488272
1544 Ga0070664_101111172
1545 Ga0070664_102306881
1546 Ga0068857_100001170
1547 Ga0068857_100025316
1548 Ga0068857_100057707
1549 Ga0068857_100281438
1550 Ga0068857_100423786
1551 Ga0068857_101651492
1552 Ga0068856_100039848
1553 Ga0068856_100071819
1554 Ga0068856_100287903
1555 Ga0068856_101863173
1556 Ga0070702_100016250
1557 Ga0070702_100100120
1558 Ga0070702_100190333
1559 Ga0070702_101393924
1560 Ga0068852_100033490
1561 Ga0068852_100259612
1562 Ga0068852_100433884
1563 Ga0068852_100537678
1564 Ga0068852_101589722
1565 Ga0068852_101711642
1566 Ga0068852_102435327
1567 Ga0068852_102443178
1568 Ga0068859_100296254
1569 Ga0068864_100012754
1570 Ga0068866_11314208
1571 Ga0068861_100215960
1572 Ga0068861_100296781
1573 Ga0068861_100398226
1574 Ga0068861_100461604
1575 Ga0068861_100745019
1576 Ga0068870_10162064
1577 Ga0068870_10235083
1578 Ga0068863_100930777
1579 Ga0068863_101214227
1580 Ga0068860_100672318
1581 Ga0068860_100702038
1582 Ga0068862_101598155
1583 Ga0081455_10003318
1584 Ga0081455_10046116
1585 Ga0081455_10054960
1586 Ga0081455_10062783
1587 Ga0081455_10085605
1588 Ga0081455_10182159
1589 Ga0081455_10268805
1590 Ga0081538_10000116
1591 Ga0081538_10000148
1592 Ga0081538_10000505
1593 Ga0081538_10001447
1594 Ga0081538_10001820
1595 Ga0081538_10003248
1596 Ga0081538_10009165
1597 Ga0081538_10021860
1598 Ga0081538_10023620
1599 Ga0081538_10039742
1600 Ga0081538_10042059
1601 Ga0081538_10062030
1602 Ga0081538_10063697
1603 Ga0081538_10073932
1604 Ga0081538_10369407
1605 Ga0081540_1003276
1606 Ga0081540_1007593
1607 Ga0081539_10000639
1608 Ga0070717_10254571
1609 Ga0070717_10499540
1610 Ga0075365_10086983
1611 Ga0075365_10412379
1612 Ga0075368_10342944
1613 Ga0075363_100435578
1614 Ga0075364_10159160
1615 Ga0075364_10253123
1616 Ga0075432_10000924
1617 Ga0075432_10101068
1618 Ga0075432_10121224
1619 Ga0070715_10069363
1620 Ga0070716_100033529
1621 Ga0070712_101172496
1622 Ga0070712_101533997
1623 Ga0070712_101875843
1624 Ga0075367_10227435
1625 Ga0097621_100214345
1626 Ga0097621_100958124
1627 Ga0097621_101044043
1628 Ga0075370_10306338
1629 Ga0068871_100728734
1630 Ga0075428_100001400
1631 Ga0075428_100005170
1632 Ga0075428_100013379
1633 Ga0075428_100103049
1634 Ga0075428_100709004
1635 Ga0075428_100960266
1636 Ga0075428_101296586
1637 Ga0075428_102086197
1638 Ga0075430_100009893
1639 Ga0075430_100012099
1640 Ga0075430_100731754
1641 Ga0075431_100004744
1642 Ga0075431_100109734
1643 Ga0075431_100183442
1644 Ga0075431_100215094
1645 Ga0075431_100310978
1646 Ga0075433_10082629
1647 Ga0075433_10085696
1648 Ga0075433_10189581
1649 Ga0075434_100975855
1650 Ga0075434_101618478
1651 Ga0075434_102291266
1652 Ga0075429_100014330
1653 Ga0075429_100030367
1654 Ga0075429_100065939
1655 Ga0075429_100076770
1656 Ga0075429_100436940
1657 Ga0075429_100778855
1658 Ga0068865_100114158
1659 Ga0068865_100320455
1660 Ga0068865_101113835
1661 Ga0068865_101306814
1662 Ga0068865_102128460
1663 Ga0075436_100062001
1664 Ga0097620_100296253
1665 Ga0075435_100056047
1666 Ga0075435_100136767
1667 Ga0075435_100218804
1668 Ga0075435_101027038
1669 Ga0075435_101282161
1670 Ga0105240_10011292
1671 Ga0105240_10105580
1672 Ga0105240_10169655
1673 Ga0105240_10270077
1674 Ga0105240_10500852
1675 Ga0105240_10798408
1676 Ga0105240_12381464
1677 Ga0111539_10004138
1678 Ga0111539_10021844
1679 Ga0111539_10309929
1680 Ga0111539_10348906
1681 Ga0111539_10395316
1682 Ga0111539_10693269
1683 Ga0111539_10788939
1684 Ga0111539_11188620
1685 Ga0111539_11734596
1686 Ga0111539_12010975
1687 Ga0105245_10000886
1688 Ga0105245_10003680
1689 Ga0105245_10029442
1690 Ga0105245_10096577
1691 Ga0105245_10422763
1692 Ga0105245_10655181
1693 Ga0105245_11422771
1694 Ga0105245_11622039
1695 Ga0105247_11336416
1696 Ga0114129_10001306
1697 Ga0114129_10004745
1698 Ga0114129_10060029
1699 Ga0114129_10117963
1700 Ga0114129_10157782
1701 Ga0114129_10175291
1702 Ga0114129_10207515
1703 Ga0114129_10806765
1704 Ga0114129_10983327
1705 Ga0114129_12971012
1706 Ga0114129_13303454
1707 Ga0105243_10007867
1708 Ga0105243_10347639
1709 Ga0105243_10684120
1710 Ga0105243_10772467
1711 Ga0105243_10808579
1712 Ga0105243_11603431
1713 Ga0105243_11817996
1714 Ga0105243_13117989
1715 Ga0105241_10517835
1716 Ga0105241_10698857
1717 Ga0105241_11685254
1718 Ga0105242_10092001
1719 Ga0105242_10158422
1720 Ga0105242_10348818
1721 Ga0105242_10395019
1722 Ga0105242_11039884
1723 Ga0105242_11568508
1724 Ga0105242_12877103
1725 Ga0105248_10512026
1726 Ga0105248_11714397
1727 Ga0105248_12734531
1728 Ga0105237_10029726
1729 Ga0105238_10005537
1730 Ga0105238_10082931
1731 Ga0105238_11474779
1732 Ga0105249_10119056
1733 Ga0105249_10228376
1734 Ga0105249_10455900
1735 Ga0105249_12115257
1736 Ga0105249_12543544
1737 Ga0105249_12981378
1738 Ga0105239_10069838
1739 Ga0105239_10071496
1740 Ga0105239_10652117
1741 Ga0105239_11015929
1742 Ga0105239_11298584
1743 Ga0105246_10075384
1744 Ga0105246_10213239
1745 Ga0105246_11227281
1746 Ga0105246_11555414
1747 Ga0157373_10108751
1748 Ga0157373_10467221
1749 Ga0157373_11552324
1750 Ga0157371_10133484
1751 Ga0157370_10006231
1752 Ga0157370_10011092
1753 Ga0157370_10072016
1754 Ga0157370_11767980
1755 Ga0157369_10076037
1756 Ga0157369_10124296
1757 Ga0157369_10220188
1758 Ga0157374_10020848
1759 Ga0157374_10032162
1760 Ga0157374_10935198
1761 Ga0157374_11843171
1762 Ga0157378_10232212
1763 Ga0163162_10123397
1764 Ga0163162_11098518
1765 Ga0163162_11250366
1766 Ga0163162_13231238
1767 Ga0157372_10032357
1768 Ga0157372_10354980
1769 Ga0157372_10527035
1770 Ga0157372_10581949
1771 Ga0157372_10589938
1772 Ga0157375_10008169
1773 Ga0157375_10086746
1774 Ga0157375_10165580
1775 Ga0157375_10175128
1776 Ga0157375_10849351
1777 Ga0163163_10013246
1778 Ga0163163_10728768
1779 Ga0163163_10989421
1780 Ga0163163_11028904
1781 Ga0163163_11369443
1782 Ga0157380_10045621
1783 Ga0157380_10101798
1784 Ga0157380_11480021
1785 Ga0182008_10081683
1786 Ga0182008_10168586
1787 Ga0157377_10045170
1788 Ga0157377_10165178
1789 Ga0157377_10973849
1790 Ga0157379_10000361
1791 Ga0157376_10064988
1792 Ga0157376_10152620
1793 Ga0157376_10285770
1794 Ga0157376_10311233
1795 Ga0157376_10443772
1796 Ga0157376_10463480
1797 Ga0157376_11587313
1798 Ga0157376_11758130
1799 Ga0182005_1103315
1800 Ga0197907_10128593
1801 Ga0197907_10773643
1802 Ga0206356_10183135
1803 Ga0206356_10997765
1804 Ga0206356_11336474
1805 Ga0206356_11817704
1806 Ga0206355_1017289
1807 Ga0206354_10073080
1808 Ga0206354_10559490
1809 Ga0206353_10317175
1810 Ga0206353_10581558
1811 Ga0206353_11350363
1812 Ga0206353_11565494
1813 Ga0206353_11806520
1814 Ga0224712_10022161
1815 Ga0207682_10413214
1816 Ga0207642_10098040
1817 Ga0207688_10008356
1818 Ga0207688_10038126
1819 Ga0207688_10041035
1820 Ga0207685_10066592
1821 Ga0207699_10050165
1822 Ga0207643_10023866
1823 Ga0207643_10933476
1824 Ga0207643_11030105
1825 Ga0207705_10016223
1826 Ga0207705_10056247
1827 Ga0207705_10144660
1828 Ga0207705_10438496
1829 Ga0207705_10676112
1830 Ga0207684_10026539
1831 Ga0207684_10153369
1832 Ga0207684_10216272
1833 Ga0207654_10336270
1834 Ga0207654_10921708
1835 Ga0207707_10020785
1836 Ga0207707_10076468
1837 Ga0207707_10118432
1838 Ga0207707_10173475
1839 Ga0207707_10313980
1840 Ga0207707_10421550
1841 Ga0207707_10824724
1842 Ga0207695_10458629
1843 Ga0207695_10504546
1844 Ga0207695_10886840
1845 Ga0207695_10932919
1846 Ga0207695_11466669
1847 Ga0207671_10935083
1848 Ga0207693_10928761
1849 Ga0207693_11389590
1850 Ga0207660_10027421
1851 Ga0207660_10053922
1852 Ga0207660_10099336
1853 Ga0207660_10155654
1854 Ga0207660_10171518
1855 Ga0207662_10347454
1856 Ga0207657_10002271
1857 Ga0207657_10002341
1858 Ga0207657_10005771
1859 Ga0207657_10052514
1860 Ga0207657_10070595
1861 Ga0207657_10753786
1862 Ga0207657_10773756
1863 Ga0207649_10044264
1864 Ga0207649_10079695
1865 Ga0207649_10692769
1866 Ga0207649_10985842
1867 Ga0207652_10069691
1868 Ga0207652_10111375
1869 Ga0207652_10137647
1870 Ga0207652_10147034
1871 Ga0207652_10355828
1872 Ga0207646_10011178
1873 Ga0207646_10083727
1874 Ga0207646_10293128
1875 Ga0207646_10344556
1876 Ga0207694_10035943
1877 Ga0207694_10440572
1878 Ga0207694_10817412
1879 Ga0207650_10180996
1880 Ga0207650_11740919
1881 Ga0207659_10084574
1882 Ga0207659_10099852
1883 Ga0207659_10750438
1884 Ga0207687_10006981
1885 Ga0207687_10013050
1886 Ga0207687_10156910
1887 Ga0207687_10607656
1888 Ga0207687_10839940
1889 Ga0207687_11388977
1890 Ga0207687_11512732
1891 Ga0207700_10000001
1892 Ga0207700_10980553
1893 Ga0207700_11428561
1894 Ga0207644_10726284
1895 Ga0207690_10024421
1896 Ga0207690_10057275
1897 Ga0207690_10581731
1898 Ga0207690_11850909
1899 Ga0207706_10007492
1900 Ga0207706_10246842
1901 Ga0207686_10185027
1902 Ga0207686_10252929
1903 Ga0207686_10429413
1904 Ga0207686_11112687
1905 Ga0207709_10065462
1906 Ga0207709_10115360
1907 Ga0207709_10266962
1908 Ga0207709_11010050
1909 Ga0207709_11060552
1910 Ga0207709_11222926
1911 Ga0207670_10258611
1912 Ga0207669_10044252
1913 Ga0207669_10513681
1914 Ga0207669_10773853
1915 Ga0207669_10977404
1916 Ga0207704_10112490
1917 Ga0207704_10396011
1918 Ga0207704_10950444
1919 Ga0207704_11276668
1920 Ga0207665_10004897
1921 Ga0207665_10439138
1922 Ga0207665_10689806
1923 Ga0207665_11142926
1924 Ga0207691_10203085
1925 Ga0207691_10443851
1926 Ga0207691_10893532
1927 Ga0207689_10303893
1928 Ga0207689_10366670
1929 Ga0207689_10824971
1930 Ga0207661_10007449
1931 Ga0207661_10008791
1932 Ga0207661_10051729
1933 Ga0207661_10130319
1934 Ga0207661_10178160
1935 Ga0207661_10494199
1936 Ga0207661_10514653
1937 Ga0207661_11081058
1938 Ga0207661_12036713
1939 Ga0207679_10523627
1940 Ga0207679_11114661
1941 Ga0207679_11244087
1942 Ga0207667_10077710
1943 Ga0207667_10094279
1944 Ga0207667_10506430
1945 Ga0207651_10715573
1946 Ga0207651_10956080
1947 Ga0207712_10052342
1948 Ga0207712_10339945
1949 Ga0207668_10009738
1950 Ga0207668_10188431
1951 Ga0207668_10588814
1952 Ga0207668_10679050
1953 Ga0207640_10812919
1954 Ga0207677_10726142
1955 Ga0207677_10825521
1956 Ga0207677_11291240
1957 Ga0207703_10464866
1958 Ga0207639_10037858
1959 Ga0207639_10313465
1960 Ga0207678_10408754
1961 Ga0207678_10547149
1962 Ga0207678_11170749
1963 Ga0207708_10067909
1964 Ga0207708_10077414
1965 Ga0207708_11473922
1966 Ga0207708_11518936
1967 Ga0207702_10004098
1968 Ga0207702_10065246
1969 Ga0207702_10619801
1970 Ga0207702_10811067
1971 Ga0207702_11078791
1972 Ga0207641_10898051
1973 Ga0207641_11841514
1974 Ga0207641_12328347
1975 Ga0207648_10029509
1976 Ga0207648_10226366
1977 Ga0207648_10248860
1978 Ga0207676_10184195
1979 Ga0207674_10001150
1980 Ga0207674_10019690
1981 Ga0207674_10045789
1982 Ga0207674_10134684
1983 Ga0207674_10277288
1984 Ga0207674_10345643
1985 Ga0207675_100192496
1986 Ga0207675_100385654
1987 Ga0207683_10010822
1988 Ga0207683_10114313
1989 Ga0207683_10288195
1990 Ga0207698_10223582
1991 Ga0207698_10436443
1992 Ga0207698_10591646
1993 Ga0207698_10592366
1994 Ga0207698_11082165
1995 Ga0207698_11410675
1996 Ga0207698_12705961
1997 Ga0207428_10000536
1998 Ga0207428_10012230
1999 Ga0207428_10026570
2000 Ga0207428_10044535
2001 Ga0207428_10333954
2002 Ga0207428_10596396
2003 Ga0207428_11190180
2004 Ga0268266_10036563
2005 Ga0268266_10090416
2006 Ga0268266_10944596
2007 Ga0268266_11205453
2008 Ga0268265_10910345
2009 Ga0268264_10486763
2010 Ga0268264_10860024
2011 Ga0316178_1037630
2012 Ga0307408_101684150
2013 Ga0307408_102061275
2014 Ga0307408_102278527
2015 Ga0307408_102290394
2016 Ga0307405_10048936
2017 Ga0307405_10102728
2018 Ga0307405_10935387
2019 Ga0307405_11037297
2020 Ga0307405_11152827
2021 Ga0307413_10007066
2022 Ga0307413_10254537
2023 Ga0307410_10015876
2024 Ga0307410_11447158
2025 Ga0307406_10095538
2026 Ga0307406_10168082
2027 Ga0307406_11121042
2028 Ga0307407_10003349
2029 Ga0307407_10175804
2030 Ga0307407_10233446
2031 Ga0307407_10631261
2032 Ga0307407_11141684
2033 Ga0307412_10091827
2034 Ga0307412_10093161
2035 Ga0307412_10329700
2036 Ga0307409_100003896
2037 Ga0307409_100045038
2038 Ga0307409_100115250
2039 Ga0307409_100206755
2040 Ga0307409_100311664
2041 Ga0307409_100384618
2042 Ga0307409_100517677
2043 Ga0307409_100588855
2044 Ga0307409_101527753
2045 Ga0307409_102839468
2046 Ga0307416_100029210
2047 Ga0307416_100032968
2048 Ga0307416_100153538
2049 Ga0307416_100516232
2050 Ga0307416_100566591
2051 Ga0307416_100687956
2052 Ga0307416_100985989
2053 Ga0307416_100997313
2054 Ga0307416_101166592
2055 Ga0307416_101267778
2056 Ga0307416_103312202
2057 Ga0307414_10113787
2058 Ga0307414_10658948
2059 Ga0307414_11577395
2060 Ga0307411_10073410
2061 Ga0307411_10166703
2062 Ga0307411_11589718
2063 Ga0307411_12212169
2064 Ga0307415_100001530
2065 Ga0307415_100017904
2066 Ga0307415_100054831
2067 Ga0307415_100699011
2068 Ga0373930_0121727
2069 Ga0373944_0293153
2070 Ga0373951_0263284
2071 Ga0373932_0187110
2072 Ga0373939_0395136
2073 Ga0373954_0428778
2074 Ga0373960_0400001
2075 Ga0373942_0335848
2076 Ga0373961_0095177
2077 Ga0373931_0053746
2078 Ga0373931_1169192
2079 Ga0373935_1101432
2080 Ga0373947_0728286
2081 Ga0395899_0007828
2082 Ga0395899_0008491
2083 Ga0395899_0012697
2084 Ga0395899_0014207
2085 Ga0395899_0021696
2086 Ga0395899_0033808
2087 Ga0395899_0050107
2088 Ga0395899_0145003
2089 Ga0395899_0145331
2090 Ga0395899_0166908
2091 Ga0395899_0316534
2092 Ga0395899_0531307
2093 Ga0395899_0540227
2094 Ga0395900_0001553
2095 Ga0395900_0012790
2096 Ga0395900_0021952
2097 Ga0395900_0022614
2098 Ga0395900_0023193
2099 Ga0395900_0050981
2100 Ga0395900_0052104
2101 Ga0395900_0055656
2102 Ga0395900_0070049
2103 Ga0395900_0075062
2104 Ga0395900_0115199
2105 Ga0395900_0145035
2106 Ga0395900_0202017
2107 Ga0395900_0219935
2108 Ga0395900_0289524
2109 Ga0395900_0378820
2110 Ga0395900_0492682
2111 Ga0395900_0532422
2112 Ga0395900_0589808
2113 Ga0395900_0781683
2114 Ga0395900_0925434
2115 Ga0395900_1034123
2116 Ga0395900_1270813
2117 Ga0395900_1277452
2118 Ga0395900_1409215
2119 Ga0395900_1519988
2120 Ga0395900_1669698
2121 Ga0395900_1870118
2122 Ga0395898_0002858
2123 Ga0395898_0021795
2124 Ga0395898_0025590
2125 Ga0395898_0027149
2126 Ga0395898_0037487
2127 Ga0395898_0041969
2128 Ga0395898_0093507
2129 Ga0395898_0096225
2130 Ga0395898_0234996
2131 Ga0395898_0381341
2132 Ga0395898_0508228
2133 Ga0395898_0648023
2134 Ga0395898_0766874
2135 Ga0395898_0974239
2136 Ga0395898_1090281
2137 Ga0395898_1316919
2138 Ga0395898_1730324
2139 Ga0395905_0002826
2140 Ga0395905_0005069
2141 Ga0395905_0006393
2142 Ga0395905_0012073
2143 Ga0395905_0018558
2144 Ga0395905_0029705
2145 Ga0395905_0033462
2146 Ga0395905_0064347
2147 Ga0395905_0101391
2148 Ga0395905_0107338
2149 Ga0395905_0113689
2150 Ga0395905_0114990
2151 Ga0395905_0147772
2152 Ga0395905_0150369
2153 Ga0395905_0159763
2154 Ga0395905_0188991
2155 Ga0395905_0698388
2156 Ga0395905_0799838
2157 Ga0395905_0807432
2158 Ga0395905_1176322
2159 Ga0395905_1270012
2160 Ga0395905_1444153
2161 Ga0395905_1583378
2162 Ga0395901_0003414
2163 Ga0395901_0006478
2164 Ga0395901_0007417
2165 Ga0395901_0009653
2166 Ga0395901_0010617
2167 Ga0395901_0022705
2168 Ga0395901_0033632
2169 Ga0395901_0045082
2170 Ga0395901_0066857
2171 Ga0395901_0078559
2172 Ga0395901_0135207
2173 Ga0395901_0173151
2174 Ga0395901_0237332
2175 Ga0395901_0321267
2176 Ga0395901_0344220
2177 Ga0395901_0367390
2178 Ga0395901_0382551
2179 Ga0395901_0405310
2180 Ga0395901_0434487
2181 Ga0395901_0451648
2182 Ga0395901_0593840
2183 Ga0395901_0603207
2184 Ga0395901_0611251
2185 Ga0395901_0674757
2186 Ga0395901_0821798
2187 Ga0395901_0929463
2188 Ga0395901_0963153
2189 Ga0395901_0968798
2190 Ga0395901_0996210
2191 Ga0395901_1336957
2192 Ga0395901_1570188
2193 Ga0395901_1870151
2194 Ga0439436_0218924
2195 Ga0439438_130960
2196 Ga0439439_0006255
2197 Ga0439453_0002223
2198 Ga0439453_0005720
2199 Ga0439461_0031942
2200 Ga0439466_0088650
2201 Ga0451800_0309535
2202 Ga0451853_2179209
2203 Ga0439431_0111550
2204 Ga0439431_0138589
2205 Ga0439433_0023140
2206 Ga0439437_015360
2207 Ga0439441_017373
2208 Ga0439442_006866
2209 Ga0439442_023510
2210 Ga0439445_0178903
2211 Ga0439448_0003027
2212 Ga0439448_0061733
2213 Ga0439449_0058128
2214 Ga0439450_049964
2215 Ga0439451_016636
2216 Ga0439451_024833
2217 Ga0439452_088132
2218 Ga0439454_081731
2219 Ga0439455_0217342
2220 Ga0439455_0240557
2221 Ga0439462_0004580
2222 Ga0439463_120763
2223 Ga0439463_175103
2224 Ga0450914_021871
2225 Ga0450920_089665
2226 Ga0450923_173904
2227 Ga0450890_023110
2228 Ga0450900_011248
2229 Ga0450902_029791
2230 Ga0450905_015382
2231 Ga0450907_005941
2232 Ga0450910_036354
2233 Ga0450910_056967
2234 Ga0439446_0021133
2235 Ga0439458_0021478
2236 Ga0439458_0205994
2237 Ga0450908_006627
2238 Ga0439434_0026709
2239 Ga0439434_0038317
2240 Ga0439435_0034455
2241 Ga0439435_0295357
2242 Ga0439464_0099723
2243 Ga0450918_009019
2244 Ga0439440_0231308
2245 Ga0466972_0168827
2246 Ga0466965_0339077
2247 Ga0466966_0029678
2248 Ga0466961_0017470
2249 Ga0466961_0064374
2250 Ga0466961_0488804
2251 Ga0466963_0013473
2252 Ga0466963_0015435
2253 Ga0466963_0063986
2254 Ga0466963_0079946
2255 Ga0466963_0225724
2256 Ga0466963_0589795
2257 Ga0466963_0856809
2258 Ga0466963_1196040
2259 Ga0466964_0028639
2260 Ga0466964_0188501
2261 Ga0466964_0269470
2262 Ga0466964_0327517
2263 Ga0466971_0000831
2264 Ga0466968_0032855
2265 Ga0466968_0485567
2266 Ga0466968_0505392
2267 Ga0466970_0177592
2268 Ga0466957_0001330
2269 Ga0466960_0101107
2270 Ga0466960_0268311
2271 Ga0466960_0470536
2272 Ga0466960_0537309
2273 Ga0466959_0015047
2274 Ga0451576_0510263
2275 Ga0451576_1146877
2276 Ga0466958_0008659
2277 Ga0466958_0011986
2278 Ga0466967_0011587
2279 Ga0466967_0038525
2280 Ga0466967_0074894
2281 Ga0466967_0100598
2282 Ga0466967_0116897
2283 Ga0466967_0152767
2284 Ga0466967_0168181
2285 Ga0466967_0211307
2286 Ga0466967_0628889
2287 Ga0466967_0641626
2288 Ga0466967_0660269
2289 Ga0466967_0865924
2290 Ga0466967_0899719
2291 Ga0466967_1025621
2292 Ga0466967_1038663
2293 Ga0466967_2491659
2294 Ga0495627_070290
2295 Ga0495603_0144422
2296 Ga0495590_0374008
2297 Ga0495629_0428947
2298 Ga0495582_0532604
2299 Ga0495582_0557761
2300 Ga0495605_0310537
2301 Ga0495584_0520786
2302 Ga0495596_0081125
2303 Ga0495596_0451081
2304 Ga0495607_0497972
2305 Ga0495620_0065799
2306 Ga0495628_0100958
2307 Ga0495630_0052439
2308 Ga0495630_0226607
2309 Ga0495630_0342463
2310 Ga0495663_0144823
2311 Ga0495640_0229753
2312 Ga0495587_0089926
2313 Ga0495621_0027072
2314 Ga0495667_0173584
2315 Ga0495656_0254606
2316 Ga0495656_0419928
2317 Ga0495668_0188362
2318 Ga0495625_0280710
2319 Ga0495635_0667308
2320 Ga0495657_0164444
2321 Ga0495623_0283267
2322 Ga0495647_0615142
2323 Ga0495613_0285627
2324 Ga0495613_0794556
2325 Ga0495600_0115691
2326 Ga0495581_0474673
2327 Ga0495674_0418827
2328 Ga0495676_0205592
2329 Ga0495676_0760623
2330 Ga0495680_0368245
2331 Ga0495680_0497478
2332 Ga0495675_0212780
2333 Ga0495679_211766
2334 Ga0495684_0470105
2335 Ga0495614_0583253
2336 Ga0496100_0058352
2337 Ga0496100_0125907
2338 Ga0496100_1102817
2339 Ga0496100_1376458
2340 Ga0496101_0063660
2341 Ga0496101_0081843
2342 Ga0496101_0091651
2343 Ga0496101_0197564
2344 Ga0496101_0331030
2345 Ga0496102_0022571
2346 Ga0496102_0023009
2347 Ga0496102_0031090
2348 Ga0496102_0252706
2349 Ga0496102_0323854
2350 Ga0496103_0007091
2351 Ga0496103_0069723
2352 Ga0496103_0712851
2353 Ga0496104_0012670
2354 Ga0496104_0233141
2355 Ga0496104_0324386
2356 Ga0496104_1174299
2357 Ga0496105_0996113
2358 Ga0496106_0020914
2359 Ga0496106_0118474
2360 Ga0496106_0216819
2361 Ga0496106_1205921
2362 Ga0496107_0077631
2363 Ga0496107_0159994
2364 Ga0496107_0214404
2365 Ga0496108_0263078
2366 Ga0496108_0379032
2367 Ga0496108_0503910
2368 Ga0496109_0103463
2369 Ga0496109_0215223
2370 Ga0496109_0244829
2371 Ga0496109_1722827
2372 Ga0496110_0009650
2373 Ga0496110_0011731
2374 Ga0496110_0189259
2375 Ga0496110_0208339
2376 Ga0496110_0230674
2377 Ga0496110_0271396
2378 Ga0496110_0410081
2379 Ga0496110_0555096
2380 Ga0496110_0767124
2381 Ga0496111_0045231
2382 Ga0496111_0049657
2383 Ga0496111_0059509
2384 Ga0496111_0146490
2385 Ga0496111_0169093
2386 Ga0496111_0199124
2387 Ga0496111_0742926
2388 Ga0496111_0822427
2389 Ga0496111_1100938
2390 Ga0496112_0003611
2391 Ga0496112_0047768
2392 Ga0496112_0094601
2393 Ga0496112_0110992
2394 Ga0496112_0146267
2395 Ga0496112_1476198
2396 Ga0496113_0265442
2397 Ga0496113_1123001
2398 Ga0496114_0000442
2399 Ga0496114_0066590
2400 Ga0496114_0142410
2401 Ga0496114_0765749
2402 Ga0496114_1526629
2403 Ga0496114_1665284
2404 Ga0496115_1209130
2405 Ga0501031_0000143
2406 Ga0501031_0010987
2407 Ga0501031_0093994
2408 Ga0501031_0211263
2409 Ga0501031_0649800
2410 Ga0501031_0734714
2411 Ga0501032_0009219
2412 Ga0501032_0545993
2413 Ga0501032_0585018
2414 Ga0501032_0691671
2415 Ga0501032_0834809
2416 Ga0501033_0002376
2417 Ga0501033_0022460
2418 Ga0501033_0066278
2419 Ga0501033_0494914
2420 Ga0501033_1154416
2421 Ga0501034_0014167
2422 Ga0501034_0049959
2423 Ga0501034_1679246
2424 Ga0501036_0000767
2425 Ga0501036_0007871
2426 Ga0501036_0040462
2427 Ga0501036_0161358
2428 Ga0501036_0268483
2429 Ga0501036_0304389
2430 Ga0501036_0789500
2431 Ga0501036_0826123
2432 Ga0501036_0919297
2433 Ga0501036_1235105
2434 Ga0501037_0000558
2435 Ga0501037_0249679
2436 Ga0501037_0509819
2437 Ga0501037_1022604
2438 Ga0501038_0001974
2439 Ga0501038_0258729
2440 Ga0501038_0349151
2441 Ga0501038_0425750
2442 Ga0501038_0889508
2443 Ga0501038_0890600
2444 Ga0501038_1003975
2445 Ga0501038_1014378
2446 Ga0501039_0003385
2447 Ga0501039_0011636
2448 Ga0501039_0013440
2449 Ga0501039_0016294
2450 Ga0501039_0109933
2451 Ga0501039_0161148
2452 Ga0501039_0361031
2453 Ga0501039_0810018
2454 Ga0501039_1569589
2455 Ga0501040_0001835
2456 Ga0501040_0029984
2457 Ga0501040_0035697
2458 Ga0501040_0079269
2459 Ga0501040_0335680
2460 Ga0501040_0422684
2461 Ga0501040_0601621
2462 Ga0501040_0929063
2463 Ga0501040_1144958
2464 Ga0501041_0011657
2465 Ga0501041_0020444
2466 Ga0501041_0025444
2467 Ga0501041_0154948
2468 Ga0501041_0193988
2469 Ga0501041_0271990
2470 Ga0501041_0484353
2471 Ga0501041_0743683
2472 Ga0501041_0751927
2473 Ga0501041_0854362
2474 Ga0501041_0870367
2475 Ga0501041_0901216
2476 Ga0501042_0000785
2477 Ga0501042_0007018
2478 Ga0501042_0018547
2479 Ga0501042_0020334
2480 Ga0501042_0024913
2481 Ga0501042_0114240
2482 Ga0501042_0240505
2483 Ga0501042_0365805
2484 Ga0501042_0696913
2485 Ga0501042_0701218
2486 Ga0501042_0887674
2487 Ga0501042_1420390
2488 Ga0501042_1456793
2489 Ga0501043_0003153
2490 Ga0501043_0021083
2491 Ga0501043_0166122
2492 Ga0501043_0260959
2493 Ga0501043_0700312
2494 Ga0501043_1118921
2495 Ga0501046_0004710
2496 Ga0501046_0024951
2497 Ga0501046_0036430
2498 Ga0501046_0040701
2499 Ga0501046_0400863
2500 Ga0501047_0004536
2501 Ga0501047_0009861
2502 Ga0501047_0017625
2503 Ga0501047_0324560
2504 Ga0501048_0010994
2505 Ga0501048_0012448
2506 Ga0501048_0083807
2507 Ga0501048_0085103
2508 Ga0501048_0149585
2509 Ga0501048_0469530
2510 Ga0501048_0779465
2511 Ga0501048_0819044
2512 Ga0501048_0972170
2513 Ga0501048_1203066
2514 Ga0501048_1363443
2515 Ga0501067_0019282
2516 Ga0501067_0124766
2517 Ga0501067_0226862
2518 Ga0501068_0001101
2519 Ga0501068_0040130
2520 Ga0501068_0052025
2521 Ga0501068_0067805
2522 Ga0501068_0174555
2523 Ga0501068_0508255
2524 Ga0501068_0774028
2525 Ga0501068_0972736
2526 Ga0501068_1031316
2527 Ga0501069_0000164
2528 Ga0501069_0023440
2529 Ga0501069_0215970
2530 Ga0501069_0832628
2531 Ga0501069_0960562
2532 Ga0501070_0002617
2533 Ga0501070_0042381
2534 Ga0501070_0056977
2535 Ga0501070_0214798
2536 Ga0501070_0332187
2537 Ga0501070_0405193
2538 Ga0501071_0016948
2539 Ga0501071_0017070
2540 Ga0501071_0096348
2541 Ga0501071_0100489
2542 Ga0501071_0138296
2543 Ga0501071_0140288
2544 Ga0501071_0166109
2545 Ga0501071_0278305
2546 Ga0501071_0440523
2547 Ga0501071_0602744
2548 Ga0501071_0862869
2549 Ga0501071_1086846
2550 Ga0501071_1332673
2551 Ga0501072_0001470
2552 Ga0501072_0009619
2553 Ga0501072_0019421
2554 Ga0501072_0023181
2555 Ga0501072_0084089
2556 Ga0501072_0117400
2557 Ga0501072_0175855
2558 Ga0501072_0293216
2559 Ga0501072_0681809
2560 Ga0501073_0009164
2561 Ga0501073_0414304
2562 Ga0501073_0604090
2563 Ga0501074_0000321
2564 Ga0501074_0004627
2565 Ga0501074_0017499
2566 Ga0501074_0081844
2567 Ga0501074_0102912
2568 Ga0501074_0286052
2569 Ga0501074_0615671
2570 Ga0501074_0729675
2571 Ga0501074_0751243
2572 Ga0501074_1217296
2573 Ga0501075_0008772
2574 Ga0501075_0018372
2575 Ga0501075_0026422
2576 Ga0501075_0048433
2577 Ga0501075_0083694
2578 Ga0501075_0086806
2579 Ga0501075_0097392
2580 Ga0501075_0168701
2581 Ga0501075_0214544
2582 Ga0501075_0364206
2583 Ga0501075_0524572
2584 Ga0501075_1135085
2585 Ga0501075_1144968
2586 Ga0501076_0001569
2587 Ga0501076_0006475
2588 Ga0501076_0024647
2589 Ga0501076_0083688
2590 Ga0501076_0139579
2591 Ga0501076_0241625
2592 Ga0501076_0537836
2593 Ga0501076_1703826
2594 Ga0501076_1784323
2595 Ga0501077_0003418
2596 Ga0501077_0013074
2597 Ga0501077_0044271
2598 Ga0501077_0047941
2599 Ga0501077_0082928
2600 Ga0501077_0139190
2601 Ga0501077_0331697
2602 Ga0501077_0855705
2603 Ga0501079_0005337
2604 Ga0501079_0007496
2605 Ga0501079_0011148
2606 Ga0501079_0046731
2607 Ga0501079_0076880
2608 Ga0501079_0130774
2609 Ga0501079_0277555
2610 Ga0501079_0293013
2611 Ga0501079_0443844
2612 Ga0501079_0550364
2613 Ga0501079_0562517
2614 Ga0501079_1095758
2615 Ga0501080_0003261
2616 Ga0501080_0027125
2617 Ga0501080_0039151
2618 Ga0501080_0071955
2619 Ga0501080_0233236
2620 Ga0501080_0425533
2621 Ga0501080_0513821
2622 Ga0501080_0679836
2623 Ga0501081_0000852
2624 Ga0501081_0013748
2625 Ga0501081_0020952
2626 Ga0501081_0088976
2627 Ga0501081_0205441
2628 Ga0501081_0312597
2629 Ga0501081_0536495
2630 Ga0501081_0571988
2631 Ga0501083_0000179
2632 Ga0501083_0063508
2633 Ga0501083_0105067
2634 Ga0501083_0142078
2635 Ga0501083_0354626
2636 Ga0501083_0380088
2637 Ga0501035_0000493
2638 Ga0501035_0046718
2639 Ga0501035_0135555
2640 Ga0501035_0320886
2641 Ga0501035_0609809
2642 Ga0501035_0951722
2643 Ga0501035_1136146
2644 Ga0501044_0005307
2645 Ga0501044_0028152
2646 Ga0501044_0921305
2647 Ga0501045_0003079
2648 Ga0501045_0008250
2649 Ga0501045_0019287
2650 Ga0501045_0034329
2651 Ga0501045_0127396
2652 Ga0501045_0168697
2653 Ga0501045_0228615
2654 Ga0501045_0281803
2655 Ga0501045_0328195
2656 Ga0501045_0435934
2657 Ga0501045_0459118
2658 Ga0501045_0514471
2659 Ga0501045_0903800
2660 Ga0501045_1116487
2661 nmdc:mga00v17_149912_c1
2662 nmdc:mga00v17_189156_c1
2663 nmdc:mga00v17_786027_c1
2664 nmdc:mga0yw44_205301_c1
2665 nmdc:mga0yw44_73030_c1
2666 nmdc:mga0yw44_915491_c1
2667 nmdc:mga06z11_196941_c1
2668 nmdc:mga05p37_1353856_c1
2669 nmdc:mga05p37_1705496_c1
2670 nmdc:mga05p37_37852_c1
2671 nmdc:mga05p37_43526_c1
2672 nmdc:mga05p37_5072_c1
2673 nmdc:mga05p37_51869_c1
2674 nmdc:mga05p37_74185_c2
2675 nmdc:mga09592_1177227_c1
2676 nmdc:mga09592_250955_c1
2677 nmdc:mga09592_316899_c1
2678 nmdc:mga09592_33257_c1
2679 nmdc:mga09592_365435_c1
2680 nmdc:mga09592_926770_c1
2681 nmdc:mga09592_9396_c1
2682 nmdc:mga0qj67_24510_c1
2683 nmdc:mga0qj67_27445_c1
2684 nmdc:mga0qj67_545164_c1
2685 nmdc:mga06r32_246155_c1
2686 nmdc:mga06r32_249817_c1
2687 nmdc:mga06r32_250934_c1
2688 nmdc:mga06r32_42785_c2
2689 nmdc:mga06r32_70669_c1
2690 nmdc:mga08y16_10615_c1
2691 nmdc:mga08y16_1191710_c1
2692 nmdc:mga08y16_1268522_c1
2693 nmdc:mga08y16_239100_c1
2694 nmdc:mga08y16_254234_c1
2695 nmdc:mga08y16_375557_c1
2696 nmdc:mga08y16_700565_c1
2697 nmdc:mga08y16_7569_c1
2698 nmdc:mga0n895_1559789_c1
2699 nmdc:mga0n895_1898045_c1
2700 nmdc:mga0n895_237729_c1
2701 nmdc:mga0n895_644502_c1
2702 nmdc:mga0rr50_122082_c1
2703 nmdc:mga0rr50_31543_c1
2704 nmdc:mga0rr50_434532_c1
2705 nmdc:mga0rr50_737801_c1
2706 nmdc:mga08x19_370067_c1
2707 nmdc:mga0a205_1255921_c1
2708 nmdc:mga0a205_185262_c1
2709 nmdc:mga0a205_336070_c1
2710 nmdc:mga0a205_42279_c1
2711 Ga0495601_1055382
2712 Ga0495612_0341833
2713 Ga0495655_0016976
2714 Ga0495595_0186503
2715 Ga0495619_0073266
2716 Ga0501084_0003960
2717 Ga0501084_0013123
2718 Ga0501084_0022244
2719 Ga0501084_0029841
2720 Ga0501084_0049147
2721 Ga0501084_0063448
2722 Ga0501084_0174137
2723 Ga0501084_0218404
2724 Ga0501084_0287116
2725 Ga0501084_0646006
2726 Ga0501084_1128307
2727 Ga0590071_140484
2728 Ga0590074_021865
2729 Ga0590075_076056
2730 Ga0590075_162340
2731 Ga0590077_126921
2732 Ga0501082_0001562
2733 Ga0501082_0002174
2734 Ga0501082_0017729
2735 Ga0501082_0033004
2736 Ga0501082_0085042
2737 Ga0501082_0130072
2738 Ga0501082_0310713
2739 Ga0501082_0727691
2740 Ga0501082_0793969
2741 Ga0466962_0000400
2742 Ga0466962_0545547
2743 Ga0530510_0001510
2744 Ga0530510_0003823
2745 Ga0530510_0009903
2746 Ga0530510_0010034
2747 Ga0530510_0091257
2748 Ga0530510_0331399
2749 Ga0530510_0606255
2750 Ga0530510_1037444
2751 Ga0530510_1208846
2752 Ga0530510_1346892

MSA Aligner

Family Sequences

Structural Annotation

Top 5 Hits

ID Description Score Start End
5wuq-assembly2.cif.gz_D crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form 0.5415 29 75
3hug-assembly6.cif.gz_P crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.5242 30 75
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.5205 8 73
2ouw-assembly1.cif.gz_B crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution 0.4565 8 73
3hug-assembly6.cif.gz_P crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl 0.4275 30 75
ID Description Score Start End Superfamily
2z2sB01 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.6422 31 72 1.10.10.1320
af_Q9UW24_7_110_1.25.40.70 Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Phosphatidylinositol 3-kinase, accessory domain (PIK) 0.6332 21 74 1.25.40.70
3hugD00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5729 30 72 1.10.10.1320
3hugP00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5242 30 75 1.10.10.1320
3hugT00 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain 0.5209 29 75 1.10.10.1320
ID Description Score Start End GO Terms
AF-A0A2D6LCD1-F1-model_v4 Zf-HC2 domain-containing protein 0.9349 20 71
AF-A0A6P2C7M5-F1-model_v4 Zf-HC2 domain-containing protein 0.9303 20 71
AF-A0A661W3Z6-F1-model_v4 Zinc-finger domain-containing protein 0.912 19 74
AF-A0A538CRS3-F1-model_v4 Zf-HC2 domain-containing protein 0.8683 14 75
AF-A0A1F8U7R0-F1-model_v4 Zinc-finger domain-containing protein 0.8665 13 70

Map