F493476
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1376 | 385 | 2752 | 77 |
Family's Representative Sequence
| Representative Sequence | 3300049572|Ga0501036_1397973|Ga0501036_1397973_253_519 |
| Length | 88 |
| Sequence | MDRPDIAEALEQLLGPGRPEVGCEECFAQLDRYVELELTGGDADAAIPGMRAHLLGCPACREEHESLRALVERGRTPRPAWRLIRLEP |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 2 | 3300000041 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Arabidopsis cpr5 old rhizosphere | Metagenome | Rhizosphere |
| 3 | 3300000044 | Arabidopsis rhizosphere microbial communities from the University of North Carolina, USA - sample from Arabidopsis soil old | Metagenome | Rhizosphere |
| 4 | 3300000652 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample from Col-0 young rhizosphere DNA | Metagenome | Rhizosphere |
| 5 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 6 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 7 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 8 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 9 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 10 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 12 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 14 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 16 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 29 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 32 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 43 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 44 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 49 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 50 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 51 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 58 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 59 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 61 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 62 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 63 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 64 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 65 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 66 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 67 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 68 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 69 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 70 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 71 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 72 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 73 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 74 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 75 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 76 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 77 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 78 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 79 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 80 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 81 | 3300006058 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 | Metagenome | Rhizosphere |
| 82 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 83 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 84 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 85 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 86 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 87 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 88 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 89 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 90 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 91 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 92 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 93 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 94 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 95 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 96 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 97 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 98 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 99 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 100 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 101 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 130 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 132 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 133 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 191 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300030735 | Rhizosphere soil microbial communities in a healthy wheat plant from Wellcamp field in Toowoomba, Australia - sample 4 | Metagenome | Rhizosphere |
| 195 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 196 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 197 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 198 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 199 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 200 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 201 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 202 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 203 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 204 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 205 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 206 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 207 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 208 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 209 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 210 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 212 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 213 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 214 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 215 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 216 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 217 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 218 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 219 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 220 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 221 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 222 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 223 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 224 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 225 | 3300041405 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z080117_5414 | Metagenome | Rhizosphere |
| 226 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 227 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 228 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 229 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 230 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 231 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 232 | 3300041997 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0317DE14Z082817_5607 | Metagenome | Rhizosphere |
| 233 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 234 | 3300042000 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z081617_5539 | Metagenome | Rhizosphere |
| 235 | 3300042001 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 | Metagenome | Rhizosphere |
| 236 | 3300042002 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z082817_5616 | Metagenome | Rhizosphere |
| 237 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 238 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 239 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 240 | 3300042008 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 | Metagenome | Rhizosphere |
| 241 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 242 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 243 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 244 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 245 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 246 | 3300042016 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 | Metagenome | Rhizosphere |
| 247 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 248 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 249 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 250 | 3300042127 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC1030F_E14_070516_91 | Metagenome | Rhizosphere |
| 251 | 3300042136 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530F_E14_072516_1294 | Metagenome | Rhizosphere |
| 252 | 3300042137 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_072516_1519 | Metagenome | Rhizosphere |
| 253 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 254 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 255 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 256 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 257 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 258 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 259 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 260 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 261 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 262 | 3300042531 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0117D_E14_082716_2253 | Metagenome | Rhizosphere |
| 263 | 3300042993 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 | Metagenome | Rhizosphere |
| 264 | 3300044658 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC1R | Metagenome | Rhizosphere |
| 265 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 266 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 267 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 268 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 269 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 270 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 271 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 272 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 273 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 274 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 275 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 276 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 277 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 315 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 316 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 317 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 318 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 319 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 320 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 321 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 323 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 324 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 325 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 326 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 327 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 328 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 329 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 330 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 331 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 332 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 333 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 334 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 335 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 336 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 342 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 343 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 347 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 348 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 349 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 354 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 361 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 362 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 363 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 364 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 365 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 366 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 367 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 368 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 369 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 374 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 375 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 378 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 379 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 380 | 3300059423 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 8_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 381 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 382 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 383 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 384 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 385 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.91 |
| Metatranscriptomes | 1.09 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 1.09 |
| Nodule | 0 |
| Rhizoplane | 5.09 |
| Rhizosphere | 93.75 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 16.21 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0501036_1397973 | 3300049572 | Bacteria | 567 |
| 2 | ARcpr5oldR_c001197 | 3300000041 | Bacteria | 2666 |
| 3 | ARSoilOldRDRAFT_c000964 | 3300000044 | Bacteria | 2797 |
| 4 | ARCol0yngRDRAFT_1000704 | 3300000652 | Bacteria | 3321 |
| 5 | JGI24737J22298_10044293 | 3300001990 | Bacteria | 1361 |
| 6 | JGI25406J46586_10238588 | 3300003203 | Unclassified | 533 |
| 7 | JGI25407J50210_10000051 | 3300003373 | Bacteria | 13670 |
| 8 | JGI25407J50210_10001892 | 3300003373 | Bacteria | 4853 |
| 9 | JGI25407J50210_10050240 | 3300003373 | Bacteria | 1058 |
| 10 | JGI25407J50210_10052063 | 3300003373 | Bacteria | 1036 |
| 11 | JGI25407J50210_10073606 | 3300003373 | Bacteria | 852 |
| 12 | JGI25407J50210_10136414 | 3300003373 | Archaea | 604 |
| 13 | Ga0070658_10067133 | 3300005327 | Unclassified | 2930 |
| 14 | Ga0070658_10096535 | 3300005327 | Bacteria | 2440 |
| 15 | Ga0070658_10922781 | 3300005327 | Bacteria | 759 |
| 16 | Ga0070658_11181920 | 3300005327 | Unclassified | 665 |
| 17 | Ga0070683_100002922 | 3300005329 | Bacteria | 13693 |
| 18 | Ga0070683_100003946 | 3300005329 | Bacteria | 12140 |
| 19 | Ga0070683_100075110 | 3300005329 | Unclassified | 3158 |
| 20 | Ga0070683_100113353 | 3300005329 | Bacteria | 2559 |
| 21 | Ga0070683_100139593 | 3300005329 | Bacteria | 2296 |
| 22 | Ga0070683_101011265 | 3300005329 | Bacteria | 798 |
| 23 | Ga0070683_101653964 | 3300005329 | Bacteria | 616 |
| 24 | Ga0070683_102334236 | 3300005329 | Bacteria | 513 |
| 25 | Ga0070690_100185030 | 3300005330 | Bacteria | 1441 |
| 26 | Ga0070690_100578423 | 3300005330 | Unclassified | 850 |
| 27 | Ga0068869_100105026 | 3300005334 | Bacteria | 2142 |
| 28 | Ga0068869_100358993 | 3300005334 | Bacteria | 1189 |
| 29 | Ga0068869_100409896 | 3300005334 | Unclassified | 1116 |
| 30 | Ga0068869_101826727 | 3300005334 | Unclassified | 544 |
| 31 | Ga0070666_11434258 | 3300005335 | Bacteria | 516 |
| 32 | Ga0070680_100029316 | 3300005336 | Bacteria | 4420 |
| 33 | Ga0070680_100038162 | 3300005336 | Bacteria | 3884 |
| 34 | Ga0070680_100136905 | 3300005336 | Bacteria | 2052 |
| 35 | Ga0070682_100028671 | 3300005337 | Bacteria | 3349 |
| 36 | Ga0070682_100038659 | 3300005337 | Unclassified | 2928 |
| 37 | Ga0070682_100063128 | 3300005337 | Bacteria | 2348 |
| 38 | Ga0070682_100525841 | 3300005337 | Bacteria | 921 |
| 39 | Ga0070682_100780754 | 3300005337 | Bacteria | 774 |
| 40 | Ga0070682_101557456 | 3300005337 | Bacteria | 570 |
| 41 | Ga0068868_101066079 | 3300005338 | Bacteria | 742 |
| 42 | Ga0070660_100029567 | 3300005339 | Bacteria | 4107 |
| 43 | Ga0070660_100033678 | 3300005339 | Bacteria | 3864 |
| 44 | Ga0070660_100070080 | 3300005339 | Bacteria | 2735 |
| 45 | Ga0070660_100090129 | 3300005339 | Bacteria | 2417 |
| 46 | Ga0070660_100376033 | 3300005339 | Unclassified | 1172 |
| 47 | Ga0070660_101880718 | 3300005339 | Bacteria | 510 |
| 48 | Ga0070660_101933191 | 3300005339 | Unclassified | 503 |
| 49 | Ga0070689_100148630 | 3300005340 | Bacteria | 1888 |
| 50 | Ga0070689_102162115 | 3300005340 | Unclassified | 510 |
| 51 | Ga0070691_10219406 | 3300005341 | Bacteria | 1007 |
| 52 | Ga0070691_10539284 | 3300005341 | Bacteria | 680 |
| 53 | Ga0070687_100891862 | 3300005343 | Bacteria | 637 |
| 54 | Ga0070661_100039491 | 3300005344 | Bacteria | 3439 |
| 55 | Ga0070661_100066266 | 3300005344 | Unclassified | 2653 |
| 56 | Ga0070661_100393914 | 3300005344 | Bacteria | 1094 |
| 57 | Ga0070661_101430362 | 3300005344 | Unclassified | 582 |
| 58 | Ga0070692_10003070 | 3300005345 | Bacteria | 6675 |
| 59 | Ga0070692_10276299 | 3300005345 | Bacteria | 1016 |
| 60 | Ga0070692_10770992 | 3300005345 | Unclassified | 654 |
| 61 | Ga0070668_101273232 | 3300005347 | Bacteria | 668 |
| 62 | Ga0070669_101646237 | 3300005353 | Bacteria | 559 |
| 63 | Ga0070669_101657833 | 3300005353 | Bacteria | 557 |
| 64 | Ga0070675_100035132 | 3300005354 | Bacteria | 4072 |
| 65 | Ga0070675_100075867 | 3300005354 | Bacteria | 2795 |
| 66 | Ga0070675_100394605 | 3300005354 | Bacteria | 1233 |
| 67 | Ga0070671_100886356 | 3300005355 | Bacteria | 779 |
| 68 | Ga0070671_101002264 | 3300005355 | Bacteria | 732 |
| 69 | Ga0070674_100006549 | 3300005356 | Bacteria | 6804 |
| 70 | Ga0070674_100036551 | 3300005356 | Bacteria | 3298 |
| 71 | Ga0070674_100068963 | 3300005356 | Bacteria | 2493 |
| 72 | Ga0070674_101983043 | 3300005356 | Bacteria | 530 |
| 73 | Ga0070673_101257628 | 3300005364 | Bacteria | 694 |
| 74 | Ga0070673_101405644 | 3300005364 | Unclassified | 657 |
| 75 | Ga0070688_100368837 | 3300005365 | Unclassified | 1055 |
| 76 | Ga0070659_100003810 | 3300005366 | Bacteria | 10756 |
| 77 | Ga0070659_100052021 | 3300005366 | Bacteria | 3220 |
| 78 | Ga0070659_100325336 | 3300005366 | Bacteria | 1286 |
| 79 | Ga0070659_100654860 | 3300005366 | Unclassified | 906 |
| 80 | Ga0070659_100986470 | 3300005366 | Unclassified | 739 |
| 81 | Ga0070659_101034086 | 3300005366 | Bacteria | 722 |
| 82 | Ga0070667_100818349 | 3300005367 | Unclassified | 865 |
| 83 | Ga0070667_101833007 | 3300005367 | Bacteria | 571 |
| 84 | Ga0070709_10070396 | 3300005434 | Bacteria | 2254 |
| 85 | Ga0070709_10350030 | 3300005434 | Bacteria | 1091 |
| 86 | Ga0070714_100033558 | 3300005435 | Bacteria | 4291 |
| 87 | Ga0070713_100130497 | 3300005436 | Bacteria | 2215 |
| 88 | Ga0070713_101859447 | 3300005436 | Unclassified | 584 |
| 89 | Ga0070701_10336951 | 3300005438 | Bacteria | 938 |
| 90 | Ga0070701_10603621 | 3300005438 | Bacteria | 727 |
| 91 | Ga0070711_100097642 | 3300005439 | Bacteria | 2131 |
| 92 | Ga0070700_100051473 | 3300005441 | Bacteria | 2563 |
| 93 | Ga0070700_100067837 | 3300005441 | Bacteria | 2267 |
| 94 | Ga0070694_100017086 | 3300005444 | Bacteria | 4580 |
| 95 | Ga0070708_100010667 | 3300005445 | Bacteria | 7453 |
| 96 | Ga0070708_100495144 | 3300005445 | Unclassified | 1153 |
| 97 | Ga0070708_101748524 | 3300005445 | Unclassified | 578 |
| 98 | Ga0070663_100257211 | 3300005455 | Bacteria | 1384 |
| 99 | Ga0070663_100746905 | 3300005455 | Unclassified | 835 |
| 100 | Ga0070663_101103297 | 3300005455 | Bacteria | 694 |
| 101 | Ga0070678_100011103 | 3300005456 | Bacteria | 5540 |
| 102 | Ga0070678_100362826 | 3300005456 | Bacteria | 1249 |
| 103 | Ga0070678_101043070 | 3300005456 | Unclassified | 753 |
| 104 | Ga0070678_102217799 | 3300005456 | Bacteria | 521 |
| 105 | Ga0070662_100046211 | 3300005457 | Bacteria | 3128 |
| 106 | Ga0070681_10006371 | 3300005458 | Bacteria | 11472 |
| 107 | Ga0070681_10043297 | 3300005458 | Bacteria | 4510 |
| 108 | Ga0070681_10058451 | 3300005458 | Bacteria | 3836 |
| 109 | Ga0070681_10081367 | 3300005458 | Bacteria | 3194 |
| 110 | Ga0070681_10087399 | 3300005458 | Bacteria | 3070 |
| 111 | Ga0070681_10139091 | 3300005458 | Bacteria | 2358 |
| 112 | Ga0070681_10251194 | 3300005458 | Bacteria | 1681 |
| 113 | Ga0068867_100222865 | 3300005459 | Bacteria | 1521 |
| 114 | Ga0068867_100290909 | 3300005459 | Bacteria | 1343 |
| 115 | Ga0068867_101124008 | 3300005459 | Unclassified | 718 |
| 116 | Ga0070706_100037349 | 3300005467 | Bacteria | 4486 |
| 117 | Ga0070706_100239114 | 3300005467 | Bacteria | 1695 |
| 118 | Ga0070706_100953063 | 3300005467 | Unclassified | 792 |
| 119 | Ga0070707_100023151 | 3300005468 | Bacteria | 5876 |
| 120 | Ga0070707_100053172 | 3300005468 | Unclassified | 3882 |
| 121 | Ga0070707_100097602 | 3300005468 | Unclassified | 2846 |
| 122 | Ga0070707_101431489 | 3300005468 | Bacteria | 658 |
| 123 | Ga0070698_100010517 | 3300005471 | Bacteria | 9864 |
| 124 | Ga0070698_100070889 | 3300005471 | Bacteria | 3496 |
| 125 | Ga0070698_100147483 | 3300005471 | Bacteria | 2301 |
| 126 | Ga0070698_100242948 | 3300005471 | Bacteria | 1734 |
| 127 | Ga0070699_100023793 | 3300005518 | Bacteria | 5278 |
| 128 | Ga0070699_100029327 | 3300005518 | Bacteria | 4744 |
| 129 | Ga0070699_100110527 | 3300005518 | Bacteria | 2413 |
| 130 | Ga0070699_100113020 | 3300005518 | Bacteria | 2385 |
| 131 | Ga0070699_100361888 | 3300005518 | Unclassified | 1308 |
| 132 | Ga0070679_100024083 | 3300005530 | Bacteria | 5963 |
| 133 | Ga0070679_100039163 | 3300005530 | Bacteria | 4712 |
| 134 | Ga0070679_100075853 | 3300005530 | Unclassified | 3352 |
| 135 | Ga0070679_100168219 | 3300005530 | Bacteria | 2165 |
| 136 | Ga0070679_100172137 | 3300005530 | Unclassified | 2138 |
| 137 | Ga0070679_100459577 | 3300005530 | Bacteria | 1218 |
| 138 | Ga0070684_100000721 | 3300005535 | Bacteria | 22898 |
| 139 | Ga0070684_100004187 | 3300005535 | Bacteria | 10926 |
| 140 | Ga0070684_100023303 | 3300005535 | Bacteria | 5175 |
| 141 | Ga0070684_100037347 | 3300005535 | Bacteria | 4166 |
| 142 | Ga0070684_100041130 | 3300005535 | Bacteria | 3983 |
| 143 | Ga0070684_100481704 | 3300005535 | Bacteria | 1148 |
| 144 | Ga0070684_101540386 | 3300005535 | Bacteria | 627 |
| 145 | Ga0070684_102252561 | 3300005535 | Bacteria | 514 |
| 146 | Ga0068853_100034734 | 3300005539 | Bacteria | 4281 |
| 147 | Ga0068853_102199335 | 3300005539 | Bacteria | 535 |
| 148 | Ga0068853_102354407 | 3300005539 | Bacteria | 516 |
| 149 | Ga0070672_100251939 | 3300005543 | Bacteria | 1487 |
| 150 | Ga0070672_100370834 | 3300005543 | Bacteria | 1223 |
| 151 | Ga0070686_100907634 | 3300005544 | Bacteria | 717 |
| 152 | Ga0070695_100222586 | 3300005545 | Bacteria | 1360 |
| 153 | Ga0070696_100485766 | 3300005546 | Bacteria | 980 |
| 154 | Ga0070693_100004452 | 3300005547 | Bacteria | 6626 |
| 155 | Ga0070693_100029782 | 3300005547 | Bacteria | 2980 |
| 156 | Ga0070665_100077581 | 3300005548 | Bacteria | 3328 |
| 157 | Ga0070665_100334223 | 3300005548 | Unclassified | 1520 |
| 158 | Ga0070665_101153957 | 3300005548 | Bacteria | 786 |
| 159 | Ga0070704_100187177 | 3300005549 | Bacteria | 1661 |
| 160 | Ga0068855_100012928 | 3300005563 | Bacteria | 10071 |
| 161 | Ga0068855_100070685 | 3300005563 | Bacteria | 4060 |
| 162 | Ga0068855_100080812 | 3300005563 | Bacteria | 3769 |
| 163 | Ga0068855_100177663 | 3300005563 | Bacteria | 2408 |
| 164 | Ga0068855_100467085 | 3300005563 | Bacteria | 1375 |
| 165 | Ga0070664_100062485 | 3300005564 | Bacteria | 3175 |
| 166 | Ga0070664_100191546 | 3300005564 | Bacteria | 1822 |
| 167 | Ga0070664_100488272 | 3300005564 | Bacteria | 1134 |
| 168 | Ga0070664_101111172 | 3300005564 | Unclassified | 745 |
| 169 | Ga0070664_102306881 | 3300005564 | Unclassified | 510 |
| 170 | Ga0068857_100001170 | 3300005577 | Bacteria | 20459 |
| 171 | Ga0068857_100025316 | 3300005577 | Bacteria | 5225 |
| 172 | Ga0068857_100057707 | 3300005577 | Bacteria | 3446 |
| 173 | Ga0068857_100281438 | 3300005577 | Bacteria | 1530 |
| 174 | Ga0068857_100423786 | 3300005577 | Bacteria | 1241 |
| 175 | Ga0068857_101651492 | 3300005577 | Bacteria | 626 |
| 176 | Ga0068856_100039848 | 3300005614 | Bacteria | 4613 |
| 177 | Ga0068856_100071819 | 3300005614 | Unclassified | 3426 |
| 178 | Ga0068856_100287903 | 3300005614 | Bacteria | 1660 |
| 179 | Ga0068856_101863173 | 3300005614 | Bacteria | 613 |
| 180 | Ga0070702_100016250 | 3300005615 | Bacteria | 3815 |
| 181 | Ga0070702_100100120 | 3300005615 | Bacteria | 1776 |
| 182 | Ga0070702_100190333 | 3300005615 | Bacteria | 1350 |
| 183 | Ga0070702_101393924 | 3300005615 | Bacteria | 573 |
| 184 | Ga0068852_100033490 | 3300005616 | Unclassified | 4267 |
| 185 | Ga0068852_100259612 | 3300005616 | Bacteria | 1668 |
| 186 | Ga0068852_100433884 | 3300005616 | Unclassified | 1298 |
| 187 | Ga0068852_100537678 | 3300005616 | Bacteria | 1168 |
| 188 | Ga0068852_101589722 | 3300005616 | Bacteria | 676 |
| 189 | Ga0068852_101711642 | 3300005616 | Bacteria | 651 |
| 190 | Ga0068852_102435327 | 3300005616 | Unclassified | 544 |
| 191 | Ga0068852_102443178 | 3300005616 | Bacteria | 543 |
| 192 | Ga0068859_100296254 | 3300005617 | Bacteria | 1711 |
| 193 | Ga0068864_100012754 | 3300005618 | Bacteria | 6947 |
| 194 | Ga0068866_11314208 | 3300005718 | Bacteria | 526 |
| 195 | Ga0068861_100215960 | 3300005719 | Bacteria | 1618 |
| 196 | Ga0068861_100296781 | 3300005719 | Bacteria | 1398 |
| 197 | Ga0068861_100398226 | 3300005719 | Bacteria | 1221 |
| 198 | Ga0068861_100461604 | 3300005719 | Bacteria | 1140 |
| 199 | Ga0068861_100745019 | 3300005719 | Bacteria | 915 |
| 200 | Ga0068870_10162064 | 3300005840 | Bacteria | 1327 |
| 201 | Ga0068870_10235083 | 3300005840 | Unclassified | 1129 |
| 202 | Ga0068863_100930777 | 3300005841 | Unclassified | 870 |
| 203 | Ga0068863_101214227 | 3300005841 | Bacteria | 760 |
| 204 | Ga0068860_100672318 | 3300005843 | Unclassified | 1044 |
| 205 | Ga0068860_100702038 | 3300005843 | Bacteria | 1021 |
| 206 | Ga0068862_101598155 | 3300005844 | Bacteria | 659 |
| 207 | Ga0081455_10003318 | 3300005937 | Bacteria | 18593 |
| 208 | Ga0081455_10046116 | 3300005937 | Bacteria | 3785 |
| 209 | Ga0081455_10054960 | 3300005937 | Bacteria | 3389 |
| 210 | Ga0081455_10062783 | 3300005937 | Bacteria | 3121 |
| 211 | Ga0081455_10085605 | 3300005937 | Bacteria | 2570 |
| 212 | Ga0081455_10182159 | 3300005937 | Bacteria | 1589 |
| 213 | Ga0081455_10268805 | 3300005937 | Bacteria | 1238 |
| 214 | Ga0081538_10000116 | 3300005981 | Bacteria | 80435 |
| 215 | Ga0081538_10000148 | 3300005981 | Bacteria | 73051 |
| 216 | Ga0081538_10000505 | 3300005981 | Bacteria | 43641 |
| 217 | Ga0081538_10001447 | 3300005981 | Bacteria | 24396 |
| 218 | Ga0081538_10001820 | 3300005981 | Bacteria | 21461 |
| 219 | Ga0081538_10003248 | 3300005981 | Bacteria | 15449 |
| 220 | Ga0081538_10009165 | 3300005981 | Bacteria | 8301 |
| 221 | Ga0081538_10021860 | 3300005981 | Bacteria | 4654 |
| 222 | Ga0081538_10023620 | 3300005981 | Bacteria | 4412 |
| 223 | Ga0081538_10039742 | 3300005981 | Bacteria | 3011 |
| 224 | Ga0081538_10042059 | 3300005981 | Bacteria | 2889 |
| 225 | Ga0081538_10062030 | 3300005981 | Unclassified | 2135 |
| 226 | Ga0081538_10063697 | 3300005981 | Bacteria | 2091 |
| 227 | Ga0081538_10073932 | 3300005981 | Bacteria | 1859 |
| 228 | Ga0081538_10369407 | 3300005981 | Unclassified | 518 |
| 229 | Ga0081540_1003276 | 3300005983 | Bacteria | 12877 |
| 230 | Ga0081540_1007593 | 3300005983 | Bacteria | 7703 |
| 231 | Ga0081539_10000639 | 3300005985 | Bacteria | 70847 |
| 232 | Ga0070717_10254571 | 3300006028 | Bacteria | 1552 |
| 233 | Ga0070717_10499540 | 3300006028 | Bacteria | 1099 |
| 234 | Ga0075365_10086983 | 3300006038 | Bacteria | 2124 |
| 235 | Ga0075365_10412379 | 3300006038 | Bacteria | 953 |
| 236 | Ga0075368_10342944 | 3300006042 | Bacteria | 649 |
| 237 | Ga0075363_100435578 | 3300006048 | Bacteria | 773 |
| 238 | Ga0075364_10159160 | 3300006051 | Archaea | 1524 |
| 239 | Ga0075364_10253123 | 3300006051 | Bacteria | 1197 |
| 240 | Ga0075432_10000924 | 3300006058 | Bacteria | 9268 |
| 241 | Ga0075432_10101068 | 3300006058 | Bacteria | 1065 |
| 242 | Ga0075432_10121224 | 3300006058 | Bacteria | 983 |
| 243 | Ga0070715_10069363 | 3300006163 | Bacteria | 1571 |
| 244 | Ga0070716_100033529 | 3300006173 | Bacteria | 2809 |
| 245 | Ga0070712_101172496 | 3300006175 | Unclassified | 668 |
| 246 | Ga0070712_101533997 | 3300006175 | Bacteria | 582 |
| 247 | Ga0070712_101875843 | 3300006175 | Bacteria | 525 |
| 248 | Ga0075367_10227435 | 3300006178 | Bacteria | 1168 |
| 249 | Ga0097621_100214345 | 3300006237 | Unclassified | 1676 |
| 250 | Ga0097621_100958124 | 3300006237 | Bacteria | 799 |
| 251 | Ga0097621_101044043 | 3300006237 | Unclassified | 766 |
| 252 | Ga0075370_10306338 | 3300006353 | Bacteria | 945 |
| 253 | Ga0068871_100728734 | 3300006358 | Bacteria | 910 |
| 254 | Ga0075428_100001400 | 3300006844 | Bacteria | 25647 |
| 255 | Ga0075428_100005170 | 3300006844 | Bacteria | 14493 |
| 256 | Ga0075428_100013379 | 3300006844 | Bacteria | 9128 |
| 257 | Ga0075428_100103049 | 3300006844 | Bacteria | 3112 |
| 258 | Ga0075428_100709004 | 3300006844 | Bacteria | 1072 |
| 259 | Ga0075428_100960266 | 3300006844 | Bacteria | 905 |
| 260 | Ga0075428_101296586 | 3300006844 | Bacteria | 766 |
| 261 | Ga0075428_102086197 | 3300006844 | Unclassified | 586 |
| 262 | Ga0075430_100009893 | 3300006846 | Bacteria | 8065 |
| 263 | Ga0075430_100012099 | 3300006846 | Bacteria | 7347 |
| 264 | Ga0075430_100731754 | 3300006846 | Bacteria | 815 |
| 265 | Ga0075431_100004744 | 3300006847 | Bacteria | 13368 |
| 266 | Ga0075431_100109734 | 3300006847 | Bacteria | 2848 |
| 267 | Ga0075431_100183442 | 3300006847 | Bacteria | 2147 |
| 268 | Ga0075431_100215094 | 3300006847 | Bacteria | 1962 |
| 269 | Ga0075431_100310978 | 3300006847 | Unclassified | 1590 |
| 270 | Ga0075433_10082629 | 3300006852 | Bacteria | 2833 |
| 271 | Ga0075433_10085696 | 3300006852 | Bacteria | 2781 |
| 272 | Ga0075433_10189581 | 3300006852 | Unclassified | 1829 |
| 273 | Ga0075434_100975855 | 3300006871 | Unclassified | 861 |
| 274 | Ga0075434_101618478 | 3300006871 | Bacteria | 656 |
| 275 | Ga0075434_102291266 | 3300006871 | Unclassified | 543 |
| 276 | Ga0075429_100014330 | 3300006880 | Bacteria | 6876 |
| 277 | Ga0075429_100030367 | 3300006880 | Bacteria | 4694 |
| 278 | Ga0075429_100065939 | 3300006880 | Bacteria | 3152 |
| 279 | Ga0075429_100076770 | 3300006880 | Bacteria | 2910 |
| 280 | Ga0075429_100436940 | 3300006880 | Unclassified | 1147 |
| 281 | Ga0075429_100778855 | 3300006880 | Bacteria | 838 |
| 282 | Ga0068865_100114158 | 3300006881 | Bacteria | 1997 |
| 283 | Ga0068865_100320455 | 3300006881 | Bacteria | 1247 |
| 284 | Ga0068865_101113835 | 3300006881 | Bacteria | 696 |
| 285 | Ga0068865_101306814 | 3300006881 | Unclassified | 645 |
| 286 | Ga0068865_102128460 | 3300006881 | Bacteria | 510 |
| 287 | Ga0075436_100062001 | 3300006914 | Bacteria | 2584 |
| 288 | Ga0097620_100296253 | 3300006931 | Bacteria | 1711 |
| 289 | Ga0075435_100056047 | 3300007076 | Bacteria | 3185 |
| 290 | Ga0075435_100136767 | 3300007076 | Bacteria | 2053 |
| 291 | Ga0075435_100218804 | 3300007076 | Bacteria | 1617 |
| 292 | Ga0075435_101027038 | 3300007076 | Unclassified | 720 |
| 293 | Ga0075435_101282161 | 3300007076 | Unclassified | 641 |
| 294 | Ga0105240_10011292 | 3300009093 | Bacteria | 12445 |
| 295 | Ga0105240_10105580 | 3300009093 | Bacteria | 3419 |
| 296 | Ga0105240_10169655 | 3300009093 | Bacteria | 2585 |
| 297 | Ga0105240_10270077 | 3300009093 | Bacteria | 1958 |
| 298 | Ga0105240_10500852 | 3300009093 | Unclassified | 1351 |
| 299 | Ga0105240_10798408 | 3300009093 | Bacteria | 1022 |
| 300 | Ga0105240_12381464 | 3300009093 | Unclassified | 548 |
| 301 | Ga0111539_10004138 | 3300009094 | Bacteria | 19026 |
| 302 | Ga0111539_10021844 | 3300009094 | Bacteria | 7869 |
| 303 | Ga0111539_10309929 | 3300009094 | Bacteria | 1837 |
| 304 | Ga0111539_10348906 | 3300009094 | Bacteria | 1722 |
| 305 | Ga0111539_10395316 | 3300009094 | Bacteria | 1610 |
| 306 | Ga0111539_10693269 | 3300009094 | Bacteria | 1186 |
| 307 | Ga0111539_10788939 | 3300009094 | Bacteria | 1105 |
| 308 | Ga0111539_11188620 | 3300009094 | Bacteria | 886 |
| 309 | Ga0111539_11734596 | 3300009094 | Unclassified | 724 |
| 310 | Ga0111539_12010975 | 3300009094 | Bacteria | 670 |
| 311 | Ga0105245_10000886 | 3300009098 | Bacteria | 27215 |
| 312 | Ga0105245_10003680 | 3300009098 | Bacteria | 13689 |
| 313 | Ga0105245_10029442 | 3300009098 | Bacteria | 4851 |
| 314 | Ga0105245_10096577 | 3300009098 | Unclassified | 2727 |
| 315 | Ga0105245_10422763 | 3300009098 | Unclassified | 1336 |
| 316 | Ga0105245_10655181 | 3300009098 | Bacteria | 1080 |
| 317 | Ga0105245_11422771 | 3300009098 | Unclassified | 744 |
| 318 | Ga0105245_11622039 | 3300009098 | Bacteria | 699 |
| 319 | Ga0105247_11336416 | 3300009101 | Unclassified | 577 |
| 320 | Ga0114129_10001306 | 3300009147 | Bacteria | 33269 |
| 321 | Ga0114129_10004745 | 3300009147 | Bacteria | 19205 |
| 322 | Ga0114129_10060029 | 3300009147 | Bacteria | 5317 |
| 323 | Ga0114129_10117963 | 3300009147 | Bacteria | 3656 |
| 324 | Ga0114129_10157782 | 3300009147 | Bacteria | 3102 |
| 325 | Ga0114129_10175291 | 3300009147 | Bacteria | 2921 |
| 326 | Ga0114129_10207515 | 3300009147 | Bacteria | 2650 |
| 327 | Ga0114129_10806765 | 3300009147 | Bacteria | 1197 |
| 328 | Ga0114129_10983327 | 3300009147 | Bacteria | 1064 |
| 329 | Ga0114129_12971012 | 3300009147 | Bacteria | 558 |
| 330 | Ga0114129_13303454 | 3300009147 | Bacteria | 521 |
| 331 | Ga0105243_10007867 | 3300009148 | Bacteria | 8189 |
| 332 | Ga0105243_10347639 | 3300009148 | Bacteria | 1360 |
| 333 | Ga0105243_10684120 | 3300009148 | Bacteria | 998 |
| 334 | Ga0105243_10772467 | 3300009148 | Bacteria | 944 |
| 335 | Ga0105243_10808579 | 3300009148 | Bacteria | 925 |
| 336 | Ga0105243_11603431 | 3300009148 | Unclassified | 677 |
| 337 | Ga0105243_11817996 | 3300009148 | Unclassified | 641 |
| 338 | Ga0105243_13117989 | 3300009148 | Bacteria | 502 |
| 339 | Ga0105241_10517835 | 3300009174 | Bacteria | 1066 |
| 340 | Ga0105241_10698857 | 3300009174 | Unclassified | 925 |
| 341 | Ga0105241_11685254 | 3300009174 | Unclassified | 615 |
| 342 | Ga0105242_10092001 | 3300009176 | Bacteria | 2555 |
| 343 | Ga0105242_10158422 | 3300009176 | Bacteria | 1980 |
| 344 | Ga0105242_10348818 | 3300009176 | Bacteria | 1366 |
| 345 | Ga0105242_10395019 | 3300009176 | Bacteria | 1289 |
| 346 | Ga0105242_11039884 | 3300009176 | Bacteria | 829 |
| 347 | Ga0105242_11568508 | 3300009176 | Bacteria | 691 |
| 348 | Ga0105242_12877103 | 3300009176 | Bacteria | 532 |
| 349 | Ga0105248_10512026 | 3300009177 | Unclassified | 1353 |
| 350 | Ga0105248_11714397 | 3300009177 | Unclassified | 712 |
| 351 | Ga0105248_12734531 | 3300009177 | Bacteria | 563 |
| 352 | Ga0105237_10029726 | 3300009545 | Bacteria | 5552 |
| 353 | Ga0105238_10005537 | 3300009551 | Bacteria | 12469 |
| 354 | Ga0105238_10082931 | 3300009551 | Bacteria | 3195 |
| 355 | Ga0105238_11474779 | 3300009551 | Bacteria | 709 |
| 356 | Ga0105249_10119056 | 3300009553 | Bacteria | 2507 |
| 357 | Ga0105249_10228376 | 3300009553 | Bacteria | 1835 |
| 358 | Ga0105249_10455900 | 3300009553 | Bacteria | 1318 |
| 359 | Ga0105249_12115257 | 3300009553 | Unclassified | 636 |
| 360 | Ga0105249_12543544 | 3300009553 | Unclassified | 584 |
| 361 | Ga0105249_12981378 | 3300009553 | Bacteria | 543 |
| 362 | Ga0105239_10069838 | 3300010375 | Bacteria | 3858 |
| 363 | Ga0105239_10071496 | 3300010375 | Unclassified | 3812 |
| 364 | Ga0105239_10652117 | 3300010375 | Bacteria | 1202 |
| 365 | Ga0105239_11015929 | 3300010375 | Bacteria | 954 |
| 366 | Ga0105239_11298584 | 3300010375 | Bacteria | 839 |
| 367 | Ga0105246_10075384 | 3300011119 | Bacteria | 2388 |
| 368 | Ga0105246_10213239 | 3300011119 | Bacteria | 1508 |
| 369 | Ga0105246_11227281 | 3300011119 | Bacteria | 691 |
| 370 | Ga0105246_11555414 | 3300011119 | Bacteria | 623 |
| 371 | Ga0157373_10108751 | 3300013100 | Bacteria | 1949 |
| 372 | Ga0157373_10467221 | 3300013100 | Bacteria | 909 |
| 373 | Ga0157373_11552324 | 3300013100 | Bacteria | 506 |
| 374 | Ga0157371_10133484 | 3300013102 | Bacteria | 1767 |
| 375 | Ga0157370_10006231 | 3300013104 | Bacteria | 13214 |
| 376 | Ga0157370_10011092 | 3300013104 | Bacteria | 9447 |
| 377 | Ga0157370_10072016 | 3300013104 | Bacteria | 3261 |
| 378 | Ga0157370_11767980 | 3300013104 | Bacteria | 555 |
| 379 | Ga0157369_10076037 | 3300013105 | Unclassified | 3600 |
| 380 | Ga0157369_10124296 | 3300013105 | Bacteria | 2736 |
| 381 | Ga0157369_10220188 | 3300013105 | Bacteria | 1987 |
| 382 | Ga0157374_10020848 | 3300013296 | Bacteria | 5822 |
| 383 | Ga0157374_10032162 | 3300013296 | Bacteria | 4775 |
| 384 | Ga0157374_10935198 | 3300013296 | Unclassified | 885 |
| 385 | Ga0157374_11843171 | 3300013296 | Bacteria | 630 |
| 386 | Ga0157378_10232212 | 3300013297 | Bacteria | 1758 |
| 387 | Ga0163162_10123397 | 3300013306 | Unclassified | 2695 |
| 388 | Ga0163162_11098518 | 3300013306 | Unclassified | 901 |
| 389 | Ga0163162_11250366 | 3300013306 | Unclassified | 843 |
| 390 | Ga0163162_13231238 | 3300013306 | Unclassified | 523 |
| 391 | Ga0157372_10032357 | 3300013307 | Bacteria | 5734 |
| 392 | Ga0157372_10354980 | 3300013307 | Bacteria | 1708 |
| 393 | Ga0157372_10527035 | 3300013307 | Bacteria | 1377 |
| 394 | Ga0157372_10581949 | 3300013307 | Unclassified | 1305 |
| 395 | Ga0157372_10589938 | 3300013307 | Bacteria | 1295 |
| 396 | Ga0157375_10008169 | 3300013308 | Bacteria | 9161 |
| 397 | Ga0157375_10086746 | 3300013308 | Bacteria | 3181 |
| 398 | Ga0157375_10165580 | 3300013308 | Bacteria | 2355 |
| 399 | Ga0157375_10175128 | 3300013308 | Bacteria | 2294 |
| 400 | Ga0157375_10849351 | 3300013308 | Bacteria | 1059 |
| 401 | Ga0163163_10013246 | 3300014325 | Bacteria | 7542 |
| 402 | Ga0163163_10728768 | 3300014325 | Bacteria | 1055 |
| 403 | Ga0163163_10989421 | 3300014325 | Bacteria | 904 |
| 404 | Ga0163163_11028904 | 3300014325 | Bacteria | 887 |
| 405 | Ga0163163_11369443 | 3300014325 | Bacteria | 769 |
| 406 | Ga0157380_10045621 | 3300014326 | Bacteria | 3440 |
| 407 | Ga0157380_10101798 | 3300014326 | Bacteria | 2394 |
| 408 | Ga0157380_11480021 | 3300014326 | Bacteria | 731 |
| 409 | Ga0182008_10081683 | 3300014497 | Bacteria | 1591 |
| 410 | Ga0182008_10168586 | 3300014497 | Bacteria | 1105 |
| 411 | Ga0157377_10045170 | 3300014745 | Bacteria | 2460 |
| 412 | Ga0157377_10165178 | 3300014745 | Unclassified | 1380 |
| 413 | Ga0157377_10973849 | 3300014745 | Bacteria | 640 |
| 414 | Ga0157379_10000361 | 3300014968 | Bacteria | 36481 |
| 415 | Ga0157376_10064988 | 3300014969 | Bacteria | 3078 |
| 416 | Ga0157376_10152620 | 3300014969 | Bacteria | 2085 |
| 417 | Ga0157376_10285770 | 3300014969 | Bacteria | 1555 |
| 418 | Ga0157376_10311233 | 3300014969 | Bacteria | 1494 |
| 419 | Ga0157376_10443772 | 3300014969 | Bacteria | 1264 |
| 420 | Ga0157376_10463480 | 3300014969 | Bacteria | 1239 |
| 421 | Ga0157376_11587313 | 3300014969 | Bacteria | 688 |
| 422 | Ga0157376_11758130 | 3300014969 | Bacteria | 656 |
| 423 | Ga0182005_1103315 | 3300015265 | Bacteria | 800 |
| 424 | Ga0197907_10128593 | 3300020069 | Unclassified | 885 |
| 425 | Ga0197907_10773643 | 3300020069 | Bacteria | 585 |
| 426 | Ga0206356_10183135 | 3300020070 | Bacteria | 3085 |
| 427 | Ga0206356_10997765 | 3300020070 | Bacteria | 3409 |
| 428 | Ga0206356_11336474 | 3300020070 | Bacteria | 3014 |
| 429 | Ga0206356_11817704 | 3300020070 | Bacteria | 1779 |
| 430 | Ga0206355_1017289 | 3300020076 | Bacteria | 1107 |
| 431 | Ga0206354_10073080 | 3300020081 | Bacteria | 2277 |
| 432 | Ga0206354_10559490 | 3300020081 | Bacteria | 2572 |
| 433 | Ga0206353_10317175 | 3300020082 | Bacteria | 1232 |
| 434 | Ga0206353_10581558 | 3300020082 | Bacteria | 12890 |
| 435 | Ga0206353_11350363 | 3300020082 | Bacteria | 1172 |
| 436 | Ga0206353_11565494 | 3300020082 | Bacteria | 800 |
| 437 | Ga0206353_11806520 | 3300020082 | Bacteria | 4115 |
| 438 | Ga0224712_10022161 | 3300022467 | Bacteria | 2186 |
| 439 | Ga0207682_10413214 | 3300025893 | Unclassified | 638 |
| 440 | Ga0207642_10098040 | 3300025899 | Bacteria | 1465 |
| 441 | Ga0207688_10008356 | 3300025901 | Bacteria | 5630 |
| 442 | Ga0207688_10038126 | 3300025901 | Bacteria | 2666 |
| 443 | Ga0207688_10041035 | 3300025901 | Bacteria | 2573 |
| 444 | Ga0207685_10066592 | 3300025905 | Bacteria | 1446 |
| 445 | Ga0207699_10050165 | 3300025906 | Bacteria | 2459 |
| 446 | Ga0207643_10023866 | 3300025908 | Bacteria | 3375 |
| 447 | Ga0207643_10933476 | 3300025908 | Unclassified | 562 |
| 448 | Ga0207643_11030105 | 3300025908 | Bacteria | 532 |
| 449 | Ga0207705_10016223 | 3300025909 | Bacteria | 5342 |
| 450 | Ga0207705_10056247 | 3300025909 | Unclassified | 2836 |
| 451 | Ga0207705_10144660 | 3300025909 | Unclassified | 1778 |
| 452 | Ga0207705_10438496 | 3300025909 | Bacteria | 1012 |
| 453 | Ga0207705_10676112 | 3300025909 | Bacteria | 803 |
| 454 | Ga0207684_10026539 | 3300025910 | Bacteria | 4938 |
| 455 | Ga0207684_10153369 | 3300025910 | Bacteria | 1982 |
| 456 | Ga0207684_10216272 | 3300025910 | Bacteria | 1653 |
| 457 | Ga0207654_10336270 | 3300025911 | Bacteria | 1036 |
| 458 | Ga0207654_10921708 | 3300025911 | Unclassified | 634 |
| 459 | Ga0207707_10020785 | 3300025912 | Bacteria | 5733 |
| 460 | Ga0207707_10076468 | 3300025912 | Bacteria | 2921 |
| 461 | Ga0207707_10118432 | 3300025912 | Unclassified | 2315 |
| 462 | Ga0207707_10173475 | 3300025912 | Bacteria | 1884 |
| 463 | Ga0207707_10313980 | 3300025912 | Unclassified | 1354 |
| 464 | Ga0207707_10421550 | 3300025912 | Bacteria | 1144 |
| 465 | Ga0207707_10824724 | 3300025912 | Bacteria | 771 |
| 466 | Ga0207695_10458629 | 3300025913 | Bacteria | 1158 |
| 467 | Ga0207695_10504546 | 3300025913 | Unclassified | 1092 |
| 468 | Ga0207695_10886840 | 3300025913 | Bacteria | 772 |
| 469 | Ga0207695_10932919 | 3300025913 | Bacteria | 748 |
| 470 | Ga0207695_11466669 | 3300025913 | Unclassified | 563 |
| 471 | Ga0207671_10935083 | 3300025914 | Unclassified | 685 |
| 472 | Ga0207693_10928761 | 3300025915 | Unclassified | 667 |
| 473 | Ga0207693_11389590 | 3300025915 | Bacteria | 522 |
| 474 | Ga0207660_10027421 | 3300025917 | Bacteria | 3886 |
| 475 | Ga0207660_10053922 | 3300025917 | Bacteria | 2868 |
| 476 | Ga0207660_10099336 | 3300025917 | Bacteria | 2172 |
| 477 | Ga0207660_10155654 | 3300025917 | Bacteria | 1759 |
| 478 | Ga0207660_10171518 | 3300025917 | Bacteria | 1679 |
| 479 | Ga0207662_10347454 | 3300025918 | Bacteria | 995 |
| 480 | Ga0207657_10002271 | 3300025919 | Bacteria | 20838 |
| 481 | Ga0207657_10002341 | 3300025919 | Bacteria | 20536 |
| 482 | Ga0207657_10005771 | 3300025919 | Bacteria | 12908 |
| 483 | Ga0207657_10052514 | 3300025919 | Unclassified | 3537 |
| 484 | Ga0207657_10070595 | 3300025919 | Bacteria | 2960 |
| 485 | Ga0207657_10753786 | 3300025919 | Unclassified | 754 |
| 486 | Ga0207657_10773756 | 3300025919 | Bacteria | 743 |
| 487 | Ga0207649_10044264 | 3300025920 | Bacteria | 2725 |
| 488 | Ga0207649_10079695 | 3300025920 | Bacteria | 2116 |
| 489 | Ga0207649_10692769 | 3300025920 | Bacteria | 790 |
| 490 | Ga0207649_10985842 | 3300025920 | Unclassified | 663 |
| 491 | Ga0207652_10069691 | 3300025921 | Bacteria | 3053 |
| 492 | Ga0207652_10111375 | 3300025921 | Bacteria | 2427 |
| 493 | Ga0207652_10137647 | 3300025921 | Bacteria | 2182 |
| 494 | Ga0207652_10147034 | 3300025921 | Bacteria | 2109 |
| 495 | Ga0207652_10355828 | 3300025921 | Bacteria | 1321 |
| 496 | Ga0207646_10011178 | 3300025922 | Bacteria | 8716 |
| 497 | Ga0207646_10083727 | 3300025922 | Unclassified | 2853 |
| 498 | Ga0207646_10293128 | 3300025922 | Bacteria | 1470 |
| 499 | Ga0207646_10344556 | 3300025922 | Bacteria | 1346 |
| 500 | Ga0207694_10035943 | 3300025924 | Unclassified | 3800 |
| 501 | Ga0207694_10440572 | 3300025924 | Bacteria | 1087 |
| 502 | Ga0207694_10817412 | 3300025924 | Unclassified | 787 |
| 503 | Ga0207650_10180996 | 3300025925 | Bacteria | 1679 |
| 504 | Ga0207650_11740919 | 3300025925 | Bacteria | 528 |
| 505 | Ga0207659_10084574 | 3300025926 | Bacteria | 2355 |
| 506 | Ga0207659_10099852 | 3300025926 | Bacteria | 2186 |
| 507 | Ga0207659_10750438 | 3300025926 | Bacteria | 837 |
| 508 | Ga0207687_10006981 | 3300025927 | Bacteria | 7440 |
| 509 | Ga0207687_10013050 | 3300025927 | Bacteria | 5429 |
| 510 | Ga0207687_10156910 | 3300025927 | Bacteria | 1742 |
| 511 | Ga0207687_10607656 | 3300025927 | Unclassified | 922 |
| 512 | Ga0207687_10839940 | 3300025927 | Unclassified | 784 |
| 513 | Ga0207687_11388977 | 3300025927 | Bacteria | 604 |
| 514 | Ga0207687_11512732 | 3300025927 | Bacteria | 576 |
| 515 | Ga0207700_10000001 | 3300025928 | Bacteria | 1122509 |
| 516 | Ga0207700_10980553 | 3300025928 | Unclassified | 756 |
| 517 | Ga0207700_11428561 | 3300025928 | Unclassified | 615 |
| 518 | Ga0207644_10726284 | 3300025931 | Bacteria | 829 |
| 519 | Ga0207690_10024421 | 3300025932 | Unclassified | 3786 |
| 520 | Ga0207690_10057275 | 3300025932 | Bacteria | 2632 |
| 521 | Ga0207690_10581731 | 3300025932 | Unclassified | 913 |
| 522 | Ga0207690_11850909 | 3300025932 | Bacteria | 504 |
| 523 | Ga0207706_10007492 | 3300025933 | Bacteria | 10095 |
| 524 | Ga0207706_10246842 | 3300025933 | Bacteria | 1560 |
| 525 | Ga0207686_10185027 | 3300025934 | Bacteria | 1480 |
| 526 | Ga0207686_10252929 | 3300025934 | Unclassified | 1288 |
| 527 | Ga0207686_10429413 | 3300025934 | Unclassified | 1012 |
| 528 | Ga0207686_11112687 | 3300025934 | Bacteria | 644 |
| 529 | Ga0207709_10065462 | 3300025935 | Bacteria | 2286 |
| 530 | Ga0207709_10115360 | 3300025935 | Bacteria | 1804 |
| 531 | Ga0207709_10266962 | 3300025935 | Bacteria | 1258 |
| 532 | Ga0207709_11010050 | 3300025935 | Bacteria | 680 |
| 533 | Ga0207709_11060552 | 3300025935 | Bacteria | 664 |
| 534 | Ga0207709_11222926 | 3300025935 | Bacteria | 619 |
| 535 | Ga0207670_10258611 | 3300025936 | Unclassified | 1348 |
| 536 | Ga0207669_10044252 | 3300025937 | Unclassified | 2614 |
| 537 | Ga0207669_10513681 | 3300025937 | Bacteria | 961 |
| 538 | Ga0207669_10773853 | 3300025937 | Bacteria | 794 |
| 539 | Ga0207669_10977404 | 3300025937 | Bacteria | 710 |
| 540 | Ga0207704_10112490 | 3300025938 | Bacteria | 1844 |
| 541 | Ga0207704_10396011 | 3300025938 | Bacteria | 1088 |
| 542 | Ga0207704_10950444 | 3300025938 | Bacteria | 725 |
| 543 | Ga0207704_11276668 | 3300025938 | Unclassified | 627 |
| 544 | Ga0207665_10004897 | 3300025939 | Bacteria | 8923 |
| 545 | Ga0207665_10439138 | 3300025939 | Bacteria | 1000 |
| 546 | Ga0207665_10689806 | 3300025939 | Bacteria | 802 |
| 547 | Ga0207665_11142926 | 3300025939 | Unclassified | 621 |
| 548 | Ga0207691_10203085 | 3300025940 | Bacteria | 1724 |
| 549 | Ga0207691_10443851 | 3300025940 | Bacteria | 1104 |
| 550 | Ga0207691_10893532 | 3300025940 | Bacteria | 744 |
| 551 | Ga0207689_10303893 | 3300025942 | Bacteria | 1322 |
| 552 | Ga0207689_10366670 | 3300025942 | Unclassified | 1198 |
| 553 | Ga0207689_10824971 | 3300025942 | Bacteria | 783 |
| 554 | Ga0207661_10007449 | 3300025944 | Bacteria | 7788 |
| 555 | Ga0207661_10008791 | 3300025944 | Bacteria | 7226 |
| 556 | Ga0207661_10051729 | 3300025944 | Bacteria | 3278 |
| 557 | Ga0207661_10130319 | 3300025944 | Bacteria | 2153 |
| 558 | Ga0207661_10178160 | 3300025944 | Bacteria | 1855 |
| 559 | Ga0207661_10494199 | 3300025944 | Bacteria | 1118 |
| 560 | Ga0207661_10514653 | 3300025944 | Bacteria | 1094 |
| 561 | Ga0207661_11081058 | 3300025944 | Bacteria | 739 |
| 562 | Ga0207661_12036713 | 3300025944 | Bacteria | 520 |
| 563 | Ga0207679_10523627 | 3300025945 | Unclassified | 1061 |
| 564 | Ga0207679_11114661 | 3300025945 | Unclassified | 724 |
| 565 | Ga0207679_11244087 | 3300025945 | Bacteria | 683 |
| 566 | Ga0207667_10077710 | 3300025949 | Bacteria | 3442 |
| 567 | Ga0207667_10094279 | 3300025949 | Bacteria | 3090 |
| 568 | Ga0207667_10506430 | 3300025949 | Unclassified | 1224 |
| 569 | Ga0207651_10715573 | 3300025960 | Bacteria | 883 |
| 570 | Ga0207651_10956080 | 3300025960 | Bacteria | 764 |
| 571 | Ga0207712_10052342 | 3300025961 | Bacteria | 2860 |
| 572 | Ga0207712_10339945 | 3300025961 | Bacteria | 1244 |
| 573 | Ga0207668_10009738 | 3300025972 | Bacteria | 5770 |
| 574 | Ga0207668_10188431 | 3300025972 | Bacteria | 1633 |
| 575 | Ga0207668_10588814 | 3300025972 | Bacteria | 968 |
| 576 | Ga0207668_10679050 | 3300025972 | Bacteria | 904 |
| 577 | Ga0207640_10812919 | 3300025981 | Bacteria | 811 |
| 578 | Ga0207677_10726142 | 3300026023 | Unclassified | 883 |
| 579 | Ga0207677_10825521 | 3300026023 | Bacteria | 831 |
| 580 | Ga0207677_11291240 | 3300026023 | Unclassified | 670 |
| 581 | Ga0207703_10464866 | 3300026035 | Archaea | 1184 |
| 582 | Ga0207639_10037858 | 3300026041 | Bacteria | 3586 |
| 583 | Ga0207639_10313465 | 3300026041 | Bacteria | 1391 |
| 584 | Ga0207678_10408754 | 3300026067 | Bacteria | 1176 |
| 585 | Ga0207678_10547149 | 3300026067 | Bacteria | 1012 |
| 586 | Ga0207678_11170749 | 3300026067 | Bacteria | 681 |
| 587 | Ga0207708_10067909 | 3300026075 | Bacteria | 2728 |
| 588 | Ga0207708_10077414 | 3300026075 | Bacteria | 2552 |
| 589 | Ga0207708_11473922 | 3300026075 | Bacteria | 598 |
| 590 | Ga0207708_11518936 | 3300026075 | Bacteria | 588 |
| 591 | Ga0207702_10004098 | 3300026078 | Bacteria | 13072 |
| 592 | Ga0207702_10065246 | 3300026078 | Unclassified | 3118 |
| 593 | Ga0207702_10619801 | 3300026078 | Bacteria | 1062 |
| 594 | Ga0207702_10811067 | 3300026078 | Bacteria | 925 |
| 595 | Ga0207702_11078791 | 3300026078 | Bacteria | 797 |
| 596 | Ga0207641_10898051 | 3300026088 | Unclassified | 880 |
| 597 | Ga0207641_11841514 | 3300026088 | Bacteria | 607 |
| 598 | Ga0207641_12328347 | 3300026088 | Unclassified | 535 |
| 599 | Ga0207648_10029509 | 3300026089 | Bacteria | 4863 |
| 600 | Ga0207648_10226366 | 3300026089 | Bacteria | 1663 |
| 601 | Ga0207648_10248860 | 3300026089 | Bacteria | 1584 |
| 602 | Ga0207676_10184195 | 3300026095 | Bacteria | 1831 |
| 603 | Ga0207674_10001150 | 3300026116 | Bacteria | 34275 |
| 604 | Ga0207674_10019690 | 3300026116 | Bacteria | 7306 |
| 605 | Ga0207674_10045789 | 3300026116 | Bacteria | 4497 |
| 606 | Ga0207674_10134684 | 3300026116 | Bacteria | 2433 |
| 607 | Ga0207674_10277288 | 3300026116 | Bacteria | 1624 |
| 608 | Ga0207674_10345643 | 3300026116 | Bacteria | 1438 |
| 609 | Ga0207675_100192496 | 3300026118 | Bacteria | 1956 |
| 610 | Ga0207675_100385654 | 3300026118 | Unclassified | 1378 |
| 611 | Ga0207683_10010822 | 3300026121 | Bacteria | 7778 |
| 612 | Ga0207683_10114313 | 3300026121 | Bacteria | 2418 |
| 613 | Ga0207683_10288195 | 3300026121 | Bacteria | 1501 |
| 614 | Ga0207698_10223582 | 3300026142 | Bacteria | 1703 |
| 615 | Ga0207698_10436443 | 3300026142 | Bacteria | 1261 |
| 616 | Ga0207698_10591646 | 3300026142 | Bacteria | 1093 |
| 617 | Ga0207698_10592366 | 3300026142 | Bacteria | 1092 |
| 618 | Ga0207698_11082165 | 3300026142 | Bacteria | 814 |
| 619 | Ga0207698_11410675 | 3300026142 | Bacteria | 712 |
| 620 | Ga0207698_12705961 | 3300026142 | Unclassified | 505 |
| 621 | Ga0207428_10000536 | 3300027907 | Bacteria | 45269 |
| 622 | Ga0207428_10012230 | 3300027907 | Bacteria | 7549 |
| 623 | Ga0207428_10026570 | 3300027907 | Bacteria | 4831 |
| 624 | Ga0207428_10044535 | 3300027907 | Bacteria | 3580 |
| 625 | Ga0207428_10333954 | 3300027907 | Bacteria | 1117 |
| 626 | Ga0207428_10596396 | 3300027907 | Bacteria | 796 |
| 627 | Ga0207428_11190180 | 3300027907 | Bacteria | 530 |
| 628 | Ga0268266_10036563 | 3300028379 | Bacteria | 4181 |
| 629 | Ga0268266_10090416 | 3300028379 | Bacteria | 2683 |
| 630 | Ga0268266_10944596 | 3300028379 | Bacteria | 834 |
| 631 | Ga0268266_11205453 | 3300028379 | Bacteria | 732 |
| 632 | Ga0268265_10910345 | 3300028380 | Unclassified | 864 |
| 633 | Ga0268264_10486763 | 3300028381 | Unclassified | 1201 |
| 634 | Ga0268264_10860024 | 3300028381 | Unclassified | 909 |
| 635 | Ga0316178_1037630 | 3300030735 | Unclassified | 630 |
| 636 | Ga0307408_101684150 | 3300031548 | Bacteria | 604 |
| 637 | Ga0307408_102061275 | 3300031548 | Bacteria | 549 |
| 638 | Ga0307408_102278527 | 3300031548 | Bacteria | 524 |
| 639 | Ga0307408_102290394 | 3300031548 | Unclassified | 523 |
| 640 | Ga0307405_10048936 | 3300031731 | Bacteria | 2610 |
| 641 | Ga0307405_10102728 | 3300031731 | Bacteria | 1921 |
| 642 | Ga0307405_10935387 | 3300031731 | Bacteria | 735 |
| 643 | Ga0307405_11037297 | 3300031731 | Unclassified | 702 |
| 644 | Ga0307405_11152827 | 3300031731 | Unclassified | 668 |
| 645 | Ga0307413_10007066 | 3300031824 | Bacteria | 5179 |
| 646 | Ga0307413_10254537 | 3300031824 | Bacteria | 1305 |
| 647 | Ga0307410_10015876 | 3300031852 | Bacteria | 4476 |
| 648 | Ga0307410_11447158 | 3300031852 | Unclassified | 604 |
| 649 | Ga0307406_10095538 | 3300031901 | Unclassified | 2011 |
| 650 | Ga0307406_10168082 | 3300031901 | Bacteria | 1584 |
| 651 | Ga0307406_11121042 | 3300031901 | Bacteria | 680 |
| 652 | Ga0307407_10003349 | 3300031903 | Bacteria | 6554 |
| 653 | Ga0307407_10175804 | 3300031903 | Unclassified | 1414 |
| 654 | Ga0307407_10233446 | 3300031903 | Bacteria | 1251 |
| 655 | Ga0307407_10631261 | 3300031903 | Bacteria | 801 |
| 656 | Ga0307407_11141684 | 3300031903 | Bacteria | 607 |
| 657 | Ga0307412_10091827 | 3300031911 | Bacteria | 2126 |
| 658 | Ga0307412_10093161 | 3300031911 | Bacteria | 2113 |
| 659 | Ga0307412_10329700 | 3300031911 | Bacteria | 1218 |
| 660 | Ga0307409_100003896 | 3300031995 | Bacteria | 8253 |
| 661 | Ga0307409_100045038 | 3300031995 | Bacteria | 3328 |
| 662 | Ga0307409_100115250 | 3300031995 | Bacteria | 2262 |
| 663 | Ga0307409_100206755 | 3300031995 | Unclassified | 1761 |
| 664 | Ga0307409_100311664 | 3300031995 | Bacteria | 1469 |
| 665 | Ga0307409_100384618 | 3300031995 | Bacteria | 1335 |
| 666 | Ga0307409_100517677 | 3300031995 | Bacteria | 1165 |
| 667 | Ga0307409_100588855 | 3300031995 | Bacteria | 1098 |
| 668 | Ga0307409_101527753 | 3300031995 | Bacteria | 695 |
| 669 | Ga0307409_102839468 | 3300031995 | Bacteria | 512 |
| 670 | Ga0307416_100029210 | 3300032002 | Bacteria | 4114 |
| 671 | Ga0307416_100032968 | 3300032002 | Bacteria | 3921 |
| 672 | Ga0307416_100153538 | 3300032002 | Bacteria | 2116 |
| 673 | Ga0307416_100516232 | 3300032002 | Bacteria | 1262 |
| 674 | Ga0307416_100566591 | 3300032002 | Bacteria | 1211 |
| 675 | Ga0307416_100687956 | 3300032002 | Unclassified | 1111 |
| 676 | Ga0307416_100985989 | 3300032002 | Bacteria | 945 |
| 677 | Ga0307416_100997313 | 3300032002 | Bacteria | 940 |
| 678 | Ga0307416_101166592 | 3300032002 | Bacteria | 876 |
| 679 | Ga0307416_101267778 | 3300032002 | Bacteria | 843 |
| 680 | Ga0307416_103312202 | 3300032002 | Bacteria | 539 |
| 681 | Ga0307414_10113787 | 3300032004 | Bacteria | 2066 |
| 682 | Ga0307414_10658948 | 3300032004 | Bacteria | 944 |
| 683 | Ga0307414_11577395 | 3300032004 | Bacteria | 612 |
| 684 | Ga0307411_10073410 | 3300032005 | Bacteria | 2327 |
| 685 | Ga0307411_10166703 | 3300032005 | Bacteria | 1657 |
| 686 | Ga0307411_11589718 | 3300032005 | Unclassified | 603 |
| 687 | Ga0307411_12212169 | 3300032005 | Bacteria | 516 |
| 688 | Ga0307415_100001530 | 3300032126 | Bacteria | 11099 |
| 689 | Ga0307415_100017904 | 3300032126 | Bacteria | 4261 |
| 690 | Ga0307415_100054831 | 3300032126 | Bacteria | 2724 |
| 691 | Ga0307415_100699011 | 3300032126 | Bacteria | 915 |
| 692 | Ga0373930_0121727 | 3300034816 | Bacteria | 636 |
| 693 | Ga0373944_0293153 | 3300035089 | Unclassified | 609 |
| 694 | Ga0373951_0263284 | 3300035091 | Bacteria | 521 |
| 695 | Ga0373932_0187110 | 3300035112 | Bacteria | 730 |
| 696 | Ga0373939_0395136 | 3300035114 | Bacteria | 572 |
| 697 | Ga0373954_0428778 | 3300035118 | Unclassified | 654 |
| 698 | Ga0373960_0400001 | 3300035121 | Bacteria | 530 |
| 699 | Ga0373942_0335848 | 3300035207 | Bacteria | 531 |
| 700 | Ga0373961_0095177 | 3300035241 | Bacteria | 957 |
| 701 | Ga0373931_0053746 | 3300035691 | Bacteria | 2150 |
| 702 | Ga0373931_1169192 | 3300035691 | Unclassified | 526 |
| 703 | Ga0373935_1101432 | 3300035692 | Bacteria | 591 |
| 704 | Ga0373947_0728286 | 3300035725 | Unclassified | 677 |
| 705 | Ga0395899_0007828 | 3300037312 | Bacteria | 8236 |
| 706 | Ga0395899_0008491 | 3300037312 | Bacteria | 7913 |
| 707 | Ga0395899_0012697 | 3300037312 | Bacteria | 6455 |
| 708 | Ga0395899_0014207 | 3300037312 | Bacteria | 6076 |
| 709 | Ga0395899_0021696 | 3300037312 | Bacteria | 4870 |
| 710 | Ga0395899_0033808 | 3300037312 | Bacteria | 3840 |
| 711 | Ga0395899_0050107 | 3300037312 | Bacteria | 3101 |
| 712 | Ga0395899_0145003 | 3300037312 | Bacteria | 1687 |
| 713 | Ga0395899_0145331 | 3300037312 | Bacteria | 1684 |
| 714 | Ga0395899_0166908 | 3300037312 | Unclassified | 1552 |
| 715 | Ga0395899_0316534 | 3300037312 | Unclassified | 1052 |
| 716 | Ga0395899_0531307 | 3300037312 | Bacteria | 759 |
| 717 | Ga0395899_0540227 | 3300037312 | Unclassified | 751 |
| 718 | Ga0395900_0001553 | 3300037418 | Bacteria | 27276 |
| 719 | Ga0395900_0012790 | 3300037418 | Bacteria | 8578 |
| 720 | Ga0395900_0021952 | 3300037418 | Bacteria | 6527 |
| 721 | Ga0395900_0022614 | 3300037418 | Bacteria | 6434 |
| 722 | Ga0395900_0023193 | 3300037418 | Bacteria | 6352 |
| 723 | Ga0395900_0050981 | 3300037418 | Bacteria | 4263 |
| 724 | Ga0395900_0052104 | 3300037418 | Bacteria | 4213 |
| 725 | Ga0395900_0055656 | 3300037418 | Bacteria | 4073 |
| 726 | Ga0395900_0070049 | 3300037418 | Unclassified | 3605 |
| 727 | Ga0395900_0075062 | 3300037418 | Bacteria | 3475 |
| 728 | Ga0395900_0115199 | 3300037418 | Bacteria | 2758 |
| 729 | Ga0395900_0145035 | 3300037418 | Bacteria | 2428 |
| 730 | Ga0395900_0202017 | 3300037418 | Bacteria | 2010 |
| 731 | Ga0395900_0219935 | 3300037418 | Bacteria | 1915 |
| 732 | Ga0395900_0289524 | 3300037418 | Unclassified | 1627 |
| 733 | Ga0395900_0378820 | 3300037418 | Bacteria | 1383 |
| 734 | Ga0395900_0492682 | 3300037418 | Bacteria | 1177 |
| 735 | Ga0395900_0532422 | 3300037418 | Bacteria | 1121 |
| 736 | Ga0395900_0589808 | 3300037418 | Bacteria | 1053 |
| 737 | Ga0395900_0781683 | 3300037418 | Bacteria | 883 |
| 738 | Ga0395900_0925434 | 3300037418 | Bacteria | 794 |
| 739 | Ga0395900_1034123 | 3300037418 | Bacteria | 740 |
| 740 | Ga0395900_1270813 | 3300037418 | Bacteria | 650 |
| 741 | Ga0395900_1277452 | 3300037418 | Bacteria | 648 |
| 742 | Ga0395900_1409215 | 3300037418 | Bacteria | 610 |
| 743 | Ga0395900_1519988 | 3300037418 | Bacteria | 581 |
| 744 | Ga0395900_1669698 | 3300037418 | Unclassified | 548 |
| 745 | Ga0395900_1870118 | 3300037418 | Unclassified | 511 |
| 746 | Ga0395898_0002858 | 3300037466 | Bacteria | 19705 |
| 747 | Ga0395898_0021795 | 3300037466 | Bacteria | 6492 |
| 748 | Ga0395898_0025590 | 3300037466 | Bacteria | 5944 |
| 749 | Ga0395898_0027149 | 3300037466 | Bacteria | 5750 |
| 750 | Ga0395898_0037487 | 3300037466 | Bacteria | 4808 |
| 751 | Ga0395898_0041969 | 3300037466 | Bacteria | 4516 |
| 752 | Ga0395898_0093507 | 3300037466 | Bacteria | 2889 |
| 753 | Ga0395898_0096225 | 3300037466 | Bacteria | 2844 |
| 754 | Ga0395898_0234996 | 3300037466 | Bacteria | 1748 |
| 755 | Ga0395898_0381341 | 3300037466 | Bacteria | 1344 |
| 756 | Ga0395898_0508228 | 3300037466 | Bacteria | 1146 |
| 757 | Ga0395898_0648023 | 3300037466 | Unclassified | 999 |
| 758 | Ga0395898_0766874 | 3300037466 | Bacteria | 905 |
| 759 | Ga0395898_0974239 | 3300037466 | Unclassified | 784 |
| 760 | Ga0395898_1090281 | 3300037466 | Bacteria | 732 |
| 761 | Ga0395898_1316919 | 3300037466 | Bacteria | 651 |
| 762 | Ga0395898_1730324 | 3300037466 | Bacteria | 547 |
| 763 | Ga0395905_0002826 | 3300037471 | Bacteria | 19022 |
| 764 | Ga0395905_0005069 | 3300037471 | Bacteria | 13555 |
| 765 | Ga0395905_0006393 | 3300037471 | Bacteria | 11872 |
| 766 | Ga0395905_0012073 | 3300037471 | Bacteria | 8324 |
| 767 | Ga0395905_0018558 | 3300037471 | Bacteria | 6600 |
| 768 | Ga0395905_0029705 | 3300037471 | Bacteria | 5151 |
| 769 | Ga0395905_0033462 | 3300037471 | Bacteria | 4828 |
| 770 | Ga0395905_0064347 | 3300037471 | Bacteria | 3432 |
| 771 | Ga0395905_0101391 | 3300037471 | Bacteria | 2702 |
| 772 | Ga0395905_0107338 | 3300037471 | Bacteria | 2621 |
| 773 | Ga0395905_0113689 | 3300037471 | Bacteria | 2543 |
| 774 | Ga0395905_0114990 | 3300037471 | Unclassified | 2528 |
| 775 | Ga0395905_0147772 | 3300037471 | Bacteria | 2211 |
| 776 | Ga0395905_0150369 | 3300037471 | Unclassified | 2190 |
| 777 | Ga0395905_0159763 | 3300037471 | Bacteria | 2118 |
| 778 | Ga0395905_0188991 | 3300037471 | Bacteria | 1932 |
| 779 | Ga0395905_0698388 | 3300037471 | Unclassified | 917 |
| 780 | Ga0395905_0799838 | 3300037471 | Bacteria | 846 |
| 781 | Ga0395905_0807432 | 3300037471 | Unclassified | 841 |
| 782 | Ga0395905_1176322 | 3300037471 | Bacteria | 670 |
| 783 | Ga0395905_1270012 | 3300037471 | Bacteria | 640 |
| 784 | Ga0395905_1444153 | 3300037471 | Unclassified | 592 |
| 785 | Ga0395905_1583378 | 3300037471 | Bacteria | 560 |
| 786 | Ga0395901_0003414 | 3300038443 | Bacteria | 16004 |
| 787 | Ga0395901_0006478 | 3300038443 | Bacteria | 11853 |
| 788 | Ga0395901_0007417 | 3300038443 | Bacteria | 11065 |
| 789 | Ga0395901_0009653 | 3300038443 | Bacteria | 9789 |
| 790 | Ga0395901_0010617 | 3300038443 | Bacteria | 9331 |
| 791 | Ga0395901_0022705 | 3300038443 | Bacteria | 6433 |
| 792 | Ga0395901_0033632 | 3300038443 | Bacteria | 5293 |
| 793 | Ga0395901_0045082 | 3300038443 | Bacteria | 4575 |
| 794 | Ga0395901_0066857 | 3300038443 | Bacteria | 3743 |
| 795 | Ga0395901_0078559 | 3300038443 | Bacteria | 3445 |
| 796 | Ga0395901_0135207 | 3300038443 | Bacteria | 2591 |
| 797 | Ga0395901_0173151 | 3300038443 | Bacteria | 2264 |
| 798 | Ga0395901_0237332 | 3300038443 | Unclassified | 1902 |
| 799 | Ga0395901_0321267 | 3300038443 | Unclassified | 1601 |
| 800 | Ga0395901_0344220 | 3300038443 | Bacteria | 1540 |
| 801 | Ga0395901_0367390 | 3300038443 | Bacteria | 1482 |
| 802 | Ga0395901_0382551 | 3300038443 | Bacteria | 1448 |
| 803 | Ga0395901_0405310 | 3300038443 | Unclassified | 1400 |
| 804 | Ga0395901_0434487 | 3300038443 | Bacteria | 1345 |
| 805 | Ga0395901_0451648 | 3300038443 | Bacteria | 1314 |
| 806 | Ga0395901_0593840 | 3300038443 | Bacteria | 1117 |
| 807 | Ga0395901_0603207 | 3300038443 | Bacteria | 1107 |
| 808 | Ga0395901_0611251 | 3300038443 | Bacteria | 1098 |
| 809 | Ga0395901_0674757 | 3300038443 | Unclassified | 1034 |
| 810 | Ga0395901_0821798 | 3300038443 | Unclassified | 917 |
| 811 | Ga0395901_0929463 | 3300038443 | Bacteria | 850 |
| 812 | Ga0395901_0963153 | 3300038443 | Unclassified | 831 |
| 813 | Ga0395901_0968798 | 3300038443 | Bacteria | 828 |
| 814 | Ga0395901_0996210 | 3300038443 | Unclassified | 814 |
| 815 | Ga0395901_1336957 | 3300038443 | Bacteria | 677 |
| 816 | Ga0395901_1570188 | 3300038443 | Bacteria | 612 |
| 817 | Ga0395901_1870151 | 3300038443 | Bacteria | 548 |
| 818 | Ga0439436_0218924 | 3300041404 | Unclassified | 547 |
| 819 | Ga0439438_130960 | 3300041405 | Bacteria | 601 |
| 820 | Ga0439439_0006255 | 3300041406 | Unclassified | 2748 |
| 821 | Ga0439453_0002223 | 3300041408 | Bacteria | 2645 |
| 822 | Ga0439453_0005720 | 3300041408 | Bacteria | 1905 |
| 823 | Ga0439461_0031942 | 3300041410 | Unclassified | 1102 |
| 824 | Ga0439466_0088650 | 3300041411 | Unclassified | 971 |
| 825 | Ga0451800_0309535 | 3300041459 | Unclassified | 606 |
| 826 | Ga0451853_2179209 | 3300041512 | Unclassified | 677 |
| 827 | Ga0439431_0111550 | 3300041997 | Bacteria | 758 |
| 828 | Ga0439431_0138589 | 3300041997 | Bacteria | 686 |
| 829 | Ga0439433_0023140 | 3300041999 | Unclassified | 1397 |
| 830 | Ga0439437_015360 | 3300042000 | Bacteria | 899 |
| 831 | Ga0439441_017373 | 3300042001 | Bacteria | 1291 |
| 832 | Ga0439442_006866 | 3300042002 | Bacteria | 2285 |
| 833 | Ga0439442_023510 | 3300042002 | Bacteria | 1281 |
| 834 | Ga0439445_0178903 | 3300042004 | Unclassified | 623 |
| 835 | Ga0439448_0003027 | 3300042005 | Bacteria | 4618 |
| 836 | Ga0439448_0061733 | 3300042005 | Unclassified | 1239 |
| 837 | Ga0439449_0058128 | 3300042007 | Unclassified | 1428 |
| 838 | Ga0439450_049964 | 3300042008 | Bacteria | 991 |
| 839 | Ga0439451_016636 | 3300042009 | Bacteria | 1481 |
| 840 | Ga0439451_024833 | 3300042009 | Bacteria | 1207 |
| 841 | Ga0439452_088132 | 3300042010 | Bacteria | 672 |
| 842 | Ga0439454_081731 | 3300042011 | Bacteria | 586 |
| 843 | Ga0439455_0217342 | 3300042012 | Bacteria | 555 |
| 844 | Ga0439455_0240557 | 3300042012 | Unclassified | 529 |
| 845 | Ga0439462_0004580 | 3300042015 | Bacteria | 3384 |
| 846 | Ga0439463_120763 | 3300042016 | Bacteria | 677 |
| 847 | Ga0439463_175103 | 3300042016 | Bacteria | 557 |
| 848 | Ga0450914_021871 | 3300042118 | Bacteria | 718 |
| 849 | Ga0450920_089665 | 3300042122 | Bacteria | 634 |
| 850 | Ga0450923_173904 | 3300042125 | Unclassified | 528 |
| 851 | Ga0450890_023110 | 3300042127 | Bacteria | 853 |
| 852 | Ga0450900_011248 | 3300042136 | Bacteria | 1160 |
| 853 | Ga0450902_029791 | 3300042137 | Bacteria | 917 |
| 854 | Ga0450905_015382 | 3300042142 | Bacteria | 1097 |
| 855 | Ga0450907_005941 | 3300042146 | Bacteria | 2049 |
| 856 | Ga0450910_036354 | 3300042147 | Bacteria | 787 |
| 857 | Ga0450910_056967 | 3300042147 | Bacteria | 654 |
| 858 | Ga0439446_0021133 | 3300042156 | Bacteria | 1838 |
| 859 | Ga0439458_0021478 | 3300042157 | Bacteria | 1495 |
| 860 | Ga0439458_0205994 | 3300042157 | Bacteria | 539 |
| 861 | Ga0450908_006627 | 3300042184 | Bacteria | 2194 |
| 862 | Ga0439434_0026709 | 3300042435 | Unclassified | 1744 |
| 863 | Ga0439434_0038317 | 3300042435 | Bacteria | 1469 |
| 864 | Ga0439435_0034455 | 3300042436 | Bacteria | 1392 |
| 865 | Ga0439435_0295357 | 3300042436 | Bacteria | 554 |
| 866 | Ga0439464_0099723 | 3300042439 | Bacteria | 882 |
| 867 | Ga0450918_009019 | 3300042531 | Bacteria | 1750 |
| 868 | Ga0439440_0231308 | 3300042993 | Unclassified | 557 |
| 869 | Ga0466972_0168827 | 3300044658 | Unclassified | 1027 |
| 870 | Ga0466965_0339077 | 3300044683 | Bacteria | 821 |
| 871 | Ga0466966_0029678 | 3300044684 | Bacteria | 3556 |
| 872 | Ga0466961_0017470 | 3300044693 | Bacteria | 4609 |
| 873 | Ga0466961_0064374 | 3300044693 | Unclassified | 2330 |
| 874 | Ga0466961_0488804 | 3300044693 | Bacteria | 744 |
| 875 | Ga0466963_0013473 | 3300044694 | Bacteria | 5021 |
| 876 | Ga0466963_0015435 | 3300044694 | Bacteria | 4730 |
| 877 | Ga0466963_0063986 | 3300044694 | Bacteria | 2463 |
| 878 | Ga0466963_0079946 | 3300044694 | Bacteria | 2212 |
| 879 | Ga0466963_0225724 | 3300044694 | Bacteria | 1312 |
| 880 | Ga0466963_0589795 | 3300044694 | Bacteria | 785 |
| 881 | Ga0466963_0856809 | 3300044694 | Bacteria | 641 |
| 882 | Ga0466963_1196040 | 3300044694 | Bacteria | 534 |
| 883 | Ga0466964_0028639 | 3300044706 | Bacteria | 2196 |
| 884 | Ga0466964_0188501 | 3300044706 | Bacteria | 982 |
| 885 | Ga0466964_0269470 | 3300044706 | Bacteria | 847 |
| 886 | Ga0466964_0327517 | 3300044706 | Bacteria | 780 |
| 887 | Ga0466971_0000831 | 3300044719 | Bacteria | 12521 |
| 888 | Ga0466968_0032855 | 3300044735 | Unclassified | 2160 |
| 889 | Ga0466968_0485567 | 3300044735 | Unclassified | 614 |
| 890 | Ga0466968_0505392 | 3300044735 | Bacteria | 603 |
| 891 | Ga0466970_0177592 | 3300044765 | Unclassified | 1181 |
| 892 | Ga0466957_0001330 | 3300044842 | Bacteria | 12901 |
| 893 | Ga0466960_0101107 | 3300044901 | Bacteria | 1485 |
| 894 | Ga0466960_0268311 | 3300044901 | Bacteria | 953 |
| 895 | Ga0466960_0470536 | 3300044901 | Bacteria | 733 |
| 896 | Ga0466960_0537309 | 3300044901 | Bacteria | 688 |
| 897 | Ga0466959_0015047 | 3300045049 | Bacteria | 5635 |
| 898 | Ga0451576_0510263 | 3300045051 | Bacteria | 1263 |
| 899 | Ga0451576_1146877 | 3300045051 | Bacteria | 813 |
| 900 | Ga0466958_0008659 | 3300045836 | Bacteria | 5650 |
| 901 | Ga0466958_0011986 | 3300045836 | Bacteria | 4898 |
| 902 | Ga0466967_0011587 | 3300045976 | Bacteria | 6692 |
| 903 | Ga0466967_0038525 | 3300045976 | Bacteria | 4100 |
| 904 | Ga0466967_0074894 | 3300045976 | Bacteria | 3042 |
| 905 | Ga0466967_0100598 | 3300045976 | Bacteria | 2641 |
| 906 | Ga0466967_0116897 | 3300045976 | Bacteria | 2457 |
| 907 | Ga0466967_0152767 | 3300045976 | Bacteria | 2159 |
| 908 | Ga0466967_0168181 | 3300045976 | Bacteria | 2061 |
| 909 | Ga0466967_0211307 | 3300045976 | Bacteria | 1840 |
| 910 | Ga0466967_0628889 | 3300045976 | Bacteria | 1060 |
| 911 | Ga0466967_0641626 | 3300045976 | Bacteria | 1050 |
| 912 | Ga0466967_0660269 | 3300045976 | Bacteria | 1034 |
| 913 | Ga0466967_0865924 | 3300045976 | Bacteria | 898 |
| 914 | Ga0466967_0899719 | 3300045976 | Unclassified | 880 |
| 915 | Ga0466967_1025621 | 3300045976 | Bacteria | 822 |
| 916 | Ga0466967_1038663 | 3300045976 | Bacteria | 816 |
| 917 | Ga0466967_2491659 | 3300045976 | Bacteria | 512 |
| 918 | Ga0495627_070290 | 3300046453 | Bacteria | 1024 |
| 919 | Ga0495603_0144422 | 3300046455 | Unclassified | 1384 |
| 920 | Ga0495590_0374008 | 3300046457 | Bacteria | 544 |
| 921 | Ga0495629_0428947 | 3300046459 | Bacteria | 897 |
| 922 | Ga0495582_0532604 | 3300046473 | Bacteria | 679 |
| 923 | Ga0495582_0557761 | 3300046473 | Bacteria | 663 |
| 924 | Ga0495605_0310537 | 3300046474 | Unclassified | 666 |
| 925 | Ga0495584_0520786 | 3300046491 | Bacteria | 606 |
| 926 | Ga0495596_0081125 | 3300046500 | Bacteria | 1259 |
| 927 | Ga0495596_0451081 | 3300046500 | Unclassified | 502 |
| 928 | Ga0495607_0497972 | 3300046501 | Bacteria | 541 |
| 929 | Ga0495620_0065799 | 3300046515 | Bacteria | 1495 |
| 930 | Ga0495628_0100958 | 3300046516 | Unclassified | 2227 |
| 931 | Ga0495630_0052439 | 3300046517 | Bacteria | 3054 |
| 932 | Ga0495630_0226607 | 3300046517 | Bacteria | 1427 |
| 933 | Ga0495630_0342463 | 3300046517 | Bacteria | 1144 |
| 934 | Ga0495663_0144823 | 3300046525 | Bacteria | 808 |
| 935 | Ga0495640_0229753 | 3300046533 | Bacteria | 1167 |
| 936 | Ga0495587_0089926 | 3300046536 | Bacteria | 1774 |
| 937 | Ga0495621_0027072 | 3300046539 | Bacteria | 1939 |
| 938 | Ga0495667_0173584 | 3300046559 | Bacteria | 1385 |
| 939 | Ga0495656_0254606 | 3300046615 | Bacteria | 888 |
| 940 | Ga0495656_0419928 | 3300046615 | Bacteria | 702 |
| 941 | Ga0495668_0188362 | 3300046616 | Bacteria | 1130 |
| 942 | Ga0495625_0280710 | 3300046660 | Bacteria | 1072 |
| 943 | Ga0495635_0667308 | 3300046663 | Bacteria | 676 |
| 944 | Ga0495657_0164444 | 3300046675 | Bacteria | 1371 |
| 945 | Ga0495623_0283267 | 3300046679 | Bacteria | 921 |
| 946 | Ga0495647_0615142 | 3300046681 | Bacteria | 510 |
| 947 | Ga0495613_0285627 | 3300046689 | Bacteria | 1145 |
| 948 | Ga0495613_0794556 | 3300046689 | Bacteria | 618 |
| 949 | Ga0495600_0115691 | 3300046809 | Bacteria | 1746 |
| 950 | Ga0495581_0474673 | 3300047315 | Bacteria | 728 |
| 951 | Ga0495674_0418827 | 3300047319 | Bacteria | 1079 |
| 952 | Ga0495676_0205592 | 3300047321 | Unclassified | 1366 |
| 953 | Ga0495676_0760623 | 3300047321 | Unclassified | 625 |
| 954 | Ga0495680_0368245 | 3300047322 | Bacteria | 997 |
| 955 | Ga0495680_0497478 | 3300047322 | Bacteria | 828 |
| 956 | Ga0495675_0212780 | 3300047444 | Bacteria | 1173 |
| 957 | Ga0495679_211766 | 3300047446 | Unclassified | 508 |
| 958 | Ga0495684_0470105 | 3300047471 | Bacteria | 870 |
| 959 | Ga0495614_0583253 | 3300048089 | Bacteria | 536 |
| 960 | Ga0496100_0058352 | 3300048903 | Bacteria | 2532 |
| 961 | Ga0496100_0125907 | 3300048903 | Bacteria | 1798 |
| 962 | Ga0496100_1102817 | 3300048903 | Unclassified | 625 |
| 963 | Ga0496100_1376458 | 3300048903 | Bacteria | 557 |
| 964 | Ga0496101_0063660 | 3300048904 | Bacteria | 2685 |
| 965 | Ga0496101_0081843 | 3300048904 | Bacteria | 2389 |
| 966 | Ga0496101_0091651 | 3300048904 | Bacteria | 2262 |
| 967 | Ga0496101_0197564 | 3300048904 | Bacteria | 1554 |
| 968 | Ga0496101_0331030 | 3300048904 | Bacteria | 1195 |
| 969 | Ga0496102_0022571 | 3300048905 | Bacteria | 5577 |
| 970 | Ga0496102_0023009 | 3300048905 | Bacteria | 5529 |
| 971 | Ga0496102_0031090 | 3300048905 | Bacteria | 4785 |
| 972 | Ga0496102_0252706 | 3300048905 | Unclassified | 1662 |
| 973 | Ga0496102_0323854 | 3300048905 | Bacteria | 1452 |
| 974 | Ga0496103_0007091 | 3300048906 | Bacteria | 6691 |
| 975 | Ga0496103_0069723 | 3300048906 | Bacteria | 2198 |
| 976 | Ga0496103_0712851 | 3300048906 | Bacteria | 636 |
| 977 | Ga0496104_0012670 | 3300048907 | Bacteria | 7593 |
| 978 | Ga0496104_0233141 | 3300048907 | Bacteria | 1753 |
| 979 | Ga0496104_0324386 | 3300048907 | Bacteria | 1453 |
| 980 | Ga0496104_1174299 | 3300048907 | Bacteria | 671 |
| 981 | Ga0496105_0996113 | 3300048908 | Bacteria | 627 |
| 982 | Ga0496106_0020914 | 3300048909 | Bacteria | 4856 |
| 983 | Ga0496106_0118474 | 3300048909 | Bacteria | 2067 |
| 984 | Ga0496106_0216819 | 3300048909 | Bacteria | 1525 |
| 985 | Ga0496106_1205921 | 3300048909 | Bacteria | 590 |
| 986 | Ga0496107_0077631 | 3300048910 | Bacteria | 2419 |
| 987 | Ga0496107_0159994 | 3300048910 | Bacteria | 1668 |
| 988 | Ga0496107_0214404 | 3300048910 | Bacteria | 1432 |
| 989 | Ga0496108_0263078 | 3300048911 | Bacteria | 1501 |
| 990 | Ga0496108_0379032 | 3300048911 | Bacteria | 1235 |
| 991 | Ga0496108_0503910 | 3300048911 | Bacteria | 1057 |
| 992 | Ga0496109_0103463 | 3300048912 | Bacteria | 2643 |
| 993 | Ga0496109_0215223 | 3300048912 | Bacteria | 1807 |
| 994 | Ga0496109_0244829 | 3300048912 | Bacteria | 1688 |
| 995 | Ga0496109_1722827 | 3300048912 | Bacteria | 560 |
| 996 | Ga0496110_0009650 | 3300048913 | Bacteria | 7815 |
| 997 | Ga0496110_0011731 | 3300048913 | Bacteria | 7190 |
| 998 | Ga0496110_0189259 | 3300048913 | Bacteria | 1869 |
| 999 | Ga0496110_0208339 | 3300048913 | Bacteria | 1777 |
| 1000 | Ga0496110_0230674 | 3300048913 | Bacteria | 1684 |
| 1001 | Ga0496110_0271396 | 3300048913 | Bacteria | 1544 |
| 1002 | Ga0496110_0410081 | 3300048913 | Bacteria | 1235 |
| 1003 | Ga0496110_0555096 | 3300048913 | Bacteria | 1044 |
| 1004 | Ga0496110_0767124 | 3300048913 | Bacteria | 868 |
| 1005 | Ga0496111_0045231 | 3300048914 | Bacteria | 3167 |
| 1006 | Ga0496111_0049657 | 3300048914 | Bacteria | 3025 |
| 1007 | Ga0496111_0059509 | 3300048914 | Bacteria | 2768 |
| 1008 | Ga0496111_0146490 | 3300048914 | Bacteria | 1751 |
| 1009 | Ga0496111_0169093 | 3300048914 | Bacteria | 1624 |
| 1010 | Ga0496111_0199124 | 3300048914 | Bacteria | 1489 |
| 1011 | Ga0496111_0742926 | 3300048914 | Bacteria | 712 |
| 1012 | Ga0496111_0822427 | 3300048914 | Unclassified | 672 |
| 1013 | Ga0496111_1100938 | 3300048914 | Unclassified | 566 |
| 1014 | Ga0496112_0003611 | 3300048915 | Bacteria | 12880 |
| 1015 | Ga0496112_0047768 | 3300048915 | Bacteria | 4199 |
| 1016 | Ga0496112_0094601 | 3300048915 | Bacteria | 2958 |
| 1017 | Ga0496112_0110992 | 3300048915 | Bacteria | 2712 |
| 1018 | Ga0496112_0146267 | 3300048915 | Unclassified | 2332 |
| 1019 | Ga0496112_1476198 | 3300048915 | Bacteria | 594 |
| 1020 | Ga0496113_0265442 | 3300048916 | Bacteria | 1372 |
| 1021 | Ga0496113_1123001 | 3300048916 | Bacteria | 616 |
| 1022 | Ga0496114_0000442 | 3300048917 | Bacteria | 30535 |
| 1023 | Ga0496114_0066590 | 3300048917 | Bacteria | 3020 |
| 1024 | Ga0496114_0142410 | 3300048917 | Bacteria | 2077 |
| 1025 | Ga0496114_0765749 | 3300048917 | Unclassified | 843 |
| 1026 | Ga0496114_1526629 | 3300048917 | Unclassified | 556 |
| 1027 | Ga0496114_1665284 | 3300048917 | Archaea | 526 |
| 1028 | Ga0496115_1209130 | 3300048918 | Bacteria | 567 |
| 1029 | Ga0501031_0000143 | 3300049568 | Bacteria | 40199 |
| 1030 | Ga0501031_0010987 | 3300049568 | Bacteria | 5900 |
| 1031 | Ga0501031_0093994 | 3300049568 | Bacteria | 1956 |
| 1032 | Ga0501031_0211263 | 3300049568 | Bacteria | 1264 |
| 1033 | Ga0501031_0649800 | 3300049568 | Bacteria | 678 |
| 1034 | Ga0501031_0734714 | 3300049568 | Bacteria | 633 |
| 1035 | Ga0501032_0009219 | 3300049569 | Bacteria | 7156 |
| 1036 | Ga0501032_0545993 | 3300049569 | Bacteria | 739 |
| 1037 | Ga0501032_0585018 | 3300049569 | Bacteria | 711 |
| 1038 | Ga0501032_0691671 | 3300049569 | Bacteria | 646 |
| 1039 | Ga0501032_0834809 | 3300049569 | Unclassified | 581 |
| 1040 | Ga0501033_0002376 | 3300049570 | Bacteria | 16028 |
| 1041 | Ga0501033_0022460 | 3300049570 | Bacteria | 4759 |
| 1042 | Ga0501033_0066278 | 3300049570 | Unclassified | 2655 |
| 1043 | Ga0501033_0494914 | 3300049570 | Bacteria | 846 |
| 1044 | Ga0501033_1154416 | 3300049570 | Bacteria | 514 |
| 1045 | Ga0501034_0014167 | 3300049571 | Bacteria | 8218 |
| 1046 | Ga0501034_0049959 | 3300049571 | Bacteria | 4219 |
| 1047 | Ga0501034_1679246 | 3300049571 | Bacteria | 508 |
| 1048 | Ga0501036_0000767 | 3300049572 | Bacteria | 23813 |
| 1049 | Ga0501036_0007871 | 3300049572 | Bacteria | 8717 |
| 1050 | Ga0501036_0040462 | 3300049572 | Bacteria | 3942 |
| 1051 | Ga0501036_0161358 | 3300049572 | Bacteria | 1890 |
| 1052 | Ga0501036_0268483 | 3300049572 | Bacteria | 1429 |
| 1053 | Ga0501036_0304389 | 3300049572 | Unclassified | 1333 |
| 1054 | Ga0501036_0789500 | 3300049572 | Bacteria | 782 |
| 1055 | Ga0501036_0826123 | 3300049572 | Unclassified | 762 |
| 1056 | Ga0501036_0919297 | 3300049572 | Bacteria | 718 |
| 1057 | Ga0501036_1235105 | 3300049572 | Bacteria | 608 |
| 1058 | Ga0501037_0000558 | 3300049573 | Bacteria | 29625 |
| 1059 | Ga0501037_0249679 | 3300049573 | Bacteria | 1242 |
| 1060 | Ga0501037_0509819 | 3300049573 | Bacteria | 815 |
| 1061 | Ga0501037_1022604 | 3300049573 | Bacteria | 537 |
| 1062 | Ga0501038_0001974 | 3300049574 | Bacteria | 18950 |
| 1063 | Ga0501038_0258729 | 3300049574 | Unclassified | 1376 |
| 1064 | Ga0501038_0349151 | 3300049574 | Bacteria | 1152 |
| 1065 | Ga0501038_0425750 | 3300049574 | Bacteria | 1023 |
| 1066 | Ga0501038_0889508 | 3300049574 | Bacteria | 658 |
| 1067 | Ga0501038_0890600 | 3300049574 | Bacteria | 657 |
| 1068 | Ga0501038_1003975 | 3300049574 | Bacteria | 613 |
| 1069 | Ga0501038_1014378 | 3300049574 | Bacteria | 609 |
| 1070 | Ga0501039_0003385 | 3300049575 | Bacteria | 11921 |
| 1071 | Ga0501039_0011636 | 3300049575 | Bacteria | 6700 |
| 1072 | Ga0501039_0013440 | 3300049575 | Bacteria | 6261 |
| 1073 | Ga0501039_0016294 | 3300049575 | Bacteria | 5694 |
| 1074 | Ga0501039_0109933 | 3300049575 | Bacteria | 2155 |
| 1075 | Ga0501039_0161148 | 3300049575 | Bacteria | 1763 |
| 1076 | Ga0501039_0361031 | 3300049575 | Bacteria | 1141 |
| 1077 | Ga0501039_0810018 | 3300049575 | Bacteria | 730 |
| 1078 | Ga0501039_1569589 | 3300049575 | Bacteria | 505 |
| 1079 | Ga0501040_0001835 | 3300049576 | Bacteria | 13646 |
| 1080 | Ga0501040_0029984 | 3300049576 | Bacteria | 3671 |
| 1081 | Ga0501040_0035697 | 3300049576 | Bacteria | 3372 |
| 1082 | Ga0501040_0079269 | 3300049576 | Bacteria | 2273 |
| 1083 | Ga0501040_0335680 | 3300049576 | Bacteria | 1082 |
| 1084 | Ga0501040_0422684 | 3300049576 | Bacteria | 958 |
| 1085 | Ga0501040_0601621 | 3300049576 | Bacteria | 794 |
| 1086 | Ga0501040_0929063 | 3300049576 | Bacteria | 630 |
| 1087 | Ga0501040_1144958 | 3300049576 | Bacteria | 564 |
| 1088 | Ga0501041_0011657 | 3300049577 | Bacteria | 5201 |
| 1089 | Ga0501041_0020444 | 3300049577 | Bacteria | 3958 |
| 1090 | Ga0501041_0025444 | 3300049577 | Bacteria | 3556 |
| 1091 | Ga0501041_0154948 | 3300049577 | Bacteria | 1431 |
| 1092 | Ga0501041_0193988 | 3300049577 | Bacteria | 1272 |
| 1093 | Ga0501041_0271990 | 3300049577 | Bacteria | 1066 |
| 1094 | Ga0501041_0484353 | 3300049577 | Bacteria | 786 |
| 1095 | Ga0501041_0743683 | 3300049577 | Bacteria | 628 |
| 1096 | Ga0501041_0751927 | 3300049577 | Bacteria | 624 |
| 1097 | Ga0501041_0854362 | 3300049577 | Bacteria | 584 |
| 1098 | Ga0501041_0870367 | 3300049577 | Bacteria | 578 |
| 1099 | Ga0501041_0901216 | 3300049577 | Bacteria | 568 |
| 1100 | Ga0501042_0000785 | 3300049578 | Bacteria | 17383 |
| 1101 | Ga0501042_0007018 | 3300049578 | Bacteria | 7354 |
| 1102 | Ga0501042_0018547 | 3300049578 | Bacteria | 4819 |
| 1103 | Ga0501042_0020334 | 3300049578 | Bacteria | 4619 |
| 1104 | Ga0501042_0024913 | 3300049578 | Bacteria | 4200 |
| 1105 | Ga0501042_0114240 | 3300049578 | Bacteria | 1944 |
| 1106 | Ga0501042_0240505 | 3300049578 | Bacteria | 1306 |
| 1107 | Ga0501042_0365805 | 3300049578 | Bacteria | 1044 |
| 1108 | Ga0501042_0696913 | 3300049578 | Unclassified | 738 |
| 1109 | Ga0501042_0701218 | 3300049578 | Unclassified | 736 |
| 1110 | Ga0501042_0887674 | 3300049578 | Bacteria | 649 |
| 1111 | Ga0501042_1420390 | 3300049578 | Bacteria | 506 |
| 1112 | Ga0501042_1456793 | 3300049578 | Bacteria | 500 |
| 1113 | Ga0501043_0003153 | 3300049579 | Bacteria | 13646 |
| 1114 | Ga0501043_0021083 | 3300049579 | Bacteria | 5108 |
| 1115 | Ga0501043_0166122 | 3300049579 | Bacteria | 1723 |
| 1116 | Ga0501043_0260959 | 3300049579 | Unclassified | 1332 |
| 1117 | Ga0501043_0700312 | 3300049579 | Bacteria | 740 |
| 1118 | Ga0501043_1118921 | 3300049579 | Bacteria | 556 |
| 1119 | Ga0501046_0004710 | 3300049580 | Bacteria | 12302 |
| 1120 | Ga0501046_0024951 | 3300049580 | Bacteria | 4898 |
| 1121 | Ga0501046_0036430 | 3300049580 | Bacteria | 3958 |
| 1122 | Ga0501046_0040701 | 3300049580 | Bacteria | 3712 |
| 1123 | Ga0501046_0400863 | 3300049580 | Bacteria | 991 |
| 1124 | Ga0501047_0004536 | 3300049581 | Bacteria | 13058 |
| 1125 | Ga0501047_0009861 | 3300049581 | Bacteria | 9026 |
| 1126 | Ga0501047_0017625 | 3300049581 | Bacteria | 6843 |
| 1127 | Ga0501047_0324560 | 3300049581 | Bacteria | 1379 |
| 1128 | Ga0501048_0010994 | 3300049582 | Bacteria | 6752 |
| 1129 | Ga0501048_0012448 | 3300049582 | Bacteria | 6328 |
| 1130 | Ga0501048_0083807 | 3300049582 | Bacteria | 2248 |
| 1131 | Ga0501048_0085103 | 3300049582 | Bacteria | 2230 |
| 1132 | Ga0501048_0149585 | 3300049582 | Bacteria | 1651 |
| 1133 | Ga0501048_0469530 | 3300049582 | Bacteria | 901 |
| 1134 | Ga0501048_0779465 | 3300049582 | Bacteria | 687 |
| 1135 | Ga0501048_0819044 | 3300049582 | Bacteria | 669 |
| 1136 | Ga0501048_0972170 | 3300049582 | Bacteria | 611 |
| 1137 | Ga0501048_1203066 | 3300049582 | Bacteria | 545 |
| 1138 | Ga0501048_1363443 | 3300049582 | Bacteria | 510 |
| 1139 | Ga0501067_0019282 | 3300049583 | Bacteria | 3774 |
| 1140 | Ga0501067_0124766 | 3300049583 | Bacteria | 1433 |
| 1141 | Ga0501067_0226862 | 3300049583 | Bacteria | 1040 |
| 1142 | Ga0501068_0001101 | 3300049584 | Bacteria | 14316 |
| 1143 | Ga0501068_0040130 | 3300049584 | Bacteria | 2809 |
| 1144 | Ga0501068_0052025 | 3300049584 | Bacteria | 2478 |
| 1145 | Ga0501068_0067805 | 3300049584 | Bacteria | 2175 |
| 1146 | Ga0501068_0174555 | 3300049584 | Bacteria | 1357 |
| 1147 | Ga0501068_0508255 | 3300049584 | Bacteria | 782 |
| 1148 | Ga0501068_0774028 | 3300049584 | Bacteria | 629 |
| 1149 | Ga0501068_0972736 | 3300049584 | Bacteria | 560 |
| 1150 | Ga0501068_1031316 | 3300049584 | Bacteria | 543 |
| 1151 | Ga0501069_0000164 | 3300049585 | Bacteria | 29328 |
| 1152 | Ga0501069_0023440 | 3300049585 | Bacteria | 3365 |
| 1153 | Ga0501069_0215970 | 3300049585 | Unclassified | 1114 |
| 1154 | Ga0501069_0832628 | 3300049585 | Bacteria | 560 |
| 1155 | Ga0501069_0960562 | 3300049585 | Bacteria | 521 |
| 1156 | Ga0501070_0002617 | 3300049586 | Bacteria | 15721 |
| 1157 | Ga0501070_0042381 | 3300049586 | Bacteria | 3791 |
| 1158 | Ga0501070_0056977 | 3300049586 | Bacteria | 3239 |
| 1159 | Ga0501070_0214798 | 3300049586 | Bacteria | 1578 |
| 1160 | Ga0501070_0332187 | 3300049586 | Bacteria | 1235 |
| 1161 | Ga0501070_0405193 | 3300049586 | Bacteria | 1103 |
| 1162 | Ga0501071_0016948 | 3300049587 | Bacteria | 5014 |
| 1163 | Ga0501071_0017070 | 3300049587 | Bacteria | 5000 |
| 1164 | Ga0501071_0096348 | 3300049587 | Bacteria | 2178 |
| 1165 | Ga0501071_0100489 | 3300049587 | Bacteria | 2132 |
| 1166 | Ga0501071_0138296 | 3300049587 | Bacteria | 1813 |
| 1167 | Ga0501071_0140288 | 3300049587 | Bacteria | 1799 |
| 1168 | Ga0501071_0166109 | 3300049587 | Bacteria | 1651 |
| 1169 | Ga0501071_0278305 | 3300049587 | Bacteria | 1266 |
| 1170 | Ga0501071_0440523 | 3300049587 | Bacteria | 997 |
| 1171 | Ga0501071_0602744 | 3300049587 | Bacteria | 844 |
| 1172 | Ga0501071_0862869 | 3300049587 | Bacteria | 698 |
| 1173 | Ga0501071_1086846 | 3300049587 | Unclassified | 618 |
| 1174 | Ga0501071_1332673 | 3300049587 | Unclassified | 554 |
| 1175 | Ga0501072_0001470 | 3300049588 | Bacteria | 17651 |
| 1176 | Ga0501072_0009619 | 3300049588 | Bacteria | 7352 |
| 1177 | Ga0501072_0019421 | 3300049588 | Bacteria | 5252 |
| 1178 | Ga0501072_0023181 | 3300049588 | Bacteria | 4820 |
| 1179 | Ga0501072_0084089 | 3300049588 | Bacteria | 2523 |
| 1180 | Ga0501072_0117400 | 3300049588 | Bacteria | 2119 |
| 1181 | Ga0501072_0175855 | 3300049588 | Bacteria | 1708 |
| 1182 | Ga0501072_0293216 | 3300049588 | Bacteria | 1293 |
| 1183 | Ga0501072_0681809 | 3300049588 | Unclassified | 808 |
| 1184 | Ga0501073_0009164 | 3300049589 | Bacteria | 7301 |
| 1185 | Ga0501073_0414304 | 3300049589 | Bacteria | 931 |
| 1186 | Ga0501073_0604090 | 3300049589 | Bacteria | 757 |
| 1187 | Ga0501074_0000321 | 3300049590 | Bacteria | 27781 |
| 1188 | Ga0501074_0004627 | 3300049590 | Bacteria | 9850 |
| 1189 | Ga0501074_0017499 | 3300049590 | Bacteria | 5202 |
| 1190 | Ga0501074_0081844 | 3300049590 | Bacteria | 2315 |
| 1191 | Ga0501074_0102912 | 3300049590 | Bacteria | 2044 |
| 1192 | Ga0501074_0286052 | 3300049590 | Bacteria | 1172 |
| 1193 | Ga0501074_0615671 | 3300049590 | Bacteria | 768 |
| 1194 | Ga0501074_0729675 | 3300049590 | Bacteria | 699 |
| 1195 | Ga0501074_0751243 | 3300049590 | Bacteria | 688 |
| 1196 | Ga0501074_1217296 | 3300049590 | Bacteria | 528 |
| 1197 | Ga0501075_0008772 | 3300049591 | Bacteria | 7045 |
| 1198 | Ga0501075_0018372 | 3300049591 | Bacteria | 5061 |
| 1199 | Ga0501075_0026422 | 3300049591 | Bacteria | 4273 |
| 1200 | Ga0501075_0048433 | 3300049591 | Bacteria | 3194 |
| 1201 | Ga0501075_0083694 | 3300049591 | Bacteria | 2416 |
| 1202 | Ga0501075_0086806 | 3300049591 | Bacteria | 2370 |
| 1203 | Ga0501075_0097392 | 3300049591 | Bacteria | 2232 |
| 1204 | Ga0501075_0168701 | 3300049591 | Bacteria | 1670 |
| 1205 | Ga0501075_0214544 | 3300049591 | Bacteria | 1468 |
| 1206 | Ga0501075_0364206 | 3300049591 | Bacteria | 1102 |
| 1207 | Ga0501075_0524572 | 3300049591 | Bacteria | 904 |
| 1208 | Ga0501075_1135085 | 3300049591 | Unclassified | 593 |
| 1209 | Ga0501075_1144968 | 3300049591 | Unclassified | 590 |
| 1210 | Ga0501076_0001569 | 3300049592 | Bacteria | 15334 |
| 1211 | Ga0501076_0006475 | 3300049592 | Bacteria | 8502 |
| 1212 | Ga0501076_0024647 | 3300049592 | Bacteria | 4652 |
| 1213 | Ga0501076_0083688 | 3300049592 | Bacteria | 2562 |
| 1214 | Ga0501076_0139579 | 3300049592 | Bacteria | 1968 |
| 1215 | Ga0501076_0241625 | 3300049592 | Unclassified | 1477 |
| 1216 | Ga0501076_0537836 | 3300049592 | Bacteria | 963 |
| 1217 | Ga0501076_1703826 | 3300049592 | Unclassified | 517 |
| 1218 | Ga0501076_1784323 | 3300049592 | Bacteria | 504 |
| 1219 | Ga0501077_0003418 | 3300049593 | Bacteria | 9545 |
| 1220 | Ga0501077_0013074 | 3300049593 | Bacteria | 5201 |
| 1221 | Ga0501077_0044271 | 3300049593 | Bacteria | 2827 |
| 1222 | Ga0501077_0047941 | 3300049593 | Bacteria | 2714 |
| 1223 | Ga0501077_0082928 | 3300049593 | Bacteria | 2031 |
| 1224 | Ga0501077_0139190 | 3300049593 | Bacteria | 1539 |
| 1225 | Ga0501077_0331697 | 3300049593 | Bacteria | 970 |
| 1226 | Ga0501077_0855705 | 3300049593 | Bacteria | 585 |
| 1227 | Ga0501079_0005337 | 3300049741 | Bacteria | 9566 |
| 1228 | Ga0501079_0007496 | 3300049741 | Bacteria | 8252 |
| 1229 | Ga0501079_0011148 | 3300049741 | Bacteria | 6855 |
| 1230 | Ga0501079_0046731 | 3300049741 | Bacteria | 3340 |
| 1231 | Ga0501079_0076880 | 3300049741 | Bacteria | 2582 |
| 1232 | Ga0501079_0130774 | 3300049741 | Bacteria | 1953 |
| 1233 | Ga0501079_0277555 | 3300049741 | Bacteria | 1310 |
| 1234 | Ga0501079_0293013 | 3300049741 | Bacteria | 1273 |
| 1235 | Ga0501079_0443844 | 3300049741 | Bacteria | 1019 |
| 1236 | Ga0501079_0550364 | 3300049741 | Bacteria | 907 |
| 1237 | Ga0501079_0562517 | 3300049741 | Bacteria | 897 |
| 1238 | Ga0501079_1095758 | 3300049741 | Bacteria | 627 |
| 1239 | Ga0501080_0003261 | 3300049742 | Bacteria | 14318 |
| 1240 | Ga0501080_0027125 | 3300049742 | Bacteria | 5326 |
| 1241 | Ga0501080_0039151 | 3300049742 | Bacteria | 4424 |
| 1242 | Ga0501080_0071955 | 3300049742 | Bacteria | 3217 |
| 1243 | Ga0501080_0233236 | 3300049742 | Bacteria | 1682 |
| 1244 | Ga0501080_0425533 | 3300049742 | Bacteria | 1192 |
| 1245 | Ga0501080_0513821 | 3300049742 | Bacteria | 1069 |
| 1246 | Ga0501080_0679836 | 3300049742 | Bacteria | 909 |
| 1247 | Ga0501081_0000852 | 3300049743 | Bacteria | 18010 |
| 1248 | Ga0501081_0013748 | 3300049743 | Bacteria | 5324 |
| 1249 | Ga0501081_0020952 | 3300049743 | Bacteria | 4362 |
| 1250 | Ga0501081_0088976 | 3300049743 | Bacteria | 2169 |
| 1251 | Ga0501081_0205441 | 3300049743 | Bacteria | 1429 |
| 1252 | Ga0501081_0312597 | 3300049743 | Bacteria | 1154 |
| 1253 | Ga0501081_0536495 | 3300049743 | Bacteria | 873 |
| 1254 | Ga0501081_0571988 | 3300049743 | Unclassified | 845 |
| 1255 | Ga0501083_0000179 | 3300049744 | Bacteria | 40905 |
| 1256 | Ga0501083_0063508 | 3300049744 | Bacteria | 2463 |
| 1257 | Ga0501083_0105067 | 3300049744 | Bacteria | 1860 |
| 1258 | Ga0501083_0142078 | 3300049744 | Unclassified | 1572 |
| 1259 | Ga0501083_0354626 | 3300049744 | Bacteria | 954 |
| 1260 | Ga0501083_0380088 | 3300049744 | Bacteria | 918 |
| 1261 | Ga0501035_0000493 | 3300049822 | Bacteria | 44347 |
| 1262 | Ga0501035_0046718 | 3300049822 | Bacteria | 3894 |
| 1263 | Ga0501035_0135555 | 3300049822 | Bacteria | 2144 |
| 1264 | Ga0501035_0320886 | 3300049822 | Bacteria | 1301 |
| 1265 | Ga0501035_0609809 | 3300049822 | Bacteria | 889 |
| 1266 | Ga0501035_0951722 | 3300049822 | Bacteria | 677 |
| 1267 | Ga0501035_1136146 | 3300049822 | Bacteria | 609 |
| 1268 | Ga0501044_0005307 | 3300049823 | Bacteria | 14331 |
| 1269 | Ga0501044_0028152 | 3300049823 | Bacteria | 5931 |
| 1270 | Ga0501044_0921305 | 3300049823 | Bacteria | 748 |
| 1271 | Ga0501045_0003079 | 3300049824 | Bacteria | 11400 |
| 1272 | Ga0501045_0008250 | 3300049824 | Bacteria | 7252 |
| 1273 | Ga0501045_0019287 | 3300049824 | Bacteria | 4859 |
| 1274 | Ga0501045_0034329 | 3300049824 | Bacteria | 3682 |
| 1275 | Ga0501045_0127396 | 3300049824 | Bacteria | 1892 |
| 1276 | Ga0501045_0168697 | 3300049824 | Bacteria | 1630 |
| 1277 | Ga0501045_0228615 | 3300049824 | Bacteria | 1385 |
| 1278 | Ga0501045_0281803 | 3300049824 | Bacteria | 1237 |
| 1279 | Ga0501045_0328195 | 3300049824 | Bacteria | 1138 |
| 1280 | Ga0501045_0435934 | 3300049824 | Bacteria | 974 |
| 1281 | Ga0501045_0459118 | 3300049824 | Bacteria | 947 |
| 1282 | Ga0501045_0514471 | 3300049824 | Bacteria | 889 |
| 1283 | Ga0501045_0903800 | 3300049824 | Bacteria | 649 |
| 1284 | Ga0501045_1116487 | 3300049824 | Unclassified | 576 |
| 1285 | nmdc:mga00v17_149912_c1 | 3300050491 | Bacteria | 1498 |
| 1286 | nmdc:mga00v17_189156_c1 | 3300050491 | Archaea | 1329 |
| 1287 | nmdc:mga00v17_786027_c1 | 3300050491 | Bacteria | 607 |
| 1288 | nmdc:mga0yw44_205301_c1 | 3300050492 | Bacteria | 1302 |
| 1289 | nmdc:mga0yw44_73030_c1 | 3300050492 | Bacteria | 1224 |
| 1290 | nmdc:mga0yw44_915491_c1 | 3300050492 | Bacteria | 594 |
| 1291 | nmdc:mga06z11_196941_c1 | 3300050494 | Bacteria | 1168 |
| 1292 | nmdc:mga05p37_1353856_c1 | 3300050507 | Bacteria | 721 |
| 1293 | nmdc:mga05p37_1705496_c1 | 3300050507 | Unclassified | 614 |
| 1294 | nmdc:mga05p37_37852_c1 | 3300050507 | Bacteria | 5916 |
| 1295 | nmdc:mga05p37_43526_c1 | 3300050507 | Bacteria | 5524 |
| 1296 | nmdc:mga05p37_5072_c1 | 3300050507 | Bacteria | 15436 |
| 1297 | nmdc:mga05p37_51869_c1 | 3300050507 | Bacteria | 5044 |
| 1298 | nmdc:mga05p37_74185_c2 | 3300050507 | Bacteria | 2793 |
| 1299 | nmdc:mga09592_1177227_c1 | 3300050508 | Bacteria | 634 |
| 1300 | nmdc:mga09592_250955_c1 | 3300050508 | Bacteria | 1534 |
| 1301 | nmdc:mga09592_316899_c1 | 3300050508 | Bacteria | 1351 |
| 1302 | nmdc:mga09592_33257_c1 | 3300050508 | Bacteria | 4303 |
| 1303 | nmdc:mga09592_365435_c1 | 3300050508 | Bacteria | 1248 |
| 1304 | nmdc:mga09592_926770_c1 | 3300050508 | Bacteria | 731 |
| 1305 | nmdc:mga09592_9396_c1 | 3300050508 | Bacteria | 7947 |
| 1306 | nmdc:mga0qj67_24510_c1 | 3300050509 | Bacteria | 4651 |
| 1307 | nmdc:mga0qj67_27445_c1 | 3300050509 | Bacteria | 4414 |
| 1308 | nmdc:mga0qj67_545164_c1 | 3300050509 | Bacteria | 930 |
| 1309 | nmdc:mga06r32_246155_c1 | 3300050510 | Bacteria | 1775 |
| 1310 | nmdc:mga06r32_249817_c1 | 3300050510 | Unclassified | 1761 |
| 1311 | nmdc:mga06r32_250934_c1 | 3300050510 | Bacteria | 1757 |
| 1312 | nmdc:mga06r32_42785_c2 | 3300050510 | Bacteria | 1912 |
| 1313 | nmdc:mga06r32_70669_c1 | 3300050510 | Bacteria | 3377 |
| 1314 | nmdc:mga08y16_10615_c1 | 3300050511 | Bacteria | 9663 |
| 1315 | nmdc:mga08y16_1191710_c1 | 3300050511 | Bacteria | 733 |
| 1316 | nmdc:mga08y16_1268522_c1 | 3300050511 | Bacteria | 705 |
| 1317 | nmdc:mga08y16_239100_c1 | 3300050511 | Bacteria | 1877 |
| 1318 | nmdc:mga08y16_254234_c1 | 3300050511 | Bacteria | 1815 |
| 1319 | nmdc:mga08y16_375557_c1 | 3300050511 | Bacteria | 1458 |
| 1320 | nmdc:mga08y16_700565_c1 | 3300050511 | Bacteria | 1013 |
| 1321 | nmdc:mga08y16_7569_c1 | 3300050511 | Bacteria | 11374 |
| 1322 | nmdc:mga0n895_1559789_c1 | 3300050512 | Unclassified | 625 |
| 1323 | nmdc:mga0n895_1898045_c1 | 3300050512 | Unclassified | 555 |
| 1324 | nmdc:mga0n895_237729_c1 | 3300050512 | Unclassified | 1849 |
| 1325 | nmdc:mga0n895_644502_c1 | 3300050512 | Bacteria | 1059 |
| 1326 | nmdc:mga0rr50_122082_c1 | 3300050513 | Bacteria | 2075 |
| 1327 | nmdc:mga0rr50_31543_c1 | 3300050513 | Bacteria | 3765 |
| 1328 | nmdc:mga0rr50_434532_c1 | 3300050513 | Bacteria | 1111 |
| 1329 | nmdc:mga0rr50_737801_c1 | 3300050513 | Unclassified | 841 |
| 1330 | nmdc:mga08x19_370067_c1 | 3300050514 | Bacteria | 1003 |
| 1331 | nmdc:mga0a205_1255921_c1 | 3300050515 | Unclassified | 588 |
| 1332 | nmdc:mga0a205_185262_c1 | 3300050515 | Bacteria | 1975 |
| 1333 | nmdc:mga0a205_336070_c1 | 3300050515 | Bacteria | 1380 |
| 1334 | nmdc:mga0a205_42279_c1 | 3300050515 | Bacteria | 4391 |
| 1335 | Ga0495601_1055382 | 3300053077 | Bacteria | 510 |
| 1336 | Ga0495612_0341833 | 3300053078 | Bacteria | 675 |
| 1337 | Ga0495655_0016976 | 3300053083 | Unclassified | 1578 |
| 1338 | Ga0495595_0186503 | 3300053084 | Bacteria | 1030 |
| 1339 | Ga0495619_0073266 | 3300053085 | Bacteria | 2295 |
| 1340 | Ga0501084_0003960 | 3300054114 | Bacteria | 12062 |
| 1341 | Ga0501084_0013123 | 3300054114 | Bacteria | 6855 |
| 1342 | Ga0501084_0022244 | 3300054114 | Bacteria | 5290 |
| 1343 | Ga0501084_0029841 | 3300054114 | Bacteria | 4560 |
| 1344 | Ga0501084_0049147 | 3300054114 | Bacteria | 3531 |
| 1345 | Ga0501084_0063448 | 3300054114 | Bacteria | 3093 |
| 1346 | Ga0501084_0174137 | 3300054114 | Bacteria | 1816 |
| 1347 | Ga0501084_0218404 | 3300054114 | Bacteria | 1608 |
| 1348 | Ga0501084_0287116 | 3300054114 | Bacteria | 1389 |
| 1349 | Ga0501084_0646006 | 3300054114 | Bacteria | 893 |
| 1350 | Ga0501084_1128307 | 3300054114 | Unclassified | 658 |
| 1351 | Ga0590071_140484 | 3300059421 | Unclassified | 623 |
| 1352 | Ga0590074_021865 | 3300059423 | Bacteria | 1104 |
| 1353 | Ga0590075_076056 | 3300059424 | Bacteria | 868 |
| 1354 | Ga0590075_162340 | 3300059424 | Bacteria | 589 |
| 1355 | Ga0590077_126921 | 3300059426 | Bacteria | 605 |
| 1356 | Ga0501082_0001562 | 3300060353 | Bacteria | 20162 |
| 1357 | Ga0501082_0002174 | 3300060353 | Bacteria | 17191 |
| 1358 | Ga0501082_0017729 | 3300060353 | Bacteria | 6132 |
| 1359 | Ga0501082_0033004 | 3300060353 | Bacteria | 4464 |
| 1360 | Ga0501082_0085042 | 3300060353 | Bacteria | 2728 |
| 1361 | Ga0501082_0130072 | 3300060353 | Bacteria | 2184 |
| 1362 | Ga0501082_0310713 | 3300060353 | Bacteria | 1373 |
| 1363 | Ga0501082_0727691 | 3300060353 | Unclassified | 868 |
| 1364 | Ga0501082_0793969 | 3300060353 | Bacteria | 828 |
| 1365 | Ga0466962_0000400 | 3300061719 | Bacteria | 18718 |
| 1366 | Ga0466962_0545547 | 3300061719 | Bacteria | 589 |
| 1367 | Ga0530510_0001510 | 3300061734 | Bacteria | 15648 |
| 1368 | Ga0530510_0003823 | 3300061734 | Bacteria | 10383 |
| 1369 | Ga0530510_0009903 | 3300061734 | Bacteria | 6689 |
| 1370 | Ga0530510_0010034 | 3300061734 | Bacteria | 6642 |
| 1371 | Ga0530510_0091257 | 3300061734 | Bacteria | 2222 |
| 1372 | Ga0530510_0331399 | 3300061734 | Bacteria | 1142 |
| 1373 | Ga0530510_0606255 | 3300061734 | Bacteria | 833 |
| 1374 | Ga0530510_1037444 | 3300061734 | Bacteria | 628 |
| 1375 | Ga0530510_1208846 | 3300061734 | Unclassified | 579 |
| 1376 | Ga0530510_1346892 | 3300061734 | Bacteria | 548 |
| 1377 | Ga0501036_1397973 | |||
| 1378 | ARcpr5oldR_c001197 | |||
| 1379 | ARSoilOldRDRAFT_c000964 | |||
| 1380 | ARCol0yngRDRAFT_1000704 | |||
| 1381 | JGI24737J22298_10044293 | |||
| 1382 | JGI25406J46586_10238588 | |||
| 1383 | JGI25407J50210_10000051 | |||
| 1384 | JGI25407J50210_10001892 | |||
| 1385 | JGI25407J50210_10050240 | |||
| 1386 | JGI25407J50210_10052063 | |||
| 1387 | JGI25407J50210_10073606 | |||
| 1388 | JGI25407J50210_10136414 | |||
| 1389 | Ga0070658_10067133 | |||
| 1390 | Ga0070658_10096535 | |||
| 1391 | Ga0070658_10922781 | |||
| 1392 | Ga0070658_11181920 | |||
| 1393 | Ga0070683_100002922 | |||
| 1394 | Ga0070683_100003946 | |||
| 1395 | Ga0070683_100075110 | |||
| 1396 | Ga0070683_100113353 | |||
| 1397 | Ga0070683_100139593 | |||
| 1398 | Ga0070683_101011265 | |||
| 1399 | Ga0070683_101653964 | |||
| 1400 | Ga0070683_102334236 | |||
| 1401 | Ga0070690_100185030 | |||
| 1402 | Ga0070690_100578423 | |||
| 1403 | Ga0068869_100105026 | |||
| 1404 | Ga0068869_100358993 | |||
| 1405 | Ga0068869_100409896 | |||
| 1406 | Ga0068869_101826727 | |||
| 1407 | Ga0070666_11434258 | |||
| 1408 | Ga0070680_100029316 | |||
| 1409 | Ga0070680_100038162 | |||
| 1410 | Ga0070680_100136905 | |||
| 1411 | Ga0070682_100028671 | |||
| 1412 | Ga0070682_100038659 | |||
| 1413 | Ga0070682_100063128 | |||
| 1414 | Ga0070682_100525841 | |||
| 1415 | Ga0070682_100780754 | |||
| 1416 | Ga0070682_101557456 | |||
| 1417 | Ga0068868_101066079 | |||
| 1418 | Ga0070660_100029567 | |||
| 1419 | Ga0070660_100033678 | |||
| 1420 | Ga0070660_100070080 | |||
| 1421 | Ga0070660_100090129 | |||
| 1422 | Ga0070660_100376033 | |||
| 1423 | Ga0070660_101880718 | |||
| 1424 | Ga0070660_101933191 | |||
| 1425 | Ga0070689_100148630 | |||
| 1426 | Ga0070689_102162115 | |||
| 1427 | Ga0070691_10219406 | |||
| 1428 | Ga0070691_10539284 | |||
| 1429 | Ga0070687_100891862 | |||
| 1430 | Ga0070661_100039491 | |||
| 1431 | Ga0070661_100066266 | |||
| 1432 | Ga0070661_100393914 | |||
| 1433 | Ga0070661_101430362 | |||
| 1434 | Ga0070692_10003070 | |||
| 1435 | Ga0070692_10276299 | |||
| 1436 | Ga0070692_10770992 | |||
| 1437 | Ga0070668_101273232 | |||
| 1438 | Ga0070669_101646237 | |||
| 1439 | Ga0070669_101657833 | |||
| 1440 | Ga0070675_100035132 | |||
| 1441 | Ga0070675_100075867 | |||
| 1442 | Ga0070675_100394605 | |||
| 1443 | Ga0070671_100886356 | |||
| 1444 | Ga0070671_101002264 | |||
| 1445 | Ga0070674_100006549 | |||
| 1446 | Ga0070674_100036551 | |||
| 1447 | Ga0070674_100068963 | |||
| 1448 | Ga0070674_101983043 | |||
| 1449 | Ga0070673_101257628 | |||
| 1450 | Ga0070673_101405644 | |||
| 1451 | Ga0070688_100368837 | |||
| 1452 | Ga0070659_100003810 | |||
| 1453 | Ga0070659_100052021 | |||
| 1454 | Ga0070659_100325336 | |||
| 1455 | Ga0070659_100654860 | |||
| 1456 | Ga0070659_100986470 | |||
| 1457 | Ga0070659_101034086 | |||
| 1458 | Ga0070667_100818349 | |||
| 1459 | Ga0070667_101833007 | |||
| 1460 | Ga0070709_10070396 | |||
| 1461 | Ga0070709_10350030 | |||
| 1462 | Ga0070714_100033558 | |||
| 1463 | Ga0070713_100130497 | |||
| 1464 | Ga0070713_101859447 | |||
| 1465 | Ga0070701_10336951 | |||
| 1466 | Ga0070701_10603621 | |||
| 1467 | Ga0070711_100097642 | |||
| 1468 | Ga0070700_100051473 | |||
| 1469 | Ga0070700_100067837 | |||
| 1470 | Ga0070694_100017086 | |||
| 1471 | Ga0070708_100010667 | |||
| 1472 | Ga0070708_100495144 | |||
| 1473 | Ga0070708_101748524 | |||
| 1474 | Ga0070663_100257211 | |||
| 1475 | Ga0070663_100746905 | |||
| 1476 | Ga0070663_101103297 | |||
| 1477 | Ga0070678_100011103 | |||
| 1478 | Ga0070678_100362826 | |||
| 1479 | Ga0070678_101043070 | |||
| 1480 | Ga0070678_102217799 | |||
| 1481 | Ga0070662_100046211 | |||
| 1482 | Ga0070681_10006371 | |||
| 1483 | Ga0070681_10043297 | |||
| 1484 | Ga0070681_10058451 | |||
| 1485 | Ga0070681_10081367 | |||
| 1486 | Ga0070681_10087399 | |||
| 1487 | Ga0070681_10139091 | |||
| 1488 | Ga0070681_10251194 | |||
| 1489 | Ga0068867_100222865 | |||
| 1490 | Ga0068867_100290909 | |||
| 1491 | Ga0068867_101124008 | |||
| 1492 | Ga0070706_100037349 | |||
| 1493 | Ga0070706_100239114 | |||
| 1494 | Ga0070706_100953063 | |||
| 1495 | Ga0070707_100023151 | |||
| 1496 | Ga0070707_100053172 | |||
| 1497 | Ga0070707_100097602 | |||
| 1498 | Ga0070707_101431489 | |||
| 1499 | Ga0070698_100010517 | |||
| 1500 | Ga0070698_100070889 | |||
| 1501 | Ga0070698_100147483 | |||
| 1502 | Ga0070698_100242948 | |||
| 1503 | Ga0070699_100023793 | |||
| 1504 | Ga0070699_100029327 | |||
| 1505 | Ga0070699_100110527 | |||
| 1506 | Ga0070699_100113020 | |||
| 1507 | Ga0070699_100361888 | |||
| 1508 | Ga0070679_100024083 | |||
| 1509 | Ga0070679_100039163 | |||
| 1510 | Ga0070679_100075853 | |||
| 1511 | Ga0070679_100168219 | |||
| 1512 | Ga0070679_100172137 | |||
| 1513 | Ga0070679_100459577 | |||
| 1514 | Ga0070684_100000721 | |||
| 1515 | Ga0070684_100004187 | |||
| 1516 | Ga0070684_100023303 | |||
| 1517 | Ga0070684_100037347 | |||
| 1518 | Ga0070684_100041130 | |||
| 1519 | Ga0070684_100481704 | |||
| 1520 | Ga0070684_101540386 | |||
| 1521 | Ga0070684_102252561 | |||
| 1522 | Ga0068853_100034734 | |||
| 1523 | Ga0068853_102199335 | |||
| 1524 | Ga0068853_102354407 | |||
| 1525 | Ga0070672_100251939 | |||
| 1526 | Ga0070672_100370834 | |||
| 1527 | Ga0070686_100907634 | |||
| 1528 | Ga0070695_100222586 | |||
| 1529 | Ga0070696_100485766 | |||
| 1530 | Ga0070693_100004452 | |||
| 1531 | Ga0070693_100029782 | |||
| 1532 | Ga0070665_100077581 | |||
| 1533 | Ga0070665_100334223 | |||
| 1534 | Ga0070665_101153957 | |||
| 1535 | Ga0070704_100187177 | |||
| 1536 | Ga0068855_100012928 | |||
| 1537 | Ga0068855_100070685 | |||
| 1538 | Ga0068855_100080812 | |||
| 1539 | Ga0068855_100177663 | |||
| 1540 | Ga0068855_100467085 | |||
| 1541 | Ga0070664_100062485 | |||
| 1542 | Ga0070664_100191546 | |||
| 1543 | Ga0070664_100488272 | |||
| 1544 | Ga0070664_101111172 | |||
| 1545 | Ga0070664_102306881 | |||
| 1546 | Ga0068857_100001170 | |||
| 1547 | Ga0068857_100025316 | |||
| 1548 | Ga0068857_100057707 | |||
| 1549 | Ga0068857_100281438 | |||
| 1550 | Ga0068857_100423786 | |||
| 1551 | Ga0068857_101651492 | |||
| 1552 | Ga0068856_100039848 | |||
| 1553 | Ga0068856_100071819 | |||
| 1554 | Ga0068856_100287903 | |||
| 1555 | Ga0068856_101863173 | |||
| 1556 | Ga0070702_100016250 | |||
| 1557 | Ga0070702_100100120 | |||
| 1558 | Ga0070702_100190333 | |||
| 1559 | Ga0070702_101393924 | |||
| 1560 | Ga0068852_100033490 | |||
| 1561 | Ga0068852_100259612 | |||
| 1562 | Ga0068852_100433884 | |||
| 1563 | Ga0068852_100537678 | |||
| 1564 | Ga0068852_101589722 | |||
| 1565 | Ga0068852_101711642 | |||
| 1566 | Ga0068852_102435327 | |||
| 1567 | Ga0068852_102443178 | |||
| 1568 | Ga0068859_100296254 | |||
| 1569 | Ga0068864_100012754 | |||
| 1570 | Ga0068866_11314208 | |||
| 1571 | Ga0068861_100215960 | |||
| 1572 | Ga0068861_100296781 | |||
| 1573 | Ga0068861_100398226 | |||
| 1574 | Ga0068861_100461604 | |||
| 1575 | Ga0068861_100745019 | |||
| 1576 | Ga0068870_10162064 | |||
| 1577 | Ga0068870_10235083 | |||
| 1578 | Ga0068863_100930777 | |||
| 1579 | Ga0068863_101214227 | |||
| 1580 | Ga0068860_100672318 | |||
| 1581 | Ga0068860_100702038 | |||
| 1582 | Ga0068862_101598155 | |||
| 1583 | Ga0081455_10003318 | |||
| 1584 | Ga0081455_10046116 | |||
| 1585 | Ga0081455_10054960 | |||
| 1586 | Ga0081455_10062783 | |||
| 1587 | Ga0081455_10085605 | |||
| 1588 | Ga0081455_10182159 | |||
| 1589 | Ga0081455_10268805 | |||
| 1590 | Ga0081538_10000116 | |||
| 1591 | Ga0081538_10000148 | |||
| 1592 | Ga0081538_10000505 | |||
| 1593 | Ga0081538_10001447 | |||
| 1594 | Ga0081538_10001820 | |||
| 1595 | Ga0081538_10003248 | |||
| 1596 | Ga0081538_10009165 | |||
| 1597 | Ga0081538_10021860 | |||
| 1598 | Ga0081538_10023620 | |||
| 1599 | Ga0081538_10039742 | |||
| 1600 | Ga0081538_10042059 | |||
| 1601 | Ga0081538_10062030 | |||
| 1602 | Ga0081538_10063697 | |||
| 1603 | Ga0081538_10073932 | |||
| 1604 | Ga0081538_10369407 | |||
| 1605 | Ga0081540_1003276 | |||
| 1606 | Ga0081540_1007593 | |||
| 1607 | Ga0081539_10000639 | |||
| 1608 | Ga0070717_10254571 | |||
| 1609 | Ga0070717_10499540 | |||
| 1610 | Ga0075365_10086983 | |||
| 1611 | Ga0075365_10412379 | |||
| 1612 | Ga0075368_10342944 | |||
| 1613 | Ga0075363_100435578 | |||
| 1614 | Ga0075364_10159160 | |||
| 1615 | Ga0075364_10253123 | |||
| 1616 | Ga0075432_10000924 | |||
| 1617 | Ga0075432_10101068 | |||
| 1618 | Ga0075432_10121224 | |||
| 1619 | Ga0070715_10069363 | |||
| 1620 | Ga0070716_100033529 | |||
| 1621 | Ga0070712_101172496 | |||
| 1622 | Ga0070712_101533997 | |||
| 1623 | Ga0070712_101875843 | |||
| 1624 | Ga0075367_10227435 | |||
| 1625 | Ga0097621_100214345 | |||
| 1626 | Ga0097621_100958124 | |||
| 1627 | Ga0097621_101044043 | |||
| 1628 | Ga0075370_10306338 | |||
| 1629 | Ga0068871_100728734 | |||
| 1630 | Ga0075428_100001400 | |||
| 1631 | Ga0075428_100005170 | |||
| 1632 | Ga0075428_100013379 | |||
| 1633 | Ga0075428_100103049 | |||
| 1634 | Ga0075428_100709004 | |||
| 1635 | Ga0075428_100960266 | |||
| 1636 | Ga0075428_101296586 | |||
| 1637 | Ga0075428_102086197 | |||
| 1638 | Ga0075430_100009893 | |||
| 1639 | Ga0075430_100012099 | |||
| 1640 | Ga0075430_100731754 | |||
| 1641 | Ga0075431_100004744 | |||
| 1642 | Ga0075431_100109734 | |||
| 1643 | Ga0075431_100183442 | |||
| 1644 | Ga0075431_100215094 | |||
| 1645 | Ga0075431_100310978 | |||
| 1646 | Ga0075433_10082629 | |||
| 1647 | Ga0075433_10085696 | |||
| 1648 | Ga0075433_10189581 | |||
| 1649 | Ga0075434_100975855 | |||
| 1650 | Ga0075434_101618478 | |||
| 1651 | Ga0075434_102291266 | |||
| 1652 | Ga0075429_100014330 | |||
| 1653 | Ga0075429_100030367 | |||
| 1654 | Ga0075429_100065939 | |||
| 1655 | Ga0075429_100076770 | |||
| 1656 | Ga0075429_100436940 | |||
| 1657 | Ga0075429_100778855 | |||
| 1658 | Ga0068865_100114158 | |||
| 1659 | Ga0068865_100320455 | |||
| 1660 | Ga0068865_101113835 | |||
| 1661 | Ga0068865_101306814 | |||
| 1662 | Ga0068865_102128460 | |||
| 1663 | Ga0075436_100062001 | |||
| 1664 | Ga0097620_100296253 | |||
| 1665 | Ga0075435_100056047 | |||
| 1666 | Ga0075435_100136767 | |||
| 1667 | Ga0075435_100218804 | |||
| 1668 | Ga0075435_101027038 | |||
| 1669 | Ga0075435_101282161 | |||
| 1670 | Ga0105240_10011292 | |||
| 1671 | Ga0105240_10105580 | |||
| 1672 | Ga0105240_10169655 | |||
| 1673 | Ga0105240_10270077 | |||
| 1674 | Ga0105240_10500852 | |||
| 1675 | Ga0105240_10798408 | |||
| 1676 | Ga0105240_12381464 | |||
| 1677 | Ga0111539_10004138 | |||
| 1678 | Ga0111539_10021844 | |||
| 1679 | Ga0111539_10309929 | |||
| 1680 | Ga0111539_10348906 | |||
| 1681 | Ga0111539_10395316 | |||
| 1682 | Ga0111539_10693269 | |||
| 1683 | Ga0111539_10788939 | |||
| 1684 | Ga0111539_11188620 | |||
| 1685 | Ga0111539_11734596 | |||
| 1686 | Ga0111539_12010975 | |||
| 1687 | Ga0105245_10000886 | |||
| 1688 | Ga0105245_10003680 | |||
| 1689 | Ga0105245_10029442 | |||
| 1690 | Ga0105245_10096577 | |||
| 1691 | Ga0105245_10422763 | |||
| 1692 | Ga0105245_10655181 | |||
| 1693 | Ga0105245_11422771 | |||
| 1694 | Ga0105245_11622039 | |||
| 1695 | Ga0105247_11336416 | |||
| 1696 | Ga0114129_10001306 | |||
| 1697 | Ga0114129_10004745 | |||
| 1698 | Ga0114129_10060029 | |||
| 1699 | Ga0114129_10117963 | |||
| 1700 | Ga0114129_10157782 | |||
| 1701 | Ga0114129_10175291 | |||
| 1702 | Ga0114129_10207515 | |||
| 1703 | Ga0114129_10806765 | |||
| 1704 | Ga0114129_10983327 | |||
| 1705 | Ga0114129_12971012 | |||
| 1706 | Ga0114129_13303454 | |||
| 1707 | Ga0105243_10007867 | |||
| 1708 | Ga0105243_10347639 | |||
| 1709 | Ga0105243_10684120 | |||
| 1710 | Ga0105243_10772467 | |||
| 1711 | Ga0105243_10808579 | |||
| 1712 | Ga0105243_11603431 | |||
| 1713 | Ga0105243_11817996 | |||
| 1714 | Ga0105243_13117989 | |||
| 1715 | Ga0105241_10517835 | |||
| 1716 | Ga0105241_10698857 | |||
| 1717 | Ga0105241_11685254 | |||
| 1718 | Ga0105242_10092001 | |||
| 1719 | Ga0105242_10158422 | |||
| 1720 | Ga0105242_10348818 | |||
| 1721 | Ga0105242_10395019 | |||
| 1722 | Ga0105242_11039884 | |||
| 1723 | Ga0105242_11568508 | |||
| 1724 | Ga0105242_12877103 | |||
| 1725 | Ga0105248_10512026 | |||
| 1726 | Ga0105248_11714397 | |||
| 1727 | Ga0105248_12734531 | |||
| 1728 | Ga0105237_10029726 | |||
| 1729 | Ga0105238_10005537 | |||
| 1730 | Ga0105238_10082931 | |||
| 1731 | Ga0105238_11474779 | |||
| 1732 | Ga0105249_10119056 | |||
| 1733 | Ga0105249_10228376 | |||
| 1734 | Ga0105249_10455900 | |||
| 1735 | Ga0105249_12115257 | |||
| 1736 | Ga0105249_12543544 | |||
| 1737 | Ga0105249_12981378 | |||
| 1738 | Ga0105239_10069838 | |||
| 1739 | Ga0105239_10071496 | |||
| 1740 | Ga0105239_10652117 | |||
| 1741 | Ga0105239_11015929 | |||
| 1742 | Ga0105239_11298584 | |||
| 1743 | Ga0105246_10075384 | |||
| 1744 | Ga0105246_10213239 | |||
| 1745 | Ga0105246_11227281 | |||
| 1746 | Ga0105246_11555414 | |||
| 1747 | Ga0157373_10108751 | |||
| 1748 | Ga0157373_10467221 | |||
| 1749 | Ga0157373_11552324 | |||
| 1750 | Ga0157371_10133484 | |||
| 1751 | Ga0157370_10006231 | |||
| 1752 | Ga0157370_10011092 | |||
| 1753 | Ga0157370_10072016 | |||
| 1754 | Ga0157370_11767980 | |||
| 1755 | Ga0157369_10076037 | |||
| 1756 | Ga0157369_10124296 | |||
| 1757 | Ga0157369_10220188 | |||
| 1758 | Ga0157374_10020848 | |||
| 1759 | Ga0157374_10032162 | |||
| 1760 | Ga0157374_10935198 | |||
| 1761 | Ga0157374_11843171 | |||
| 1762 | Ga0157378_10232212 | |||
| 1763 | Ga0163162_10123397 | |||
| 1764 | Ga0163162_11098518 | |||
| 1765 | Ga0163162_11250366 | |||
| 1766 | Ga0163162_13231238 | |||
| 1767 | Ga0157372_10032357 | |||
| 1768 | Ga0157372_10354980 | |||
| 1769 | Ga0157372_10527035 | |||
| 1770 | Ga0157372_10581949 | |||
| 1771 | Ga0157372_10589938 | |||
| 1772 | Ga0157375_10008169 | |||
| 1773 | Ga0157375_10086746 | |||
| 1774 | Ga0157375_10165580 | |||
| 1775 | Ga0157375_10175128 | |||
| 1776 | Ga0157375_10849351 | |||
| 1777 | Ga0163163_10013246 | |||
| 1778 | Ga0163163_10728768 | |||
| 1779 | Ga0163163_10989421 | |||
| 1780 | Ga0163163_11028904 | |||
| 1781 | Ga0163163_11369443 | |||
| 1782 | Ga0157380_10045621 | |||
| 1783 | Ga0157380_10101798 | |||
| 1784 | Ga0157380_11480021 | |||
| 1785 | Ga0182008_10081683 | |||
| 1786 | Ga0182008_10168586 | |||
| 1787 | Ga0157377_10045170 | |||
| 1788 | Ga0157377_10165178 | |||
| 1789 | Ga0157377_10973849 | |||
| 1790 | Ga0157379_10000361 | |||
| 1791 | Ga0157376_10064988 | |||
| 1792 | Ga0157376_10152620 | |||
| 1793 | Ga0157376_10285770 | |||
| 1794 | Ga0157376_10311233 | |||
| 1795 | Ga0157376_10443772 | |||
| 1796 | Ga0157376_10463480 | |||
| 1797 | Ga0157376_11587313 | |||
| 1798 | Ga0157376_11758130 | |||
| 1799 | Ga0182005_1103315 | |||
| 1800 | Ga0197907_10128593 | |||
| 1801 | Ga0197907_10773643 | |||
| 1802 | Ga0206356_10183135 | |||
| 1803 | Ga0206356_10997765 | |||
| 1804 | Ga0206356_11336474 | |||
| 1805 | Ga0206356_11817704 | |||
| 1806 | Ga0206355_1017289 | |||
| 1807 | Ga0206354_10073080 | |||
| 1808 | Ga0206354_10559490 | |||
| 1809 | Ga0206353_10317175 | |||
| 1810 | Ga0206353_10581558 | |||
| 1811 | Ga0206353_11350363 | |||
| 1812 | Ga0206353_11565494 | |||
| 1813 | Ga0206353_11806520 | |||
| 1814 | Ga0224712_10022161 | |||
| 1815 | Ga0207682_10413214 | |||
| 1816 | Ga0207642_10098040 | |||
| 1817 | Ga0207688_10008356 | |||
| 1818 | Ga0207688_10038126 | |||
| 1819 | Ga0207688_10041035 | |||
| 1820 | Ga0207685_10066592 | |||
| 1821 | Ga0207699_10050165 | |||
| 1822 | Ga0207643_10023866 | |||
| 1823 | Ga0207643_10933476 | |||
| 1824 | Ga0207643_11030105 | |||
| 1825 | Ga0207705_10016223 | |||
| 1826 | Ga0207705_10056247 | |||
| 1827 | Ga0207705_10144660 | |||
| 1828 | Ga0207705_10438496 | |||
| 1829 | Ga0207705_10676112 | |||
| 1830 | Ga0207684_10026539 | |||
| 1831 | Ga0207684_10153369 | |||
| 1832 | Ga0207684_10216272 | |||
| 1833 | Ga0207654_10336270 | |||
| 1834 | Ga0207654_10921708 | |||
| 1835 | Ga0207707_10020785 | |||
| 1836 | Ga0207707_10076468 | |||
| 1837 | Ga0207707_10118432 | |||
| 1838 | Ga0207707_10173475 | |||
| 1839 | Ga0207707_10313980 | |||
| 1840 | Ga0207707_10421550 | |||
| 1841 | Ga0207707_10824724 | |||
| 1842 | Ga0207695_10458629 | |||
| 1843 | Ga0207695_10504546 | |||
| 1844 | Ga0207695_10886840 | |||
| 1845 | Ga0207695_10932919 | |||
| 1846 | Ga0207695_11466669 | |||
| 1847 | Ga0207671_10935083 | |||
| 1848 | Ga0207693_10928761 | |||
| 1849 | Ga0207693_11389590 | |||
| 1850 | Ga0207660_10027421 | |||
| 1851 | Ga0207660_10053922 | |||
| 1852 | Ga0207660_10099336 | |||
| 1853 | Ga0207660_10155654 | |||
| 1854 | Ga0207660_10171518 | |||
| 1855 | Ga0207662_10347454 | |||
| 1856 | Ga0207657_10002271 | |||
| 1857 | Ga0207657_10002341 | |||
| 1858 | Ga0207657_10005771 | |||
| 1859 | Ga0207657_10052514 | |||
| 1860 | Ga0207657_10070595 | |||
| 1861 | Ga0207657_10753786 | |||
| 1862 | Ga0207657_10773756 | |||
| 1863 | Ga0207649_10044264 | |||
| 1864 | Ga0207649_10079695 | |||
| 1865 | Ga0207649_10692769 | |||
| 1866 | Ga0207649_10985842 | |||
| 1867 | Ga0207652_10069691 | |||
| 1868 | Ga0207652_10111375 | |||
| 1869 | Ga0207652_10137647 | |||
| 1870 | Ga0207652_10147034 | |||
| 1871 | Ga0207652_10355828 | |||
| 1872 | Ga0207646_10011178 | |||
| 1873 | Ga0207646_10083727 | |||
| 1874 | Ga0207646_10293128 | |||
| 1875 | Ga0207646_10344556 | |||
| 1876 | Ga0207694_10035943 | |||
| 1877 | Ga0207694_10440572 | |||
| 1878 | Ga0207694_10817412 | |||
| 1879 | Ga0207650_10180996 | |||
| 1880 | Ga0207650_11740919 | |||
| 1881 | Ga0207659_10084574 | |||
| 1882 | Ga0207659_10099852 | |||
| 1883 | Ga0207659_10750438 | |||
| 1884 | Ga0207687_10006981 | |||
| 1885 | Ga0207687_10013050 | |||
| 1886 | Ga0207687_10156910 | |||
| 1887 | Ga0207687_10607656 | |||
| 1888 | Ga0207687_10839940 | |||
| 1889 | Ga0207687_11388977 | |||
| 1890 | Ga0207687_11512732 | |||
| 1891 | Ga0207700_10000001 | |||
| 1892 | Ga0207700_10980553 | |||
| 1893 | Ga0207700_11428561 | |||
| 1894 | Ga0207644_10726284 | |||
| 1895 | Ga0207690_10024421 | |||
| 1896 | Ga0207690_10057275 | |||
| 1897 | Ga0207690_10581731 | |||
| 1898 | Ga0207690_11850909 | |||
| 1899 | Ga0207706_10007492 | |||
| 1900 | Ga0207706_10246842 | |||
| 1901 | Ga0207686_10185027 | |||
| 1902 | Ga0207686_10252929 | |||
| 1903 | Ga0207686_10429413 | |||
| 1904 | Ga0207686_11112687 | |||
| 1905 | Ga0207709_10065462 | |||
| 1906 | Ga0207709_10115360 | |||
| 1907 | Ga0207709_10266962 | |||
| 1908 | Ga0207709_11010050 | |||
| 1909 | Ga0207709_11060552 | |||
| 1910 | Ga0207709_11222926 | |||
| 1911 | Ga0207670_10258611 | |||
| 1912 | Ga0207669_10044252 | |||
| 1913 | Ga0207669_10513681 | |||
| 1914 | Ga0207669_10773853 | |||
| 1915 | Ga0207669_10977404 | |||
| 1916 | Ga0207704_10112490 | |||
| 1917 | Ga0207704_10396011 | |||
| 1918 | Ga0207704_10950444 | |||
| 1919 | Ga0207704_11276668 | |||
| 1920 | Ga0207665_10004897 | |||
| 1921 | Ga0207665_10439138 | |||
| 1922 | Ga0207665_10689806 | |||
| 1923 | Ga0207665_11142926 | |||
| 1924 | Ga0207691_10203085 | |||
| 1925 | Ga0207691_10443851 | |||
| 1926 | Ga0207691_10893532 | |||
| 1927 | Ga0207689_10303893 | |||
| 1928 | Ga0207689_10366670 | |||
| 1929 | Ga0207689_10824971 | |||
| 1930 | Ga0207661_10007449 | |||
| 1931 | Ga0207661_10008791 | |||
| 1932 | Ga0207661_10051729 | |||
| 1933 | Ga0207661_10130319 | |||
| 1934 | Ga0207661_10178160 | |||
| 1935 | Ga0207661_10494199 | |||
| 1936 | Ga0207661_10514653 | |||
| 1937 | Ga0207661_11081058 | |||
| 1938 | Ga0207661_12036713 | |||
| 1939 | Ga0207679_10523627 | |||
| 1940 | Ga0207679_11114661 | |||
| 1941 | Ga0207679_11244087 | |||
| 1942 | Ga0207667_10077710 | |||
| 1943 | Ga0207667_10094279 | |||
| 1944 | Ga0207667_10506430 | |||
| 1945 | Ga0207651_10715573 | |||
| 1946 | Ga0207651_10956080 | |||
| 1947 | Ga0207712_10052342 | |||
| 1948 | Ga0207712_10339945 | |||
| 1949 | Ga0207668_10009738 | |||
| 1950 | Ga0207668_10188431 | |||
| 1951 | Ga0207668_10588814 | |||
| 1952 | Ga0207668_10679050 | |||
| 1953 | Ga0207640_10812919 | |||
| 1954 | Ga0207677_10726142 | |||
| 1955 | Ga0207677_10825521 | |||
| 1956 | Ga0207677_11291240 | |||
| 1957 | Ga0207703_10464866 | |||
| 1958 | Ga0207639_10037858 | |||
| 1959 | Ga0207639_10313465 | |||
| 1960 | Ga0207678_10408754 | |||
| 1961 | Ga0207678_10547149 | |||
| 1962 | Ga0207678_11170749 | |||
| 1963 | Ga0207708_10067909 | |||
| 1964 | Ga0207708_10077414 | |||
| 1965 | Ga0207708_11473922 | |||
| 1966 | Ga0207708_11518936 | |||
| 1967 | Ga0207702_10004098 | |||
| 1968 | Ga0207702_10065246 | |||
| 1969 | Ga0207702_10619801 | |||
| 1970 | Ga0207702_10811067 | |||
| 1971 | Ga0207702_11078791 | |||
| 1972 | Ga0207641_10898051 | |||
| 1973 | Ga0207641_11841514 | |||
| 1974 | Ga0207641_12328347 | |||
| 1975 | Ga0207648_10029509 | |||
| 1976 | Ga0207648_10226366 | |||
| 1977 | Ga0207648_10248860 | |||
| 1978 | Ga0207676_10184195 | |||
| 1979 | Ga0207674_10001150 | |||
| 1980 | Ga0207674_10019690 | |||
| 1981 | Ga0207674_10045789 | |||
| 1982 | Ga0207674_10134684 | |||
| 1983 | Ga0207674_10277288 | |||
| 1984 | Ga0207674_10345643 | |||
| 1985 | Ga0207675_100192496 | |||
| 1986 | Ga0207675_100385654 | |||
| 1987 | Ga0207683_10010822 | |||
| 1988 | Ga0207683_10114313 | |||
| 1989 | Ga0207683_10288195 | |||
| 1990 | Ga0207698_10223582 | |||
| 1991 | Ga0207698_10436443 | |||
| 1992 | Ga0207698_10591646 | |||
| 1993 | Ga0207698_10592366 | |||
| 1994 | Ga0207698_11082165 | |||
| 1995 | Ga0207698_11410675 | |||
| 1996 | Ga0207698_12705961 | |||
| 1997 | Ga0207428_10000536 | |||
| 1998 | Ga0207428_10012230 | |||
| 1999 | Ga0207428_10026570 | |||
| 2000 | Ga0207428_10044535 | |||
| 2001 | Ga0207428_10333954 | |||
| 2002 | Ga0207428_10596396 | |||
| 2003 | Ga0207428_11190180 | |||
| 2004 | Ga0268266_10036563 | |||
| 2005 | Ga0268266_10090416 | |||
| 2006 | Ga0268266_10944596 | |||
| 2007 | Ga0268266_11205453 | |||
| 2008 | Ga0268265_10910345 | |||
| 2009 | Ga0268264_10486763 | |||
| 2010 | Ga0268264_10860024 | |||
| 2011 | Ga0316178_1037630 | |||
| 2012 | Ga0307408_101684150 | |||
| 2013 | Ga0307408_102061275 | |||
| 2014 | Ga0307408_102278527 | |||
| 2015 | Ga0307408_102290394 | |||
| 2016 | Ga0307405_10048936 | |||
| 2017 | Ga0307405_10102728 | |||
| 2018 | Ga0307405_10935387 | |||
| 2019 | Ga0307405_11037297 | |||
| 2020 | Ga0307405_11152827 | |||
| 2021 | Ga0307413_10007066 | |||
| 2022 | Ga0307413_10254537 | |||
| 2023 | Ga0307410_10015876 | |||
| 2024 | Ga0307410_11447158 | |||
| 2025 | Ga0307406_10095538 | |||
| 2026 | Ga0307406_10168082 | |||
| 2027 | Ga0307406_11121042 | |||
| 2028 | Ga0307407_10003349 | |||
| 2029 | Ga0307407_10175804 | |||
| 2030 | Ga0307407_10233446 | |||
| 2031 | Ga0307407_10631261 | |||
| 2032 | Ga0307407_11141684 | |||
| 2033 | Ga0307412_10091827 | |||
| 2034 | Ga0307412_10093161 | |||
| 2035 | Ga0307412_10329700 | |||
| 2036 | Ga0307409_100003896 | |||
| 2037 | Ga0307409_100045038 | |||
| 2038 | Ga0307409_100115250 | |||
| 2039 | Ga0307409_100206755 | |||
| 2040 | Ga0307409_100311664 | |||
| 2041 | Ga0307409_100384618 | |||
| 2042 | Ga0307409_100517677 | |||
| 2043 | Ga0307409_100588855 | |||
| 2044 | Ga0307409_101527753 | |||
| 2045 | Ga0307409_102839468 | |||
| 2046 | Ga0307416_100029210 | |||
| 2047 | Ga0307416_100032968 | |||
| 2048 | Ga0307416_100153538 | |||
| 2049 | Ga0307416_100516232 | |||
| 2050 | Ga0307416_100566591 | |||
| 2051 | Ga0307416_100687956 | |||
| 2052 | Ga0307416_100985989 | |||
| 2053 | Ga0307416_100997313 | |||
| 2054 | Ga0307416_101166592 | |||
| 2055 | Ga0307416_101267778 | |||
| 2056 | Ga0307416_103312202 | |||
| 2057 | Ga0307414_10113787 | |||
| 2058 | Ga0307414_10658948 | |||
| 2059 | Ga0307414_11577395 | |||
| 2060 | Ga0307411_10073410 | |||
| 2061 | Ga0307411_10166703 | |||
| 2062 | Ga0307411_11589718 | |||
| 2063 | Ga0307411_12212169 | |||
| 2064 | Ga0307415_100001530 | |||
| 2065 | Ga0307415_100017904 | |||
| 2066 | Ga0307415_100054831 | |||
| 2067 | Ga0307415_100699011 | |||
| 2068 | Ga0373930_0121727 | |||
| 2069 | Ga0373944_0293153 | |||
| 2070 | Ga0373951_0263284 | |||
| 2071 | Ga0373932_0187110 | |||
| 2072 | Ga0373939_0395136 | |||
| 2073 | Ga0373954_0428778 | |||
| 2074 | Ga0373960_0400001 | |||
| 2075 | Ga0373942_0335848 | |||
| 2076 | Ga0373961_0095177 | |||
| 2077 | Ga0373931_0053746 | |||
| 2078 | Ga0373931_1169192 | |||
| 2079 | Ga0373935_1101432 | |||
| 2080 | Ga0373947_0728286 | |||
| 2081 | Ga0395899_0007828 | |||
| 2082 | Ga0395899_0008491 | |||
| 2083 | Ga0395899_0012697 | |||
| 2084 | Ga0395899_0014207 | |||
| 2085 | Ga0395899_0021696 | |||
| 2086 | Ga0395899_0033808 | |||
| 2087 | Ga0395899_0050107 | |||
| 2088 | Ga0395899_0145003 | |||
| 2089 | Ga0395899_0145331 | |||
| 2090 | Ga0395899_0166908 | |||
| 2091 | Ga0395899_0316534 | |||
| 2092 | Ga0395899_0531307 | |||
| 2093 | Ga0395899_0540227 | |||
| 2094 | Ga0395900_0001553 | |||
| 2095 | Ga0395900_0012790 | |||
| 2096 | Ga0395900_0021952 | |||
| 2097 | Ga0395900_0022614 | |||
| 2098 | Ga0395900_0023193 | |||
| 2099 | Ga0395900_0050981 | |||
| 2100 | Ga0395900_0052104 | |||
| 2101 | Ga0395900_0055656 | |||
| 2102 | Ga0395900_0070049 | |||
| 2103 | Ga0395900_0075062 | |||
| 2104 | Ga0395900_0115199 | |||
| 2105 | Ga0395900_0145035 | |||
| 2106 | Ga0395900_0202017 | |||
| 2107 | Ga0395900_0219935 | |||
| 2108 | Ga0395900_0289524 | |||
| 2109 | Ga0395900_0378820 | |||
| 2110 | Ga0395900_0492682 | |||
| 2111 | Ga0395900_0532422 | |||
| 2112 | Ga0395900_0589808 | |||
| 2113 | Ga0395900_0781683 | |||
| 2114 | Ga0395900_0925434 | |||
| 2115 | Ga0395900_1034123 | |||
| 2116 | Ga0395900_1270813 | |||
| 2117 | Ga0395900_1277452 | |||
| 2118 | Ga0395900_1409215 | |||
| 2119 | Ga0395900_1519988 | |||
| 2120 | Ga0395900_1669698 | |||
| 2121 | Ga0395900_1870118 | |||
| 2122 | Ga0395898_0002858 | |||
| 2123 | Ga0395898_0021795 | |||
| 2124 | Ga0395898_0025590 | |||
| 2125 | Ga0395898_0027149 | |||
| 2126 | Ga0395898_0037487 | |||
| 2127 | Ga0395898_0041969 | |||
| 2128 | Ga0395898_0093507 | |||
| 2129 | Ga0395898_0096225 | |||
| 2130 | Ga0395898_0234996 | |||
| 2131 | Ga0395898_0381341 | |||
| 2132 | Ga0395898_0508228 | |||
| 2133 | Ga0395898_0648023 | |||
| 2134 | Ga0395898_0766874 | |||
| 2135 | Ga0395898_0974239 | |||
| 2136 | Ga0395898_1090281 | |||
| 2137 | Ga0395898_1316919 | |||
| 2138 | Ga0395898_1730324 | |||
| 2139 | Ga0395905_0002826 | |||
| 2140 | Ga0395905_0005069 | |||
| 2141 | Ga0395905_0006393 | |||
| 2142 | Ga0395905_0012073 | |||
| 2143 | Ga0395905_0018558 | |||
| 2144 | Ga0395905_0029705 | |||
| 2145 | Ga0395905_0033462 | |||
| 2146 | Ga0395905_0064347 | |||
| 2147 | Ga0395905_0101391 | |||
| 2148 | Ga0395905_0107338 | |||
| 2149 | Ga0395905_0113689 | |||
| 2150 | Ga0395905_0114990 | |||
| 2151 | Ga0395905_0147772 | |||
| 2152 | Ga0395905_0150369 | |||
| 2153 | Ga0395905_0159763 | |||
| 2154 | Ga0395905_0188991 | |||
| 2155 | Ga0395905_0698388 | |||
| 2156 | Ga0395905_0799838 | |||
| 2157 | Ga0395905_0807432 | |||
| 2158 | Ga0395905_1176322 | |||
| 2159 | Ga0395905_1270012 | |||
| 2160 | Ga0395905_1444153 | |||
| 2161 | Ga0395905_1583378 | |||
| 2162 | Ga0395901_0003414 | |||
| 2163 | Ga0395901_0006478 | |||
| 2164 | Ga0395901_0007417 | |||
| 2165 | Ga0395901_0009653 | |||
| 2166 | Ga0395901_0010617 | |||
| 2167 | Ga0395901_0022705 | |||
| 2168 | Ga0395901_0033632 | |||
| 2169 | Ga0395901_0045082 | |||
| 2170 | Ga0395901_0066857 | |||
| 2171 | Ga0395901_0078559 | |||
| 2172 | Ga0395901_0135207 | |||
| 2173 | Ga0395901_0173151 | |||
| 2174 | Ga0395901_0237332 | |||
| 2175 | Ga0395901_0321267 | |||
| 2176 | Ga0395901_0344220 | |||
| 2177 | Ga0395901_0367390 | |||
| 2178 | Ga0395901_0382551 | |||
| 2179 | Ga0395901_0405310 | |||
| 2180 | Ga0395901_0434487 | |||
| 2181 | Ga0395901_0451648 | |||
| 2182 | Ga0395901_0593840 | |||
| 2183 | Ga0395901_0603207 | |||
| 2184 | Ga0395901_0611251 | |||
| 2185 | Ga0395901_0674757 | |||
| 2186 | Ga0395901_0821798 | |||
| 2187 | Ga0395901_0929463 | |||
| 2188 | Ga0395901_0963153 | |||
| 2189 | Ga0395901_0968798 | |||
| 2190 | Ga0395901_0996210 | |||
| 2191 | Ga0395901_1336957 | |||
| 2192 | Ga0395901_1570188 | |||
| 2193 | Ga0395901_1870151 | |||
| 2194 | Ga0439436_0218924 | |||
| 2195 | Ga0439438_130960 | |||
| 2196 | Ga0439439_0006255 | |||
| 2197 | Ga0439453_0002223 | |||
| 2198 | Ga0439453_0005720 | |||
| 2199 | Ga0439461_0031942 | |||
| 2200 | Ga0439466_0088650 | |||
| 2201 | Ga0451800_0309535 | |||
| 2202 | Ga0451853_2179209 | |||
| 2203 | Ga0439431_0111550 | |||
| 2204 | Ga0439431_0138589 | |||
| 2205 | Ga0439433_0023140 | |||
| 2206 | Ga0439437_015360 | |||
| 2207 | Ga0439441_017373 | |||
| 2208 | Ga0439442_006866 | |||
| 2209 | Ga0439442_023510 | |||
| 2210 | Ga0439445_0178903 | |||
| 2211 | Ga0439448_0003027 | |||
| 2212 | Ga0439448_0061733 | |||
| 2213 | Ga0439449_0058128 | |||
| 2214 | Ga0439450_049964 | |||
| 2215 | Ga0439451_016636 | |||
| 2216 | Ga0439451_024833 | |||
| 2217 | Ga0439452_088132 | |||
| 2218 | Ga0439454_081731 | |||
| 2219 | Ga0439455_0217342 | |||
| 2220 | Ga0439455_0240557 | |||
| 2221 | Ga0439462_0004580 | |||
| 2222 | Ga0439463_120763 | |||
| 2223 | Ga0439463_175103 | |||
| 2224 | Ga0450914_021871 | |||
| 2225 | Ga0450920_089665 | |||
| 2226 | Ga0450923_173904 | |||
| 2227 | Ga0450890_023110 | |||
| 2228 | Ga0450900_011248 | |||
| 2229 | Ga0450902_029791 | |||
| 2230 | Ga0450905_015382 | |||
| 2231 | Ga0450907_005941 | |||
| 2232 | Ga0450910_036354 | |||
| 2233 | Ga0450910_056967 | |||
| 2234 | Ga0439446_0021133 | |||
| 2235 | Ga0439458_0021478 | |||
| 2236 | Ga0439458_0205994 | |||
| 2237 | Ga0450908_006627 | |||
| 2238 | Ga0439434_0026709 | |||
| 2239 | Ga0439434_0038317 | |||
| 2240 | Ga0439435_0034455 | |||
| 2241 | Ga0439435_0295357 | |||
| 2242 | Ga0439464_0099723 | |||
| 2243 | Ga0450918_009019 | |||
| 2244 | Ga0439440_0231308 | |||
| 2245 | Ga0466972_0168827 | |||
| 2246 | Ga0466965_0339077 | |||
| 2247 | Ga0466966_0029678 | |||
| 2248 | Ga0466961_0017470 | |||
| 2249 | Ga0466961_0064374 | |||
| 2250 | Ga0466961_0488804 | |||
| 2251 | Ga0466963_0013473 | |||
| 2252 | Ga0466963_0015435 | |||
| 2253 | Ga0466963_0063986 | |||
| 2254 | Ga0466963_0079946 | |||
| 2255 | Ga0466963_0225724 | |||
| 2256 | Ga0466963_0589795 | |||
| 2257 | Ga0466963_0856809 | |||
| 2258 | Ga0466963_1196040 | |||
| 2259 | Ga0466964_0028639 | |||
| 2260 | Ga0466964_0188501 | |||
| 2261 | Ga0466964_0269470 | |||
| 2262 | Ga0466964_0327517 | |||
| 2263 | Ga0466971_0000831 | |||
| 2264 | Ga0466968_0032855 | |||
| 2265 | Ga0466968_0485567 | |||
| 2266 | Ga0466968_0505392 | |||
| 2267 | Ga0466970_0177592 | |||
| 2268 | Ga0466957_0001330 | |||
| 2269 | Ga0466960_0101107 | |||
| 2270 | Ga0466960_0268311 | |||
| 2271 | Ga0466960_0470536 | |||
| 2272 | Ga0466960_0537309 | |||
| 2273 | Ga0466959_0015047 | |||
| 2274 | Ga0451576_0510263 | |||
| 2275 | Ga0451576_1146877 | |||
| 2276 | Ga0466958_0008659 | |||
| 2277 | Ga0466958_0011986 | |||
| 2278 | Ga0466967_0011587 | |||
| 2279 | Ga0466967_0038525 | |||
| 2280 | Ga0466967_0074894 | |||
| 2281 | Ga0466967_0100598 | |||
| 2282 | Ga0466967_0116897 | |||
| 2283 | Ga0466967_0152767 | |||
| 2284 | Ga0466967_0168181 | |||
| 2285 | Ga0466967_0211307 | |||
| 2286 | Ga0466967_0628889 | |||
| 2287 | Ga0466967_0641626 | |||
| 2288 | Ga0466967_0660269 | |||
| 2289 | Ga0466967_0865924 | |||
| 2290 | Ga0466967_0899719 | |||
| 2291 | Ga0466967_1025621 | |||
| 2292 | Ga0466967_1038663 | |||
| 2293 | Ga0466967_2491659 | |||
| 2294 | Ga0495627_070290 | |||
| 2295 | Ga0495603_0144422 | |||
| 2296 | Ga0495590_0374008 | |||
| 2297 | Ga0495629_0428947 | |||
| 2298 | Ga0495582_0532604 | |||
| 2299 | Ga0495582_0557761 | |||
| 2300 | Ga0495605_0310537 | |||
| 2301 | Ga0495584_0520786 | |||
| 2302 | Ga0495596_0081125 | |||
| 2303 | Ga0495596_0451081 | |||
| 2304 | Ga0495607_0497972 | |||
| 2305 | Ga0495620_0065799 | |||
| 2306 | Ga0495628_0100958 | |||
| 2307 | Ga0495630_0052439 | |||
| 2308 | Ga0495630_0226607 | |||
| 2309 | Ga0495630_0342463 | |||
| 2310 | Ga0495663_0144823 | |||
| 2311 | Ga0495640_0229753 | |||
| 2312 | Ga0495587_0089926 | |||
| 2313 | Ga0495621_0027072 | |||
| 2314 | Ga0495667_0173584 | |||
| 2315 | Ga0495656_0254606 | |||
| 2316 | Ga0495656_0419928 | |||
| 2317 | Ga0495668_0188362 | |||
| 2318 | Ga0495625_0280710 | |||
| 2319 | Ga0495635_0667308 | |||
| 2320 | Ga0495657_0164444 | |||
| 2321 | Ga0495623_0283267 | |||
| 2322 | Ga0495647_0615142 | |||
| 2323 | Ga0495613_0285627 | |||
| 2324 | Ga0495613_0794556 | |||
| 2325 | Ga0495600_0115691 | |||
| 2326 | Ga0495581_0474673 | |||
| 2327 | Ga0495674_0418827 | |||
| 2328 | Ga0495676_0205592 | |||
| 2329 | Ga0495676_0760623 | |||
| 2330 | Ga0495680_0368245 | |||
| 2331 | Ga0495680_0497478 | |||
| 2332 | Ga0495675_0212780 | |||
| 2333 | Ga0495679_211766 | |||
| 2334 | Ga0495684_0470105 | |||
| 2335 | Ga0495614_0583253 | |||
| 2336 | Ga0496100_0058352 | |||
| 2337 | Ga0496100_0125907 | |||
| 2338 | Ga0496100_1102817 | |||
| 2339 | Ga0496100_1376458 | |||
| 2340 | Ga0496101_0063660 | |||
| 2341 | Ga0496101_0081843 | |||
| 2342 | Ga0496101_0091651 | |||
| 2343 | Ga0496101_0197564 | |||
| 2344 | Ga0496101_0331030 | |||
| 2345 | Ga0496102_0022571 | |||
| 2346 | Ga0496102_0023009 | |||
| 2347 | Ga0496102_0031090 | |||
| 2348 | Ga0496102_0252706 | |||
| 2349 | Ga0496102_0323854 | |||
| 2350 | Ga0496103_0007091 | |||
| 2351 | Ga0496103_0069723 | |||
| 2352 | Ga0496103_0712851 | |||
| 2353 | Ga0496104_0012670 | |||
| 2354 | Ga0496104_0233141 | |||
| 2355 | Ga0496104_0324386 | |||
| 2356 | Ga0496104_1174299 | |||
| 2357 | Ga0496105_0996113 | |||
| 2358 | Ga0496106_0020914 | |||
| 2359 | Ga0496106_0118474 | |||
| 2360 | Ga0496106_0216819 | |||
| 2361 | Ga0496106_1205921 | |||
| 2362 | Ga0496107_0077631 | |||
| 2363 | Ga0496107_0159994 | |||
| 2364 | Ga0496107_0214404 | |||
| 2365 | Ga0496108_0263078 | |||
| 2366 | Ga0496108_0379032 | |||
| 2367 | Ga0496108_0503910 | |||
| 2368 | Ga0496109_0103463 | |||
| 2369 | Ga0496109_0215223 | |||
| 2370 | Ga0496109_0244829 | |||
| 2371 | Ga0496109_1722827 | |||
| 2372 | Ga0496110_0009650 | |||
| 2373 | Ga0496110_0011731 | |||
| 2374 | Ga0496110_0189259 | |||
| 2375 | Ga0496110_0208339 | |||
| 2376 | Ga0496110_0230674 | |||
| 2377 | Ga0496110_0271396 | |||
| 2378 | Ga0496110_0410081 | |||
| 2379 | Ga0496110_0555096 | |||
| 2380 | Ga0496110_0767124 | |||
| 2381 | Ga0496111_0045231 | |||
| 2382 | Ga0496111_0049657 | |||
| 2383 | Ga0496111_0059509 | |||
| 2384 | Ga0496111_0146490 | |||
| 2385 | Ga0496111_0169093 | |||
| 2386 | Ga0496111_0199124 | |||
| 2387 | Ga0496111_0742926 | |||
| 2388 | Ga0496111_0822427 | |||
| 2389 | Ga0496111_1100938 | |||
| 2390 | Ga0496112_0003611 | |||
| 2391 | Ga0496112_0047768 | |||
| 2392 | Ga0496112_0094601 | |||
| 2393 | Ga0496112_0110992 | |||
| 2394 | Ga0496112_0146267 | |||
| 2395 | Ga0496112_1476198 | |||
| 2396 | Ga0496113_0265442 | |||
| 2397 | Ga0496113_1123001 | |||
| 2398 | Ga0496114_0000442 | |||
| 2399 | Ga0496114_0066590 | |||
| 2400 | Ga0496114_0142410 | |||
| 2401 | Ga0496114_0765749 | |||
| 2402 | Ga0496114_1526629 | |||
| 2403 | Ga0496114_1665284 | |||
| 2404 | Ga0496115_1209130 | |||
| 2405 | Ga0501031_0000143 | |||
| 2406 | Ga0501031_0010987 | |||
| 2407 | Ga0501031_0093994 | |||
| 2408 | Ga0501031_0211263 | |||
| 2409 | Ga0501031_0649800 | |||
| 2410 | Ga0501031_0734714 | |||
| 2411 | Ga0501032_0009219 | |||
| 2412 | Ga0501032_0545993 | |||
| 2413 | Ga0501032_0585018 | |||
| 2414 | Ga0501032_0691671 | |||
| 2415 | Ga0501032_0834809 | |||
| 2416 | Ga0501033_0002376 | |||
| 2417 | Ga0501033_0022460 | |||
| 2418 | Ga0501033_0066278 | |||
| 2419 | Ga0501033_0494914 | |||
| 2420 | Ga0501033_1154416 | |||
| 2421 | Ga0501034_0014167 | |||
| 2422 | Ga0501034_0049959 | |||
| 2423 | Ga0501034_1679246 | |||
| 2424 | Ga0501036_0000767 | |||
| 2425 | Ga0501036_0007871 | |||
| 2426 | Ga0501036_0040462 | |||
| 2427 | Ga0501036_0161358 | |||
| 2428 | Ga0501036_0268483 | |||
| 2429 | Ga0501036_0304389 | |||
| 2430 | Ga0501036_0789500 | |||
| 2431 | Ga0501036_0826123 | |||
| 2432 | Ga0501036_0919297 | |||
| 2433 | Ga0501036_1235105 | |||
| 2434 | Ga0501037_0000558 | |||
| 2435 | Ga0501037_0249679 | |||
| 2436 | Ga0501037_0509819 | |||
| 2437 | Ga0501037_1022604 | |||
| 2438 | Ga0501038_0001974 | |||
| 2439 | Ga0501038_0258729 | |||
| 2440 | Ga0501038_0349151 | |||
| 2441 | Ga0501038_0425750 | |||
| 2442 | Ga0501038_0889508 | |||
| 2443 | Ga0501038_0890600 | |||
| 2444 | Ga0501038_1003975 | |||
| 2445 | Ga0501038_1014378 | |||
| 2446 | Ga0501039_0003385 | |||
| 2447 | Ga0501039_0011636 | |||
| 2448 | Ga0501039_0013440 | |||
| 2449 | Ga0501039_0016294 | |||
| 2450 | Ga0501039_0109933 | |||
| 2451 | Ga0501039_0161148 | |||
| 2452 | Ga0501039_0361031 | |||
| 2453 | Ga0501039_0810018 | |||
| 2454 | Ga0501039_1569589 | |||
| 2455 | Ga0501040_0001835 | |||
| 2456 | Ga0501040_0029984 | |||
| 2457 | Ga0501040_0035697 | |||
| 2458 | Ga0501040_0079269 | |||
| 2459 | Ga0501040_0335680 | |||
| 2460 | Ga0501040_0422684 | |||
| 2461 | Ga0501040_0601621 | |||
| 2462 | Ga0501040_0929063 | |||
| 2463 | Ga0501040_1144958 | |||
| 2464 | Ga0501041_0011657 | |||
| 2465 | Ga0501041_0020444 | |||
| 2466 | Ga0501041_0025444 | |||
| 2467 | Ga0501041_0154948 | |||
| 2468 | Ga0501041_0193988 | |||
| 2469 | Ga0501041_0271990 | |||
| 2470 | Ga0501041_0484353 | |||
| 2471 | Ga0501041_0743683 | |||
| 2472 | Ga0501041_0751927 | |||
| 2473 | Ga0501041_0854362 | |||
| 2474 | Ga0501041_0870367 | |||
| 2475 | Ga0501041_0901216 | |||
| 2476 | Ga0501042_0000785 | |||
| 2477 | Ga0501042_0007018 | |||
| 2478 | Ga0501042_0018547 | |||
| 2479 | Ga0501042_0020334 | |||
| 2480 | Ga0501042_0024913 | |||
| 2481 | Ga0501042_0114240 | |||
| 2482 | Ga0501042_0240505 | |||
| 2483 | Ga0501042_0365805 | |||
| 2484 | Ga0501042_0696913 | |||
| 2485 | Ga0501042_0701218 | |||
| 2486 | Ga0501042_0887674 | |||
| 2487 | Ga0501042_1420390 | |||
| 2488 | Ga0501042_1456793 | |||
| 2489 | Ga0501043_0003153 | |||
| 2490 | Ga0501043_0021083 | |||
| 2491 | Ga0501043_0166122 | |||
| 2492 | Ga0501043_0260959 | |||
| 2493 | Ga0501043_0700312 | |||
| 2494 | Ga0501043_1118921 | |||
| 2495 | Ga0501046_0004710 | |||
| 2496 | Ga0501046_0024951 | |||
| 2497 | Ga0501046_0036430 | |||
| 2498 | Ga0501046_0040701 | |||
| 2499 | Ga0501046_0400863 | |||
| 2500 | Ga0501047_0004536 | |||
| 2501 | Ga0501047_0009861 | |||
| 2502 | Ga0501047_0017625 | |||
| 2503 | Ga0501047_0324560 | |||
| 2504 | Ga0501048_0010994 | |||
| 2505 | Ga0501048_0012448 | |||
| 2506 | Ga0501048_0083807 | |||
| 2507 | Ga0501048_0085103 | |||
| 2508 | Ga0501048_0149585 | |||
| 2509 | Ga0501048_0469530 | |||
| 2510 | Ga0501048_0779465 | |||
| 2511 | Ga0501048_0819044 | |||
| 2512 | Ga0501048_0972170 | |||
| 2513 | Ga0501048_1203066 | |||
| 2514 | Ga0501048_1363443 | |||
| 2515 | Ga0501067_0019282 | |||
| 2516 | Ga0501067_0124766 | |||
| 2517 | Ga0501067_0226862 | |||
| 2518 | Ga0501068_0001101 | |||
| 2519 | Ga0501068_0040130 | |||
| 2520 | Ga0501068_0052025 | |||
| 2521 | Ga0501068_0067805 | |||
| 2522 | Ga0501068_0174555 | |||
| 2523 | Ga0501068_0508255 | |||
| 2524 | Ga0501068_0774028 | |||
| 2525 | Ga0501068_0972736 | |||
| 2526 | Ga0501068_1031316 | |||
| 2527 | Ga0501069_0000164 | |||
| 2528 | Ga0501069_0023440 | |||
| 2529 | Ga0501069_0215970 | |||
| 2530 | Ga0501069_0832628 | |||
| 2531 | Ga0501069_0960562 | |||
| 2532 | Ga0501070_0002617 | |||
| 2533 | Ga0501070_0042381 | |||
| 2534 | Ga0501070_0056977 | |||
| 2535 | Ga0501070_0214798 | |||
| 2536 | Ga0501070_0332187 | |||
| 2537 | Ga0501070_0405193 | |||
| 2538 | Ga0501071_0016948 | |||
| 2539 | Ga0501071_0017070 | |||
| 2540 | Ga0501071_0096348 | |||
| 2541 | Ga0501071_0100489 | |||
| 2542 | Ga0501071_0138296 | |||
| 2543 | Ga0501071_0140288 | |||
| 2544 | Ga0501071_0166109 | |||
| 2545 | Ga0501071_0278305 | |||
| 2546 | Ga0501071_0440523 | |||
| 2547 | Ga0501071_0602744 | |||
| 2548 | Ga0501071_0862869 | |||
| 2549 | Ga0501071_1086846 | |||
| 2550 | Ga0501071_1332673 | |||
| 2551 | Ga0501072_0001470 | |||
| 2552 | Ga0501072_0009619 | |||
| 2553 | Ga0501072_0019421 | |||
| 2554 | Ga0501072_0023181 | |||
| 2555 | Ga0501072_0084089 | |||
| 2556 | Ga0501072_0117400 | |||
| 2557 | Ga0501072_0175855 | |||
| 2558 | Ga0501072_0293216 | |||
| 2559 | Ga0501072_0681809 | |||
| 2560 | Ga0501073_0009164 | |||
| 2561 | Ga0501073_0414304 | |||
| 2562 | Ga0501073_0604090 | |||
| 2563 | Ga0501074_0000321 | |||
| 2564 | Ga0501074_0004627 | |||
| 2565 | Ga0501074_0017499 | |||
| 2566 | Ga0501074_0081844 | |||
| 2567 | Ga0501074_0102912 | |||
| 2568 | Ga0501074_0286052 | |||
| 2569 | Ga0501074_0615671 | |||
| 2570 | Ga0501074_0729675 | |||
| 2571 | Ga0501074_0751243 | |||
| 2572 | Ga0501074_1217296 | |||
| 2573 | Ga0501075_0008772 | |||
| 2574 | Ga0501075_0018372 | |||
| 2575 | Ga0501075_0026422 | |||
| 2576 | Ga0501075_0048433 | |||
| 2577 | Ga0501075_0083694 | |||
| 2578 | Ga0501075_0086806 | |||
| 2579 | Ga0501075_0097392 | |||
| 2580 | Ga0501075_0168701 | |||
| 2581 | Ga0501075_0214544 | |||
| 2582 | Ga0501075_0364206 | |||
| 2583 | Ga0501075_0524572 | |||
| 2584 | Ga0501075_1135085 | |||
| 2585 | Ga0501075_1144968 | |||
| 2586 | Ga0501076_0001569 | |||
| 2587 | Ga0501076_0006475 | |||
| 2588 | Ga0501076_0024647 | |||
| 2589 | Ga0501076_0083688 | |||
| 2590 | Ga0501076_0139579 | |||
| 2591 | Ga0501076_0241625 | |||
| 2592 | Ga0501076_0537836 | |||
| 2593 | Ga0501076_1703826 | |||
| 2594 | Ga0501076_1784323 | |||
| 2595 | Ga0501077_0003418 | |||
| 2596 | Ga0501077_0013074 | |||
| 2597 | Ga0501077_0044271 | |||
| 2598 | Ga0501077_0047941 | |||
| 2599 | Ga0501077_0082928 | |||
| 2600 | Ga0501077_0139190 | |||
| 2601 | Ga0501077_0331697 | |||
| 2602 | Ga0501077_0855705 | |||
| 2603 | Ga0501079_0005337 | |||
| 2604 | Ga0501079_0007496 | |||
| 2605 | Ga0501079_0011148 | |||
| 2606 | Ga0501079_0046731 | |||
| 2607 | Ga0501079_0076880 | |||
| 2608 | Ga0501079_0130774 | |||
| 2609 | Ga0501079_0277555 | |||
| 2610 | Ga0501079_0293013 | |||
| 2611 | Ga0501079_0443844 | |||
| 2612 | Ga0501079_0550364 | |||
| 2613 | Ga0501079_0562517 | |||
| 2614 | Ga0501079_1095758 | |||
| 2615 | Ga0501080_0003261 | |||
| 2616 | Ga0501080_0027125 | |||
| 2617 | Ga0501080_0039151 | |||
| 2618 | Ga0501080_0071955 | |||
| 2619 | Ga0501080_0233236 | |||
| 2620 | Ga0501080_0425533 | |||
| 2621 | Ga0501080_0513821 | |||
| 2622 | Ga0501080_0679836 | |||
| 2623 | Ga0501081_0000852 | |||
| 2624 | Ga0501081_0013748 | |||
| 2625 | Ga0501081_0020952 | |||
| 2626 | Ga0501081_0088976 | |||
| 2627 | Ga0501081_0205441 | |||
| 2628 | Ga0501081_0312597 | |||
| 2629 | Ga0501081_0536495 | |||
| 2630 | Ga0501081_0571988 | |||
| 2631 | Ga0501083_0000179 | |||
| 2632 | Ga0501083_0063508 | |||
| 2633 | Ga0501083_0105067 | |||
| 2634 | Ga0501083_0142078 | |||
| 2635 | Ga0501083_0354626 | |||
| 2636 | Ga0501083_0380088 | |||
| 2637 | Ga0501035_0000493 | |||
| 2638 | Ga0501035_0046718 | |||
| 2639 | Ga0501035_0135555 | |||
| 2640 | Ga0501035_0320886 | |||
| 2641 | Ga0501035_0609809 | |||
| 2642 | Ga0501035_0951722 | |||
| 2643 | Ga0501035_1136146 | |||
| 2644 | Ga0501044_0005307 | |||
| 2645 | Ga0501044_0028152 | |||
| 2646 | Ga0501044_0921305 | |||
| 2647 | Ga0501045_0003079 | |||
| 2648 | Ga0501045_0008250 | |||
| 2649 | Ga0501045_0019287 | |||
| 2650 | Ga0501045_0034329 | |||
| 2651 | Ga0501045_0127396 | |||
| 2652 | Ga0501045_0168697 | |||
| 2653 | Ga0501045_0228615 | |||
| 2654 | Ga0501045_0281803 | |||
| 2655 | Ga0501045_0328195 | |||
| 2656 | Ga0501045_0435934 | |||
| 2657 | Ga0501045_0459118 | |||
| 2658 | Ga0501045_0514471 | |||
| 2659 | Ga0501045_0903800 | |||
| 2660 | Ga0501045_1116487 | |||
| 2661 | nmdc:mga00v17_149912_c1 | |||
| 2662 | nmdc:mga00v17_189156_c1 | |||
| 2663 | nmdc:mga00v17_786027_c1 | |||
| 2664 | nmdc:mga0yw44_205301_c1 | |||
| 2665 | nmdc:mga0yw44_73030_c1 | |||
| 2666 | nmdc:mga0yw44_915491_c1 | |||
| 2667 | nmdc:mga06z11_196941_c1 | |||
| 2668 | nmdc:mga05p37_1353856_c1 | |||
| 2669 | nmdc:mga05p37_1705496_c1 | |||
| 2670 | nmdc:mga05p37_37852_c1 | |||
| 2671 | nmdc:mga05p37_43526_c1 | |||
| 2672 | nmdc:mga05p37_5072_c1 | |||
| 2673 | nmdc:mga05p37_51869_c1 | |||
| 2674 | nmdc:mga05p37_74185_c2 | |||
| 2675 | nmdc:mga09592_1177227_c1 | |||
| 2676 | nmdc:mga09592_250955_c1 | |||
| 2677 | nmdc:mga09592_316899_c1 | |||
| 2678 | nmdc:mga09592_33257_c1 | |||
| 2679 | nmdc:mga09592_365435_c1 | |||
| 2680 | nmdc:mga09592_926770_c1 | |||
| 2681 | nmdc:mga09592_9396_c1 | |||
| 2682 | nmdc:mga0qj67_24510_c1 | |||
| 2683 | nmdc:mga0qj67_27445_c1 | |||
| 2684 | nmdc:mga0qj67_545164_c1 | |||
| 2685 | nmdc:mga06r32_246155_c1 | |||
| 2686 | nmdc:mga06r32_249817_c1 | |||
| 2687 | nmdc:mga06r32_250934_c1 | |||
| 2688 | nmdc:mga06r32_42785_c2 | |||
| 2689 | nmdc:mga06r32_70669_c1 | |||
| 2690 | nmdc:mga08y16_10615_c1 | |||
| 2691 | nmdc:mga08y16_1191710_c1 | |||
| 2692 | nmdc:mga08y16_1268522_c1 | |||
| 2693 | nmdc:mga08y16_239100_c1 | |||
| 2694 | nmdc:mga08y16_254234_c1 | |||
| 2695 | nmdc:mga08y16_375557_c1 | |||
| 2696 | nmdc:mga08y16_700565_c1 | |||
| 2697 | nmdc:mga08y16_7569_c1 | |||
| 2698 | nmdc:mga0n895_1559789_c1 | |||
| 2699 | nmdc:mga0n895_1898045_c1 | |||
| 2700 | nmdc:mga0n895_237729_c1 | |||
| 2701 | nmdc:mga0n895_644502_c1 | |||
| 2702 | nmdc:mga0rr50_122082_c1 | |||
| 2703 | nmdc:mga0rr50_31543_c1 | |||
| 2704 | nmdc:mga0rr50_434532_c1 | |||
| 2705 | nmdc:mga0rr50_737801_c1 | |||
| 2706 | nmdc:mga08x19_370067_c1 | |||
| 2707 | nmdc:mga0a205_1255921_c1 | |||
| 2708 | nmdc:mga0a205_185262_c1 | |||
| 2709 | nmdc:mga0a205_336070_c1 | |||
| 2710 | nmdc:mga0a205_42279_c1 | |||
| 2711 | Ga0495601_1055382 | |||
| 2712 | Ga0495612_0341833 | |||
| 2713 | Ga0495655_0016976 | |||
| 2714 | Ga0495595_0186503 | |||
| 2715 | Ga0495619_0073266 | |||
| 2716 | Ga0501084_0003960 | |||
| 2717 | Ga0501084_0013123 | |||
| 2718 | Ga0501084_0022244 | |||
| 2719 | Ga0501084_0029841 | |||
| 2720 | Ga0501084_0049147 | |||
| 2721 | Ga0501084_0063448 | |||
| 2722 | Ga0501084_0174137 | |||
| 2723 | Ga0501084_0218404 | |||
| 2724 | Ga0501084_0287116 | |||
| 2725 | Ga0501084_0646006 | |||
| 2726 | Ga0501084_1128307 | |||
| 2727 | Ga0590071_140484 | |||
| 2728 | Ga0590074_021865 | |||
| 2729 | Ga0590075_076056 | |||
| 2730 | Ga0590075_162340 | |||
| 2731 | Ga0590077_126921 | |||
| 2732 | Ga0501082_0001562 | |||
| 2733 | Ga0501082_0002174 | |||
| 2734 | Ga0501082_0017729 | |||
| 2735 | Ga0501082_0033004 | |||
| 2736 | Ga0501082_0085042 | |||
| 2737 | Ga0501082_0130072 | |||
| 2738 | Ga0501082_0310713 | |||
| 2739 | Ga0501082_0727691 | |||
| 2740 | Ga0501082_0793969 | |||
| 2741 | Ga0466962_0000400 | |||
| 2742 | Ga0466962_0545547 | |||
| 2743 | Ga0530510_0001510 | |||
| 2744 | Ga0530510_0003823 | |||
| 2745 | Ga0530510_0009903 | |||
| 2746 | Ga0530510_0010034 | |||
| 2747 | Ga0530510_0091257 | |||
| 2748 | Ga0530510_0331399 | |||
| 2749 | Ga0530510_0606255 | |||
| 2750 | Ga0530510_1037444 | |||
| 2751 | Ga0530510_1208846 | |||
| 2752 | Ga0530510_1346892 |
Family Sequences
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5wuq-assembly2.cif.gz_D | crystal structure of sigw in complex with its anti-sigma rsiw, a zinc binding form | 0.5415 | 29 | 75 |
| 3hug-assembly6.cif.gz_P | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.5242 | 30 | 75 |
| 2ouw-assembly1.cif.gz_B | crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution | 0.5205 | 8 | 73 |
| 2ouw-assembly1.cif.gz_B | crystal structure of alkylhydroperoxidase ahpd core (yp_425393.1) from rhodospirillum rubrum atcc 11170 at 1.95 a resolution | 0.4565 | 8 | 73 |
| 3hug-assembly6.cif.gz_P | crystal structure of mycobacterium tuberculosis anti-sigma factor rsla in complex with -35 promoter binding domain of sigl | 0.4275 | 30 | 75 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 2z2sB01 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.6422 | 31 | 72 | 1.10.10.1320 |
| af_Q9UW24_7_110_1.25.40.70 | Mainly Alpha;Alpha Horseshoe;Serine Threonine Protein Phosphatase 5, Tetratricopeptide repeat;Phosphatidylinositol 3-kinase, accessory domain (PIK) | 0.6332 | 21 | 74 | 1.25.40.70 |
| 3hugD00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.5729 | 30 | 72 | 1.10.10.1320 |
| 3hugP00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.5242 | 30 | 75 | 1.10.10.1320 |
| 3hugT00 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Anti-sigma factor, zinc-finger domain | 0.5209 | 29 | 75 | 1.10.10.1320 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2D6LCD1-F1-model_v4 | Zf-HC2 domain-containing protein | 0.9349 | 20 | 71 |
|
| AF-A0A6P2C7M5-F1-model_v4 | Zf-HC2 domain-containing protein | 0.9303 | 20 | 71 |
|
| AF-A0A661W3Z6-F1-model_v4 | Zinc-finger domain-containing protein | 0.912 | 19 | 74 |
|
| AF-A0A538CRS3-F1-model_v4 | Zf-HC2 domain-containing protein | 0.8683 | 14 | 75 |
|
| AF-A0A1F8U7R0-F1-model_v4 | Zinc-finger domain-containing protein | 0.8665 | 13 | 70 |
|