F493404

General Info

Members Datasets Scaffolds Average Seq Length
1370 553 2740 171

Family's Representative Sequence

Representative Sequence 3300005841|Ga0068863_101115030|Ga0068863_1011150302
Length 182
Sequence VTTLAITINGRPYGPTEVRDDLTMNDFLREMLGMTGTKFGCGAAQCLSCAVIIDNPDGTSYTSPTCIVPALSFNGKAIRTVEGHAEDGKLSVLQKAFIEHFAFQCGFCTAGFLNEGQVLLERLAKKPVARAELEKTITEALDGHLCRCTGYIKYHEAVRDVILAEPGRYLVVTTGQRPGEKQ

Samples

Sample ID Description Type Environment
1 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
2 3300001989 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
7 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
8 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
9 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
10 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
11 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
12 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
13 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
14 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
15 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
16 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
17 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
18 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
19 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
20 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
21 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
22 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
23 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
24 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
25 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
26 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
27 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
28 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
29 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
30 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
31 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
32 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
33 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
34 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
35 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
36 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
37 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
38 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
39 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
40 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
41 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
42 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
43 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
44 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
45 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
46 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
47 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
48 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
49 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
50 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
51 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
52 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
53 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
54 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
55 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
56 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
57 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
58 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
59 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
60 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
61 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
62 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
63 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
64 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
65 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
66 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
67 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
68 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
69 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
70 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
71 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
72 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
73 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
74 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
75 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
76 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
77 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
78 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
79 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
80 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
81 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
82 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
83 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
84 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
89 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
90 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
91 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
92 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
93 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
94 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
95 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
96 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
97 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
98 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
99 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
100 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
101 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
102 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
103 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
104 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
105 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
113 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
114 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
115 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
116 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
117 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
121 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
122 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
123 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
124 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
125 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
126 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
127 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
128 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
129 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
130 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
131 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
132 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
133 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
134 3300021358 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 Metagenome Rhizosphere
135 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
136 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
137 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
138 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
139 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
140 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
141 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
142 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025711 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027512 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028786 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 23_EM Metagenome Unclassified
216 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
217 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
218 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
219 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
220 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
221 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
222 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
223 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
224 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
227 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
228 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
229 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
230 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
231 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
232 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
233 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
234 3300033442 Root nodule microbial communities collected in Santa Monica, California, United States - Edamame nodules 1 Metagenome Nodule
235 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
236 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
237 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
246 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
247 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
248 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
249 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
250 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
254 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
255 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
256 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
257 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
258 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
262 3300041441 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_1 MetaG Metagenome Rhizoplane
263 3300041451 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_3 MetaG Metagenome Rhizoplane
264 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
265 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
266 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
267 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
268 3300041509 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_6 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
271 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
272 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
273 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
274 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
275 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
276 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
277 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
278 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
279 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
280 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
281 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
282 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
283 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
284 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
285 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
286 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
287 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
288 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
289 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
290 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
291 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
292 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
293 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
297 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
300 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
301 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
302 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
303 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
306 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
307 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
308 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
309 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
310 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
311 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
312 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
313 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
314 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
315 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
316 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
317 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
318 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
319 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
320 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
321 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
322 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
323 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
324 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
325 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
326 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
327 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
328 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
329 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
330 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
335 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
336 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
337 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
338 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
339 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
340 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
341 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
342 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
343 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
344 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
345 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
346 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
347 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
348 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
349 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
350 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
351 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
352 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
353 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
354 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
355 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
356 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
357 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
358 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
359 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
360 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
361 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
362 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
363 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
364 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
365 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
366 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
367 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
368 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
369 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
370 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
371 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
372 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
373 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
374 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
375 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
376 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
377 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
378 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
379 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
380 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
381 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
382 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
383 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
384 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
385 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
386 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
387 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
388 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
389 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
390 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
391 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
392 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
393 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
394 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
395 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
396 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
397 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
398 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
399 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
400 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
401 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
402 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
403 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
404 3300053080 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 endosphere Metagenome Endosphere
405 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
406 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
407 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
408 3300053086 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 endosphere Metagenome Endosphere
409 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
410 3300053091 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 endosphere Metagenome Endosphere
411 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
412 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
413 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
414 3300053095 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL3_72_14 endosphere Metagenome Endosphere
415 3300053096 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 endosphere Metagenome Endosphere
416 3300053102 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 endosphere Metagenome Endosphere
417 3300053104 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 endosphere Metagenome Endosphere
418 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
419 3300053108 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 endosphere Metagenome Endosphere
420 3300053109 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 endosphere Metagenome Endosphere
421 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
422 3300053120 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 endosphere Metagenome Endosphere
423 3300053122 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 endosphere Metagenome Endosphere
424 3300053123 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 endosphere Metagenome Endosphere
425 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
426 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
427 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
428 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
429 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
430 3300053142 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 endosphere Metagenome Endosphere
431 3300053146 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 endosphere Metagenome Endosphere
432 3300053147 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 endosphere Metagenome Endosphere
433 3300053150 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 endosphere Metagenome Endosphere
434 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
435 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
436 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
437 3300053158 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 endosphere Metagenome Endosphere
438 3300053160 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 endosphere Metagenome Endosphere
439 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
440 3300053162 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 endosphere Metagenome Endosphere
441 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
442 3300053178 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 endosphere Metagenome Endosphere
443 3300053729 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 endosphere Metagenome Endosphere
444 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
445 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
446 3300053736 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 endosphere Metagenome Endosphere
447 3300053737 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 endosphere Metagenome Endosphere
448 3300055283 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23_RD_R2 endosphere Metagenome Endosphere
449 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
450 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere
451 2507262055 Bradyrhizobium sp. WSM1417 Isolate Nodule
452 2508501009 Bradyrhizobium sp. WSM471 Isolate Nodule
453 2508501042 Bradyrhizobium sp. WSM1253 Isolate Nodule
454 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
455 2513237096 Bradyrhizobium pachyrhizi USDA 3259 Isolate Nodule
456 2513237098 Bradyrhizobium elkanii WSM2783 Isolate Nodule
457 2513237104 Bradyrhizobium sp. EC3.3 Isolate Nodule
458 2513237137 Bradyrhizobium elkanii USDA 94 Isolate Nodule
459 2513237145 Bradyrhizobium elkanii USDA 3254 Isolate Nodule
460 2515154112 Bradyrhizobium sp. WSM4349 Isolate Nodule
461 2517572143 Bradyrhizobium elkanii USDA 76 Isolate Nodule
462 2524023205 Bradyrhizobium sp. Cp5.3 Isolate Nodule
463 2524023228 Bradyrhizobium sp. Th.b2 Isolate Nodule
464 2643221733 Bosea sp. Root381 Isolate Unclassified
465 2721755755 Bradyrhizobium icense LMTR 13 Isolate Nodule
466 2744054633 Bradyrhizobium neotropicale BR 10247 Isolate Unclassified
467 2791355199
468 2874590934 Bradyrhizobium canariense UBMA181 Isolate Nodule
469 2874620515 Bradyrhizobium nanningense CCBAU 53390 Isolate Unclassified
470 2874645413 Bradyrhizobium canariense UBMA122 Isolate Nodule
471 2876761206 Bradyrhizobium centrolobii BR 10245 Isolate Nodule
472 2876771140 Bradyrhizobium canariense UBMA192 Isolate Nodule
473 2876808645 Bradyrhizobium algeriense RST89 Isolate Unclassified
474 2876818435 Bradyrhizobium canariense UBMA195 Isolate Nodule
475 2879074833 Bradyrhizobium canariense UBMA171 Isolate Nodule
476 2879110137 Bradyrhizobium algeriense RST91 Isolate Nodule
477 2879127579 Bradyrhizobium canariense UBMA052 Isolate Nodule
478 2879142872 Bradyrhizobium canariense UBMA061 Isolate Nodule
479 2885366525 Bradyrhizobium sp. LVM 105 Isolate Unclassified
480 2885374607 Bradyrhizobium sp. NAS96.2 Isolate Unclassified
481 2885383462 Bradyrhizobium sp. Leo170 Isolate Unclassified
482 2903748898 Bradyrhizobium uaiense UFLA 03-164 Isolate Nodule
483 2903768456 Bradyrhizobium sp. Leo121 Isolate Unclassified
484 2904666416 Bradyrhizobium nanningense CCBAU 51757 Isolate Unclassified
485 2904690495 Bradyrhizobium ivorense CI-1B Isolate Nodule
486 2904699407
487 2906610324
488 2906626472 Bradyrhizobium hipponense aSej3 Isolate Unclassified
489 2906635258 Bradyrhizobium sp. USDA 3458 Isolate Unclassified
490 2906660503 Bradyrhizobium brasilense UFLA 03-321 Isolate Unclassified
491 2908739725 Bradyrhizobium sp. UFLA03-84 Isolate Nodule
492 2908756301 Bradyrhizobium ivorense CI-41S Isolate Nodule
493 2919450847 Ancylobacter sp. 3268 Isolate Rhizosphere
494 2922425934
495 2932794094 Bradyrhizobium sp. S3.2.6 Isolate Nodule
496 2932801729 Bradyrhizobium sp. S3.3.6 Isolate Nodule
497 2935608549 Bradyrhizobium sp. RT6a Isolate Nodule
498 2935630451 Bradyrhizobium sp. I1.14.4 Isolate Nodule
499 2935648319 Bradyrhizobium sp. JR4.3 Isolate Nodule
500 2935656913 Bradyrhizobium sp. JR5.3 Isolate Nodule
501 2935769743 Bradyrhizobium sp. LB12.1 Isolate Nodule
502 2935777560 Bradyrhizobium sp. LB14.3 Isolate Nodule
503 2935785616 Bradyrhizobium sp. LB5.2 Isolate Nodule
504 2935793552 Bradyrhizobium sp. LB8.2 Isolate Nodule
505 2935819856 Bradyrhizobium sp. RT3b Isolate Nodule
506 2935847175 Bradyrhizobium sp. RT5a Isolate Nodule
507 2935883170 Bradyrhizobium sp. S3.12.5 Isolate Nodule
508 2935908558 Bradyrhizobium sp. F1.1.1 Isolate Nodule
509 2935916978 Bradyrhizobium sp. F1.13.3 Isolate Nodule
510 2935926038 Bradyrhizobium sp. F1.2.1 Isolate Nodule
511 2935934488 Bradyrhizobium sp. F1.2.2 Isolate Nodule
512 2935942939 Bradyrhizobium sp. F1.2.6 Isolate Nodule
513 2935951376 Bradyrhizobium sp. F1.2.8 Isolate Nodule
514 2935967501 Bradyrhizobium sp. F1.6.2 Isolate Nodule
515 2935975950 Bradyrhizobium sp. GM2.2 Isolate Nodule
516 2935984226 Bradyrhizobium sp. i1.15.2 Isolate Nodule
517 2936011229 Bradyrhizobium sp. JR1.1 Isolate Nodule
518 2936019824 Bradyrhizobium sp. JR1.5 Isolate Nodule
519 2936028420 Bradyrhizobium sp. JR1.7 Isolate Nodule
520 2936046547 Bradyrhizobium sp. JR3.12 Isolate Nodule
521 2936055302 Bradyrhizobium sp. JR4.1 Isolate Nodule
522 2941507105 Bradyrhizobium sp. i1.12.3 Isolate Nodule
523 2941515067 Bradyrhizobium sp. i1.14.1 Isolate Nodule
524 2941523033 Bradyrhizobium sp. i1.8.4 Isolate Nodule
525 2941531003 Bradyrhizobium sp. LB11.1 Isolate Nodule
526 3005474847 Bradyrhizobium sp. CCBAU 53421 Isolate Nodule
527 3005594810 Bradyrhizobium sp. CCBAU 53340 Isolate Nodule
528 8001845381 Ancylobacter sonchi VKM B-3145 Isolate Unclassified
529 8006964411 Bradyrhizobium sp. sBnM-33 Isolate Nodule
530 8006973647 Bradyrhizobium septentrionale 162S2 Isolate Nodule
531 8006984368 Bradyrhizobium sp. SRL28 Isolate Unclassified
532 8016522445 Bradyrhizobium sp. LM6.9 Isolate Nodule
533 8016530956 Bradyrhizobium sp. LM6.11 Isolate Nodule
534 8016539877 Bradyrhizobium sp. LM6.10 Isolate Nodule
535 8016548790 Bradyrhizobium sp. LM3.6 Isolate Nodule
536 8016557553 Bradyrhizobium sp. LM3.4 Isolate Nodule
537 8016566248 Bradyrhizobium sp. LM3.2 Isolate Nodule
538 8016575299 Bradyrhizobium sp. LM2.9 Isolate Nodule
539 8016583857 Bradyrhizobium sp. LM2.7 Isolate Nodule
540 8016595262 Bradyrhizobium sp. LM2.3 Isolate Nodule
541 8016613128 Bradyrhizobium sp. LB7.1 Isolate Nodule
542 8016622563 Bradyrhizobium sp. LB13.1 Isolate Nodule
543 8016630954 Bradyrhizobium sp. F1.13.1 Isolate Nodule
544 8019530166 Bradyrhizobium sp. LM4.3 Isolate Nodule
545 8019555841 Bradyrhizobium sp. JR6.1 Isolate Nodule
546 8019565922 Bradyrhizobium sp. JR3.5 Isolate Nodule
547 8019619141 Bradyrhizobium sp. GM7.3 Isolate Nodule
548 8019638758 Bradyrhizobium sp. GM5.1 Isolate Nodule
549 8019648815 Bradyrhizobium sp. GM24.11 Isolate Nodule
550 8019668869 Bradyrhizobium sp. GM2.4 Isolate Nodule
551 8019678201 Bradyrhizobium sp. GM0.4 Isolate Nodule
552 8019687851 Bradyrhizobium sp. F1.13.4 Isolate Nodule
553 8056689827 Bradyrhizobium semiaridum WSM 1704 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 92.61
Metatranscriptomes 0.15
Isolates 7.25

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 11.09
Nodule 6.2
Rhizoplane 8.91
Rhizosphere 69.05
Stem 0
Stem Tuber 0
Unclassified 0

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0068863_101115030 3300005841 Bacteria 794
2 JGI24739J22299_10075864 3300001989 Bacteria 1039
3 JGI24743J22301_10007339 3300001991 Bacteria 1909
4 JGI24743J22301_10012808 3300001991 Bacteria 1531
5 JGI24742J22300_10000505 3300002244 Bacteria 5806
6 JGI24751J29686_10016475 3300002459 Bacteria 1524
7 JGI25153J46596_10084628 3300003215 Bacteria 781
8 Ga0065712_10006480 3300005290 Bacteria 4861
9 Ga0065715_10127944 3300005293 Bacteria 2057
10 Ga0065715_10130756 3300005293 Bacteria 1995
11 Ga0070658_10061394 3300005327 Bacteria 3062
12 Ga0070658_10160128 3300005327 Bacteria 1888
13 Ga0070658_10497799 3300005327 Bacteria 1052
14 Ga0070676_10031271 3300005328 Bacteria 3041
15 Ga0070683_100002855 3300005329 Bacteria 13833
16 Ga0070690_100017565 3300005330 Bacteria 4306
17 Ga0070690_100052415 3300005330 Bacteria 2608
18 Ga0070690_100530283 3300005330 Bacteria 885
19 Ga0070670_100025854 3300005331 Bacteria 5051
20 Ga0070670_100085973 3300005331 Bacteria 2702
21 Ga0070670_100328580 3300005331 Bacteria 1341
22 Ga0070670_100898770 3300005331 Bacteria 803
23 Ga0068869_100000224 3300005334 Bacteria 29645
24 Ga0068869_100556714 3300005334 Bacteria 964
25 Ga0068869_100830424 3300005334 Bacteria 796
26 Ga0070666_10004151 3300005335 Bacteria 8790
27 Ga0070666_10070746 3300005335 Bacteria 2374
28 Ga0070666_10163197 3300005335 Bacteria 1558
29 Ga0070680_100009965 3300005336 Bacteria 7320
30 Ga0070680_100194676 3300005336 Bacteria 1709
31 Ga0070680_100839550 3300005336 Bacteria 792
32 Ga0070682_100028268 3300005337 Bacteria 3372
33 Ga0068868_100010158 3300005338 Bacteria 6803
34 Ga0070660_100095382 3300005339 Bacteria 2351
35 Ga0070660_100193322 3300005339 Bacteria 1649
36 Ga0070689_100226516 3300005340 Bacteria 1535
37 Ga0070689_100572211 3300005340 Bacteria 976
38 Ga0070691_10048413 3300005341 Bacteria 2023
39 Ga0070691_10132782 3300005341 Bacteria 1263
40 Ga0070687_100019510 3300005343 Bacteria 3155
41 Ga0070661_100215481 3300005344 Bacteria 1471
42 Ga0070661_100673783 3300005344 Bacteria 841
43 Ga0070668_100015506 3300005347 Bacteria 5697
44 Ga0070668_100020791 3300005347 Bacteria 4957
45 Ga0070668_100060366 3300005347 Bacteria 2936
46 Ga0070668_100608619 3300005347 Bacteria 957
47 Ga0070669_100009656 3300005353 Bacteria 6874
48 Ga0070669_100036724 3300005353 Bacteria 3552
49 Ga0070669_100042830 3300005353 Bacteria 3296
50 Ga0070669_100217559 3300005353 Bacteria 1509
51 Ga0070669_100411980 3300005353 Bacteria 1108
52 Ga0070669_100779636 3300005353 Bacteria 811
53 Ga0070675_100008255 3300005354 Bacteria 8076
54 Ga0070675_100065037 3300005354 Bacteria 3015
55 Ga0070675_100266666 3300005354 Bacteria 1502
56 Ga0070675_101023539 3300005354 Bacteria 758
57 Ga0070675_101114818 3300005354 Bacteria 726
58 Ga0070671_100009484 3300005355 Bacteria 7814
59 Ga0070671_100061749 3300005355 Bacteria 3121
60 Ga0070671_100447939 3300005355 Bacteria 1107
61 Ga0070674_100001383 3300005356 Bacteria 12816
62 Ga0070674_100057066 3300005356 Bacteria 2709
63 Ga0070674_100749225 3300005356 Bacteria 839
64 Ga0070673_100007805 3300005364 Bacteria 7085
65 Ga0070673_100020941 3300005364 Bacteria 4728
66 Ga0070673_100029310 3300005364 Bacteria 4103
67 Ga0070673_100338624 3300005364 Bacteria 1332
68 Ga0070673_100580557 3300005364 Bacteria 1021
69 Ga0070688_100030437 3300005365 Bacteria 3240
70 Ga0070688_100076098 3300005365 Bacteria 2159
71 Ga0070659_100019602 3300005366 Bacteria 5129
72 Ga0070667_100016459 3300005367 Bacteria 6119
73 Ga0070667_100109429 3300005367 Bacteria 2395
74 Ga0070667_100283461 3300005367 Bacteria 1488
75 Ga0070667_100291107 3300005367 Bacteria 1468
76 Ga0070709_10025530 3300005434 Bacteria 3492
77 Ga0070709_10129324 3300005434 Bacteria 1722
78 Ga0070714_100026264 3300005435 Bacteria 4811
79 Ga0070714_100039094 3300005435 Bacteria 3992
80 Ga0070714_100069675 3300005435 Bacteria 3039
81 Ga0070714_100384524 3300005435 Bacteria 1324
82 Ga0070714_100413540 3300005435 Bacteria 1277
83 Ga0070714_101149114 3300005435 Bacteria 757
84 Ga0070713_100011022 3300005436 Bacteria 6562
85 Ga0070713_100091093 3300005436 Bacteria 2622
86 Ga0070713_100300916 3300005436 Bacteria 1476
87 Ga0070713_100366339 3300005436 Bacteria 1340
88 Ga0070713_100922277 3300005436 Bacteria 841
89 Ga0070710_10016187 3300005437 Bacteria 3789
90 Ga0070710_10407448 3300005437 Bacteria 913
91 Ga0070710_10756465 3300005437 Bacteria 690
92 Ga0070711_100021590 3300005439 Bacteria 4165
93 Ga0070711_100097360 3300005439 Bacteria 2133
94 Ga0070711_100217216 3300005439 Bacteria 1484
95 Ga0070711_100344523 3300005439 Bacteria 1197
96 Ga0070711_100351994 3300005439 Bacteria 1184
97 Ga0070705_100125406 3300005440 Bacteria 1665
98 Ga0070705_100142555 3300005440 Bacteria 1579
99 Ga0070705_100561764 3300005440 Bacteria 877
100 Ga0070705_101156148 3300005440 Bacteria 636
101 Ga0070700_100014295 3300005441 Bacteria 4478
102 Ga0070700_100144933 3300005441 Bacteria 1618
103 Ga0070700_100183153 3300005441 Bacteria 1459
104 Ga0070700_100408073 3300005441 Bacteria 1023
105 Ga0070708_100041936 3300005445 Bacteria 4015
106 Ga0070708_100051002 3300005445 Bacteria 3665
107 Ga0070708_100054107 3300005445 Bacteria 3564
108 Ga0070708_101031586 3300005445 Bacteria 771
109 Ga0070663_100107514 3300005455 Bacteria 2091
110 Ga0070663_100351239 3300005455 Bacteria 1194
111 Ga0070663_100656517 3300005455 Bacteria 887
112 Ga0070678_100061968 3300005456 Bacteria 2759
113 Ga0070678_100283491 3300005456 Bacteria 1402
114 Ga0070662_100012198 3300005457 Bacteria 5692
115 Ga0070662_100265983 3300005457 Bacteria 1383
116 Ga0070681_10067486 3300005458 Bacteria 3544
117 Ga0070681_10180191 3300005458 Bacteria 2034
118 Ga0068867_100002837 3300005459 Bacteria 12187
119 Ga0068867_100035591 3300005459 Bacteria 3612
120 Ga0068867_100064497 3300005459 Bacteria 2724
121 Ga0070685_10015396 3300005466 Bacteria 4062
122 Ga0070685_10057358 3300005466 Bacteria 2266
123 Ga0070706_100406608 3300005467 Bacteria 1267
124 Ga0070706_100514725 3300005467 Bacteria 1113
125 Ga0070706_100697332 3300005467 Bacteria 942
126 Ga0070707_100048636 3300005468 Bacteria 4062
127 Ga0070707_100453928 3300005468 Bacteria 1242
128 Ga0070707_100943355 3300005468 Bacteria 828
129 Ga0070698_100260774 3300005471 Bacteria 1665
130 Ga0070698_100263593 3300005471 Bacteria 1655
131 Ga0070699_100042058 3300005518 Bacteria 3954
132 Ga0070699_100043125 3300005518 Bacteria 3905
133 Ga0070699_100079039 3300005518 Bacteria 2865
134 Ga0070679_100151322 3300005530 Bacteria 2297
135 Ga0070679_101197100 3300005530 Bacteria 705
136 Ga0070684_100002055 3300005535 Bacteria 14821
137 Ga0068853_100010507 3300005539 Bacteria 7486
138 Ga0068853_100132594 3300005539 Bacteria 2232
139 Ga0068853_100202733 3300005539 Bacteria 1806
140 Ga0068853_100220978 3300005539 Bacteria 1730
141 Ga0068853_100333237 3300005539 Bacteria 1409
142 Ga0068853_100380938 3300005539 Bacteria 1317
143 Ga0070672_100021871 3300005543 Bacteria 4686
144 Ga0070672_100037186 3300005543 Bacteria 3712
145 Ga0070672_100060174 3300005543 Bacteria 2990
146 Ga0070672_100142384 3300005543 Bacteria 1979
147 Ga0070672_100185037 3300005543 Bacteria 1737
148 Ga0070672_100480357 3300005543 Bacteria 1073
149 Ga0070686_100069919 3300005544 Bacteria 2294
150 Ga0070686_100155232 3300005544 Bacteria 1606
151 Ga0070695_100078571 3300005545 Bacteria 2176
152 Ga0070695_100534069 3300005545 Bacteria 912
153 Ga0070696_100074564 3300005546 Bacteria 2393
154 Ga0070696_100922403 3300005546 Bacteria 726
155 Ga0070693_100308931 3300005547 Bacteria 1068
156 Ga0070693_100634578 3300005547 Bacteria 775
157 Ga0070665_100029316 3300005548 Bacteria 5539
158 Ga0070665_100151533 3300005548 Bacteria 2321
159 Ga0070665_100254896 3300005548 Bacteria 1755
160 Ga0070665_100557103 3300005548 Bacteria 1159
161 Ga0070704_100507160 3300005549 Bacteria 1048
162 Ga0070704_101182121 3300005549 Bacteria 697
163 Ga0068855_100028344 3300005563 Bacteria 6698
164 Ga0068855_100030806 3300005563 Bacteria 6413
165 Ga0068855_100315827 3300005563 Bacteria 1728
166 Ga0070664_100178277 3300005564 Bacteria 1888
167 Ga0070664_100259501 3300005564 Bacteria 1563
168 Ga0070664_100538916 3300005564 Bacteria 1079
169 Ga0068857_100986098 3300005577 Bacteria 811
170 Ga0068854_100264237 3300005578 Bacteria 1379
171 Ga0068854_100318663 3300005578 Bacteria 1263
172 Ga0068854_100420784 3300005578 Bacteria 1110
173 Ga0068854_100520523 3300005578 Bacteria 1004
174 Ga0070702_100025846 3300005615 Bacteria 3150
175 Ga0070702_100049333 3300005615 Bacteria 2400
176 Ga0070702_100768467 3300005615 Bacteria 742
177 Ga0068852_100020112 3300005616 Bacteria 5303
178 Ga0068852_100054176 3300005616 Bacteria 3456
179 Ga0068852_100114381 3300005616 Bacteria 2458
180 Ga0068852_100572538 3300005616 Bacteria 1131
181 Ga0068859_100007790 3300005617 Bacteria 10873
182 Ga0068859_101272489 3300005617 Bacteria 810
183 Ga0068864_100000229 3300005618 Bacteria 50484
184 Ga0068864_100020269 3300005618 Bacteria 5563
185 Ga0068864_100061430 3300005618 Bacteria 3254
186 Ga0068864_101532166 3300005618 Bacteria 670
187 Ga0068866_10066563 3300005718 Bacteria 1888
188 Ga0068866_10173050 3300005718 Bacteria 1269
189 Ga0068861_100060712 3300005719 Bacteria 2899
190 Ga0068861_100074966 3300005719 Bacteria 2632
191 Ga0068861_100321133 3300005719 Bacteria 1348
192 Ga0068851_10096273 3300005834 Bacteria 1565
193 Ga0068851_10288196 3300005834 Bacteria 941
194 Ga0068851_10327924 3300005834 Bacteria 886
195 Ga0068870_10007574 3300005840 Bacteria 4849
196 Ga0068870_10020835 3300005840 Bacteria 3199
197 Ga0068870_10031694 3300005840 Bacteria 2680
198 Ga0068863_100015909 3300005841 Bacteria 7215
199 Ga0068863_100112835 3300005841 Bacteria 2588
200 Ga0068863_100119635 3300005841 Bacteria 2510
201 Ga0068863_100124711 3300005841 Bacteria 2457
202 Ga0068863_100188713 3300005841 Bacteria 1980
203 Ga0068863_100311578 3300005841 Bacteria 1528
204 Ga0068863_100366806 3300005841 Bacteria 1405
205 Ga0068863_100460416 3300005841 Bacteria 1249
206 Ga0068863_100865351 3300005841 Bacteria 903
207 Ga0068858_100006171 3300005842 Bacteria 11688
208 Ga0068858_100307793 3300005842 Bacteria 1512
209 Ga0068858_100339041 3300005842 Bacteria 1439
210 Ga0068858_100344544 3300005842 Bacteria 1427
211 Ga0068860_100004539 3300005843 Bacteria 14171
212 Ga0068860_100066728 3300005843 Bacteria 3418
213 Ga0068860_100693726 3300005843 Bacteria 1028
214 Ga0068862_100216305 3300005844 Bacteria 1733
215 Ga0068862_100319994 3300005844 Bacteria 1431
216 Ga0068862_100611543 3300005844 Bacteria 1047
217 Ga0081455_10000982 3300005937 Bacteria 36310
218 Ga0081455_10007625 3300005937 Bacteria 11370
219 Ga0081455_10506332 3300005937 Bacteria 809
220 Ga0081538_10018810 3300005981 Bacteria 5167
221 Ga0081540_1001932 3300005983 Bacteria 17357
222 Ga0081540_1008707 3300005983 Bacteria 7062
223 Ga0081540_1015372 3300005983 Bacteria 4849
224 Ga0081540_1038118 3300005983 Bacteria 2538
225 Ga0081539_10006465 3300005985 Bacteria 11230
226 Ga0081539_10194570 3300005985 Bacteria 941
227 Ga0070717_10021652 3300006028 Bacteria 5069
228 Ga0070717_10063259 3300006028 Bacteria 3070
229 Ga0070717_10189322 3300006028 Bacteria 1797
230 Ga0070717_10194327 3300006028 Bacteria 1774
231 Ga0070717_10233217 3300006028 Bacteria 1621
232 Ga0070717_10253995 3300006028 Bacteria 1554
233 Ga0070717_10284913 3300006028 Bacteria 1466
234 Ga0070717_10386570 3300006028 Bacteria 1255
235 Ga0075365_10045657 3300006038 Bacteria 2875
236 Ga0075365_10053329 3300006038 Bacteria 2678
237 Ga0075365_10126924 3300006038 Bacteria 1763
238 Ga0075365_10216116 3300006038 Bacteria 1344
239 Ga0075365_10240940 3300006038 Bacteria 1270
240 Ga0075365_10319879 3300006038 Bacteria 1093
241 Ga0075368_10046523 3300006042 Bacteria 1716
242 Ga0075368_10090088 3300006042 Bacteria 1254
243 Ga0075368_10251888 3300006042 Bacteria 755
244 Ga0075363_100002458 3300006048 Bacteria 7574
245 Ga0075363_100004926 3300006048 Bacteria 5904
246 Ga0075363_100093427 3300006048 Bacteria 1658
247 Ga0075363_100295329 3300006048 Bacteria 939
248 Ga0075364_10004046 3300006051 Bacteria 8420
249 Ga0075364_10037551 3300006051 Bacteria 3137
250 Ga0075364_10082513 3300006051 Bacteria 2127
251 Ga0075364_10277583 3300006051 Bacteria 1140
252 Ga0070715_10033445 3300006163 Bacteria 2101
253 Ga0070716_100012323 3300006173 Bacteria 4331
254 Ga0070716_100392033 3300006173 Bacteria 996
255 Ga0070716_100540675 3300006173 Bacteria 867
256 Ga0070712_100001511 3300006175 Bacteria 14186
257 Ga0070712_100008608 3300006175 Bacteria 6422
258 Ga0070712_100011636 3300006175 Bacteria 5587
259 Ga0070712_100021244 3300006175 Bacteria 4260
260 Ga0070712_100203421 3300006175 Bacteria 1557
261 Ga0070712_100433677 3300006175 Bacteria 1091
262 Ga0070712_100872632 3300006175 Bacteria 775
263 Ga0075362_10003256 3300006177 Bacteria 5641
264 Ga0075362_10065360 3300006177 Bacteria 1652
265 Ga0075362_10138224 3300006177 Bacteria 1163
266 Ga0075362_10192825 3300006177 Bacteria 990
267 Ga0075367_10019025 3300006178 Bacteria 3800
268 Ga0075367_10101961 3300006178 Bacteria 1755
269 Ga0075367_10146607 3300006178 Bacteria 1464
270 Ga0075367_10177055 3300006178 Bacteria 1329
271 Ga0075367_10222823 3300006178 Bacteria 1180
272 Ga0075367_10365127 3300006178 Bacteria 911
273 Ga0075367_10450077 3300006178 Bacteria 816
274 Ga0075369_10024966 3300006186 Bacteria 2481
275 Ga0075369_10061723 3300006186 Bacteria 1636
276 Ga0075369_10084016 3300006186 Bacteria 1414
277 Ga0075369_10089116 3300006186 Bacteria 1375
278 Ga0075369_10159426 3300006186 Bacteria 1034
279 Ga0075366_10012644 3300006195 Bacteria 4793
280 Ga0075366_10036998 3300006195 Bacteria 2879
281 Ga0075366_10098695 3300006195 Bacteria 1752
282 Ga0097621_100577567 3300006237 Bacteria 1025
283 Ga0068871_100008823 3300006358 Bacteria 7262
284 Ga0068871_100996635 3300006358 Bacteria 780
285 Ga0075428_100053353 3300006844 Bacteria 4429
286 Ga0075428_100244637 3300006844 Bacteria 1935
287 Ga0075428_100318883 3300006844 Bacteria 1670
288 Ga0075428_100473916 3300006844 Bacteria 1340
289 Ga0075428_100571172 3300006844 Bacteria 1208
290 Ga0075430_100003089 3300006846 Bacteria 13912
291 Ga0075430_100028441 3300006846 Bacteria 4749
292 Ga0075430_100029130 3300006846 Bacteria 4687
293 Ga0075430_100175093 3300006846 Bacteria 1785
294 Ga0075431_100024543 3300006847 Bacteria 6179
295 Ga0075431_100324293 3300006847 Bacteria 1552
296 Ga0075433_10564371 3300006852 Bacteria 1000
297 Ga0075433_10856711 3300006852 Bacteria 793
298 Ga0075434_100012794 3300006871 Bacteria 7966
299 Ga0075434_100083942 3300006871 Bacteria 3183
300 Ga0075434_100257124 3300006871 Bacteria 1765
301 Ga0075434_100310786 3300006871 Bacteria 1596
302 Ga0075434_100499484 3300006871 Bacteria 1237
303 Ga0075434_100685524 3300006871 Bacteria 1042
304 Ga0075429_100031850 3300006880 Bacteria 4583
305 Ga0068865_100004224 3300006881 Bacteria 8662
306 Ga0068865_100015790 3300006881 Bacteria 4818
307 Ga0068865_101086623 3300006881 Bacteria 704
308 Ga0075436_100165717 3300006914 Bacteria 1559
309 Ga0097620_100007790 3300006931 Bacteria 10873
310 Ga0097620_101061115 3300006931 Bacteria 891
311 Ga0097620_101272496 3300006931 Bacteria 810
312 Ga0075435_100041824 3300007076 Bacteria 3664
313 Ga0075435_100379221 3300007076 Bacteria 1215
314 Ga0075435_100653847 3300007076 Bacteria 912
315 Ga0099794_10107708 3300007265 Bacteria 1394
316 Ga0099794_10395874 3300007265 Bacteria 721
317 Ga0099795_10010821 3300007788 Bacteria 2702
318 Ga0099795_10022526 3300007788 Bacteria 2080
319 Ga0105240_10017817 3300009093 Bacteria 9558
320 Ga0105240_10066925 3300009093 Bacteria 4455
321 Ga0111539_10088671 3300009094 Bacteria 3635
322 Ga0111539_10166795 3300009094 Bacteria 2574
323 Ga0111539_10655076 3300009094 Bacteria 1223
324 Ga0111539_10707686 3300009094 Bacteria 1172
325 Ga0111539_11547550 3300009094 Bacteria 769
326 Ga0105245_10060475 3300009098 Bacteria 3412
327 Ga0105245_10528269 3300009098 Bacteria 1199
328 Ga0105245_10601745 3300009098 Bacteria 1126
329 Ga0105247_10008287 3300009101 Bacteria 6340
330 Ga0105247_10078657 3300009101 Bacteria 2075
331 Ga0114129_10035550 3300009147 Bacteria 7038
332 Ga0114129_10037759 3300009147 Bacteria 6817
333 Ga0114129_10090634 3300009147 Bacteria 4238
334 Ga0114129_10517590 3300009147 Bacteria 1556
335 Ga0114129_10765634 3300009147 Bacteria 1235
336 Ga0114129_11821861 3300009147 Bacteria 740
337 Ga0105243_10038255 3300009148 Bacteria 3735
338 Ga0105243_10152517 3300009148 Bacteria 1983
339 Ga0105242_10294594 3300009176 Bacteria 1479
340 Ga0105248_10000379 3300009177 Bacteria 51830
341 Ga0105248_10021074 3300009177 Bacteria 7222
342 Ga0105248_10070000 3300009177 Bacteria 3940
343 Ga0105248_10153742 3300009177 Bacteria 2596
344 Ga0105248_10158212 3300009177 Bacteria 2556
345 Ga0105237_10005765 3300009545 Bacteria 13912
346 Ga0105237_10423184 3300009545 Bacteria 1337
347 Ga0105237_10979483 3300009545 Bacteria 852
348 Ga0105238_10009636 3300009551 Bacteria 9664
349 Ga0105238_10164466 3300009551 Bacteria 2194
350 Ga0105238_10671717 3300009551 Bacteria 1047
351 Ga0105238_11092653 3300009551 Bacteria 820
352 Ga0105249_10019374 3300009553 Bacteria 6070
353 Ga0105249_10377374 3300009553 Bacteria 1443
354 Ga0105249_10736692 3300009553 Bacteria 1047
355 Ga0105249_10931578 3300009553 Bacteria 936
356 Ga0105249_11810670 3300009553 Bacteria 683
357 Ga0099796_10011223 3300010159 Bacteria 2492
358 Ga0099796_10131521 3300010159 Bacteria 970
359 Ga0099796_10185414 3300010159 Bacteria 837
360 Ga0105239_10002417 3300010375 Bacteria 23779
361 Ga0105239_10405122 3300010375 Bacteria 1544
362 Ga0105239_10712306 3300010375 Bacteria 1148
363 Ga0105239_10769108 3300010375 Bacteria 1103
364 Ga0105246_10005683 3300011119 Bacteria 7611
365 Ga0105246_10405674 3300011119 Bacteria 1133
366 Ga0105246_10790627 3300011119 Bacteria 841
367 Ga0105246_10823651 3300011119 Bacteria 825
368 Ga0157370_10023869 3300013104 Bacteria 6065
369 Ga0157370_10223225 3300013104 Bacteria 1745
370 Ga0157369_10455333 3300013105 Bacteria 1325
371 Ga0157374_10038670 3300013296 Bacteria 4386
372 Ga0157374_10275639 3300013296 Bacteria 1659
373 Ga0157374_10551940 3300013296 Bacteria 1160
374 Ga0157378_10026493 3300013297 Bacteria 5111
375 Ga0157378_10902995 3300013297 Bacteria 914
376 Ga0157378_11862642 3300013297 Bacteria 650
377 Ga0163162_10142127 3300013306 Bacteria 2514
378 Ga0163162_10145743 3300013306 Bacteria 2484
379 Ga0163162_10428826 3300013306 Bacteria 1454
380 Ga0163162_10511590 3300013306 Bacteria 1331
381 Ga0163162_10871571 3300013306 Bacteria 1015
382 Ga0163162_11605198 3300013306 Bacteria 742
383 Ga0157372_10427892 3300013307 Bacteria 1543
384 Ga0157375_10034220 3300013308 Bacteria 4839
385 Ga0157375_10576865 3300013308 Bacteria 1285
386 Ga0157375_10769359 3300013308 Bacteria 1113
387 Ga0157375_10942517 3300013308 Bacteria 1005
388 Ga0163163_10012279 3300014325 Bacteria 7799
389 Ga0163163_10638244 3300014325 Bacteria 1128
390 Ga0163163_10643140 3300014325 Bacteria 1124
391 Ga0163163_10697812 3300014325 Bacteria 1078
392 Ga0163163_10861431 3300014325 Bacteria 969
393 Ga0163163_10905197 3300014325 Bacteria 946
394 Ga0157380_10013246 3300014326 Bacteria 6006
395 Ga0157380_10015772 3300014326 Bacteria 5558
396 Ga0157380_10138885 3300014326 Bacteria 2084
397 Ga0157380_10330671 3300014326 Bacteria 1417
398 Ga0157380_10671377 3300014326 Bacteria 1037
399 Ga0182008_10448220 3300014497 Bacteria 701
400 Ga0157377_10030023 3300014745 Bacteria 2941
401 Ga0157377_10043839 3300014745 Bacteria 2492
402 Ga0157377_10238246 3300014745 Bacteria 1173
403 Ga0157379_10009012 3300014968 Bacteria 8698
404 Ga0157379_10039663 3300014968 Bacteria 4202
405 Ga0157379_10794085 3300014968 Bacteria 893
406 Ga0157379_11711154 3300014968 Bacteria 616
407 Ga0157376_10385527 3300014969 Bacteria 1351
408 Ga0157376_10979212 3300014969 Bacteria 867
409 Ga0163161_10119178 3300017792 Bacteria 1981
410 Ga0163161_10217315 3300017792 Bacteria 1479
411 Ga0163161_10567913 3300017792 Bacteria 932
412 Ga0213873_10005100 3300021358 Bacteria 2498
413 Ga0213872_10044787 3300021361 Bacteria 2013
414 Ga0213876_10037584 3300021384 Bacteria 2555
415 Ga0213871_10033419 3300021441 Bacteria 1353
416 Ga0209233_1022292 3300025261 Bacteria 1624
417 Ga0209758_1000160 3300025297 Bacteria 154304
418 Ga0209758_1000507 3300025297 Bacteria 62923
419 Ga0209758_1001948 3300025297 Bacteria 22345
420 Ga0209758_1005368 3300025297 Bacteria 9937
421 Ga0209758_1016981 3300025297 Bacteria 3658
422 Ga0207426_1029339 3300025302 Bacteria 1815
423 Ga0209257_1099620 3300025304 Bacteria 711
424 Ga0207697_10039701 3300025315 Bacteria 1931
425 Ga0207656_10103265 3300025321 Bacteria 1309
426 Ga0207696_1075314 3300025711 Bacteria 935
427 Ga0207682_10000447 3300025893 Bacteria 19016
428 Ga0207692_10006351 3300025898 Bacteria 4792
429 Ga0207692_10033520 3300025898 Bacteria 2478
430 Ga0207692_10366291 3300025898 Bacteria 891
431 Ga0207642_10007042 3300025899 Bacteria 3774
432 Ga0207642_10069671 3300025899 Bacteria 1669
433 Ga0207710_10331314 3300025900 Bacteria 773
434 Ga0207688_10003040 3300025901 Bacteria 9143
435 Ga0207688_10315736 3300025901 Bacteria 958
436 Ga0207680_10104121 3300025903 Bacteria 1829
437 Ga0207680_10163449 3300025903 Bacteria 1495
438 Ga0207680_10184960 3300025903 Bacteria 1411
439 Ga0207680_10185387 3300025903 Bacteria 1410
440 Ga0207680_10319118 3300025903 Bacteria 1086
441 Ga0207647_10011883 3300025904 Bacteria 6082
442 Ga0207647_10158785 3300025904 Bacteria 1320
443 Ga0207685_10017129 3300025905 Bacteria 2335
444 Ga0207685_10065902 3300025905 Bacteria 1452
445 Ga0207699_10006557 3300025906 Bacteria 5646
446 Ga0207699_10367142 3300025906 Bacteria 1019
447 Ga0207645_10038033 3300025907 Bacteria 3088
448 Ga0207645_10051591 3300025907 Bacteria 2628
449 Ga0207645_10065981 3300025907 Bacteria 2314
450 Ga0207645_10088956 3300025907 Bacteria 1985
451 Ga0207645_10581320 3300025907 Bacteria 760
452 Ga0207643_10004948 3300025908 Bacteria 7129
453 Ga0207643_10026011 3300025908 Bacteria 3238
454 Ga0207643_10037613 3300025908 Bacteria 2716
455 Ga0207705_10098525 3300025909 Bacteria 2148
456 Ga0207705_10240579 3300025909 Bacteria 1379
457 Ga0207684_10105842 3300025910 Bacteria 2406
458 Ga0207684_10252290 3300025910 Bacteria 1522
459 Ga0207684_10564768 3300025910 Bacteria 973
460 Ga0207654_10272991 3300025911 Bacteria 1141
461 Ga0207707_10001734 3300025912 Bacteria 20038
462 Ga0207707_10032121 3300025912 Bacteria 4595
463 Ga0207695_10023454 3300025913 Bacteria 6970
464 Ga0207693_10002688 3300025915 Bacteria 15430
465 Ga0207693_10014235 3300025915 Bacteria 6399
466 Ga0207693_10030286 3300025915 Bacteria 4273
467 Ga0207693_10034942 3300025915 Bacteria 3965
468 Ga0207693_10085946 3300025915 Bacteria 2464
469 Ga0207693_10120482 3300025915 Bacteria 2061
470 Ga0207693_10180767 3300025915 Bacteria 1660
471 Ga0207693_10233765 3300025915 Bacteria 1443
472 Ga0207693_10292842 3300025915 Bacteria 1276
473 Ga0207693_10508524 3300025915 Bacteria 940
474 Ga0207693_10621786 3300025915 Bacteria 840
475 Ga0207693_10945831 3300025915 Bacteria 660
476 Ga0207663_10004785 3300025916 Bacteria 6762
477 Ga0207663_10051418 3300025916 Bacteria 2565
478 Ga0207663_10063787 3300025916 Bacteria 2348
479 Ga0207663_10151381 3300025916 Bacteria 1628
480 Ga0207663_10237347 3300025916 Bacteria 1335
481 Ga0207663_10567864 3300025916 Bacteria 888
482 Ga0207660_10004532 3300025917 Bacteria 9060
483 Ga0207660_10663804 3300025917 Bacteria 850
484 Ga0207662_10014007 3300025918 Bacteria 4492
485 Ga0207662_10017728 3300025918 Bacteria 4031
486 Ga0207657_10004381 3300025919 Bacteria 14944
487 Ga0207657_10036983 3300025919 Bacteria 4365
488 Ga0207657_10069293 3300025919 Bacteria 2994
489 Ga0207657_10675663 3300025919 Bacteria 803
490 Ga0207649_10178121 3300025920 Bacteria 1486
491 Ga0207649_10191308 3300025920 Bacteria 1439
492 Ga0207652_10003618 3300025921 Bacteria 12726
493 Ga0207646_10198023 3300025922 Bacteria 1814
494 Ga0207646_10198981 3300025922 Bacteria 1810
495 Ga0207681_10007624 3300025923 Bacteria 6634
496 Ga0207681_10175659 3300025923 Bacteria 1627
497 Ga0207681_10213408 3300025923 Bacteria 1489
498 Ga0207694_10003238 3300025924 Bacteria 12971
499 Ga0207694_10780990 3300025924 Bacteria 807
500 Ga0207650_10001195 3300025925 Bacteria 19069
501 Ga0207650_10013619 3300025925 Bacteria 5635
502 Ga0207650_10169442 3300025925 Bacteria 1735
503 Ga0207650_10190306 3300025925 Bacteria 1639
504 Ga0207650_10593614 3300025925 Bacteria 931
505 Ga0207659_10249040 3300025926 Bacteria 1441
506 Ga0207687_10062420 3300025927 Bacteria 2635
507 Ga0207687_10831660 3300025927 Bacteria 788
508 Ga0207687_11365178 3300025927 Bacteria 609
509 Ga0207700_10026809 3300025928 Bacteria 4024
510 Ga0207700_10345939 3300025928 Bacteria 1294
511 Ga0207700_10983258 3300025928 Bacteria 755
512 Ga0207664_10024627 3300025929 Bacteria 4524
513 Ga0207664_10441771 3300025929 Bacteria 1160
514 Ga0207644_10022011 3300025931 Bacteria 4349
515 Ga0207644_10178552 3300025931 Bacteria 1663
516 Ga0207644_10226873 3300025931 Bacteria 1483
517 Ga0207644_10283467 3300025931 Bacteria 1331
518 Ga0207690_10065867 3300025932 Bacteria 2479
519 Ga0207690_10705881 3300025932 Bacteria 829
520 Ga0207706_10076887 3300025933 Bacteria 2936
521 Ga0207706_10119598 3300025933 Bacteria 2316
522 Ga0207706_10531843 3300025933 Bacteria 1013
523 Ga0207706_10623253 3300025933 Bacteria 925
524 Ga0207686_10232881 3300025934 Bacteria 1336
525 Ga0207709_10022083 3300025935 Bacteria 3608
526 Ga0207709_10544259 3300025935 Bacteria 912
527 Ga0207670_10413162 3300025936 Bacteria 1081
528 Ga0207670_10425935 3300025936 Bacteria 1066
529 Ga0207670_10489342 3300025936 Bacteria 997
530 Ga0207670_10700745 3300025936 Bacteria 838
531 Ga0207670_10835718 3300025936 Bacteria 769
532 Ga0207669_10056133 3300025937 Bacteria 2389
533 Ga0207669_10476910 3300025937 Bacteria 994
534 Ga0207704_10063702 3300025938 Bacteria 2299
535 Ga0207704_10149158 3300025938 Bacteria 1648
536 Ga0207704_10824598 3300025938 Bacteria 776
537 Ga0207665_10009542 3300025939 Bacteria 6373
538 Ga0207665_10039736 3300025939 Bacteria 3137
539 Ga0207665_10188233 3300025939 Bacteria 1498
540 Ga0207665_10592937 3300025939 Bacteria 865
541 Ga0207665_10661252 3300025939 Bacteria 819
542 Ga0207691_10002321 3300025940 Bacteria 18626
543 Ga0207691_10011266 3300025940 Bacteria 8578
544 Ga0207691_10172248 3300025940 Bacteria 1895
545 Ga0207711_10017593 3300025941 Bacteria 5938
546 Ga0207711_10305949 3300025941 Bacteria 1467
547 Ga0207689_10000511 3300025942 Bacteria 36782
548 Ga0207689_10009592 3300025942 Bacteria 8346
549 Ga0207689_10038634 3300025942 Bacteria 3953
550 Ga0207689_10190614 3300025942 Bacteria 1691
551 Ga0207661_10072511 3300025944 Bacteria 2817
552 Ga0207679_10047332 3300025945 Bacteria 3123
553 Ga0207679_10100451 3300025945 Bacteria 2261
554 Ga0207679_10466481 3300025945 Bacteria 1122
555 Ga0207679_10530951 3300025945 Bacteria 1053
556 Ga0207667_10015629 3300025949 Bacteria 8610
557 Ga0207667_10281825 3300025949 Bacteria 1698
558 Ga0207667_10460861 3300025949 Bacteria 1291
559 Ga0207651_10008796 3300025960 Bacteria 5481
560 Ga0207651_10017323 3300025960 Bacteria 4254
561 Ga0207651_10175480 3300025960 Bacteria 1694
562 Ga0207651_10892392 3300025960 Bacteria 791
563 Ga0207712_10022589 3300025961 Bacteria 4144
564 Ga0207712_10378651 3300025961 Bacteria 1184
565 Ga0207712_10604166 3300025961 Bacteria 949
566 Ga0207712_10666191 3300025961 Bacteria 906
567 Ga0207668_10007890 3300025972 Bacteria 6327
568 Ga0207668_10212425 3300025972 Bacteria 1548
569 Ga0207668_10310685 3300025972 Bacteria 1304
570 Ga0207668_10580041 3300025972 Bacteria 975
571 Ga0207668_10823542 3300025972 Bacteria 823
572 Ga0207640_10038084 3300025981 Bacteria 3031
573 Ga0207640_10169258 3300025981 Bacteria 1626
574 Ga0207640_10260793 3300025981 Bacteria 1350
575 Ga0207658_10015147 3300025986 Bacteria 5288
576 Ga0207658_10060174 3300025986 Bacteria 2833
577 Ga0207658_10078642 3300025986 Bacteria 2521
578 Ga0207677_10037867 3300026023 Bacteria 3156
579 Ga0207677_10354101 3300026023 Bacteria 1231
580 Ga0207703_10002914 3300026035 Bacteria 14565
581 Ga0207703_10203379 3300026035 Bacteria 1761
582 Ga0207703_10412499 3300026035 Bacteria 1255
583 Ga0207639_10063661 3300026041 Bacteria 2857
584 Ga0207639_10143231 3300026041 Bacteria 1994
585 Ga0207639_10198498 3300026041 Bacteria 1719
586 Ga0207639_10291491 3300026041 Bacteria 1439
587 Ga0207678_10024563 3300026067 Bacteria 5264
588 Ga0207678_10033043 3300026067 Bacteria 4508
589 Ga0207678_10297036 3300026067 Bacteria 1388
590 Ga0207708_10010832 3300026075 Bacteria 6782
591 Ga0207708_10101827 3300026075 Bacteria 2223
592 Ga0207708_10109310 3300026075 Bacteria 2145
593 Ga0207708_10261226 3300026075 Bacteria 1398
594 Ga0207708_10278420 3300026075 Bacteria 1355
595 Ga0207641_10049540 3300026088 Bacteria 3550
596 Ga0207641_10052355 3300026088 Bacteria 3457
597 Ga0207641_10354075 3300026088 Bacteria 1400
598 Ga0207641_10597561 3300026088 Bacteria 1080
599 Ga0207641_10631216 3300026088 Bacteria 1051
600 Ga0207641_11101407 3300026088 Bacteria 793
601 Ga0207648_10005903 3300026089 Bacteria 12251
602 Ga0207648_10013548 3300026089 Bacteria 7581
603 Ga0207648_10014418 3300026089 Bacteria 7303
604 Ga0207648_10253715 3300026089 Bacteria 1568
605 Ga0207676_10005423 3300026095 Bacteria 9025
606 Ga0207676_10108001 3300026095 Bacteria 2322
607 Ga0207676_10139263 3300026095 Bacteria 2075
608 Ga0207676_10328445 3300026095 Bacteria 1407
609 Ga0207676_11607346 3300026095 Bacteria 648
610 Ga0207674_10009642 3300026116 Bacteria 11014
611 Ga0207674_10099879 3300026116 Bacteria 2884
612 Ga0207675_100010832 3300026118 Bacteria 8542
613 Ga0207675_100033567 3300026118 Bacteria 4781
614 Ga0207675_100411214 3300026118 Bacteria 1335
615 Ga0207675_100618115 3300026118 Bacteria 1088
616 Ga0207675_100890928 3300026118 Bacteria 906
617 Ga0207683_10002719 3300026121 Bacteria 15442
618 Ga0207683_10014637 3300026121 Bacteria 6680
619 Ga0207683_10076982 3300026121 Bacteria 2954
620 Ga0207698_10119716 3300026142 Bacteria 2225
621 Ga0207698_10601186 3300026142 Bacteria 1084
622 Ga0209179_1030770 3300027512 Bacteria 1098
623 Ga0209179_1033805 3300027512 Bacteria 1058
624 Ga0209588_1066604 3300027671 Bacteria 1164
625 Ga0209813_10076059 3300027866 Bacteria 1101
626 Ga0209813_10135208 3300027866 Bacteria 871
627 Ga0207428_10135494 3300027907 Bacteria 1883
628 Ga0268266_10083019 3300028379 Bacteria 2796
629 Ga0268266_11279428 3300028379 Bacteria 709
630 Ga0268265_10040724 3300028380 Bacteria 3433
631 Ga0268265_10252635 3300028380 Bacteria 1562
632 Ga0268265_10542681 3300028380 Bacteria 1102
633 Ga0268265_10644266 3300028380 Bacteria 1018
634 Ga0268264_10000516 3300028381 Bacteria 48873
635 Ga0268264_10032596 3300028381 Bacteria 4275
636 Ga0268264_10035367 3300028381 Bacteria 4112
637 Ga0268264_10072722 3300028381 Bacteria 2916
638 Ga0268264_10771292 3300028381 Bacteria 959
639 Ga0307517_10000756 3300028786 Bacteria 55661
640 Ga0265338_10031759 3300028800 Bacteria 5169
641 Ga0265762_1018429 3300030760 Bacteria 1275
642 Ga0265760_10085825 3300031090 Bacteria 980
643 Ga0265328_10026878 3300031239 Bacteria 2161
644 Ga0265331_10326921 3300031250 Bacteria 687
645 Ga0265327_10210421 3300031251 Bacteria 878
646 Ga0307513_10030823 3300031456 Bacteria 6086
647 Ga0307513_10143003 3300031456 Bacteria 2315
648 Ga0307513_10229689 3300031456 Bacteria 1669
649 Ga0307513_10276041 3300031456 Bacteria 1461
650 Ga0307408_100849158 3300031548 Bacteria 832
651 Ga0307508_10168012 3300031616 Bacteria 1797
652 Ga0307508_10467356 3300031616 Bacteria 855
653 Ga0265314_10096294 3300031711 Bacteria 1915
654 Ga0307413_10068588 3300031824 Bacteria 2222
655 Ga0307413_10233288 3300031824 Bacteria 1353
656 Ga0307410_10253626 3300031852 Bacteria 1369
657 Ga0307407_10132864 3300031903 Bacteria 1595
658 Ga0307412_10192406 3300031911 Bacteria 1543
659 Ga0307412_11595115 3300031911 Bacteria 596
660 Ga0307416_100098691 3300032002 Bacteria 2534
661 Ga0307416_100556914 3300032002 Bacteria 1221
662 Ga0307416_101889596 3300032002 Bacteria 700
663 Ga0307411_10386845 3300032005 Bacteria 1152
664 Ga0307415_100639735 3300032126 Bacteria 952
665 Ga0307510_10058232 3300033180 Bacteria 4003
666 Ga0307510_10128026 3300033180 Bacteria 2222
667 Ga0307510_10386390 3300033180 Bacteria 844
668 Ga0315911_1000001 3300033442 Bacteria 1088602
669 Ga0373930_0059673 3300034816 Bacteria 849
670 Ga0373944_0067918 3300035089 Bacteria 1156
671 Ga0373936_0038943 3300035113 Bacteria 1902
672 Ga0373945_0013092 3300035116 Bacteria 2765
673 Ga0373945_0023578 3300035116 Bacteria 2127
674 Ga0373953_0022972 3300035117 Bacteria 2358
675 Ga0373954_0005853 3300035118 Bacteria 5340
676 Ga0373954_0137927 3300035118 Bacteria 1189
677 Ga0373957_0074045 3300035120 Bacteria 1336
678 Ga0373943_0070457 3300035170 Bacteria 1769
679 Ga0373943_0159891 3300035170 Bacteria 1226
680 Ga0373946_0014144 3300035171 Bacteria 3006
681 Ga0373946_0047289 3300035171 Bacteria 1787
682 Ga0373946_0152070 3300035171 Bacteria 1080
683 Ga0373955_0003076 3300035172 Bacteria 7302
684 Ga0373955_0016314 3300035172 Bacteria 3654
685 Ga0373955_0465597 3300035172 Bacteria 771
686 Ga0373924_0001977 3300035410 Bacteria 6820
687 Ga0373924_0127582 3300035410 Bacteria 1106
688 Ga0373935_0006113 3300035692 Bacteria 7160
689 Ga0373935_0065002 3300035692 Bacteria 2340
690 Ga0373935_0128808 3300035692 Bacteria 1698
691 Ga0373927_0000846 3300035695 Bacteria 23349
692 Ga0373927_0009739 3300035695 Bacteria 6442
693 Ga0373927_0365249 3300035695 Bacteria 951
694 Ga0373933_0002161 3300035724 Bacteria 11253
695 Ga0373933_0017656 3300035724 Bacteria 4002
696 Ga0373933_0451497 3300035724 Bacteria 841
697 Ga0373947_0005350 3300035725 Bacteria 7494
698 Ga0373947_0033933 3300035725 Bacteria 3017
699 Ga0373947_0038824 3300035725 Bacteria 2831
700 Ga0373947_0083714 3300035725 Bacteria 1978
701 Ga0373937_0003460 3300036401 Bacteria 13268
702 Ga0373937_0003993 3300036401 Bacteria 12483
703 Ga0373937_0445375 3300036401 Bacteria 1230
704 Ga0373937_1649970 3300036401 Bacteria 588
705 Ga0373925_0015990 3300037068 Bacteria 5433
706 Ga0373925_0693438 3300037068 Bacteria 839
707 Ga0373925_0803821 3300037068 Bacteria 775
708 Ga0373925_1476401 3300037068 Bacteria 556
709 Ga0395900_0385009 3300037418 Bacteria 1370
710 Ga0395905_0002789 3300037471 Bacteria 19144
711 Ga0395905_0043073 3300037471 Bacteria 4235
712 Ga0436364_0307728 3300037853 Bacteria 690
713 Ga0395901_0279363 3300038443 Bacteria 1735
714 Ga0436365_0898343 3300039437 Bacteria 1824
715 Ga0436365_1732414 3300039437 Bacteria 2999
716 Ga0436365_1914442 3300039437 Bacteria 5787
717 Ga0436360_0151016 3300039438 Bacteria 1657
718 Ga0436360_0339856 3300039438 Bacteria 548
719 Ga0436360_0425837 3300039438 Bacteria 1276
720 Ga0436360_0655998 3300039438 Bacteria 1602
721 Ga0436360_0907988 3300039438 Bacteria 779
722 Ga0436360_0959728 3300039438 Bacteria 700
723 Ga0436361_0589872 3300039447 Bacteria 10332
724 Ga0436361_0967243 3300039447 Bacteria 695
725 Ga0436361_1191117 3300039447 Bacteria 3110
726 Ga0436363_1149166 3300039450 Bacteria 853
727 Ga0436363_1442007 3300039450 Bacteria 1855
728 Ga0436362_0621602 3300039453 Bacteria 6368
729 Ga0436362_1045468 3300039453 Bacteria 757
730 Ga0439453_0004683 3300041408 Bacteria 2047
731 Ga0439453_0005443 3300041408 Bacteria 1939
732 Ga0451787_087658 3300041441 Bacteria 876
733 Ga0451791_1037644 3300041451 Bacteria 1170
734 Ga0451839_0205217 3300041496 Bacteria 1320
735 Ga0451841_1383515 3300041498 Bacteria 1081
736 Ga0451845_0400515 3300041501 Bacteria 1785
737 Ga0451849_0299809 3300041505 Bacteria 651
738 Ga0451843_0790480 3300041509 Bacteria 891
739 Ga0451853_1229626 3300041512 Bacteria 1001
740 Ga0451853_1714423 3300041512 Bacteria 698
741 Ga0439443_003570 3300042003 Bacteria 1971
742 Ga0453683_1043675 3300044673 Bacteria 544
743 Ga0466961_0000013 3300044693 Bacteria 129640
744 Ga0466959_0001999 3300045049 Bacteria 12866
745 Ga0495592_0003739 3300046454 Bacteria 10972
746 Ga0495592_0015800 3300046454 Bacteria 5727
747 Ga0495592_0017868 3300046454 Bacteria 5391
748 Ga0495592_0064792 3300046454 Bacteria 2677
749 Ga0495592_0200757 3300046454 Bacteria 1346
750 Ga0495603_0067477 3300046455 Bacteria 2106
751 Ga0495629_0004974 3300046459 Bacteria 9969
752 Ga0495629_0008770 3300046459 Bacteria 7434
753 Ga0495629_0016858 3300046459 Bacteria 5243
754 Ga0495629_0045929 3300046459 Bacteria 3064
755 Ga0495629_0210289 3300046459 Bacteria 1344
756 Ga0495638_0028165 3300046460 Bacteria 3630
757 Ga0495638_0056755 3300046460 Bacteria 2429
758 Ga0495638_0130311 3300046460 Bacteria 1478
759 Ga0495638_0276654 3300046460 Bacteria 914
760 Ga0495651_0000388 3300046462 Bacteria 33995
761 Ga0495651_0001355 3300046462 Bacteria 18940
762 Ga0495651_0003038 3300046462 Bacteria 12943
763 Ga0495651_0060685 3300046462 Bacteria 2896
764 Ga0495651_0514665 3300046462 Bacteria 764
765 Ga0495653_0001875 3300046463 Bacteria 16581
766 Ga0495653_0006734 3300046463 Bacteria 9432
767 Ga0495653_0068698 3300046463 Bacteria 2657
768 Ga0495653_0075033 3300046463 Bacteria 2518
769 Ga0495653_0421232 3300046463 Bacteria 845
770 Ga0495653_0480157 3300046463 Bacteria 778
771 Ga0495580_0027946 3300046472 Bacteria 4103
772 Ga0495582_0020023 3300046473 Bacteria 3659
773 Ga0495605_0269913 3300046474 Bacteria 725
774 Ga0495662_0024618 3300046476 Bacteria 2905
775 Ga0495662_0122353 3300046476 Bacteria 1278
776 Ga0495662_0167793 3300046476 Bacteria 1082
777 Ga0495664_0000251 3300046477 Bacteria 25898
778 Ga0495664_0008800 3300046477 Bacteria 5638
779 Ga0495664_0027617 3300046477 Bacteria 3310
780 Ga0495664_0028207 3300046477 Bacteria 3278
781 Ga0495664_0202521 3300046477 Bacteria 1203
782 Ga0495664_0500785 3300046477 Bacteria 725
783 Ga0495584_0254576 3300046491 Bacteria 893
784 Ga0495594_0043884 3300046499 Bacteria 2452
785 Ga0495596_0165367 3300046500 Bacteria 860
786 Ga0495607_0152022 3300046501 Bacteria 1184
787 Ga0495583_0100244 3300046506 Bacteria 1237
788 Ga0495583_0109054 3300046506 Bacteria 1175
789 Ga0495606_0116729 3300046507 Bacteria 1602
790 Ga0495608_0006933 3300046511 Bacteria 8023
791 Ga0495608_0007405 3300046511 Bacteria 7751
792 Ga0495608_0195790 3300046511 Bacteria 1275
793 Ga0495616_0332524 3300046513 Bacteria 636
794 Ga0495618_0000361 3300046514 Bacteria 32670
795 Ga0495618_0003656 3300046514 Bacteria 9533
796 Ga0495618_0009095 3300046514 Bacteria 5996
797 Ga0495618_0056614 3300046514 Bacteria 2482
798 Ga0495618_0331114 3300046514 Bacteria 942
799 Ga0495628_0007839 3300046516 Bacteria 9208
800 Ga0495628_0014066 3300046516 Bacteria 6716
801 Ga0495628_0025697 3300046516 Bacteria 4810
802 Ga0495628_0129467 3300046516 Bacteria 1931
803 Ga0495630_0001646 3300046517 Bacteria 15520
804 Ga0495630_0040493 3300046517 Bacteria 3483
805 Ga0495630_0110011 3300046517 Bacteria 2087
806 Ga0495630_0256612 3300046517 Bacteria 1336
807 Ga0495630_0685479 3300046517 Bacteria 784
808 Ga0495637_0192457 3300046520 Bacteria 752
809 Ga0495643_0112016 3300046522 Bacteria 1387
810 Ga0495644_0064557 3300046523 Bacteria 1376
811 Ga0495648_0011260 3300046524 Bacteria 6752
812 Ga0495648_0317017 3300046524 Bacteria 724
813 Ga0495663_0010487 3300046525 Bacteria 2578
814 Ga0495666_0100111 3300046526 Bacteria 1366
815 Ga0495666_0109848 3300046526 Bacteria 1296
816 Ga0495652_0000305 3300046529 Bacteria 58441
817 Ga0495652_0004698 3300046529 Bacteria 13018
818 Ga0495652_0009607 3300046529 Bacteria 8783
819 Ga0495652_0113328 3300046529 Bacteria 2177
820 Ga0495652_0139888 3300046529 Bacteria 1904
821 Ga0495652_0195161 3300046529 Bacteria 1542
822 Ga0495652_0223649 3300046529 Bacteria 1413
823 Ga0495654_0316509 3300046530 Bacteria 634
824 Ga0495665_0047578 3300046531 Bacteria 2275
825 Ga0495665_0197332 3300046531 Bacteria 1044
826 Ga0495640_0002641 3300046533 Bacteria 14389
827 Ga0495640_0003422 3300046533 Bacteria 12776
828 Ga0495640_0005010 3300046533 Bacteria 10524
829 Ga0495640_0016478 3300046533 Bacteria 5528
830 Ga0495640_0068308 3300046533 Bacteria 2392
831 Ga0495640_0084426 3300046533 Bacteria 2106
832 Ga0495640_0158847 3300046533 Bacteria 1450
833 Ga0495586_0374428 3300046535 Bacteria 819
834 Ga0495587_0002053 3300046536 Bacteria 13447
835 Ga0495587_0007562 3300046536 Bacteria 7031
836 Ga0495587_0165561 3300046536 Bacteria 1257
837 Ga0495587_0292784 3300046536 Bacteria 911
838 Ga0495587_0393443 3300046536 Bacteria 770
839 Ga0495598_0000465 3300046537 Bacteria 7390
840 Ga0495609_0149517 3300046538 Bacteria 994
841 Ga0495621_0097163 3300046539 Bacteria 1117
842 Ga0495645_0026414 3300046543 Bacteria 4215
843 Ga0495645_0046209 3300046543 Bacteria 3174
844 Ga0495645_0070547 3300046543 Bacteria 2521
845 Ga0495645_0316299 3300046543 Bacteria 1015
846 Ga0495667_0001027 3300046559 Bacteria 18077
847 Ga0495667_0004922 3300046559 Bacteria 9033
848 Ga0495667_0008793 3300046559 Bacteria 6866
849 Ga0495667_0221116 3300046559 Bacteria 1209
850 Ga0495656_0098823 3300046615 Bacteria 1346
851 Ga0495656_0139490 3300046615 Bacteria 1161
852 Ga0495668_0130135 3300046616 Bacteria 1378
853 Ga0495668_0352817 3300046616 Bacteria 807
854 Ga0495634_0004976 3300046642 Bacteria 10265
855 Ga0495634_0020014 3300046642 Bacteria 4748
856 Ga0495634_0027596 3300046642 Bacteria 3949
857 Ga0495634_0061174 3300046642 Bacteria 2504
858 Ga0495611_0175780 3300046648 Bacteria 1001
859 Ga0495625_0124901 3300046660 Bacteria 1748
860 Ga0495625_0142531 3300046660 Bacteria 1616
861 Ga0495635_0000460 3300046663 Bacteria 25774
862 Ga0495635_0007644 3300046663 Bacteria 7544
863 Ga0495635_0176779 3300046663 Bacteria 1451
864 Ga0495661_0184077 3300046665 Bacteria 1105
865 Ga0495588_0436713 3300046674 Bacteria 687
866 Ga0495657_0007216 3300046675 Bacteria 8618
867 Ga0495657_0074386 3300046675 Bacteria 2211
868 Ga0495599_0003539 3300046678 Bacteria 9147
869 Ga0495599_0133072 3300046678 Bacteria 1544
870 Ga0495599_0138445 3300046678 Bacteria 1510
871 Ga0495623_0011498 3300046679 Bacteria 5729
872 Ga0495623_0012706 3300046679 Bacteria 5452
873 Ga0495623_0020222 3300046679 Bacteria 4302
874 Ga0495623_0244789 3300046679 Bacteria 1011
875 Ga0495646_0009087 3300046680 Bacteria 6301
876 Ga0495646_0012319 3300046680 Bacteria 5438
877 Ga0495646_0049064 3300046680 Bacteria 2563
878 Ga0495647_0314091 3300046681 Bacteria 708
879 Ga0495669_0241731 3300046684 Bacteria 867
880 Ga0495613_0189067 3300046689 Bacteria 1456
881 Ga0495613_0248938 3300046689 Bacteria 1241
882 Ga0495613_0314421 3300046689 Bacteria 1082
883 Ga0495624_0005656 3300046690 Bacteria 8971
884 Ga0495624_0014567 3300046690 Bacteria 5331
885 Ga0495624_0095765 3300046690 Bacteria 1829
886 Ga0495624_0154929 3300046690 Bacteria 1401
887 Ga0495624_0566437 3300046690 Bacteria 678
888 Ga0495649_0007168 3300046694 Bacteria 6847
889 Ga0495649_0019646 3300046694 Bacteria 3795
890 Ga0495649_0185831 3300046694 Bacteria 1083
891 Ga0495600_0003047 3300046809 Bacteria 9782
892 Ga0495600_0004031 3300046809 Bacteria 8731
893 Ga0495600_0008598 3300046809 Bacteria 6280
894 Ga0495600_0120340 3300046809 Bacteria 1708
895 Ga0495600_0316783 3300046809 Bacteria 982
896 Ga0495600_0465360 3300046809 Bacteria 780
897 Ga0495581_0098240 3300047315 Bacteria 1701
898 Ga0495581_0245020 3300047315 Bacteria 1048
899 Ga0495604_0001295 3300047317 Bacteria 20451
900 Ga0495604_0001387 3300047317 Bacteria 19848
901 Ga0495604_0147248 3300047317 Bacteria 1677
902 Ga0495604_0216024 3300047317 Bacteria 1323
903 Ga0495604_0241355 3300047317 Bacteria 1235
904 Ga0495604_0315272 3300047317 Bacteria 1046
905 Ga0495604_0405751 3300047317 Bacteria 897
906 Ga0495674_0002293 3300047319 Bacteria 18777
907 Ga0495674_0002966 3300047319 Bacteria 16507
908 Ga0495674_0004127 3300047319 Bacteria 14021
909 Ga0495674_0021408 3300047319 Bacteria 5981
910 Ga0495674_0061289 3300047319 Bacteria 3280
911 Ga0495674_0175853 3300047319 Bacteria 1784
912 Ga0495674_0314059 3300047319 Bacteria 1278
913 Ga0495674_0470568 3300047319 Bacteria 1008
914 Ga0495674_0546855 3300047319 Bacteria 922
915 Ga0495674_1017086 3300047319 Bacteria 634
916 Ga0495672_0012209 3300047320 Bacteria 6008
917 Ga0495672_0037971 3300047320 Bacteria 2942
918 Ga0495672_0040067 3300047320 Bacteria 2843
919 Ga0495672_0190730 3300047320 Bacteria 1031
920 Ga0495676_0204951 3300047321 Bacteria 1368
921 Ga0495676_0307269 3300047321 Bacteria 1068
922 Ga0495676_0326976 3300047321 Bacteria 1029
923 Ga0495680_0000268 3300047322 Bacteria 57815
924 Ga0495680_0001841 3300047322 Bacteria 22361
925 Ga0495680_0003453 3300047322 Bacteria 15563
926 Ga0495680_0223044 3300047322 Bacteria 1345
927 Ga0495687_221560 3300047443 Bacteria 585
928 Ga0495675_0009509 3300047444 Bacteria 6054
929 Ga0495675_0023964 3300047444 Bacteria 3889
930 Ga0495675_0055066 3300047444 Bacteria 2523
931 Ga0495684_0000743 3300047471 Bacteria 26279
932 Ga0495684_0002783 3300047471 Bacteria 13805
933 Ga0495684_0128700 3300047471 Bacteria 1903
934 Ga0495686_0183953 3300047472 Bacteria 1209
935 Ga0495602_0002962 3300048088 Bacteria 17410
936 Ga0495602_0003556 3300048088 Bacteria 16120
937 Ga0495602_0004414 3300048088 Bacteria 14679
938 Ga0495602_0042632 3300048088 Bacteria 4132
939 Ga0496100_0048746 3300048903 Bacteria 2735
940 Ga0496100_0130535 3300048903 Bacteria 1769
941 Ga0496100_0176170 3300048903 Bacteria 1544
942 Ga0496100_0290578 3300048903 Bacteria 1221
943 Ga0496100_0761252 3300048903 Bacteria 758
944 Ga0496101_0006282 3300048904 Bacteria 7650
945 Ga0496101_0030696 3300048904 Bacteria 3771
946 Ga0496101_0049010 3300048904 Bacteria 3037
947 Ga0496101_0153374 3300048904 Bacteria 1763
948 Ga0496101_0359680 3300048904 Bacteria 1144
949 Ga0496101_0536169 3300048904 Bacteria 925
950 Ga0496101_0648165 3300048904 Bacteria 834
951 Ga0496101_0847207 3300048904 Bacteria 720
952 Ga0496102_0017651 3300048905 Bacteria 6253
953 Ga0496102_0033585 3300048905 Bacteria 4611
954 Ga0496102_0125512 3300048905 Bacteria 2399
955 Ga0496102_0279925 3300048905 Bacteria 1572
956 Ga0496102_0409660 3300048905 Bacteria 1274
957 Ga0496102_0599682 3300048905 Bacteria 1024
958 Ga0496102_0995949 3300048905 Bacteria 759
959 Ga0496102_1126349 3300048905 Bacteria 704
960 Ga0496103_0016157 3300048906 Bacteria 4454
961 Ga0496103_0102970 3300048906 Bacteria 1808
962 Ga0496104_0000470 3300048907 Bacteria 34682
963 Ga0496104_0000856 3300048907 Bacteria 26293
964 Ga0496104_0009659 3300048907 Bacteria 8592
965 Ga0496104_0019599 3300048907 Bacteria 6192
966 Ga0496104_0059142 3300048907 Bacteria 3628
967 Ga0496104_0059926 3300048907 Bacteria 3605
968 Ga0496104_0073552 3300048907 Bacteria 3251
969 Ga0496104_0136707 3300048907 Bacteria 2354
970 Ga0496104_0183524 3300048907 Bacteria 2002
971 Ga0496104_0440740 3300048907 Bacteria 1214
972 Ga0496104_0775251 3300048907 Bacteria 865
973 Ga0496104_1119140 3300048907 Bacteria 691
974 Ga0496105_0015306 3300048908 Bacteria 6109
975 Ga0496105_0094510 3300048908 Bacteria 2469
976 Ga0496105_0109480 3300048908 Bacteria 2280
977 Ga0496105_0180257 3300048908 Bacteria 1730
978 Ga0496105_0308316 3300048908 Bacteria 1271
979 Ga0496105_0392621 3300048908 Bacteria 1103
980 Ga0496106_0049424 3300048909 Bacteria 3168
981 Ga0496106_0056473 3300048909 Bacteria 2967
982 Ga0496106_0127794 3300048909 Bacteria 1991
983 Ga0496106_0223158 3300048909 Bacteria 1503
984 Ga0496106_0335320 3300048909 Bacteria 1214
985 Ga0496106_0358948 3300048909 Bacteria 1171
986 Ga0496106_0456003 3300048909 Bacteria 1027
987 Ga0496106_0569484 3300048909 Bacteria 908
988 Ga0496107_0028389 3300048910 Bacteria 3976
989 Ga0496107_0050667 3300048910 Bacteria 2993
990 Ga0496107_0131576 3300048910 Bacteria 1847
991 Ga0496107_0207381 3300048910 Bacteria 1457
992 Ga0496107_0291552 3300048910 Bacteria 1215
993 Ga0496107_0400874 3300048910 Bacteria 1020
994 Ga0496107_0676176 3300048910 Bacteria 760
995 Ga0496108_0001364 3300048911 Bacteria 19199
996 Ga0496108_0003447 3300048911 Bacteria 12687
997 Ga0496108_0054765 3300048911 Bacteria 3348
998 Ga0496108_0085637 3300048911 Bacteria 2675
999 Ga0496108_0120782 3300048911 Bacteria 2247
1000 Ga0496108_0151651 3300048911 Bacteria 2000
1001 Ga0496108_0565719 3300048911 Bacteria 991
1002 Ga0496109_0037040 3300048912 Bacteria 4406
1003 Ga0496109_0042895 3300048912 Bacteria 4100
1004 Ga0496109_0102575 3300048912 Bacteria 2655
1005 Ga0496109_0136786 3300048912 Bacteria 2290
1006 Ga0496109_0214268 3300048912 Bacteria 1811
1007 Ga0496109_0217730 3300048912 Bacteria 1796
1008 Ga0496109_0256703 3300048912 Bacteria 1646
1009 Ga0496109_0343757 3300048912 Bacteria 1409
1010 Ga0496109_0431591 3300048912 Bacteria 1245
1011 Ga0496109_1354307 3300048912 Bacteria 647
1012 Ga0496110_0022476 3300048913 Bacteria 5355
1013 Ga0496110_0031826 3300048913 Bacteria 4553
1014 Ga0496110_0045436 3300048913 Bacteria 3839
1015 Ga0496110_0064960 3300048913 Bacteria 3226
1016 Ga0496110_0067284 3300048913 Bacteria 3170
1017 Ga0496110_0212083 3300048913 Bacteria 1761
1018 Ga0496110_0216983 3300048913 Bacteria 1740
1019 Ga0496110_0376636 3300048913 Bacteria 1293
1020 Ga0496110_0377574 3300048913 Bacteria 1292
1021 Ga0496110_0399175 3300048913 Bacteria 1253
1022 Ga0496110_0873347 3300048913 Bacteria 805
1023 Ga0496111_0012536 3300048914 Bacteria 5744
1024 Ga0496111_0022993 3300048914 Bacteria 4371
1025 Ga0496111_0046387 3300048914 Bacteria 3129
1026 Ga0496111_0052124 3300048914 Bacteria 2954
1027 Ga0496111_0088563 3300048914 Bacteria 2267
1028 Ga0496111_0138737 3300048914 Bacteria 1801
1029 Ga0496111_0235605 3300048914 Bacteria 1359
1030 Ga0496112_0010403 3300048915 Bacteria 8435
1031 Ga0496112_0022738 3300048915 Bacteria 5981
1032 Ga0496112_0054399 3300048915 Bacteria 3932
1033 Ga0496112_0080012 3300048915 Bacteria 3232
1034 Ga0496112_0104002 3300048915 Bacteria 2810
1035 Ga0496112_0112550 3300048915 Bacteria 2692
1036 Ga0496112_0154464 3300048915 Bacteria 2262
1037 Ga0496112_0166879 3300048915 Bacteria 2167
1038 Ga0496112_0176004 3300048915 Bacteria 2105
1039 Ga0496112_0600521 3300048915 Bacteria 1032
1040 Ga0496112_0790490 3300048915 Bacteria 874
1041 Ga0496112_1173859 3300048915 Bacteria 685
1042 Ga0496113_0029512 3300048916 Bacteria 3962
1043 Ga0496113_0040410 3300048916 Bacteria 3437
1044 Ga0496113_0100862 3300048916 Bacteria 2237
1045 Ga0496113_0113094 3300048916 Bacteria 2115
1046 Ga0496113_0375416 3300048916 Bacteria 1141
1047 Ga0496114_0031337 3300048917 Bacteria 4375
1048 Ga0496114_0598852 3300048917 Bacteria 972
1049 Ga0496114_0758060 3300048917 Bacteria 848
1050 Ga0496114_1098401 3300048917 Bacteria 680
1051 Ga0496114_1534111 3300048917 Bacteria 554
1052 Ga0496115_0008599 3300048918 Bacteria 7559
1053 Ga0496115_0118359 3300048918 Bacteria 2179
1054 Ga0496115_0127894 3300048918 Bacteria 2093
1055 Ga0496115_0131226 3300048918 Bacteria 2065
1056 Ga0496115_0170721 3300048918 Bacteria 1799
1057 Ga0496115_0246433 3300048918 Bacteria 1472
1058 Ga0496115_0427299 3300048918 Bacteria 1073
1059 Ga0496118_0028589 3300048921 Bacteria 4692
1060 Ga0496119_0088591 3300048922 Bacteria 1764
1061 Ga0496119_0299075 3300048922 Bacteria 794
1062 Ga0496120_0195158 3300048923 Bacteria 984
1063 Ga0496121_0002055 3300048924 Bacteria 31853
1064 Ga0496121_0003308 3300048924 Bacteria 23151
1065 Ga0496121_0013310 3300048924 Bacteria 8856
1066 Ga0496121_0033196 3300048924 Bacteria 4675
1067 Ga0496122_0412330 3300048925 Bacteria 682
1068 Ga0496123_0128804 3300048926 Bacteria 1407
1069 Ga0496124_0184884 3300048927 Bacteria 1600
1070 Ga0496124_0270346 3300048927 Bacteria 1245
1071 Ga0496125_0000040 3300048928 Bacteria 314478
1072 Ga0496125_0001260 3300048928 Bacteria 37764
1073 Ga0496126_0022355 3300048929 Bacteria 6156
1074 Ga0496126_0043051 3300048929 Bacteria 4168
1075 Ga0496126_0061151 3300048929 Bacteria 3384
1076 Ga0496126_0103658 3300048929 Bacteria 2486
1077 Ga0496126_0113724 3300048929 Bacteria 2356
1078 Ga0496126_0142801 3300048929 Bacteria 2059
1079 Ga0496126_0170639 3300048929 Bacteria 1853
1080 Ga0496126_0267306 3300048929 Bacteria 1420
1081 Ga0496126_0393029 3300048929 Bacteria 1126
1082 Ga0495682_0053027 3300049460 Bacteria 1473
1083 Ga0495682_0180207 3300049460 Bacteria 751
1084 Ga0501031_0796513 3300049568 Bacteria 606
1085 Ga0501034_0646741 3300049571 Bacteria 959
1086 Ga0501036_0227619 3300049572 Bacteria 1565
1087 Ga0501036_0273463 3300049572 Bacteria 1414
1088 Ga0501037_0273461 3300049573 Bacteria 1178
1089 Ga0501038_0566167 3300049574 Bacteria 863
1090 Ga0501039_0192029 3300049575 Bacteria 1606
1091 Ga0501040_0050034 3300049576 Bacteria 2858
1092 Ga0501042_0764626 3300049578 Bacteria 703
1093 Ga0501042_0787081 3300049578 Bacteria 692
1094 Ga0501043_0122676 3300049579 Bacteria 2038
1095 Ga0501047_0029908 3300049581 Bacteria 5251
1096 Ga0501048_0034948 3300049582 Bacteria 3622
1097 Ga0501070_0204586 3300049586 Bacteria 1621
1098 Ga0501070_0533218 3300049586 Bacteria 941
1099 Ga0501071_0119417 3300049587 Bacteria 1954
1100 Ga0501072_0573210 3300049588 Bacteria 891
1101 Ga0501075_0212642 3300049591 Bacteria 1475
1102 Ga0501079_0117112 3300049741 Bacteria 2071
1103 nmdc:mga03683_157029_c1 3300050489 Bacteria 1029
1104 nmdc:mga03683_223424_c1 3300050489 Bacteria 869
1105 nmdc:mga03683_253151_c1 3300050489 Bacteria 818
1106 nmdc:mga03683_324386_c1 3300050489 Bacteria 725
1107 nmdc:mga03683_35016_c1 3300050489 Bacteria 2034
1108 nmdc:mga03683_7114_c1 3300050489 Bacteria 3868
1109 nmdc:mga03683_81740_c1 3300050489 Bacteria 1396
1110 nmdc:mga03n38_1609_c1 3300050490 Bacteria 6593
1111 nmdc:mga03n38_266221_c1 3300050490 Bacteria 910
1112 nmdc:mga03n38_7733_c1 3300050490 Bacteria 3816
1113 nmdc:mga00v17_13272_c1 3300050491 Bacteria 4568
1114 nmdc:mga00v17_135923_c1 3300050491 Bacteria 1574
1115 nmdc:mga00v17_193094_c1 3300050491 Bacteria 1315
1116 nmdc:mga0yw44_156703_c1 3300050492 Bacteria 1489
1117 nmdc:mga0yw44_188467_c1 3300050492 Bacteria 1360
1118 nmdc:mga0yw44_379657_c1 3300050492 Bacteria 954
1119 nmdc:mga0yw44_6751_c1 3300050492 Bacteria 5576
1120 nmdc:mga0yw44_8490_c1 3300050492 Bacteria 5122
1121 nmdc:mga0yw44_8572_c1 3300050492 Bacteria 5104
1122 nmdc:mga0yw44_860107_c1 3300050492 Bacteria 615
1123 nmdc:mga0k408_18250_c1 3300050493 Bacteria 3915
1124 nmdc:mga0k408_249706_c1 3300050493 Bacteria 1059
1125 nmdc:mga0k408_348130_c1 3300050493 Bacteria 883
1126 nmdc:mga06z11_100518_c1 3300050494 Bacteria 1586
1127 nmdc:mga06z11_195865_c1 3300050494 Bacteria 1171
1128 nmdc:mga06z11_304756_c1 3300050494 Bacteria 948
1129 nmdc:mga06z11_430492_c1 3300050494 Bacteria 796
1130 nmdc:mga06z11_48176_c1 3300050494 Bacteria 2168
1131 nmdc:mga06z11_786_c1 3300050494 Bacteria 11588
1132 nmdc:mga04h51_314490_c1 3300050495 Bacteria 641
1133 nmdc:mga04h51_329386_c1 3300050495 Bacteria 628
1134 nmdc:mga04h51_53488_c1 3300050495 Bacteria 1362
1135 nmdc:mga04h51_57128_c1 3300050495 Bacteria 1327
1136 nmdc:mga07m45_67209_c1 3300050496 Bacteria 2037
1137 nmdc:mga07m45_81556_c1 3300050496 Bacteria 1847
1138 nmdc:mga05p37_1213020_c1 3300050507 Bacteria 778
1139 nmdc:mga05p37_29258_c1 3300050507 Bacteria 6724
1140 nmdc:mga05p37_417525_c1 3300050507 Bacteria 1562
1141 nmdc:mga05p37_51939_c1 3300050507 Bacteria 5040
1142 nmdc:mga05p37_571590_c1 3300050507 Bacteria 1282
1143 nmdc:mga05p37_790884_c1 3300050507 Bacteria 1039
1144 nmdc:mga05p37_79117_c1 3300050507 Bacteria 4048
1145 nmdc:mga05p37_927129_c1 3300050507 Bacteria 935
1146 nmdc:mga09592_142688_c1 3300050508 Bacteria 2065
1147 nmdc:mga09592_425704_c1 3300050508 Bacteria 1146
1148 nmdc:mga0qj67_198098_c1 3300050509 Bacteria 1632
1149 nmdc:mga0qj67_29082_c1 3300050509 Bacteria 4292
1150 nmdc:mga0qj67_34_c1 3300050509 Bacteria 96663
1151 nmdc:mga0qj67_39195_c1 3300050509 Bacteria 3720
1152 nmdc:mga06r32_306074_c1 3300050510 Bacteria 1575
1153 nmdc:mga06r32_310369_c1 3300050510 Bacteria 1220
1154 nmdc:mga06r32_331528_c1 3300050510 Bacteria 1507
1155 nmdc:mga08y16_263565_c1 3300050511 Bacteria 1779
1156 nmdc:mga08y16_42072_c1 3300050511 Bacteria 4785
1157 nmdc:mga08y16_753794_c1 3300050511 Bacteria 969
1158 nmdc:mga0n895_13881_c1 3300050512 Bacteria 7293
1159 nmdc:mga0n895_252750_c1 3300050512 Bacteria 1789
1160 nmdc:mga0n895_297857_c1 3300050512 Bacteria 1635
1161 nmdc:mga0n895_481906_c1 3300050512 Bacteria 1251
1162 nmdc:mga0rr50_1092058_c1 3300050513 Bacteria 679
1163 nmdc:mga0rr50_373181_c1 3300050513 Bacteria 1202
1164 nmdc:mga0rr50_686918_c1 3300050513 Bacteria 874
1165 nmdc:mga08x19_182448_c1 3300050514 Bacteria 1433
1166 nmdc:mga0a205_1156414_c1 3300050515 Bacteria 621
1167 nmdc:mga0a205_1201764_c1 3300050515 Bacteria 606
1168 nmdc:mga0sz30_79362_c1 3300050516 Bacteria 1419
1169 nmdc:mga0sz30_86473_c1 3300050516 Bacteria 1361
1170 Ga0495601_0001528 3300053077 Bacteria 12764
1171 Ga0495601_0002673 3300053077 Bacteria 10100
1172 Ga0495601_0012304 3300053077 Bacteria 5131
1173 Ga0495601_0034167 3300053077 Bacteria 3171
1174 Ga0495601_0040805 3300053077 Bacteria 2907
1175 Ga0495601_0138091 3300053077 Bacteria 1589
1176 Ga0495601_0142277 3300053077 Bacteria 1565
1177 Ga0495601_0294758 3300053077 Bacteria 1057
1178 Ga0495612_0000102 3300053078 Bacteria 36423
1179 Ga0495612_0001567 3300053078 Bacteria 9424
1180 Ga0495612_0005512 3300053078 Bacteria 5231
1181 Ga0495612_0044821 3300053078 Bacteria 1810
1182 Ga0495612_0070814 3300053078 Bacteria 1454
1183 Ga0495612_0257060 3300053078 Bacteria 778
1184 Ga0495612_0260995 3300053078 Bacteria 772
1185 Ga0500635_0043726 3300053080 Bacteria 1508
1186 Ga0495655_0018367 3300053083 Bacteria 1536
1187 Ga0495655_0043358 3300053083 Bacteria 1159
1188 Ga0495595_0000640 3300053084 Bacteria 13290
1189 Ga0495595_0001740 3300053084 Bacteria 8510
1190 Ga0495595_0073957 3300053084 Bacteria 1614
1191 Ga0495619_0000738 3300053085 Bacteria 21349
1192 Ga0495619_0001034 3300053085 Bacteria 18264
1193 Ga0495619_0013423 3300053085 Bacteria 5162
1194 Ga0495619_0016844 3300053085 Bacteria 4628
1195 Ga0495619_0022264 3300053085 Bacteria 4053
1196 Ga0495619_0038953 3300053085 Bacteria 3102
1197 Ga0495619_0123450 3300053085 Bacteria 1776
1198 Ga0500578_0403758 3300053086 Bacteria 787
1199 Ga0500643_000342 3300053087 Bacteria 36998
1200 Ga0500647_0029202 3300053091 Bacteria 2615
1201 Ga0500583_0317492 3300053092 Bacteria 760
1202 Ga0500651_0076085 3300053093 Bacteria 2084
1203 Ga0500566_0000082 3300053094 Bacteria 47150
1204 Ga0500566_0020503 3300053094 Bacteria 3885
1205 Ga0500566_0124191 3300053094 Bacteria 1388
1206 Ga0500640_226624 3300053095 Bacteria 625
1207 Ga0500641_0046616 3300053096 Bacteria 1770
1208 Ga0500641_0140717 3300053096 Bacteria 1042
1209 Ga0500554_005055 3300053102 Bacteria 2845
1210 Ga0500556_0009055 3300053104 Bacteria 2886
1211 Ga0500556_0013712 3300053104 Bacteria 2459
1212 Ga0500557_000015 3300053105 Bacteria 106282
1213 Ga0500562_122961 3300053108 Bacteria 707
1214 Ga0500569_065983 3300053109 Bacteria 1129
1215 Ga0500569_113876 3300053109 Bacteria 896
1216 Ga0500595_000467 3300053119 Bacteria 25049
1217 Ga0500595_000720 3300053119 Bacteria 19650
1218 Ga0500595_001239 3300053119 Bacteria 14054
1219 Ga0500595_005562 3300053119 Bacteria 5491
1220 Ga0500595_015274 3300053119 Bacteria 2886
1221 Ga0500595_051667 3300053119 Bacteria 1272
1222 Ga0500597_139838 3300053120 Bacteria 1044
1223 Ga0500608_070996 3300053122 Bacteria 1656
1224 Ga0500614_010843 3300053123 Bacteria 1962
1225 Ga0500642_0000341 3300053130 Bacteria 15927
1226 Ga0500642_0000996 3300053130 Bacteria 8129
1227 Ga0500642_0144249 3300053130 Bacteria 1117
1228 Ga0500642_0190379 3300053130 Bacteria 957
1229 Ga0500655_011866 3300053133 Bacteria 1582
1230 Ga0500658_0528593 3300053134 Bacteria 532
1231 Ga0500559_0015682 3300053136 Bacteria 3199
1232 Ga0500568_0060590 3300053139 Bacteria 1465
1233 Ga0500577_0000512 3300053142 Bacteria 9998
1234 Ga0500577_0032324 3300053142 Bacteria 1839
1235 Ga0500588_0235738 3300053146 Bacteria 685
1236 Ga0500588_0416414 3300053146 Bacteria 512
1237 Ga0500589_070910 3300053147 Bacteria 1576
1238 Ga0500589_091235 3300053147 Bacteria 1342
1239 Ga0500603_010963 3300053150 Bacteria 2054
1240 Ga0500604_0093286 3300053151 Bacteria 986
1241 Ga0500616_0008774 3300053153 Bacteria 6226
1242 Ga0500616_0018971 3300053153 Bacteria 3884
1243 Ga0500616_0202129 3300053153 Bacteria 879
1244 Ga0500622_0006716 3300053156 Bacteria 6631
1245 Ga0500622_0167764 3300053156 Bacteria 1024
1246 Ga0500627_0047324 3300053158 Bacteria 1866
1247 Ga0500633_0081618 3300053160 Bacteria 1171
1248 Ga0500634_0132618 3300053161 Bacteria 1194
1249 Ga0500638_022465 3300053162 Bacteria 2989
1250 Ga0500638_099126 3300053162 Bacteria 1362
1251 Ga0500638_103533 3300053162 Bacteria 1324
1252 Ga0500638_296815 3300053162 Bacteria 625
1253 Ga0500636_0000137 3300053177 Bacteria 38086
1254 Ga0500636_0003886 3300053177 Bacteria 8433
1255 Ga0500636_0117627 3300053177 Bacteria 1494
1256 Ga0500636_0199002 3300053177 Bacteria 1061
1257 Ga0500637_0001104 3300053178 Bacteria 11124
1258 Ga0500625_004283 3300053729 Bacteria 5801
1259 Ga0500645_010811 3300053730 Bacteria 3002
1260 Ga0500609_004143 3300053731 Bacteria 2017
1261 Ga0500599_005672 3300053736 Bacteria 1575
1262 Ga0500601_000032 3300053737 Bacteria 31109
1263 Ga0500601_003066 3300053737 Bacteria 1802
1264 Ga0500661_000043 3300055283 Bacteria 19291
1265 Ga0501082_0133991 3300060353 Bacteria 2150
1266 Ga0501082_1242146 3300060353 Bacteria 651
1267 Ga0530510_0248114 3300061734 Bacteria 1326
1268 2507508561 2507262055 Bacteria 8048963
1269 2508542636 2508501009 Bacteria 7784016
1270 2508691591 2508501042 Bacteria 8719808
1271 2513638957 2513237094 Bacteria 8789602
1272 2513654753 2513237096 Bacteria 8722461
1273 2513674479 2513237098 Bacteria 9902361
1274 2513722340 2513237104 Bacteria 10034502
1275 2513855826 2513237137 Bacteria 9558895
1276 2513915067 2513237145 Bacteria 8979722
1277 2515629880 2515154112 Bacteria 8294334
1278 2517892364 2517572143 Bacteria 9484767
1279 2524443144 2524023205 Bacteria 8918781
1280 2524538547 2524023228 Bacteria 10118060
1281 2644730455 2643221733 Bacteria 5690728
1282 2723847502 2721755755 Bacteria 8322773
1283 2745076628 2744054633 Bacteria 8678936
1284 2793081416
1285 2874598070 2874590934 Bacteria 8299676
1286 2874627806 2874620515 Bacteria 8290088
1287 2874647484 2874645413 Bacteria 8214782
1288 2876766826 2876761206 Bacteria 10111113
1289 2876778452 2876771140 Bacteria 8287509
1290 2876817074 2876808645 Bacteria 8824342
1291 2876820398 2876818435 Bacteria 8274608
1292 2879082246 2879074833 Bacteria 8279565
1293 2879117541 2879110137 Bacteria 8907982
1294 2879135393 2879127579 Bacteria 8294491
1295 2879150601 2879142872 Bacteria 8267021
1296 2885373180 2885366525 Bacteria 8326213
1297 2885380550 2885374607 Bacteria 8927485
1298 2885387413 2885383462 Bacteria 9473874
1299 2903749323 2903748898 Bacteria 9972761
1300 2903768458 2903768456 Bacteria 9749579
1301 2904672874 2904666416 Bacteria 8226587
1302 2904695844 2904690495 Bacteria 9412302
1303 2904703475
1304 2906618661
1305 2906633289 2906626472 Bacteria 8826946
1306 2906638900 2906635258 Bacteria 8601019
1307 2906666343 2906660503 Bacteria 8595048
1308 2908742662 2908739725 Bacteria 8628932
1309 2908761145 2908756301 Bacteria 8864324
1310 2919451109 2919450847 Bacteria 5631160
1311 2922430320
1312 2932797447 2932794094 Bacteria 7915132
1313 2932802768 2932801729 Bacteria 7987968
1314 2935608907 2935608549 Bacteria 8203142
1315 2935631638 2935630451 Bacteria 8169952
1316 2935650073 2935648319 Bacteria 8801166
1317 2935661775 2935656913 Bacteria 8965014
1318 2935773317 2935769743 Bacteria 7878163
1319 2935778556 2935777560 Bacteria 8077691
1320 2935792729 2935785616 Bacteria 7962367
1321 2935800756 2935793552 Bacteria 8012592
1322 2935822067 2935819856 Bacteria 8261050
1323 2935847649 2935847175 Bacteria 8228321
1324 2935889862 2935883170 Bacteria 7964738
1325 2935909080 2935908558 Bacteria 8568796
1326 2935919800 2935916978 Bacteria 9113783
1327 2935926346 2935926038 Bacteria 8601059
1328 2935934796 2935934488 Bacteria 8602579
1329 2935943246 2935942939 Bacteria 8599779
1330 2935951684 2935951376 Bacteria 8602333
1331 2935967809 2935967501 Bacteria 8603075
1332 2935982647 2935975950 Bacteria 8347125
1333 2935988142 2935984226 Bacteria 8302647
1334 2936012443 2936011229 Bacteria 8801034
1335 2936021008 2936019824 Bacteria 8804134
1336 2936029736 2936028420 Bacteria 8965941
1337 2936047201 2936046547 Bacteria 8903709
1338 2936057640 2936055302 Bacteria 8785755
1339 2941511432 2941507105 Bacteria 8166816
1340 2941519133 2941515067 Bacteria 8166720
1341 2941526287 2941523033 Bacteria 8169134
1342 2941532838 2941531003 Bacteria 7653939
1343 3005480242 3005474847 Bacteria 9259049
1344 3005599256 3005594810 Bacteria 8716512
1345 8001848930 8001845381 Bacteria 5804942
1346 8006970176 8006964411 Bacteria 8966052
1347 8006980332 8006973647 Bacteria 10679141
1348 8006985464 8006984368 Bacteria 9651211
1349 8016529590 8016522445 Bacteria 8156687
1350 8016534805 8016530956 Bacteria 8155261
1351 8016548020 8016539877 Bacteria 8155419
1352 8016554109 8016548790 Bacteria 8155074
1353 8016562485 8016557553 Bacteria 8154380
1354 8016573153 8016566248 Bacteria 8158151
1355 8016577296 8016575299 Bacteria 8154085
1356 8016591731 8016583857 Bacteria 10421953
1357 8016600277 8016595262 Bacteria 8149947
1358 8016614463 8016613128 Bacteria 8794220
1359 8016626535 8016622563 Bacteria 7999408
1360 8016640313 8016630954 Bacteria 9217207
1361 8019534572 8019530166 Bacteria 8155624
1362 8019556712 8019555841 Bacteria 9642137
1363 8019568595 8019565922 Bacteria 9639779
1364 8019628189 8019619141 Bacteria 9218857
1365 8019645299 8019638758 Bacteria 9062356
1366 8019658424 8019648815 Bacteria 10014479
1367 8019671822 8019668869 Bacteria 8791617
1368 8019684271 8019678201 Bacteria 8863603
1369 8019690102 8019687851 Bacteria 8712826
1370 8056693521 8056689827 Bacteria 6712655
1371 Ga0068863_101115030
1372 JGI24739J22299_10075864
1373 JGI24743J22301_10007339
1374 JGI24743J22301_10012808
1375 JGI24742J22300_10000505
1376 JGI24751J29686_10016475
1377 JGI25153J46596_10084628
1378 Ga0065712_10006480
1379 Ga0065715_10127944
1380 Ga0065715_10130756
1381 Ga0070658_10061394
1382 Ga0070658_10160128
1383 Ga0070658_10497799
1384 Ga0070676_10031271
1385 Ga0070683_100002855
1386 Ga0070690_100017565
1387 Ga0070690_100052415
1388 Ga0070690_100530283
1389 Ga0070670_100025854
1390 Ga0070670_100085973
1391 Ga0070670_100328580
1392 Ga0070670_100898770
1393 Ga0068869_100000224
1394 Ga0068869_100556714
1395 Ga0068869_100830424
1396 Ga0070666_10004151
1397 Ga0070666_10070746
1398 Ga0070666_10163197
1399 Ga0070680_100009965
1400 Ga0070680_100194676
1401 Ga0070680_100839550
1402 Ga0070682_100028268
1403 Ga0068868_100010158
1404 Ga0070660_100095382
1405 Ga0070660_100193322
1406 Ga0070689_100226516
1407 Ga0070689_100572211
1408 Ga0070691_10048413
1409 Ga0070691_10132782
1410 Ga0070687_100019510
1411 Ga0070661_100215481
1412 Ga0070661_100673783
1413 Ga0070668_100015506
1414 Ga0070668_100020791
1415 Ga0070668_100060366
1416 Ga0070668_100608619
1417 Ga0070669_100009656
1418 Ga0070669_100036724
1419 Ga0070669_100042830
1420 Ga0070669_100217559
1421 Ga0070669_100411980
1422 Ga0070669_100779636
1423 Ga0070675_100008255
1424 Ga0070675_100065037
1425 Ga0070675_100266666
1426 Ga0070675_101023539
1427 Ga0070675_101114818
1428 Ga0070671_100009484
1429 Ga0070671_100061749
1430 Ga0070671_100447939
1431 Ga0070674_100001383
1432 Ga0070674_100057066
1433 Ga0070674_100749225
1434 Ga0070673_100007805
1435 Ga0070673_100020941
1436 Ga0070673_100029310
1437 Ga0070673_100338624
1438 Ga0070673_100580557
1439 Ga0070688_100030437
1440 Ga0070688_100076098
1441 Ga0070659_100019602
1442 Ga0070667_100016459
1443 Ga0070667_100109429
1444 Ga0070667_100283461
1445 Ga0070667_100291107
1446 Ga0070709_10025530
1447 Ga0070709_10129324
1448 Ga0070714_100026264
1449 Ga0070714_100039094
1450 Ga0070714_100069675
1451 Ga0070714_100384524
1452 Ga0070714_100413540
1453 Ga0070714_101149114
1454 Ga0070713_100011022
1455 Ga0070713_100091093
1456 Ga0070713_100300916
1457 Ga0070713_100366339
1458 Ga0070713_100922277
1459 Ga0070710_10016187
1460 Ga0070710_10407448
1461 Ga0070710_10756465
1462 Ga0070711_100021590
1463 Ga0070711_100097360
1464 Ga0070711_100217216
1465 Ga0070711_100344523
1466 Ga0070711_100351994
1467 Ga0070705_100125406
1468 Ga0070705_100142555
1469 Ga0070705_100561764
1470 Ga0070705_101156148
1471 Ga0070700_100014295
1472 Ga0070700_100144933
1473 Ga0070700_100183153
1474 Ga0070700_100408073
1475 Ga0070708_100041936
1476 Ga0070708_100051002
1477 Ga0070708_100054107
1478 Ga0070708_101031586
1479 Ga0070663_100107514
1480 Ga0070663_100351239
1481 Ga0070663_100656517
1482 Ga0070678_100061968
1483 Ga0070678_100283491
1484 Ga0070662_100012198
1485 Ga0070662_100265983
1486 Ga0070681_10067486
1487 Ga0070681_10180191
1488 Ga0068867_100002837
1489 Ga0068867_100035591
1490 Ga0068867_100064497
1491 Ga0070685_10015396
1492 Ga0070685_10057358
1493 Ga0070706_100406608
1494 Ga0070706_100514725
1495 Ga0070706_100697332
1496 Ga0070707_100048636
1497 Ga0070707_100453928
1498 Ga0070707_100943355
1499 Ga0070698_100260774
1500 Ga0070698_100263593
1501 Ga0070699_100042058
1502 Ga0070699_100043125
1503 Ga0070699_100079039
1504 Ga0070679_100151322
1505 Ga0070679_101197100
1506 Ga0070684_100002055
1507 Ga0068853_100010507
1508 Ga0068853_100132594
1509 Ga0068853_100202733
1510 Ga0068853_100220978
1511 Ga0068853_100333237
1512 Ga0068853_100380938
1513 Ga0070672_100021871
1514 Ga0070672_100037186
1515 Ga0070672_100060174
1516 Ga0070672_100142384
1517 Ga0070672_100185037
1518 Ga0070672_100480357
1519 Ga0070686_100069919
1520 Ga0070686_100155232
1521 Ga0070695_100078571
1522 Ga0070695_100534069
1523 Ga0070696_100074564
1524 Ga0070696_100922403
1525 Ga0070693_100308931
1526 Ga0070693_100634578
1527 Ga0070665_100029316
1528 Ga0070665_100151533
1529 Ga0070665_100254896
1530 Ga0070665_100557103
1531 Ga0070704_100507160
1532 Ga0070704_101182121
1533 Ga0068855_100028344
1534 Ga0068855_100030806
1535 Ga0068855_100315827
1536 Ga0070664_100178277
1537 Ga0070664_100259501
1538 Ga0070664_100538916
1539 Ga0068857_100986098
1540 Ga0068854_100264237
1541 Ga0068854_100318663
1542 Ga0068854_100420784
1543 Ga0068854_100520523
1544 Ga0070702_100025846
1545 Ga0070702_100049333
1546 Ga0070702_100768467
1547 Ga0068852_100020112
1548 Ga0068852_100054176
1549 Ga0068852_100114381
1550 Ga0068852_100572538
1551 Ga0068859_100007790
1552 Ga0068859_101272489
1553 Ga0068864_100000229
1554 Ga0068864_100020269
1555 Ga0068864_100061430
1556 Ga0068864_101532166
1557 Ga0068866_10066563
1558 Ga0068866_10173050
1559 Ga0068861_100060712
1560 Ga0068861_100074966
1561 Ga0068861_100321133
1562 Ga0068851_10096273
1563 Ga0068851_10288196
1564 Ga0068851_10327924
1565 Ga0068870_10007574
1566 Ga0068870_10020835
1567 Ga0068870_10031694
1568 Ga0068863_100015909
1569 Ga0068863_100112835
1570 Ga0068863_100119635
1571 Ga0068863_100124711
1572 Ga0068863_100188713
1573 Ga0068863_100311578
1574 Ga0068863_100366806
1575 Ga0068863_100460416
1576 Ga0068863_100865351
1577 Ga0068858_100006171
1578 Ga0068858_100307793
1579 Ga0068858_100339041
1580 Ga0068858_100344544
1581 Ga0068860_100004539
1582 Ga0068860_100066728
1583 Ga0068860_100693726
1584 Ga0068862_100216305
1585 Ga0068862_100319994
1586 Ga0068862_100611543
1587 Ga0081455_10000982
1588 Ga0081455_10007625
1589 Ga0081455_10506332
1590 Ga0081538_10018810
1591 Ga0081540_1001932
1592 Ga0081540_1008707
1593 Ga0081540_1015372
1594 Ga0081540_1038118
1595 Ga0081539_10006465
1596 Ga0081539_10194570
1597 Ga0070717_10021652
1598 Ga0070717_10063259
1599 Ga0070717_10189322
1600 Ga0070717_10194327
1601 Ga0070717_10233217
1602 Ga0070717_10253995
1603 Ga0070717_10284913
1604 Ga0070717_10386570
1605 Ga0075365_10045657
1606 Ga0075365_10053329
1607 Ga0075365_10126924
1608 Ga0075365_10216116
1609 Ga0075365_10240940
1610 Ga0075365_10319879
1611 Ga0075368_10046523
1612 Ga0075368_10090088
1613 Ga0075368_10251888
1614 Ga0075363_100002458
1615 Ga0075363_100004926
1616 Ga0075363_100093427
1617 Ga0075363_100295329
1618 Ga0075364_10004046
1619 Ga0075364_10037551
1620 Ga0075364_10082513
1621 Ga0075364_10277583
1622 Ga0070715_10033445
1623 Ga0070716_100012323
1624 Ga0070716_100392033
1625 Ga0070716_100540675
1626 Ga0070712_100001511
1627 Ga0070712_100008608
1628 Ga0070712_100011636
1629 Ga0070712_100021244
1630 Ga0070712_100203421
1631 Ga0070712_100433677
1632 Ga0070712_100872632
1633 Ga0075362_10003256
1634 Ga0075362_10065360
1635 Ga0075362_10138224
1636 Ga0075362_10192825
1637 Ga0075367_10019025
1638 Ga0075367_10101961
1639 Ga0075367_10146607
1640 Ga0075367_10177055
1641 Ga0075367_10222823
1642 Ga0075367_10365127
1643 Ga0075367_10450077
1644 Ga0075369_10024966
1645 Ga0075369_10061723
1646 Ga0075369_10084016
1647 Ga0075369_10089116
1648 Ga0075369_10159426
1649 Ga0075366_10012644
1650 Ga0075366_10036998
1651 Ga0075366_10098695
1652 Ga0097621_100577567
1653 Ga0068871_100008823
1654 Ga0068871_100996635
1655 Ga0075428_100053353
1656 Ga0075428_100244637
1657 Ga0075428_100318883
1658 Ga0075428_100473916
1659 Ga0075428_100571172
1660 Ga0075430_100003089
1661 Ga0075430_100028441
1662 Ga0075430_100029130
1663 Ga0075430_100175093
1664 Ga0075431_100024543
1665 Ga0075431_100324293
1666 Ga0075433_10564371
1667 Ga0075433_10856711
1668 Ga0075434_100012794
1669 Ga0075434_100083942
1670 Ga0075434_100257124
1671 Ga0075434_100310786
1672 Ga0075434_100499484
1673 Ga0075434_100685524
1674 Ga0075429_100031850
1675 Ga0068865_100004224
1676 Ga0068865_100015790
1677 Ga0068865_101086623
1678 Ga0075436_100165717
1679 Ga0097620_100007790
1680 Ga0097620_101061115
1681 Ga0097620_101272496
1682 Ga0075435_100041824
1683 Ga0075435_100379221
1684 Ga0075435_100653847
1685 Ga0099794_10107708
1686 Ga0099794_10395874
1687 Ga0099795_10010821
1688 Ga0099795_10022526
1689 Ga0105240_10017817
1690 Ga0105240_10066925
1691 Ga0111539_10088671
1692 Ga0111539_10166795
1693 Ga0111539_10655076
1694 Ga0111539_10707686
1695 Ga0111539_11547550
1696 Ga0105245_10060475
1697 Ga0105245_10528269
1698 Ga0105245_10601745
1699 Ga0105247_10008287
1700 Ga0105247_10078657
1701 Ga0114129_10035550
1702 Ga0114129_10037759
1703 Ga0114129_10090634
1704 Ga0114129_10517590
1705 Ga0114129_10765634
1706 Ga0114129_11821861
1707 Ga0105243_10038255
1708 Ga0105243_10152517
1709 Ga0105242_10294594
1710 Ga0105248_10000379
1711 Ga0105248_10021074
1712 Ga0105248_10070000
1713 Ga0105248_10153742
1714 Ga0105248_10158212
1715 Ga0105237_10005765
1716 Ga0105237_10423184
1717 Ga0105237_10979483
1718 Ga0105238_10009636
1719 Ga0105238_10164466
1720 Ga0105238_10671717
1721 Ga0105238_11092653
1722 Ga0105249_10019374
1723 Ga0105249_10377374
1724 Ga0105249_10736692
1725 Ga0105249_10931578
1726 Ga0105249_11810670
1727 Ga0099796_10011223
1728 Ga0099796_10131521
1729 Ga0099796_10185414
1730 Ga0105239_10002417
1731 Ga0105239_10405122
1732 Ga0105239_10712306
1733 Ga0105239_10769108
1734 Ga0105246_10005683
1735 Ga0105246_10405674
1736 Ga0105246_10790627
1737 Ga0105246_10823651
1738 Ga0157370_10023869
1739 Ga0157370_10223225
1740 Ga0157369_10455333
1741 Ga0157374_10038670
1742 Ga0157374_10275639
1743 Ga0157374_10551940
1744 Ga0157378_10026493
1745 Ga0157378_10902995
1746 Ga0157378_11862642
1747 Ga0163162_10142127
1748 Ga0163162_10145743
1749 Ga0163162_10428826
1750 Ga0163162_10511590
1751 Ga0163162_10871571
1752 Ga0163162_11605198
1753 Ga0157372_10427892
1754 Ga0157375_10034220
1755 Ga0157375_10576865
1756 Ga0157375_10769359
1757 Ga0157375_10942517
1758 Ga0163163_10012279
1759 Ga0163163_10638244
1760 Ga0163163_10643140
1761 Ga0163163_10697812
1762 Ga0163163_10861431
1763 Ga0163163_10905197
1764 Ga0157380_10013246
1765 Ga0157380_10015772
1766 Ga0157380_10138885
1767 Ga0157380_10330671
1768 Ga0157380_10671377
1769 Ga0182008_10448220
1770 Ga0157377_10030023
1771 Ga0157377_10043839
1772 Ga0157377_10238246
1773 Ga0157379_10009012
1774 Ga0157379_10039663
1775 Ga0157379_10794085
1776 Ga0157379_11711154
1777 Ga0157376_10385527
1778 Ga0157376_10979212
1779 Ga0163161_10119178
1780 Ga0163161_10217315
1781 Ga0163161_10567913
1782 Ga0213873_10005100
1783 Ga0213872_10044787
1784 Ga0213876_10037584
1785 Ga0213871_10033419
1786 Ga0209233_1022292
1787 Ga0209758_1000160
1788 Ga0209758_1000507
1789 Ga0209758_1001948
1790 Ga0209758_1005368
1791 Ga0209758_1016981
1792 Ga0207426_1029339
1793 Ga0209257_1099620
1794 Ga0207697_10039701
1795 Ga0207656_10103265
1796 Ga0207696_1075314
1797 Ga0207682_10000447
1798 Ga0207692_10006351
1799 Ga0207692_10033520
1800 Ga0207692_10366291
1801 Ga0207642_10007042
1802 Ga0207642_10069671
1803 Ga0207710_10331314
1804 Ga0207688_10003040
1805 Ga0207688_10315736
1806 Ga0207680_10104121
1807 Ga0207680_10163449
1808 Ga0207680_10184960
1809 Ga0207680_10185387
1810 Ga0207680_10319118
1811 Ga0207647_10011883
1812 Ga0207647_10158785
1813 Ga0207685_10017129
1814 Ga0207685_10065902
1815 Ga0207699_10006557
1816 Ga0207699_10367142
1817 Ga0207645_10038033
1818 Ga0207645_10051591
1819 Ga0207645_10065981
1820 Ga0207645_10088956
1821 Ga0207645_10581320
1822 Ga0207643_10004948
1823 Ga0207643_10026011
1824 Ga0207643_10037613
1825 Ga0207705_10098525
1826 Ga0207705_10240579
1827 Ga0207684_10105842
1828 Ga0207684_10252290
1829 Ga0207684_10564768
1830 Ga0207654_10272991
1831 Ga0207707_10001734
1832 Ga0207707_10032121
1833 Ga0207695_10023454
1834 Ga0207693_10002688
1835 Ga0207693_10014235
1836 Ga0207693_10030286
1837 Ga0207693_10034942
1838 Ga0207693_10085946
1839 Ga0207693_10120482
1840 Ga0207693_10180767
1841 Ga0207693_10233765
1842 Ga0207693_10292842
1843 Ga0207693_10508524
1844 Ga0207693_10621786
1845 Ga0207693_10945831
1846 Ga0207663_10004785
1847 Ga0207663_10051418
1848 Ga0207663_10063787
1849 Ga0207663_10151381
1850 Ga0207663_10237347
1851 Ga0207663_10567864
1852 Ga0207660_10004532
1853 Ga0207660_10663804
1854 Ga0207662_10014007
1855 Ga0207662_10017728
1856 Ga0207657_10004381
1857 Ga0207657_10036983
1858 Ga0207657_10069293
1859 Ga0207657_10675663
1860 Ga0207649_10178121
1861 Ga0207649_10191308
1862 Ga0207652_10003618
1863 Ga0207646_10198023
1864 Ga0207646_10198981
1865 Ga0207681_10007624
1866 Ga0207681_10175659
1867 Ga0207681_10213408
1868 Ga0207694_10003238
1869 Ga0207694_10780990
1870 Ga0207650_10001195
1871 Ga0207650_10013619
1872 Ga0207650_10169442
1873 Ga0207650_10190306
1874 Ga0207650_10593614
1875 Ga0207659_10249040
1876 Ga0207687_10062420
1877 Ga0207687_10831660
1878 Ga0207687_11365178
1879 Ga0207700_10026809
1880 Ga0207700_10345939
1881 Ga0207700_10983258
1882 Ga0207664_10024627
1883 Ga0207664_10441771
1884 Ga0207644_10022011
1885 Ga0207644_10178552
1886 Ga0207644_10226873
1887 Ga0207644_10283467
1888 Ga0207690_10065867
1889 Ga0207690_10705881
1890 Ga0207706_10076887
1891 Ga0207706_10119598
1892 Ga0207706_10531843
1893 Ga0207706_10623253
1894 Ga0207686_10232881
1895 Ga0207709_10022083
1896 Ga0207709_10544259
1897 Ga0207670_10413162
1898 Ga0207670_10425935
1899 Ga0207670_10489342
1900 Ga0207670_10700745
1901 Ga0207670_10835718
1902 Ga0207669_10056133
1903 Ga0207669_10476910
1904 Ga0207704_10063702
1905 Ga0207704_10149158
1906 Ga0207704_10824598
1907 Ga0207665_10009542
1908 Ga0207665_10039736
1909 Ga0207665_10188233
1910 Ga0207665_10592937
1911 Ga0207665_10661252
1912 Ga0207691_10002321
1913 Ga0207691_10011266
1914 Ga0207691_10172248
1915 Ga0207711_10017593
1916 Ga0207711_10305949
1917 Ga0207689_10000511
1918 Ga0207689_10009592
1919 Ga0207689_10038634
1920 Ga0207689_10190614
1921 Ga0207661_10072511
1922 Ga0207679_10047332
1923 Ga0207679_10100451
1924 Ga0207679_10466481
1925 Ga0207679_10530951
1926 Ga0207667_10015629
1927 Ga0207667_10281825
1928 Ga0207667_10460861
1929 Ga0207651_10008796
1930 Ga0207651_10017323
1931 Ga0207651_10175480
1932 Ga0207651_10892392
1933 Ga0207712_10022589
1934 Ga0207712_10378651
1935 Ga0207712_10604166
1936 Ga0207712_10666191
1937 Ga0207668_10007890
1938 Ga0207668_10212425
1939 Ga0207668_10310685
1940 Ga0207668_10580041
1941 Ga0207668_10823542
1942 Ga0207640_10038084
1943 Ga0207640_10169258
1944 Ga0207640_10260793
1945 Ga0207658_10015147
1946 Ga0207658_10060174
1947 Ga0207658_10078642
1948 Ga0207677_10037867
1949 Ga0207677_10354101
1950 Ga0207703_10002914
1951 Ga0207703_10203379
1952 Ga0207703_10412499
1953 Ga0207639_10063661
1954 Ga0207639_10143231
1955 Ga0207639_10198498
1956 Ga0207639_10291491
1957 Ga0207678_10024563
1958 Ga0207678_10033043
1959 Ga0207678_10297036
1960 Ga0207708_10010832
1961 Ga0207708_10101827
1962 Ga0207708_10109310
1963 Ga0207708_10261226
1964 Ga0207708_10278420
1965 Ga0207641_10049540
1966 Ga0207641_10052355
1967 Ga0207641_10354075
1968 Ga0207641_10597561
1969 Ga0207641_10631216
1970 Ga0207641_11101407
1971 Ga0207648_10005903
1972 Ga0207648_10013548
1973 Ga0207648_10014418
1974 Ga0207648_10253715
1975 Ga0207676_10005423
1976 Ga0207676_10108001
1977 Ga0207676_10139263
1978 Ga0207676_10328445
1979 Ga0207676_11607346
1980 Ga0207674_10009642
1981 Ga0207674_10099879
1982 Ga0207675_100010832
1983 Ga0207675_100033567
1984 Ga0207675_100411214
1985 Ga0207675_100618115
1986 Ga0207675_100890928
1987 Ga0207683_10002719
1988 Ga0207683_10014637
1989 Ga0207683_10076982
1990 Ga0207698_10119716
1991 Ga0207698_10601186
1992 Ga0209179_1030770
1993 Ga0209179_1033805
1994 Ga0209588_1066604
1995 Ga0209813_10076059
1996 Ga0209813_10135208
1997 Ga0207428_10135494
1998 Ga0268266_10083019
1999 Ga0268266_11279428
2000 Ga0268265_10040724
2001 Ga0268265_10252635
2002 Ga0268265_10542681
2003 Ga0268265_10644266
2004 Ga0268264_10000516
2005 Ga0268264_10032596
2006 Ga0268264_10035367
2007 Ga0268264_10072722
2008 Ga0268264_10771292
2009 Ga0307517_10000756
2010 Ga0265338_10031759
2011 Ga0265762_1018429
2012 Ga0265760_10085825
2013 Ga0265328_10026878
2014 Ga0265331_10326921
2015 Ga0265327_10210421
2016 Ga0307513_10030823
2017 Ga0307513_10143003
2018 Ga0307513_10229689
2019 Ga0307513_10276041
2020 Ga0307408_100849158
2021 Ga0307508_10168012
2022 Ga0307508_10467356
2023 Ga0265314_10096294
2024 Ga0307413_10068588
2025 Ga0307413_10233288
2026 Ga0307410_10253626
2027 Ga0307407_10132864
2028 Ga0307412_10192406
2029 Ga0307412_11595115
2030 Ga0307416_100098691
2031 Ga0307416_100556914
2032 Ga0307416_101889596
2033 Ga0307411_10386845
2034 Ga0307415_100639735
2035 Ga0307510_10058232
2036 Ga0307510_10128026
2037 Ga0307510_10386390
2038 Ga0315911_1000001
2039 Ga0373930_0059673
2040 Ga0373944_0067918
2041 Ga0373936_0038943
2042 Ga0373945_0013092
2043 Ga0373945_0023578
2044 Ga0373953_0022972
2045 Ga0373954_0005853
2046 Ga0373954_0137927
2047 Ga0373957_0074045
2048 Ga0373943_0070457
2049 Ga0373943_0159891
2050 Ga0373946_0014144
2051 Ga0373946_0047289
2052 Ga0373946_0152070
2053 Ga0373955_0003076
2054 Ga0373955_0016314
2055 Ga0373955_0465597
2056 Ga0373924_0001977
2057 Ga0373924_0127582
2058 Ga0373935_0006113
2059 Ga0373935_0065002
2060 Ga0373935_0128808
2061 Ga0373927_0000846
2062 Ga0373927_0009739
2063 Ga0373927_0365249
2064 Ga0373933_0002161
2065 Ga0373933_0017656
2066 Ga0373933_0451497
2067 Ga0373947_0005350
2068 Ga0373947_0033933
2069 Ga0373947_0038824
2070 Ga0373947_0083714
2071 Ga0373937_0003460
2072 Ga0373937_0003993
2073 Ga0373937_0445375
2074 Ga0373937_1649970
2075 Ga0373925_0015990
2076 Ga0373925_0693438
2077 Ga0373925_0803821
2078 Ga0373925_1476401
2079 Ga0395900_0385009
2080 Ga0395905_0002789
2081 Ga0395905_0043073
2082 Ga0436364_0307728
2083 Ga0395901_0279363
2084 Ga0436365_0898343
2085 Ga0436365_1732414
2086 Ga0436365_1914442
2087 Ga0436360_0151016
2088 Ga0436360_0339856
2089 Ga0436360_0425837
2090 Ga0436360_0655998
2091 Ga0436360_0907988
2092 Ga0436360_0959728
2093 Ga0436361_0589872
2094 Ga0436361_0967243
2095 Ga0436361_1191117
2096 Ga0436363_1149166
2097 Ga0436363_1442007
2098 Ga0436362_0621602
2099 Ga0436362_1045468
2100 Ga0439453_0004683
2101 Ga0439453_0005443
2102 Ga0451787_087658
2103 Ga0451791_1037644
2104 Ga0451839_0205217
2105 Ga0451841_1383515
2106 Ga0451845_0400515
2107 Ga0451849_0299809
2108 Ga0451843_0790480
2109 Ga0451853_1229626
2110 Ga0451853_1714423
2111 Ga0439443_003570
2112 Ga0453683_1043675
2113 Ga0466961_0000013
2114 Ga0466959_0001999
2115 Ga0495592_0003739
2116 Ga0495592_0015800
2117 Ga0495592_0017868
2118 Ga0495592_0064792
2119 Ga0495592_0200757
2120 Ga0495603_0067477
2121 Ga0495629_0004974
2122 Ga0495629_0008770
2123 Ga0495629_0016858
2124 Ga0495629_0045929
2125 Ga0495629_0210289
2126 Ga0495638_0028165
2127 Ga0495638_0056755
2128 Ga0495638_0130311
2129 Ga0495638_0276654
2130 Ga0495651_0000388
2131 Ga0495651_0001355
2132 Ga0495651_0003038
2133 Ga0495651_0060685
2134 Ga0495651_0514665
2135 Ga0495653_0001875
2136 Ga0495653_0006734
2137 Ga0495653_0068698
2138 Ga0495653_0075033
2139 Ga0495653_0421232
2140 Ga0495653_0480157
2141 Ga0495580_0027946
2142 Ga0495582_0020023
2143 Ga0495605_0269913
2144 Ga0495662_0024618
2145 Ga0495662_0122353
2146 Ga0495662_0167793
2147 Ga0495664_0000251
2148 Ga0495664_0008800
2149 Ga0495664_0027617
2150 Ga0495664_0028207
2151 Ga0495664_0202521
2152 Ga0495664_0500785
2153 Ga0495584_0254576
2154 Ga0495594_0043884
2155 Ga0495596_0165367
2156 Ga0495607_0152022
2157 Ga0495583_0100244
2158 Ga0495583_0109054
2159 Ga0495606_0116729
2160 Ga0495608_0006933
2161 Ga0495608_0007405
2162 Ga0495608_0195790
2163 Ga0495616_0332524
2164 Ga0495618_0000361
2165 Ga0495618_0003656
2166 Ga0495618_0009095
2167 Ga0495618_0056614
2168 Ga0495618_0331114
2169 Ga0495628_0007839
2170 Ga0495628_0014066
2171 Ga0495628_0025697
2172 Ga0495628_0129467
2173 Ga0495630_0001646
2174 Ga0495630_0040493
2175 Ga0495630_0110011
2176 Ga0495630_0256612
2177 Ga0495630_0685479
2178 Ga0495637_0192457
2179 Ga0495643_0112016
2180 Ga0495644_0064557
2181 Ga0495648_0011260
2182 Ga0495648_0317017
2183 Ga0495663_0010487
2184 Ga0495666_0100111
2185 Ga0495666_0109848
2186 Ga0495652_0000305
2187 Ga0495652_0004698
2188 Ga0495652_0009607
2189 Ga0495652_0113328
2190 Ga0495652_0139888
2191 Ga0495652_0195161
2192 Ga0495652_0223649
2193 Ga0495654_0316509
2194 Ga0495665_0047578
2195 Ga0495665_0197332
2196 Ga0495640_0002641
2197 Ga0495640_0003422
2198 Ga0495640_0005010
2199 Ga0495640_0016478
2200 Ga0495640_0068308
2201 Ga0495640_0084426
2202 Ga0495640_0158847
2203 Ga0495586_0374428
2204 Ga0495587_0002053
2205 Ga0495587_0007562
2206 Ga0495587_0165561
2207 Ga0495587_0292784
2208 Ga0495587_0393443
2209 Ga0495598_0000465
2210 Ga0495609_0149517
2211 Ga0495621_0097163
2212 Ga0495645_0026414
2213 Ga0495645_0046209
2214 Ga0495645_0070547
2215 Ga0495645_0316299
2216 Ga0495667_0001027
2217 Ga0495667_0004922
2218 Ga0495667_0008793
2219 Ga0495667_0221116
2220 Ga0495656_0098823
2221 Ga0495656_0139490
2222 Ga0495668_0130135
2223 Ga0495668_0352817
2224 Ga0495634_0004976
2225 Ga0495634_0020014
2226 Ga0495634_0027596
2227 Ga0495634_0061174
2228 Ga0495611_0175780
2229 Ga0495625_0124901
2230 Ga0495625_0142531
2231 Ga0495635_0000460
2232 Ga0495635_0007644
2233 Ga0495635_0176779
2234 Ga0495661_0184077
2235 Ga0495588_0436713
2236 Ga0495657_0007216
2237 Ga0495657_0074386
2238 Ga0495599_0003539
2239 Ga0495599_0133072
2240 Ga0495599_0138445
2241 Ga0495623_0011498
2242 Ga0495623_0012706
2243 Ga0495623_0020222
2244 Ga0495623_0244789
2245 Ga0495646_0009087
2246 Ga0495646_0012319
2247 Ga0495646_0049064
2248 Ga0495647_0314091
2249 Ga0495669_0241731
2250 Ga0495613_0189067
2251 Ga0495613_0248938
2252 Ga0495613_0314421
2253 Ga0495624_0005656
2254 Ga0495624_0014567
2255 Ga0495624_0095765
2256 Ga0495624_0154929
2257 Ga0495624_0566437
2258 Ga0495649_0007168
2259 Ga0495649_0019646
2260 Ga0495649_0185831
2261 Ga0495600_0003047
2262 Ga0495600_0004031
2263 Ga0495600_0008598
2264 Ga0495600_0120340
2265 Ga0495600_0316783
2266 Ga0495600_0465360
2267 Ga0495581_0098240
2268 Ga0495581_0245020
2269 Ga0495604_0001295
2270 Ga0495604_0001387
2271 Ga0495604_0147248
2272 Ga0495604_0216024
2273 Ga0495604_0241355
2274 Ga0495604_0315272
2275 Ga0495604_0405751
2276 Ga0495674_0002293
2277 Ga0495674_0002966
2278 Ga0495674_0004127
2279 Ga0495674_0021408
2280 Ga0495674_0061289
2281 Ga0495674_0175853
2282 Ga0495674_0314059
2283 Ga0495674_0470568
2284 Ga0495674_0546855
2285 Ga0495674_1017086
2286 Ga0495672_0012209
2287 Ga0495672_0037971
2288 Ga0495672_0040067
2289 Ga0495672_0190730
2290 Ga0495676_0204951
2291 Ga0495676_0307269
2292 Ga0495676_0326976
2293 Ga0495680_0000268
2294 Ga0495680_0001841
2295 Ga0495680_0003453
2296 Ga0495680_0223044
2297 Ga0495687_221560
2298 Ga0495675_0009509
2299 Ga0495675_0023964
2300 Ga0495675_0055066
2301 Ga0495684_0000743
2302 Ga0495684_0002783
2303 Ga0495684_0128700
2304 Ga0495686_0183953
2305 Ga0495602_0002962
2306 Ga0495602_0003556
2307 Ga0495602_0004414
2308 Ga0495602_0042632
2309 Ga0496100_0048746
2310 Ga0496100_0130535
2311 Ga0496100_0176170
2312 Ga0496100_0290578
2313 Ga0496100_0761252
2314 Ga0496101_0006282
2315 Ga0496101_0030696
2316 Ga0496101_0049010
2317 Ga0496101_0153374
2318 Ga0496101_0359680
2319 Ga0496101_0536169
2320 Ga0496101_0648165
2321 Ga0496101_0847207
2322 Ga0496102_0017651
2323 Ga0496102_0033585
2324 Ga0496102_0125512
2325 Ga0496102_0279925
2326 Ga0496102_0409660
2327 Ga0496102_0599682
2328 Ga0496102_0995949
2329 Ga0496102_1126349
2330 Ga0496103_0016157
2331 Ga0496103_0102970
2332 Ga0496104_0000470
2333 Ga0496104_0000856
2334 Ga0496104_0009659
2335 Ga0496104_0019599
2336 Ga0496104_0059142
2337 Ga0496104_0059926
2338 Ga0496104_0073552
2339 Ga0496104_0136707
2340 Ga0496104_0183524
2341 Ga0496104_0440740
2342 Ga0496104_0775251
2343 Ga0496104_1119140
2344 Ga0496105_0015306
2345 Ga0496105_0094510
2346 Ga0496105_0109480
2347 Ga0496105_0180257
2348 Ga0496105_0308316
2349 Ga0496105_0392621
2350 Ga0496106_0049424
2351 Ga0496106_0056473
2352 Ga0496106_0127794
2353 Ga0496106_0223158
2354 Ga0496106_0335320
2355 Ga0496106_0358948
2356 Ga0496106_0456003
2357 Ga0496106_0569484
2358 Ga0496107_0028389
2359 Ga0496107_0050667
2360 Ga0496107_0131576
2361 Ga0496107_0207381
2362 Ga0496107_0291552
2363 Ga0496107_0400874
2364 Ga0496107_0676176
2365 Ga0496108_0001364
2366 Ga0496108_0003447
2367 Ga0496108_0054765
2368 Ga0496108_0085637
2369 Ga0496108_0120782
2370 Ga0496108_0151651
2371 Ga0496108_0565719
2372 Ga0496109_0037040
2373 Ga0496109_0042895
2374 Ga0496109_0102575
2375 Ga0496109_0136786
2376 Ga0496109_0214268
2377 Ga0496109_0217730
2378 Ga0496109_0256703
2379 Ga0496109_0343757
2380 Ga0496109_0431591
2381 Ga0496109_1354307
2382 Ga0496110_0022476
2383 Ga0496110_0031826
2384 Ga0496110_0045436
2385 Ga0496110_0064960
2386 Ga0496110_0067284
2387 Ga0496110_0212083
2388 Ga0496110_0216983
2389 Ga0496110_0376636
2390 Ga0496110_0377574
2391 Ga0496110_0399175
2392 Ga0496110_0873347
2393 Ga0496111_0012536
2394 Ga0496111_0022993
2395 Ga0496111_0046387
2396 Ga0496111_0052124
2397 Ga0496111_0088563
2398 Ga0496111_0138737
2399 Ga0496111_0235605
2400 Ga0496112_0010403
2401 Ga0496112_0022738
2402 Ga0496112_0054399
2403 Ga0496112_0080012
2404 Ga0496112_0104002
2405 Ga0496112_0112550
2406 Ga0496112_0154464
2407 Ga0496112_0166879
2408 Ga0496112_0176004
2409 Ga0496112_0600521
2410 Ga0496112_0790490
2411 Ga0496112_1173859
2412 Ga0496113_0029512
2413 Ga0496113_0040410
2414 Ga0496113_0100862
2415 Ga0496113_0113094
2416 Ga0496113_0375416
2417 Ga0496114_0031337
2418 Ga0496114_0598852
2419 Ga0496114_0758060
2420 Ga0496114_1098401
2421 Ga0496114_1534111
2422 Ga0496115_0008599
2423 Ga0496115_0118359
2424 Ga0496115_0127894
2425 Ga0496115_0131226
2426 Ga0496115_0170721
2427 Ga0496115_0246433
2428 Ga0496115_0427299
2429 Ga0496118_0028589
2430 Ga0496119_0088591
2431 Ga0496119_0299075
2432 Ga0496120_0195158
2433 Ga0496121_0002055
2434 Ga0496121_0003308
2435 Ga0496121_0013310
2436 Ga0496121_0033196
2437 Ga0496122_0412330
2438 Ga0496123_0128804
2439 Ga0496124_0184884
2440 Ga0496124_0270346
2441 Ga0496125_0000040
2442 Ga0496125_0001260
2443 Ga0496126_0022355
2444 Ga0496126_0043051
2445 Ga0496126_0061151
2446 Ga0496126_0103658
2447 Ga0496126_0113724
2448 Ga0496126_0142801
2449 Ga0496126_0170639
2450 Ga0496126_0267306
2451 Ga0496126_0393029
2452 Ga0495682_0053027
2453 Ga0495682_0180207
2454 Ga0501031_0796513
2455 Ga0501034_0646741
2456 Ga0501036_0227619
2457 Ga0501036_0273463
2458 Ga0501037_0273461
2459 Ga0501038_0566167
2460 Ga0501039_0192029
2461 Ga0501040_0050034
2462 Ga0501042_0764626
2463 Ga0501042_0787081
2464 Ga0501043_0122676
2465 Ga0501047_0029908
2466 Ga0501048_0034948
2467 Ga0501070_0204586
2468 Ga0501070_0533218
2469 Ga0501071_0119417
2470 Ga0501072_0573210
2471 Ga0501075_0212642
2472 Ga0501079_0117112
2473 nmdc:mga03683_157029_c1
2474 nmdc:mga03683_223424_c1
2475 nmdc:mga03683_253151_c1
2476 nmdc:mga03683_324386_c1
2477 nmdc:mga03683_35016_c1
2478 nmdc:mga03683_7114_c1
2479 nmdc:mga03683_81740_c1
2480 nmdc:mga03n38_1609_c1
2481 nmdc:mga03n38_266221_c1
2482 nmdc:mga03n38_7733_c1
2483 nmdc:mga00v17_13272_c1
2484 nmdc:mga00v17_135923_c1
2485 nmdc:mga00v17_193094_c1
2486 nmdc:mga0yw44_156703_c1
2487 nmdc:mga0yw44_188467_c1
2488 nmdc:mga0yw44_379657_c1
2489 nmdc:mga0yw44_6751_c1
2490 nmdc:mga0yw44_8490_c1
2491 nmdc:mga0yw44_8572_c1
2492 nmdc:mga0yw44_860107_c1
2493 nmdc:mga0k408_18250_c1
2494 nmdc:mga0k408_249706_c1
2495 nmdc:mga0k408_348130_c1
2496 nmdc:mga06z11_100518_c1
2497 nmdc:mga06z11_195865_c1
2498 nmdc:mga06z11_304756_c1
2499 nmdc:mga06z11_430492_c1
2500 nmdc:mga06z11_48176_c1
2501 nmdc:mga06z11_786_c1
2502 nmdc:mga04h51_314490_c1
2503 nmdc:mga04h51_329386_c1
2504 nmdc:mga04h51_53488_c1
2505 nmdc:mga04h51_57128_c1
2506 nmdc:mga07m45_67209_c1
2507 nmdc:mga07m45_81556_c1
2508 nmdc:mga05p37_1213020_c1
2509 nmdc:mga05p37_29258_c1
2510 nmdc:mga05p37_417525_c1
2511 nmdc:mga05p37_51939_c1
2512 nmdc:mga05p37_571590_c1
2513 nmdc:mga05p37_790884_c1
2514 nmdc:mga05p37_79117_c1
2515 nmdc:mga05p37_927129_c1
2516 nmdc:mga09592_142688_c1
2517 nmdc:mga09592_425704_c1
2518 nmdc:mga0qj67_198098_c1
2519 nmdc:mga0qj67_29082_c1
2520 nmdc:mga0qj67_34_c1
2521 nmdc:mga0qj67_39195_c1
2522 nmdc:mga06r32_306074_c1
2523 nmdc:mga06r32_310369_c1
2524 nmdc:mga06r32_331528_c1
2525 nmdc:mga08y16_263565_c1
2526 nmdc:mga08y16_42072_c1
2527 nmdc:mga08y16_753794_c1
2528 nmdc:mga0n895_13881_c1
2529 nmdc:mga0n895_252750_c1
2530 nmdc:mga0n895_297857_c1
2531 nmdc:mga0n895_481906_c1
2532 nmdc:mga0rr50_1092058_c1
2533 nmdc:mga0rr50_373181_c1
2534 nmdc:mga0rr50_686918_c1
2535 nmdc:mga08x19_182448_c1
2536 nmdc:mga0a205_1156414_c1
2537 nmdc:mga0a205_1201764_c1
2538 nmdc:mga0sz30_79362_c1
2539 nmdc:mga0sz30_86473_c1
2540 Ga0495601_0001528
2541 Ga0495601_0002673
2542 Ga0495601_0012304
2543 Ga0495601_0034167
2544 Ga0495601_0040805
2545 Ga0495601_0138091
2546 Ga0495601_0142277
2547 Ga0495601_0294758
2548 Ga0495612_0000102
2549 Ga0495612_0001567
2550 Ga0495612_0005512
2551 Ga0495612_0044821
2552 Ga0495612_0070814
2553 Ga0495612_0257060
2554 Ga0495612_0260995
2555 Ga0500635_0043726
2556 Ga0495655_0018367
2557 Ga0495655_0043358
2558 Ga0495595_0000640
2559 Ga0495595_0001740
2560 Ga0495595_0073957
2561 Ga0495619_0000738
2562 Ga0495619_0001034
2563 Ga0495619_0013423
2564 Ga0495619_0016844
2565 Ga0495619_0022264
2566 Ga0495619_0038953
2567 Ga0495619_0123450
2568 Ga0500578_0403758
2569 Ga0500643_000342
2570 Ga0500647_0029202
2571 Ga0500583_0317492
2572 Ga0500651_0076085
2573 Ga0500566_0000082
2574 Ga0500566_0020503
2575 Ga0500566_0124191
2576 Ga0500640_226624
2577 Ga0500641_0046616
2578 Ga0500641_0140717
2579 Ga0500554_005055
2580 Ga0500556_0009055
2581 Ga0500556_0013712
2582 Ga0500557_000015
2583 Ga0500562_122961
2584 Ga0500569_065983
2585 Ga0500569_113876
2586 Ga0500595_000467
2587 Ga0500595_000720
2588 Ga0500595_001239
2589 Ga0500595_005562
2590 Ga0500595_015274
2591 Ga0500595_051667
2592 Ga0500597_139838
2593 Ga0500608_070996
2594 Ga0500614_010843
2595 Ga0500642_0000341
2596 Ga0500642_0000996
2597 Ga0500642_0144249
2598 Ga0500642_0190379
2599 Ga0500655_011866
2600 Ga0500658_0528593
2601 Ga0500559_0015682
2602 Ga0500568_0060590
2603 Ga0500577_0000512
2604 Ga0500577_0032324
2605 Ga0500588_0235738
2606 Ga0500588_0416414
2607 Ga0500589_070910
2608 Ga0500589_091235
2609 Ga0500603_010963
2610 Ga0500604_0093286
2611 Ga0500616_0008774
2612 Ga0500616_0018971
2613 Ga0500616_0202129
2614 Ga0500622_0006716
2615 Ga0500622_0167764
2616 Ga0500627_0047324
2617 Ga0500633_0081618
2618 Ga0500634_0132618
2619 Ga0500638_022465
2620 Ga0500638_099126
2621 Ga0500638_103533
2622 Ga0500638_296815
2623 Ga0500636_0000137
2624 Ga0500636_0003886
2625 Ga0500636_0117627
2626 Ga0500636_0199002
2627 Ga0500637_0001104
2628 Ga0500625_004283
2629 Ga0500645_010811
2630 Ga0500609_004143
2631 Ga0500599_005672
2632 Ga0500601_000032
2633 Ga0500601_003066
2634 Ga0500661_000043
2635 Ga0501082_0133991
2636 Ga0501082_1242146
2637 Ga0530510_0248114
2638 2507508561
2639 2508542636
2640 2508691591
2641 2513638957
2642 2513654753
2643 2513674479
2644 2513722340
2645 2513855826
2646 2513915067
2647 2515629880
2648 2517892364
2649 2524443144
2650 2524538547
2651 2644730455
2652 2723847502
2653 2745076628
2654 2793081416
2655 2874598070
2656 2874627806
2657 2874647484
2658 2876766826
2659 2876778452
2660 2876817074
2661 2876820398
2662 2879082246
2663 2879117541
2664 2879135393
2665 2879150601
2666 2885373180
2667 2885380550
2668 2885387413
2669 2903749323
2670 2903768458
2671 2904672874
2672 2904695844
2673 2904703475
2674 2906618661
2675 2906633289
2676 2906638900
2677 2906666343
2678 2908742662
2679 2908761145
2680 2919451109
2681 2922430320
2682 2932797447
2683 2932802768
2684 2935608907
2685 2935631638
2686 2935650073
2687 2935661775
2688 2935773317
2689 2935778556
2690 2935792729
2691 2935800756
2692 2935822067
2693 2935847649
2694 2935889862
2695 2935909080
2696 2935919800
2697 2935926346
2698 2935934796
2699 2935943246
2700 2935951684
2701 2935967809
2702 2935982647
2703 2935988142
2704 2936012443
2705 2936021008
2706 2936029736
2707 2936047201
2708 2936057640
2709 2941511432
2710 2941519133
2711 2941526287
2712 2941532838
2713 3005480242
2714 3005599256
2715 8001848930
2716 8006970176
2717 8006980332
2718 8006985464
2719 8016529590
2720 8016534805
2721 8016548020
2722 8016554109
2723 8016562485
2724 8016573153
2725 8016577296
2726 8016591731
2727 8016600277
2728 8016614463
2729 8016626535
2730 8016640313
2731 8019534572
2732 8019556712
2733 8019568595
2734 8019628189
2735 8019645299
2736 8019658424
2737 8019671822
2738 8019684271
2739 8019690102
2740 8056693521

MSA Aligner

Download Fasta Download Aligned Fasta

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01799

Fer2_2

[2Fe-2S] binding domain

80

159

0.94

PF00111

Fer2

2Fe-2S iron-sulfur cluster binding domain

6

70

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
4zoh-assembly1.cif.gz_C-2 crystal structure of glyceraldehyde oxidoreductase 0.814 3 163
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.8119 1 166
1n5w-assembly1.cif.gz_D crystal structure of the cu,mo-co dehydrogenase (codh); oxidized form 0.798 1 166
1rm6-assembly1.cif.gz_C structure of 4-hydroxybenzoyl-coa reductase from thauera aromatica 0.7939 2 165
7dqx-assembly1.cif.gz_F crystal structure of xanthine dehydrogenase family protein 0.7911 2 165
ID Description Score Start End Superfamily
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8533 84 163 1.10.150.120
4zohC02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8394 84 163 1.10.150.120
1sb3C02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8357 84 163 1.10.150.120
5y6qA02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8116 84 165 1.10.150.120
3hrdH02 Mainly Alpha;Orthogonal Bundle;DNA polymerase; domain 1;[2Fe-2S]-binding domain 0.8038 84 163 1.10.150.120
ID Description Score Start End GO Terms
AF-A0A537RES4-F1-model_v4 (2Fe-2S)-binding protein 0.9043 63 170 GO:0016903
GO:0046872
GO:0051537
AF-A0A2V3U944-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) 0.8967 1 170 GO:0016903
GO:0046872
GO:0051537
AF-A0A1N6LA24-F1-model_v4 deleted 0.8964 1 170
AF-A0A645GW09-F1-model_v4 [2Fe-2S]-binding domain-containing protein 0.8949 88 170 GO:0016903
GO:0046872
GO:0051537
AF-A0A4R1I3M0-F1-model_v4 Aerobic-type carbon monoxide dehydrogenase small subunit (CoxS/CutS family) 0.8944 1 170 GO:0016903
GO:0046872
GO:0051537

Map