F493403
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1370 | 416 | 2740 | 137 |
Family's Representative Sequence
| Representative Sequence | 3300005329|Ga0070683_100000914|Ga0070683_1000009148 |
| Length | 155 |
| Sequence | MARTLKSPWRGLVRSMATAAKGKKPKAMPKKNLQHFEKRLLEERKRVLKELGHYDETFGSTPQGADGDLSAYSFHMADQGTDAMEREKAFLFASQEGRFLWHIDEALRRLYRNPEQFGKCHNCGKDISFERLDALPHARYCIECKQREEDGKRQA |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 2 | 3300002076 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 | Metagenome | Rhizosphere |
| 3 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 4 | 3300004798 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) | Metatranscriptome | Unclassified |
| 5 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 6 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 7 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 8 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 9 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 10 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 14 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 17 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 19 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 21 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 23 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 24 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 25 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 26 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 27 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 34 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 37 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 67 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 68 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 69 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 70 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 71 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 72 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 73 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 74 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 75 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 76 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 77 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 78 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 79 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 80 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 81 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 82 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 83 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 84 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 85 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 86 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 91 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 92 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 93 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 94 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 95 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 96 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 97 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 98 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 99 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 100 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 102 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 129 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 131 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 133 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 134 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 135 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 136 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 137 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 138 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 139 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300027395 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027462 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027471 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027526 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027695 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 217 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 218 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300030745 | Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 | Metagenome | Rhizosphere |
| 221 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 222 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 223 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 224 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 225 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 226 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 231 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 232 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 233 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 234 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 235 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 236 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 237 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 238 | 3300034819 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 | Metagenome | Rhizosphere |
| 239 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 240 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 241 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 242 | 3300035092 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 | Metagenome | Rhizosphere |
| 243 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 246 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 247 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 248 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 252 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 253 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 254 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 255 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 256 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 257 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 258 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 259 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 260 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 261 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 262 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 263 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 264 | 3300041410 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 | Metagenome | Rhizosphere |
| 265 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 267 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 268 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 271 | 3300042134 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 | Metagenome | Rhizosphere |
| 272 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 273 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 274 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 275 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 276 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 277 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 278 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 279 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 280 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 281 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 282 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 283 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 284 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 285 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 329 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 330 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 331 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 332 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 333 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 334 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 335 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 336 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 337 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 338 | 3300049129 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300049514 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought | Metagenome | Rhizosphere |
| 340 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 341 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 342 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 343 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 346 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 347 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 348 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 350 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 351 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 352 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 353 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 355 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 356 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 357 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049649 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought | Metagenome | Rhizosphere |
| 362 | 3300049652 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought | Metagenome | Rhizosphere |
| 363 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 364 | 3300049663 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought | Metagenome | Rhizosphere |
| 365 | 3300049664 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought | Metagenome | Rhizosphere |
| 366 | 3300049667 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control | Metagenome | Rhizosphere |
| 367 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 368 | 3300049669 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049672 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought | Metagenome | Rhizosphere |
| 370 | 3300049673 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought | Metagenome | Rhizosphere |
| 371 | 3300049676 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control | Metagenome | Rhizosphere |
| 372 | 3300049677 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control | Metagenome | Rhizosphere |
| 373 | 3300049679 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought | Metagenome | Rhizosphere |
| 374 | 3300049680 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought | Metagenome | Rhizosphere |
| 375 | 3300049681 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought | Metagenome | Rhizosphere |
| 376 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 377 | 3300049688 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought | Metagenome | Rhizosphere |
| 378 | 3300049689 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought | Metagenome | Rhizosphere |
| 379 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 380 | 3300049704 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control | Metagenome | Rhizosphere |
| 381 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 382 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 383 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 384 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 385 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 386 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 387 | 3300049758 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought | Metagenome | Rhizosphere |
| 388 | 3300049759 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought | Metagenome | Rhizosphere |
| 389 | 3300049760 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control | Metagenome | Rhizosphere |
| 390 | 3300049763 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control | Metagenome | Rhizosphere |
| 391 | 3300049764 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control | Metagenome | Rhizosphere |
| 392 | 3300049765 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought | Metagenome | Rhizosphere |
| 393 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 394 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 395 | 3300049770 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control | Metagenome | Rhizosphere |
| 396 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 397 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 398 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 399 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 400 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 401 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 402 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 403 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 404 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 405 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 406 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 407 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 408 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 409 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 410 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 411 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 412 | 3300059426 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 413 | 3300059509 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 414 | 3300059510 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 415 | 3300059511 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 416 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 97.81 |
| Metatranscriptomes | 2.19 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 1.75 |
| Rhizosphere | 97.08 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.5 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0070683_100000914 | 3300005329 | Bacteria | 21921 |
| 2 | JGI24749J21850_1036818 | 3300002076 | Bacteria | 711 |
| 3 | JGI25406J46586_10059482 | 3300003203 | Bacteria | 1240 |
| 4 | Ga0058859_11508720 | 3300004798 | Bacteria | 884 |
| 5 | Ga0058863_11460199 | 3300004799 | Bacteria | 1020 |
| 6 | Ga0058863_11772184 | 3300004799 | Bacteria | 1389 |
| 7 | Ga0058863_11915949 | 3300004799 | Bacteria | 1974 |
| 8 | Ga0058861_11720212 | 3300004800 | Bacteria | 786 |
| 9 | Ga0058861_11993866 | 3300004800 | Bacteria | 1166 |
| 10 | Ga0058862_12187540 | 3300004803 | Bacteria | 859 |
| 11 | Ga0058862_12796990 | 3300004803 | Bacteria | 1848 |
| 12 | Ga0058862_12833528 | 3300004803 | Bacteria | 1103 |
| 13 | Ga0058862_12863587 | 3300004803 | Bacteria | 1608 |
| 14 | Ga0065712_10093097 | 3300005290 | Bacteria | 2306 |
| 15 | Ga0065712_10386959 | 3300005290 | Bacteria | 746 |
| 16 | Ga0065715_10105782 | 3300005293 | Bacteria | 2872 |
| 17 | Ga0065715_10211602 | 3300005293 | Unclassified | 1312 |
| 18 | Ga0065715_10843969 | 3300005293 | Unclassified | 594 |
| 19 | Ga0065707_10499732 | 3300005295 | Bacteria | 758 |
| 20 | Ga0070658_10008963 | 3300005327 | Bacteria | 8041 |
| 21 | Ga0070658_10079313 | 3300005327 | Bacteria | 2696 |
| 22 | Ga0070658_10097101 | 3300005327 | Bacteria | 2433 |
| 23 | Ga0070658_10242904 | 3300005327 | Unclassified | 1526 |
| 24 | Ga0070658_10272792 | 3300005327 | Bacteria | 1439 |
| 25 | Ga0070658_10517203 | 3300005327 | Bacteria | 1032 |
| 26 | Ga0070658_10756607 | 3300005327 | Bacteria | 844 |
| 27 | Ga0070676_10024660 | 3300005328 | Bacteria | 3391 |
| 28 | Ga0070676_10028080 | 3300005328 | Bacteria | 3194 |
| 29 | Ga0070676_10075115 | 3300005328 | Unclassified | 2037 |
| 30 | Ga0070676_10169483 | 3300005328 | Bacteria | 1411 |
| 31 | Ga0070676_10196174 | 3300005328 | Bacteria | 1321 |
| 32 | Ga0070676_10300379 | 3300005328 | Bacteria | 1088 |
| 33 | Ga0070676_10408214 | 3300005328 | Bacteria | 947 |
| 34 | Ga0070676_10656702 | 3300005328 | Bacteria | 762 |
| 35 | Ga0070683_100004028 | 3300005329 | Bacteria | 12027 |
| 36 | Ga0070683_100004580 | 3300005329 | Bacteria | 11411 |
| 37 | Ga0070683_100011985 | 3300005329 | Bacteria | 7521 |
| 38 | Ga0070683_100016824 | 3300005329 | Bacteria | 6452 |
| 39 | Ga0070683_100024969 | 3300005329 | Bacteria | 5360 |
| 40 | Ga0070683_100045674 | 3300005329 | Bacteria | 4043 |
| 41 | Ga0070683_100084391 | 3300005329 | Bacteria | 2976 |
| 42 | Ga0070683_100094410 | 3300005329 | Bacteria | 2811 |
| 43 | Ga0070683_100232236 | 3300005329 | Bacteria | 1754 |
| 44 | Ga0070683_100271521 | 3300005329 | Bacteria | 1613 |
| 45 | Ga0070683_100326625 | 3300005329 | Bacteria | 1460 |
| 46 | Ga0070683_100577685 | 3300005329 | Bacteria | 1075 |
| 47 | Ga0070683_100799696 | 3300005329 | Bacteria | 904 |
| 48 | Ga0070683_100988192 | 3300005329 | Unclassified | 808 |
| 49 | Ga0070683_101201577 | 3300005329 | Bacteria | 729 |
| 50 | Ga0070690_100015139 | 3300005330 | Bacteria | 4594 |
| 51 | Ga0070690_100040265 | 3300005330 | Bacteria | 2955 |
| 52 | Ga0070690_100534174 | 3300005330 | Bacteria | 882 |
| 53 | Ga0070690_100736596 | 3300005330 | Bacteria | 760 |
| 54 | Ga0070690_100759827 | 3300005330 | Unclassified | 749 |
| 55 | Ga0070670_100033354 | 3300005331 | Bacteria | 4434 |
| 56 | Ga0070670_100078982 | 3300005331 | Bacteria | 2827 |
| 57 | Ga0070670_100165222 | 3300005331 | Bacteria | 1919 |
| 58 | Ga0070670_100351366 | 3300005331 | Bacteria | 1295 |
| 59 | Ga0070670_100700422 | 3300005331 | Bacteria | 911 |
| 60 | Ga0070670_100779322 | 3300005331 | Unclassified | 863 |
| 61 | Ga0070670_100816618 | 3300005331 | Bacteria | 843 |
| 62 | Ga0070677_10091326 | 3300005333 | Bacteria | 1325 |
| 63 | Ga0070677_10256846 | 3300005333 | Bacteria | 870 |
| 64 | Ga0068869_100627944 | 3300005334 | Bacteria | 910 |
| 65 | Ga0068869_100895018 | 3300005334 | Bacteria | 768 |
| 66 | Ga0070666_10378477 | 3300005335 | Bacteria | 1016 |
| 67 | Ga0070680_100000010 | 3300005336 | Bacteria | 97194 |
| 68 | Ga0070680_100016417 | 3300005336 | Bacteria | 5828 |
| 69 | Ga0070680_100051986 | 3300005336 | Bacteria | 3345 |
| 70 | Ga0070680_100062216 | 3300005336 | Bacteria | 3056 |
| 71 | Ga0070680_100077514 | 3300005336 | Bacteria | 2737 |
| 72 | Ga0070680_100077788 | 3300005336 | Bacteria | 2732 |
| 73 | Ga0070680_100081540 | 3300005336 | Bacteria | 2669 |
| 74 | Ga0070680_100335218 | 3300005336 | Bacteria | 1285 |
| 75 | Ga0070680_100843550 | 3300005336 | Bacteria | 790 |
| 76 | Ga0070680_100957835 | 3300005336 | Bacteria | 739 |
| 77 | Ga0070680_101036659 | 3300005336 | Bacteria | 709 |
| 78 | Ga0070682_100020205 | 3300005337 | Unclassified | 3916 |
| 79 | Ga0070682_100122456 | 3300005337 | Bacteria | 1748 |
| 80 | Ga0070682_100132192 | 3300005337 | Bacteria | 1690 |
| 81 | Ga0070682_100216705 | 3300005337 | Bacteria | 1360 |
| 82 | Ga0070682_100456526 | 3300005337 | Bacteria | 980 |
| 83 | Ga0070682_100489176 | 3300005337 | Bacteria | 951 |
| 84 | Ga0068868_100015799 | 3300005338 | Bacteria | 5593 |
| 85 | Ga0068868_100048702 | 3300005338 | Bacteria | 3324 |
| 86 | Ga0068868_100239599 | 3300005338 | Bacteria | 1523 |
| 87 | Ga0068868_100293905 | 3300005338 | Bacteria | 1378 |
| 88 | Ga0068868_101634798 | 3300005338 | Unclassified | 606 |
| 89 | Ga0070660_100014384 | 3300005339 | Bacteria | 5697 |
| 90 | Ga0070660_100397643 | 3300005339 | Unclassified | 1139 |
| 91 | Ga0070660_100437087 | 3300005339 | Unclassified | 1084 |
| 92 | Ga0070689_100024708 | 3300005340 | Unclassified | 4507 |
| 93 | Ga0070689_100170598 | 3300005340 | Bacteria | 1763 |
| 94 | Ga0070689_100404994 | 3300005340 | Unclassified | 1154 |
| 95 | Ga0070691_10014564 | 3300005341 | Bacteria | 3609 |
| 96 | Ga0070691_10031926 | 3300005341 | Bacteria | 2472 |
| 97 | Ga0070691_10033433 | 3300005341 | Bacteria | 2420 |
| 98 | Ga0070691_10085438 | 3300005341 | Unclassified | 1550 |
| 99 | Ga0070691_10140722 | 3300005341 | Bacteria | 1229 |
| 100 | Ga0070691_10360368 | 3300005341 | Bacteria | 810 |
| 101 | Ga0070687_100004192 | 3300005343 | Bacteria | 5714 |
| 102 | Ga0070687_100041059 | 3300005343 | Bacteria | 2335 |
| 103 | Ga0070687_100062846 | 3300005343 | Bacteria | 1967 |
| 104 | Ga0070661_100008603 | 3300005344 | Bacteria | 7059 |
| 105 | Ga0070661_100013325 | 3300005344 | Bacteria | 5772 |
| 106 | Ga0070661_100078583 | 3300005344 | Bacteria | 2434 |
| 107 | Ga0070661_100137691 | 3300005344 | Bacteria | 1838 |
| 108 | Ga0070661_101888662 | 3300005344 | Bacteria | 507 |
| 109 | Ga0070692_10051290 | 3300005345 | Bacteria | 2145 |
| 110 | Ga0070692_10265842 | 3300005345 | Bacteria | 1033 |
| 111 | Ga0070692_10492311 | 3300005345 | Bacteria | 793 |
| 112 | Ga0070668_100022290 | 3300005347 | Bacteria | 4787 |
| 113 | Ga0070668_100112425 | 3300005347 | Unclassified | 2169 |
| 114 | Ga0070668_100160374 | 3300005347 | Bacteria | 1824 |
| 115 | Ga0070668_101187431 | 3300005347 | Bacteria | 691 |
| 116 | Ga0070668_101243833 | 3300005347 | Bacteria | 675 |
| 117 | Ga0070668_101819402 | 3300005347 | Unclassified | 560 |
| 118 | Ga0070669_100000431 | 3300005353 | Bacteria | 32024 |
| 119 | Ga0070669_100007862 | 3300005353 | Bacteria | 7623 |
| 120 | Ga0070669_100040274 | 3300005353 | Bacteria | 3396 |
| 121 | Ga0070669_100042955 | 3300005353 | Bacteria | 3290 |
| 122 | Ga0070669_100132355 | 3300005353 | Bacteria | 1915 |
| 123 | Ga0070669_100265810 | 3300005353 | Bacteria | 1370 |
| 124 | Ga0070669_101464147 | 3300005353 | Unclassified | 593 |
| 125 | Ga0070675_100006006 | 3300005354 | Bacteria | 9307 |
| 126 | Ga0070675_100031034 | 3300005354 | Bacteria | 4318 |
| 127 | Ga0070675_100045778 | 3300005354 | Bacteria | 3581 |
| 128 | Ga0070675_100046593 | 3300005354 | Bacteria | 3551 |
| 129 | Ga0070675_100127922 | 3300005354 | Bacteria | 2163 |
| 130 | Ga0070675_100156956 | 3300005354 | Bacteria | 1954 |
| 131 | Ga0070675_100645516 | 3300005354 | Unclassified | 962 |
| 132 | Ga0070675_101300632 | 3300005354 | Bacteria | 670 |
| 133 | Ga0070671_100145737 | 3300005355 | Bacteria | 1999 |
| 134 | Ga0070671_100206372 | 3300005355 | Bacteria | 1666 |
| 135 | Ga0070671_100378861 | 3300005355 | Bacteria | 1209 |
| 136 | Ga0070671_100685991 | 3300005355 | Bacteria | 888 |
| 137 | Ga0070674_100068016 | 3300005356 | Bacteria | 2508 |
| 138 | Ga0070674_100111523 | 3300005356 | Bacteria | 2009 |
| 139 | Ga0070674_100246574 | 3300005356 | Bacteria | 1401 |
| 140 | Ga0070674_100301803 | 3300005356 | Bacteria | 1277 |
| 141 | Ga0070674_100500303 | 3300005356 | Bacteria | 1012 |
| 142 | Ga0070674_100611255 | 3300005356 | Bacteria | 922 |
| 143 | Ga0070674_101106202 | 3300005356 | Unclassified | 700 |
| 144 | Ga0070673_100051016 | 3300005364 | Bacteria | 3237 |
| 145 | Ga0070673_100146946 | 3300005364 | Bacteria | 1993 |
| 146 | Ga0070673_100234503 | 3300005364 | Bacteria | 1593 |
| 147 | Ga0070673_100245940 | 3300005364 | Bacteria | 1557 |
| 148 | Ga0070673_100448308 | 3300005364 | Bacteria | 1160 |
| 149 | Ga0070673_101827010 | 3300005364 | Bacteria | 576 |
| 150 | Ga0070673_101957736 | 3300005364 | Unclassified | 556 |
| 151 | Ga0070688_100046871 | 3300005365 | Unclassified | 2678 |
| 152 | Ga0070688_100076527 | 3300005365 | Bacteria | 2154 |
| 153 | Ga0070688_100102832 | 3300005365 | Bacteria | 1887 |
| 154 | Ga0070688_100151422 | 3300005365 | Unclassified | 1586 |
| 155 | Ga0070659_100044995 | 3300005366 | Bacteria | 3458 |
| 156 | Ga0070659_100188505 | 3300005366 | Unclassified | 1695 |
| 157 | Ga0070659_100513955 | 3300005366 | Bacteria | 1022 |
| 158 | Ga0070659_100711727 | 3300005366 | Unclassified | 869 |
| 159 | Ga0070659_101143478 | 3300005366 | Unclassified | 687 |
| 160 | Ga0070667_100030245 | 3300005367 | Bacteria | 4516 |
| 161 | Ga0070667_100036770 | 3300005367 | Unclassified | 4105 |
| 162 | Ga0070667_100076515 | 3300005367 | Bacteria | 2858 |
| 163 | Ga0070667_100084208 | 3300005367 | Bacteria | 2725 |
| 164 | Ga0070667_100096057 | 3300005367 | Bacteria | 2556 |
| 165 | Ga0070667_100144813 | 3300005367 | Bacteria | 2083 |
| 166 | Ga0070667_100425422 | 3300005367 | Unclassified | 1211 |
| 167 | Ga0070709_10002485 | 3300005434 | Bacteria | 9984 |
| 168 | Ga0070709_10010493 | 3300005434 | Bacteria | 5134 |
| 169 | Ga0070709_10340334 | 3300005434 | Bacteria | 1106 |
| 170 | Ga0070709_10923485 | 3300005434 | Unclassified | 691 |
| 171 | Ga0070714_100004586 | 3300005435 | Bacteria | 10421 |
| 172 | Ga0070714_100049437 | 3300005435 | Bacteria | 3579 |
| 173 | Ga0070714_100167165 | 3300005435 | Unclassified | 1994 |
| 174 | Ga0070714_100370251 | 3300005435 | Unclassified | 1349 |
| 175 | Ga0070713_100000196 | 3300005436 | Bacteria | 40355 |
| 176 | Ga0070713_100015290 | 3300005436 | Bacteria | 5729 |
| 177 | Ga0070713_100066727 | 3300005436 | Bacteria | 3026 |
| 178 | Ga0070710_10027153 | 3300005437 | Bacteria | 3051 |
| 179 | Ga0070710_11354728 | 3300005437 | Bacteria | 531 |
| 180 | Ga0070701_10008088 | 3300005438 | Bacteria | 4527 |
| 181 | Ga0070701_10180897 | 3300005438 | Bacteria | 1234 |
| 182 | Ga0070711_100135598 | 3300005439 | Bacteria | 1839 |
| 183 | Ga0070711_100430570 | 3300005439 | Unclassified | 1077 |
| 184 | Ga0070705_100028775 | 3300005440 | Bacteria | 3047 |
| 185 | Ga0070700_100053030 | 3300005441 | Bacteria | 2530 |
| 186 | Ga0070700_100127439 | 3300005441 | Bacteria | 1713 |
| 187 | Ga0070700_100194942 | 3300005441 | Unclassified | 1419 |
| 188 | Ga0070700_100252388 | 3300005441 | Bacteria | 1266 |
| 189 | Ga0070700_100803035 | 3300005441 | Bacteria | 758 |
| 190 | Ga0070700_101034780 | 3300005441 | Bacteria | 677 |
| 191 | Ga0070700_101306024 | 3300005441 | Bacteria | 610 |
| 192 | Ga0070694_100070264 | 3300005444 | Bacteria | 2410 |
| 193 | Ga0070694_100137090 | 3300005444 | Bacteria | 1774 |
| 194 | Ga0070694_100168061 | 3300005444 | Bacteria | 1614 |
| 195 | Ga0070694_100197646 | 3300005444 | Bacteria | 1497 |
| 196 | Ga0070694_100314148 | 3300005444 | Bacteria | 1204 |
| 197 | Ga0070708_100000025 | 3300005445 | Bacteria | 98091 |
| 198 | Ga0070708_100014311 | 3300005445 | Bacteria | 6523 |
| 199 | Ga0070708_100550537 | 3300005445 | Bacteria | 1088 |
| 200 | Ga0070663_100103275 | 3300005455 | Bacteria | 2130 |
| 201 | Ga0070663_100129361 | 3300005455 | Bacteria | 1916 |
| 202 | Ga0070678_100076827 | 3300005456 | Unclassified | 2517 |
| 203 | Ga0070678_100188247 | 3300005456 | Bacteria | 1695 |
| 204 | Ga0070678_100650231 | 3300005456 | Bacteria | 946 |
| 205 | Ga0070678_101224314 | 3300005456 | Unclassified | 697 |
| 206 | Ga0070662_100010644 | 3300005457 | Bacteria | 6048 |
| 207 | Ga0070662_100202818 | 3300005457 | Unclassified | 1575 |
| 208 | Ga0070662_100660780 | 3300005457 | Bacteria | 882 |
| 209 | Ga0070681_10007819 | 3300005458 | Bacteria | 10456 |
| 210 | Ga0070681_10008138 | 3300005458 | Bacteria | 10264 |
| 211 | Ga0070681_10031391 | 3300005458 | Bacteria | 5333 |
| 212 | Ga0070681_10039500 | 3300005458 | Unclassified | 4730 |
| 213 | Ga0070681_10080795 | 3300005458 | Bacteria | 3207 |
| 214 | Ga0070681_10103118 | 3300005458 | Bacteria | 2797 |
| 215 | Ga0070681_10250291 | 3300005458 | Unclassified | 1685 |
| 216 | Ga0070681_10277496 | 3300005458 | Bacteria | 1587 |
| 217 | Ga0070681_10400357 | 3300005458 | Bacteria | 1284 |
| 218 | Ga0070681_10438187 | 3300005458 | Bacteria | 1219 |
| 219 | Ga0068867_100027571 | 3300005459 | Bacteria | 4084 |
| 220 | Ga0068867_100089882 | 3300005459 | Bacteria | 2329 |
| 221 | Ga0068867_100093105 | 3300005459 | Bacteria | 2290 |
| 222 | Ga0068867_100129305 | 3300005459 | Bacteria | 1961 |
| 223 | Ga0068867_100261223 | 3300005459 | Bacteria | 1412 |
| 224 | Ga0068867_100299558 | 3300005459 | Bacteria | 1325 |
| 225 | Ga0068867_100435738 | 3300005459 | Bacteria | 1113 |
| 226 | Ga0070685_10012072 | 3300005466 | Bacteria | 4531 |
| 227 | Ga0070685_10039975 | 3300005466 | Bacteria | 2667 |
| 228 | Ga0070685_10366462 | 3300005466 | Bacteria | 989 |
| 229 | Ga0070685_10381812 | 3300005466 | Bacteria | 971 |
| 230 | Ga0070685_10838654 | 3300005466 | Unclassified | 680 |
| 231 | Ga0070706_100061780 | 3300005467 | Bacteria | 3460 |
| 232 | Ga0070706_100149082 | 3300005467 | Bacteria | 2184 |
| 233 | Ga0070707_100004196 | 3300005468 | Bacteria | 13511 |
| 234 | Ga0070707_100233677 | 3300005468 | Bacteria | 1789 |
| 235 | Ga0070707_100670230 | 3300005468 | Bacteria | 1000 |
| 236 | Ga0070698_100037275 | 3300005471 | Bacteria | 5013 |
| 237 | Ga0070698_100151048 | 3300005471 | Bacteria | 2270 |
| 238 | Ga0070698_100343810 | 3300005471 | Bacteria | 1423 |
| 239 | Ga0070698_100389326 | 3300005471 | Bacteria | 1327 |
| 240 | Ga0070698_100617553 | 3300005471 | Bacteria | 1025 |
| 241 | Ga0070699_100013240 | 3300005518 | Bacteria | 7113 |
| 242 | Ga0070699_100023699 | 3300005518 | Bacteria | 5288 |
| 243 | Ga0070699_100068820 | 3300005518 | Bacteria | 3075 |
| 244 | Ga0070699_100358501 | 3300005518 | Bacteria | 1314 |
| 245 | Ga0070679_100003720 | 3300005530 | Bacteria | 13984 |
| 246 | Ga0070679_100016597 | 3300005530 | Bacteria | 7110 |
| 247 | Ga0070679_100061388 | 3300005530 | Bacteria | 3746 |
| 248 | Ga0070679_100074759 | 3300005530 | Unclassified | 3378 |
| 249 | Ga0070679_100094722 | 3300005530 | Bacteria | 2973 |
| 250 | Ga0070679_100114728 | 3300005530 | Bacteria | 2679 |
| 251 | Ga0070679_100120874 | 3300005530 | Bacteria | 2604 |
| 252 | Ga0070679_100152145 | 3300005530 | Bacteria | 2290 |
| 253 | Ga0070679_100232458 | 3300005530 | Bacteria | 1803 |
| 254 | Ga0070679_100241404 | 3300005530 | Bacteria | 1764 |
| 255 | Ga0070679_100294389 | 3300005530 | Bacteria | 1574 |
| 256 | Ga0070679_101848092 | 3300005530 | Unclassified | 552 |
| 257 | Ga0070684_100004941 | 3300005535 | Bacteria | 10176 |
| 258 | Ga0070684_100021662 | 3300005535 | Bacteria | 5354 |
| 259 | Ga0070684_100022792 | 3300005535 | Bacteria | 5229 |
| 260 | Ga0070684_100032908 | 3300005535 | Bacteria | 4423 |
| 261 | Ga0070684_100057872 | 3300005535 | Bacteria | 3386 |
| 262 | Ga0070684_100086975 | 3300005535 | Unclassified | 2775 |
| 263 | Ga0070684_100104767 | 3300005535 | Bacteria | 2530 |
| 264 | Ga0070684_100129972 | 3300005535 | Bacteria | 2271 |
| 265 | Ga0070684_100184656 | 3300005535 | Bacteria | 1896 |
| 266 | Ga0070684_100211512 | 3300005535 | Bacteria | 1768 |
| 267 | Ga0070684_100269916 | 3300005535 | Bacteria | 1557 |
| 268 | Ga0070684_100335863 | 3300005535 | Unclassified | 1389 |
| 269 | Ga0070684_100340927 | 3300005535 | Bacteria | 1378 |
| 270 | Ga0070684_101615162 | 3300005535 | Unclassified | 611 |
| 271 | Ga0070697_100032152 | 3300005536 | Bacteria | 4221 |
| 272 | Ga0070697_100073961 | 3300005536 | Unclassified | 2798 |
| 273 | Ga0068853_100155549 | 3300005539 | Bacteria | 2060 |
| 274 | Ga0068853_100234821 | 3300005539 | Bacteria | 1679 |
| 275 | Ga0068853_100284881 | 3300005539 | Bacteria | 1524 |
| 276 | Ga0068853_101452525 | 3300005539 | Unclassified | 664 |
| 277 | Ga0070672_100017769 | 3300005543 | Bacteria | 5125 |
| 278 | Ga0070672_100093488 | 3300005543 | Bacteria | 2429 |
| 279 | Ga0070672_100099391 | 3300005543 | Bacteria | 2358 |
| 280 | Ga0070672_100127755 | 3300005543 | Bacteria | 2087 |
| 281 | Ga0070672_100168226 | 3300005543 | Bacteria | 1822 |
| 282 | Ga0070672_100251410 | 3300005543 | Unclassified | 1489 |
| 283 | Ga0070672_100279578 | 3300005543 | Bacteria | 1411 |
| 284 | Ga0070672_100717978 | 3300005543 | Bacteria | 876 |
| 285 | Ga0070672_101384489 | 3300005543 | Bacteria | 629 |
| 286 | Ga0070686_100098968 | 3300005544 | Bacteria | 1967 |
| 287 | Ga0070695_100316837 | 3300005545 | Bacteria | 1158 |
| 288 | Ga0070695_100796229 | 3300005545 | Bacteria | 757 |
| 289 | Ga0070695_100862937 | 3300005545 | Bacteria | 729 |
| 290 | Ga0070696_100000569 | 3300005546 | Bacteria | 23540 |
| 291 | Ga0070696_100001843 | 3300005546 | Bacteria | 13928 |
| 292 | Ga0070696_100022547 | 3300005546 | Bacteria | 4279 |
| 293 | Ga0070696_100032961 | 3300005546 | Bacteria | 3556 |
| 294 | Ga0070696_100061706 | 3300005546 | Bacteria | 2622 |
| 295 | Ga0070696_100116243 | 3300005546 | Bacteria | 1931 |
| 296 | Ga0070693_100028201 | 3300005547 | Bacteria | 3050 |
| 297 | Ga0070693_100066254 | 3300005547 | Bacteria | 2113 |
| 298 | Ga0070693_100596771 | 3300005547 | Unclassified | 797 |
| 299 | Ga0070665_100328730 | 3300005548 | Unclassified | 1533 |
| 300 | Ga0070665_101487667 | 3300005548 | Bacteria | 686 |
| 301 | Ga0070665_101832396 | 3300005548 | Bacteria | 613 |
| 302 | Ga0070704_100002736 | 3300005549 | Bacteria | 9967 |
| 303 | Ga0070704_100019323 | 3300005549 | Bacteria | 4376 |
| 304 | Ga0070704_100025886 | 3300005549 | Bacteria | 3868 |
| 305 | Ga0070704_100190860 | 3300005549 | Bacteria | 1647 |
| 306 | Ga0068855_100010843 | 3300005563 | Bacteria | 11003 |
| 307 | Ga0068855_100067864 | 3300005563 | Bacteria | 4153 |
| 308 | Ga0068855_100099477 | 3300005563 | Bacteria | 3350 |
| 309 | Ga0068855_100237577 | 3300005563 | Unclassified | 2037 |
| 310 | Ga0068855_100599515 | 3300005563 | Bacteria | 1188 |
| 311 | Ga0068855_100746249 | 3300005563 | Bacteria | 1044 |
| 312 | Ga0068855_100861870 | 3300005563 | Bacteria | 959 |
| 313 | Ga0068855_101116712 | 3300005563 | Unclassified | 823 |
| 314 | Ga0068855_101146963 | 3300005563 | Bacteria | 810 |
| 315 | Ga0068855_101671446 | 3300005563 | Bacteria | 650 |
| 316 | Ga0070664_100001163 | 3300005564 | Bacteria | 20879 |
| 317 | Ga0070664_100032756 | 3300005564 | Bacteria | 4348 |
| 318 | Ga0070664_100042123 | 3300005564 | Bacteria | 3855 |
| 319 | Ga0070664_100053851 | 3300005564 | Unclassified | 3412 |
| 320 | Ga0070664_100058462 | 3300005564 | Bacteria | 3279 |
| 321 | Ga0070664_100091594 | 3300005564 | Bacteria | 2632 |
| 322 | Ga0070664_100117959 | 3300005564 | Bacteria | 2321 |
| 323 | Ga0070664_100236253 | 3300005564 | Bacteria | 1639 |
| 324 | Ga0070664_100521792 | 3300005564 | Bacteria | 1096 |
| 325 | Ga0070664_100591583 | 3300005564 | Bacteria | 1028 |
| 326 | Ga0070664_100633580 | 3300005564 | Bacteria | 993 |
| 327 | Ga0070664_101702702 | 3300005564 | Unclassified | 598 |
| 328 | Ga0068857_100018350 | 3300005577 | Bacteria | 6138 |
| 329 | Ga0068857_100112463 | 3300005577 | Bacteria | 2448 |
| 330 | Ga0068857_100204113 | 3300005577 | Bacteria | 1802 |
| 331 | Ga0068857_100266308 | 3300005577 | Bacteria | 1574 |
| 332 | Ga0068857_100500254 | 3300005577 | Bacteria | 1141 |
| 333 | Ga0068857_100741812 | 3300005577 | Bacteria | 935 |
| 334 | Ga0068857_101751430 | 3300005577 | Unclassified | 608 |
| 335 | Ga0068854_100009778 | 3300005578 | Bacteria | 6199 |
| 336 | Ga0068854_100023349 | 3300005578 | Bacteria | 4223 |
| 337 | Ga0068854_100025031 | 3300005578 | Bacteria | 4094 |
| 338 | Ga0068854_100346876 | 3300005578 | Bacteria | 1214 |
| 339 | Ga0068854_100537748 | 3300005578 | Bacteria | 989 |
| 340 | Ga0068854_100859417 | 3300005578 | Bacteria | 795 |
| 341 | Ga0068854_101345134 | 3300005578 | Unclassified | 644 |
| 342 | Ga0068854_101832262 | 3300005578 | Bacteria | 557 |
| 343 | Ga0068856_100141013 | 3300005614 | Unclassified | 2417 |
| 344 | Ga0068856_100271486 | 3300005614 | Bacteria | 1712 |
| 345 | Ga0068856_100485469 | 3300005614 | Bacteria | 1256 |
| 346 | Ga0068856_102134213 | 3300005614 | Bacteria | 570 |
| 347 | Ga0070702_100065010 | 3300005615 | Bacteria | 2135 |
| 348 | Ga0070702_101177249 | 3300005615 | Bacteria | 617 |
| 349 | Ga0068852_100015330 | 3300005616 | Bacteria | 5938 |
| 350 | Ga0068852_100028072 | 3300005616 | Bacteria | 4600 |
| 351 | Ga0068852_100052592 | 3300005616 | Bacteria | 3501 |
| 352 | Ga0068852_100059930 | 3300005616 | Bacteria | 3303 |
| 353 | Ga0068852_100531315 | 3300005616 | Unclassified | 1175 |
| 354 | Ga0068852_100989559 | 3300005616 | Bacteria | 859 |
| 355 | Ga0068859_100038158 | 3300005617 | Bacteria | 4820 |
| 356 | Ga0068859_100083687 | 3300005617 | Bacteria | 3234 |
| 357 | Ga0068859_100084282 | 3300005617 | Bacteria | 3223 |
| 358 | Ga0068859_100370831 | 3300005617 | Bacteria | 1527 |
| 359 | Ga0068864_100052106 | 3300005618 | Unclassified | 3527 |
| 360 | Ga0068864_100062593 | 3300005618 | Bacteria | 3224 |
| 361 | Ga0068864_100469716 | 3300005618 | Bacteria | 1206 |
| 362 | Ga0068864_101431584 | 3300005618 | Unclassified | 693 |
| 363 | Ga0068864_101731111 | 3300005618 | Unclassified | 630 |
| 364 | Ga0068866_10055185 | 3300005718 | Bacteria | 2039 |
| 365 | Ga0068866_10229586 | 3300005718 | Bacteria | 1125 |
| 366 | Ga0068866_10474794 | 3300005718 | Unclassified | 822 |
| 367 | Ga0068861_100071518 | 3300005719 | Bacteria | 2689 |
| 368 | Ga0068861_100895797 | 3300005719 | Bacteria | 840 |
| 369 | Ga0068851_10070172 | 3300005834 | Unclassified | 1811 |
| 370 | Ga0068851_10208775 | 3300005834 | Bacteria | 1093 |
| 371 | Ga0068851_10281974 | 3300005834 | Bacteria | 950 |
| 372 | Ga0068851_10458262 | 3300005834 | Unclassified | 759 |
| 373 | Ga0068870_10015290 | 3300005840 | Bacteria | 3638 |
| 374 | Ga0068870_10045962 | 3300005840 | Unclassified | 2288 |
| 375 | Ga0068863_100077222 | 3300005841 | Bacteria | 3152 |
| 376 | Ga0068863_100288446 | 3300005841 | Bacteria | 1591 |
| 377 | Ga0068863_100477226 | 3300005841 | Bacteria | 1226 |
| 378 | Ga0068863_100885579 | 3300005841 | Unclassified | 892 |
| 379 | Ga0068863_101815222 | 3300005841 | Bacteria | 620 |
| 380 | Ga0068858_100208622 | 3300005842 | Bacteria | 1849 |
| 381 | Ga0068860_100178786 | 3300005843 | Bacteria | 2051 |
| 382 | Ga0068860_100181900 | 3300005843 | Bacteria | 2032 |
| 383 | Ga0068860_100235724 | 3300005843 | Bacteria | 1779 |
| 384 | Ga0068860_100395778 | 3300005843 | Bacteria | 1366 |
| 385 | Ga0068860_101111028 | 3300005843 | Bacteria | 810 |
| 386 | Ga0068862_100000345 | 3300005844 | Bacteria | 50340 |
| 387 | Ga0068862_100112879 | 3300005844 | Unclassified | 2387 |
| 388 | Ga0068862_100151593 | 3300005844 | Bacteria | 2064 |
| 389 | Ga0081455_10089316 | 3300005937 | Bacteria | 2501 |
| 390 | Ga0081539_10000221 | 3300005985 | Bacteria | 133216 |
| 391 | Ga0070717_10001614 | 3300006028 | Bacteria | 15615 |
| 392 | Ga0070712_100050871 | 3300006175 | Bacteria | 2885 |
| 393 | Ga0070712_100055819 | 3300006175 | Bacteria | 2768 |
| 394 | Ga0097621_100101720 | 3300006237 | Bacteria | 2418 |
| 395 | Ga0097621_100689497 | 3300006237 | Unclassified | 940 |
| 396 | Ga0068871_100141038 | 3300006358 | Bacteria | 2049 |
| 397 | Ga0068871_100460887 | 3300006358 | Bacteria | 1141 |
| 398 | Ga0068871_100482611 | 3300006358 | Bacteria | 1115 |
| 399 | Ga0068871_100751601 | 3300006358 | Bacteria | 896 |
| 400 | Ga0075428_100202153 | 3300006844 | Bacteria | 2147 |
| 401 | Ga0075428_100842328 | 3300006844 | Bacteria | 974 |
| 402 | Ga0075430_100006599 | 3300006846 | Bacteria | 9779 |
| 403 | Ga0075430_100032971 | 3300006846 | Bacteria | 4396 |
| 404 | Ga0075430_100039156 | 3300006846 | Bacteria | 4015 |
| 405 | Ga0075430_100082368 | 3300006846 | Bacteria | 2696 |
| 406 | Ga0075430_100159699 | 3300006846 | Unclassified | 1876 |
| 407 | Ga0075430_100694011 | 3300006846 | Bacteria | 839 |
| 408 | Ga0075430_101157904 | 3300006846 | Bacteria | 637 |
| 409 | Ga0075431_100003201 | 3300006847 | Bacteria | 15836 |
| 410 | Ga0075431_100097822 | 3300006847 | Bacteria | 3030 |
| 411 | Ga0075431_100156632 | 3300006847 | Bacteria | 2343 |
| 412 | Ga0075431_100297065 | 3300006847 | Bacteria | 1632 |
| 413 | Ga0075431_100312989 | 3300006847 | Bacteria | 1584 |
| 414 | Ga0075431_100568716 | 3300006847 | Bacteria | 1120 |
| 415 | Ga0075431_101121870 | 3300006847 | Bacteria | 751 |
| 416 | Ga0075431_101661809 | 3300006847 | Unclassified | 596 |
| 417 | Ga0075433_10002069 | 3300006852 | Bacteria | 15164 |
| 418 | Ga0075433_10047897 | 3300006852 | Bacteria | 3717 |
| 419 | Ga0075434_100015554 | 3300006871 | Bacteria | 7302 |
| 420 | Ga0075434_100036023 | 3300006871 | Bacteria | 4893 |
| 421 | Ga0075434_100043530 | 3300006871 | Bacteria | 4453 |
| 422 | Ga0075434_100777511 | 3300006871 | Bacteria | 974 |
| 423 | Ga0075429_100003639 | 3300006880 | Bacteria | 13128 |
| 424 | Ga0075429_100048519 | 3300006880 | Bacteria | 3693 |
| 425 | Ga0075429_100206334 | 3300006880 | Unclassified | 1722 |
| 426 | Ga0075429_100261267 | 3300006880 | Bacteria | 1516 |
| 427 | Ga0075429_100524559 | 3300006880 | Bacteria | 1038 |
| 428 | Ga0075429_100577651 | 3300006880 | Bacteria | 985 |
| 429 | Ga0068865_100007652 | 3300006881 | Bacteria | 6656 |
| 430 | Ga0068865_100043303 | 3300006881 | Bacteria | 3075 |
| 431 | Ga0068865_100156493 | 3300006881 | Bacteria | 1734 |
| 432 | Ga0068865_100527710 | 3300006881 | Bacteria | 988 |
| 433 | Ga0068865_101265731 | 3300006881 | Unclassified | 655 |
| 434 | Ga0075436_100002301 | 3300006914 | Bacteria | 13163 |
| 435 | Ga0075436_100013028 | 3300006914 | Bacteria | 5701 |
| 436 | Ga0075436_100048982 | 3300006914 | Bacteria | 2915 |
| 437 | Ga0097620_100038159 | 3300006931 | Bacteria | 4820 |
| 438 | Ga0097620_100083689 | 3300006931 | Bacteria | 3234 |
| 439 | Ga0097620_100084286 | 3300006931 | Bacteria | 3223 |
| 440 | Ga0097620_100370860 | 3300006931 | Bacteria | 1527 |
| 441 | Ga0075435_100438974 | 3300007076 | Unclassified | 1125 |
| 442 | Ga0105240_10004437 | 3300009093 | Bacteria | 21401 |
| 443 | Ga0105240_10023119 | 3300009093 | Bacteria | 8230 |
| 444 | Ga0105240_10057070 | 3300009093 | Bacteria | 4882 |
| 445 | Ga0105240_10134011 | 3300009093 | Bacteria | 2968 |
| 446 | Ga0105240_10763615 | 3300009093 | Bacteria | 1050 |
| 447 | Ga0105240_10923511 | 3300009093 | Unclassified | 938 |
| 448 | Ga0105240_11664833 | 3300009093 | Bacteria | 667 |
| 449 | Ga0111539_10018859 | 3300009094 | Bacteria | 8535 |
| 450 | Ga0111539_10083002 | 3300009094 | Bacteria | 3769 |
| 451 | Ga0111539_11394404 | 3300009094 | Unclassified | 813 |
| 452 | Ga0105245_10200643 | 3300009098 | Bacteria | 1915 |
| 453 | Ga0105245_10280170 | 3300009098 | Bacteria | 1629 |
| 454 | Ga0105245_10288039 | 3300009098 | Bacteria | 1608 |
| 455 | Ga0105245_10819580 | 3300009098 | Unclassified | 969 |
| 456 | Ga0105245_11158592 | 3300009098 | Bacteria | 820 |
| 457 | Ga0105245_11181373 | 3300009098 | Bacteria | 813 |
| 458 | Ga0105245_11386390 | 3300009098 | Bacteria | 753 |
| 459 | Ga0105245_11387830 | 3300009098 | Bacteria | 752 |
| 460 | Ga0105247_10147270 | 3300009101 | Bacteria | 1549 |
| 461 | Ga0114129_10141803 | 3300009147 | Bacteria | 3293 |
| 462 | Ga0114129_10280082 | 3300009147 | Bacteria | 2228 |
| 463 | Ga0114129_11881448 | 3300009147 | Bacteria | 726 |
| 464 | Ga0105243_10205789 | 3300009148 | Bacteria | 1729 |
| 465 | Ga0105243_10942439 | 3300009148 | Bacteria | 862 |
| 466 | Ga0105243_11767242 | 3300009148 | Bacteria | 649 |
| 467 | Ga0105241_10012411 | 3300009174 | Bacteria | 6245 |
| 468 | Ga0105241_10106603 | 3300009174 | Unclassified | 2237 |
| 469 | Ga0105241_10150260 | 3300009174 | Bacteria | 1905 |
| 470 | Ga0105242_10015286 | 3300009176 | Bacteria | 5961 |
| 471 | Ga0105242_10044869 | 3300009176 | Bacteria | 3581 |
| 472 | Ga0105242_10085069 | 3300009176 | Bacteria | 2652 |
| 473 | Ga0105242_10703948 | 3300009176 | Bacteria | 989 |
| 474 | Ga0105248_10010930 | 3300009177 | Bacteria | 10015 |
| 475 | Ga0105248_10053946 | 3300009177 | Bacteria | 4509 |
| 476 | Ga0105248_10069952 | 3300009177 | Bacteria | 3941 |
| 477 | Ga0105248_10309714 | 3300009177 | Bacteria | 1778 |
| 478 | Ga0105248_10438966 | 3300009177 | Unclassified | 1470 |
| 479 | Ga0105248_10641304 | 3300009177 | Bacteria | 1198 |
| 480 | Ga0105248_10706521 | 3300009177 | Bacteria | 1137 |
| 481 | Ga0105248_10709083 | 3300009177 | Bacteria | 1135 |
| 482 | Ga0105237_10026780 | 3300009545 | Bacteria | 5892 |
| 483 | Ga0105237_10186091 | 3300009545 | Bacteria | 2077 |
| 484 | Ga0105237_10276573 | 3300009545 | Bacteria | 1681 |
| 485 | Ga0105237_11031213 | 3300009545 | Bacteria | 829 |
| 486 | Ga0105238_10060734 | 3300009551 | Bacteria | 3784 |
| 487 | Ga0105238_10141799 | 3300009551 | Unclassified | 2380 |
| 488 | Ga0105238_10573937 | 3300009551 | Bacteria | 1134 |
| 489 | Ga0105249_10000276 | 3300009553 | Bacteria | 54132 |
| 490 | Ga0105249_10025588 | 3300009553 | Bacteria | 5315 |
| 491 | Ga0105249_10135183 | 3300009553 | Bacteria | 2358 |
| 492 | Ga0105239_10321020 | 3300010375 | Bacteria | 1746 |
| 493 | Ga0105239_11323371 | 3300010375 | Bacteria | 831 |
| 494 | Ga0105239_13450511 | 3300010375 | Bacteria | 514 |
| 495 | Ga0105246_10090990 | 3300011119 | Bacteria | 2198 |
| 496 | Ga0105246_10325804 | 3300011119 | Bacteria | 1250 |
| 497 | Ga0105246_10725057 | 3300011119 | Bacteria | 874 |
| 498 | Ga0157373_10000674 | 3300013100 | Bacteria | 26717 |
| 499 | Ga0157373_10083963 | 3300013100 | Bacteria | 2245 |
| 500 | Ga0157373_10175732 | 3300013100 | Bacteria | 1507 |
| 501 | Ga0157373_10242259 | 3300013100 | Bacteria | 1275 |
| 502 | Ga0157373_10648950 | 3300013100 | Unclassified | 771 |
| 503 | Ga0157371_10007249 | 3300013102 | Bacteria | 9004 |
| 504 | Ga0157371_10086632 | 3300013102 | Bacteria | 2218 |
| 505 | Ga0157371_10174992 | 3300013102 | Bacteria | 1534 |
| 506 | Ga0157371_10489199 | 3300013102 | Bacteria | 908 |
| 507 | Ga0157371_10631511 | 3300013102 | Bacteria | 798 |
| 508 | Ga0157370_10005892 | 3300013104 | Bacteria | 13661 |
| 509 | Ga0157370_10006750 | 3300013104 | Bacteria | 12588 |
| 510 | Ga0157370_10042235 | 3300013104 | Bacteria | 4395 |
| 511 | Ga0157370_10055314 | 3300013104 | Bacteria | 3781 |
| 512 | Ga0157370_10063356 | 3300013104 | Bacteria | 3503 |
| 513 | Ga0157370_10155255 | 3300013104 | Bacteria | 2129 |
| 514 | Ga0157370_10290124 | 3300013104 | Unclassified | 1511 |
| 515 | Ga0157370_10373213 | 3300013104 | Bacteria | 1314 |
| 516 | Ga0157370_10708497 | 3300013104 | Bacteria | 919 |
| 517 | Ga0157370_11137233 | 3300013104 | Bacteria | 705 |
| 518 | Ga0157370_11598944 | 3300013104 | Bacteria | 586 |
| 519 | Ga0157369_10010955 | 3300013105 | Bacteria | 10322 |
| 520 | Ga0157369_10028668 | 3300013105 | Bacteria | 6158 |
| 521 | Ga0157369_10099704 | 3300013105 | Bacteria | 3097 |
| 522 | Ga0157369_10129696 | 3300013105 | Bacteria | 2672 |
| 523 | Ga0157369_10301239 | 3300013105 | Bacteria | 1667 |
| 524 | Ga0157369_10635063 | 3300013105 | Bacteria | 1101 |
| 525 | Ga0157369_10757009 | 3300013105 | Bacteria | 999 |
| 526 | Ga0157369_10950489 | 3300013105 | Bacteria | 881 |
| 527 | Ga0157369_11159981 | 3300013105 | Bacteria | 789 |
| 528 | Ga0157374_10015504 | 3300013296 | Bacteria | 6685 |
| 529 | Ga0157374_10133952 | 3300013296 | Unclassified | 2400 |
| 530 | Ga0157374_10216006 | 3300013296 | Bacteria | 1881 |
| 531 | Ga0157374_10249779 | 3300013296 | Bacteria | 1745 |
| 532 | Ga0157374_11283545 | 3300013296 | Bacteria | 754 |
| 533 | Ga0157378_10029108 | 3300013297 | Bacteria | 4876 |
| 534 | Ga0157378_10060345 | 3300013297 | Unclassified | 3385 |
| 535 | Ga0157378_10092357 | 3300013297 | Bacteria | 2754 |
| 536 | Ga0157378_10179396 | 3300013297 | Unclassified | 1991 |
| 537 | Ga0157378_10260006 | 3300013297 | Bacteria | 1665 |
| 538 | Ga0157378_10470850 | 3300013297 | Bacteria | 1250 |
| 539 | Ga0163162_10075611 | 3300013306 | Bacteria | 3429 |
| 540 | Ga0163162_10078881 | 3300013306 | Bacteria | 3358 |
| 541 | Ga0163162_10104238 | 3300013306 | Unclassified | 2930 |
| 542 | Ga0163162_10568651 | 3300013306 | Bacteria | 1261 |
| 543 | Ga0163162_10722095 | 3300013306 | Bacteria | 1117 |
| 544 | Ga0157372_10011736 | 3300013307 | Bacteria | 9329 |
| 545 | Ga0157372_10036892 | 3300013307 | Bacteria | 5390 |
| 546 | Ga0157372_10052954 | 3300013307 | Bacteria | 4521 |
| 547 | Ga0157372_10056818 | 3300013307 | Bacteria | 4373 |
| 548 | Ga0157372_10097004 | 3300013307 | Bacteria | 3361 |
| 549 | Ga0157372_10098929 | 3300013307 | Unclassified | 3327 |
| 550 | Ga0157372_10129228 | 3300013307 | Bacteria | 2906 |
| 551 | Ga0157372_10174213 | 3300013307 | Bacteria | 2490 |
| 552 | Ga0157372_10515700 | 3300013307 | Unclassified | 1394 |
| 553 | Ga0157372_10643682 | 3300013307 | Bacteria | 1235 |
| 554 | Ga0157372_11347820 | 3300013307 | Bacteria | 823 |
| 555 | Ga0157372_11851538 | 3300013307 | Bacteria | 694 |
| 556 | Ga0157372_12251215 | 3300013307 | Unclassified | 626 |
| 557 | Ga0157375_10015641 | 3300013308 | Bacteria | 6797 |
| 558 | Ga0157375_10033974 | 3300013308 | Bacteria | 4853 |
| 559 | Ga0157375_10034069 | 3300013308 | Bacteria | 4847 |
| 560 | Ga0157375_10052054 | 3300013308 | Bacteria | 4024 |
| 561 | Ga0157375_10078385 | 3300013308 | Bacteria | 3337 |
| 562 | Ga0157375_10080902 | 3300013308 | Bacteria | 3287 |
| 563 | Ga0157375_10242986 | 3300013308 | Bacteria | 1960 |
| 564 | Ga0157375_10366758 | 3300013308 | Bacteria | 1606 |
| 565 | Ga0157375_10512092 | 3300013308 | Bacteria | 1364 |
| 566 | Ga0163163_10215396 | 3300014325 | Unclassified | 1969 |
| 567 | Ga0163163_10811635 | 3300014325 | Bacteria | 999 |
| 568 | Ga0157380_10009657 | 3300014326 | Bacteria | 6918 |
| 569 | Ga0157380_10124883 | 3300014326 | Bacteria | 2186 |
| 570 | Ga0157380_12886611 | 3300014326 | Bacteria | 547 |
| 571 | Ga0157377_10032521 | 3300014745 | Bacteria | 2841 |
| 572 | Ga0157379_10964651 | 3300014968 | Unclassified | 811 |
| 573 | Ga0182007_10049935 | 3300015262 | Bacteria | 1381 |
| 574 | Ga0182005_1200827 | 3300015265 | Bacteria | 599 |
| 575 | Ga0163161_10102435 | 3300017792 | Unclassified | 2132 |
| 576 | Ga0163161_10225197 | 3300017792 | Bacteria | 1454 |
| 577 | Ga0163161_10404345 | 3300017792 | Bacteria | 1095 |
| 578 | Ga0163161_10589222 | 3300017792 | Bacteria | 915 |
| 579 | Ga0197907_10300930 | 3300020069 | Bacteria | 963 |
| 580 | Ga0197907_10335747 | 3300020069 | Bacteria | 1891 |
| 581 | Ga0197907_10694383 | 3300020069 | Unclassified | 916 |
| 582 | Ga0206356_11166277 | 3300020070 | Bacteria | 1166 |
| 583 | Ga0206355_1021136 | 3300020076 | Bacteria | 1109 |
| 584 | Ga0206355_1195921 | 3300020076 | Bacteria | 1307 |
| 585 | Ga0206352_10376517 | 3300020078 | Bacteria | 2212 |
| 586 | Ga0206350_10779916 | 3300020080 | Bacteria | 1093 |
| 587 | Ga0206350_10804192 | 3300020080 | Bacteria | 1320 |
| 588 | Ga0206354_10528991 | 3300020081 | Bacteria | 1950 |
| 589 | Ga0206354_11308762 | 3300020081 | Bacteria | 655 |
| 590 | Ga0206353_10548619 | 3300020082 | Bacteria | 969 |
| 591 | Ga0206353_11927621 | 3300020082 | Unclassified | 944 |
| 592 | Ga0213876_10049722 | 3300021384 | Bacteria | 2215 |
| 593 | Ga0213876_10056960 | 3300021384 | Unclassified | 2063 |
| 594 | Ga0224712_10075175 | 3300022467 | Bacteria | 1381 |
| 595 | Ga0224712_10181660 | 3300022467 | Bacteria | 948 |
| 596 | Ga0224712_10353641 | 3300022467 | Bacteria | 694 |
| 597 | Ga0207656_10011423 | 3300025321 | Bacteria | 3355 |
| 598 | Ga0207656_10176164 | 3300025321 | Bacteria | 1024 |
| 599 | Ga0207656_10292518 | 3300025321 | Unclassified | 805 |
| 600 | Ga0207682_10025320 | 3300025893 | Bacteria | 2353 |
| 601 | Ga0207682_10194326 | 3300025893 | Bacteria | 931 |
| 602 | Ga0207692_10071496 | 3300025898 | Bacteria | 1830 |
| 603 | Ga0207692_10215920 | 3300025898 | Unclassified | 1135 |
| 604 | Ga0207692_10749304 | 3300025898 | Bacteria | 636 |
| 605 | Ga0207642_10007202 | 3300025899 | Bacteria | 3744 |
| 606 | Ga0207642_10035667 | 3300025899 | Bacteria | 2127 |
| 607 | Ga0207688_10069540 | 3300025901 | Bacteria | 1995 |
| 608 | Ga0207688_10527562 | 3300025901 | Bacteria | 741 |
| 609 | Ga0207688_10911683 | 3300025901 | Bacteria | 556 |
| 610 | Ga0207680_10107631 | 3300025903 | Bacteria | 1802 |
| 611 | Ga0207680_10378155 | 3300025903 | Bacteria | 998 |
| 612 | Ga0207647_10369324 | 3300025904 | Bacteria | 811 |
| 613 | Ga0207699_10008689 | 3300025906 | Bacteria | 5024 |
| 614 | Ga0207699_10008886 | 3300025906 | Bacteria | 4979 |
| 615 | Ga0207699_10021920 | 3300025906 | Bacteria | 3452 |
| 616 | Ga0207699_10121357 | 3300025906 | Bacteria | 1691 |
| 617 | Ga0207699_10475370 | 3300025906 | Bacteria | 899 |
| 618 | Ga0207645_10037165 | 3300025907 | Bacteria | 3126 |
| 619 | Ga0207645_10083887 | 3300025907 | Bacteria | 2044 |
| 620 | Ga0207645_10095920 | 3300025907 | Unclassified | 1910 |
| 621 | Ga0207645_10171647 | 3300025907 | Bacteria | 1421 |
| 622 | Ga0207645_10183254 | 3300025907 | Bacteria | 1374 |
| 623 | Ga0207645_10283889 | 3300025907 | Bacteria | 1100 |
| 624 | Ga0207645_10703160 | 3300025907 | Bacteria | 687 |
| 625 | Ga0207643_10038892 | 3300025908 | Bacteria | 2674 |
| 626 | Ga0207643_10046398 | 3300025908 | Bacteria | 2456 |
| 627 | Ga0207643_10061108 | 3300025908 | Unclassified | 2151 |
| 628 | Ga0207705_10001964 | 3300025909 | Bacteria | 16042 |
| 629 | Ga0207705_10003814 | 3300025909 | Bacteria | 11463 |
| 630 | Ga0207705_10088802 | 3300025909 | Bacteria | 2261 |
| 631 | Ga0207705_10091858 | 3300025909 | Bacteria | 2224 |
| 632 | Ga0207705_10121294 | 3300025909 | Bacteria | 1940 |
| 633 | Ga0207705_10229631 | 3300025909 | Unclassified | 1411 |
| 634 | Ga0207705_10610855 | 3300025909 | Bacteria | 848 |
| 635 | Ga0207705_11320602 | 3300025909 | Unclassified | 550 |
| 636 | Ga0207684_10071570 | 3300025910 | Bacteria | 2946 |
| 637 | Ga0207684_10086348 | 3300025910 | Bacteria | 2672 |
| 638 | Ga0207684_10758080 | 3300025910 | Bacteria | 822 |
| 639 | Ga0207654_10047074 | 3300025911 | Bacteria | 2462 |
| 640 | Ga0207654_10138424 | 3300025911 | Bacteria | 1549 |
| 641 | Ga0207707_10001832 | 3300025912 | Bacteria | 19501 |
| 642 | Ga0207707_10003256 | 3300025912 | Bacteria | 14427 |
| 643 | Ga0207707_10007887 | 3300025912 | Bacteria | 9259 |
| 644 | Ga0207707_10012641 | 3300025912 | Bacteria | 7337 |
| 645 | Ga0207707_10025337 | 3300025912 | Bacteria | 5188 |
| 646 | Ga0207707_10048537 | 3300025912 | Bacteria | 3698 |
| 647 | Ga0207707_10077973 | 3300025912 | Bacteria | 2893 |
| 648 | Ga0207707_10113684 | 3300025912 | Unclassified | 2366 |
| 649 | Ga0207707_10129275 | 3300025912 | Bacteria | 2209 |
| 650 | Ga0207707_10339436 | 3300025912 | Bacteria | 1295 |
| 651 | Ga0207707_11170911 | 3300025912 | Bacteria | 623 |
| 652 | Ga0207695_10003486 | 3300025913 | Bacteria | 22123 |
| 653 | Ga0207695_10017609 | 3300025913 | Bacteria | 8304 |
| 654 | Ga0207695_10019830 | 3300025913 | Bacteria | 7729 |
| 655 | Ga0207695_10023027 | 3300025913 | Bacteria | 7052 |
| 656 | Ga0207695_10062168 | 3300025913 | Bacteria | 3857 |
| 657 | Ga0207695_10139100 | 3300025913 | Bacteria | 2379 |
| 658 | Ga0207695_10766503 | 3300025913 | Bacteria | 845 |
| 659 | Ga0207695_10781330 | 3300025913 | Bacteria | 835 |
| 660 | Ga0207695_10987763 | 3300025913 | Bacteria | 721 |
| 661 | Ga0207695_11680433 | 3300025913 | Bacteria | 516 |
| 662 | Ga0207671_10146011 | 3300025914 | Unclassified | 1825 |
| 663 | Ga0207671_10158570 | 3300025914 | Bacteria | 1751 |
| 664 | Ga0207671_10336824 | 3300025914 | Bacteria | 1195 |
| 665 | Ga0207693_10018764 | 3300025915 | Bacteria | 5504 |
| 666 | Ga0207693_10101397 | 3300025915 | Bacteria | 2257 |
| 667 | Ga0207693_10605541 | 3300025915 | Bacteria | 853 |
| 668 | Ga0207663_10070604 | 3300025916 | Bacteria | 2251 |
| 669 | Ga0207663_10405262 | 3300025916 | Bacteria | 1044 |
| 670 | Ga0207663_10729702 | 3300025916 | Bacteria | 786 |
| 671 | Ga0207660_10000760 | 3300025917 | Bacteria | 21451 |
| 672 | Ga0207660_10002967 | 3300025917 | Bacteria | 11095 |
| 673 | Ga0207660_10011047 | 3300025917 | Bacteria | 5873 |
| 674 | Ga0207660_10011960 | 3300025917 | Bacteria | 5666 |
| 675 | Ga0207660_10035829 | 3300025917 | Bacteria | 3447 |
| 676 | Ga0207660_10064879 | 3300025917 | Bacteria | 2637 |
| 677 | Ga0207660_10156849 | 3300025917 | Bacteria | 1753 |
| 678 | Ga0207660_10234408 | 3300025917 | Bacteria | 1444 |
| 679 | Ga0207660_10769942 | 3300025917 | Bacteria | 785 |
| 680 | Ga0207662_10001809 | 3300025918 | Bacteria | 10497 |
| 681 | Ga0207662_10050281 | 3300025918 | Unclassified | 2475 |
| 682 | Ga0207662_10061356 | 3300025918 | Unclassified | 2257 |
| 683 | Ga0207657_10014509 | 3300025919 | Bacteria | 7684 |
| 684 | Ga0207657_10023382 | 3300025919 | Bacteria | 5755 |
| 685 | Ga0207657_10054816 | 3300025919 | Bacteria | 3446 |
| 686 | Ga0207657_10059270 | 3300025919 | Bacteria | 3291 |
| 687 | Ga0207657_10268800 | 3300025919 | Bacteria | 1356 |
| 688 | Ga0207649_10036512 | 3300025920 | Bacteria | 2960 |
| 689 | Ga0207649_10040407 | 3300025920 | Bacteria | 2835 |
| 690 | Ga0207649_10050794 | 3300025920 | Bacteria | 2566 |
| 691 | Ga0207649_10071537 | 3300025920 | Bacteria | 2215 |
| 692 | Ga0207649_10098899 | 3300025920 | Bacteria | 1926 |
| 693 | Ga0207649_10100201 | 3300025920 | Bacteria | 1916 |
| 694 | Ga0207649_10180594 | 3300025920 | Bacteria | 1477 |
| 695 | Ga0207649_10194535 | 3300025920 | Bacteria | 1428 |
| 696 | Ga0207649_10631063 | 3300025920 | Bacteria | 826 |
| 697 | Ga0207649_10674465 | 3300025920 | Bacteria | 800 |
| 698 | Ga0207652_10000783 | 3300025921 | Bacteria | 30376 |
| 699 | Ga0207652_10005886 | 3300025921 | Bacteria | 9922 |
| 700 | Ga0207652_10017563 | 3300025921 | Bacteria | 5856 |
| 701 | Ga0207652_10027000 | 3300025921 | Bacteria | 4784 |
| 702 | Ga0207652_10057791 | 3300025921 | Bacteria | 3341 |
| 703 | Ga0207652_10073673 | 3300025921 | Bacteria | 2972 |
| 704 | Ga0207652_10116909 | 3300025921 | Bacteria | 2369 |
| 705 | Ga0207652_10121793 | 3300025921 | Bacteria | 2321 |
| 706 | Ga0207652_10124231 | 3300025921 | Unclassified | 2298 |
| 707 | Ga0207652_10284849 | 3300025921 | Bacteria | 1491 |
| 708 | Ga0207652_10323423 | 3300025921 | Bacteria | 1392 |
| 709 | Ga0207652_10324908 | 3300025921 | Bacteria | 1389 |
| 710 | Ga0207652_10326119 | 3300025921 | Bacteria | 1386 |
| 711 | Ga0207652_10753397 | 3300025921 | Bacteria | 867 |
| 712 | Ga0207652_11031750 | 3300025921 | Bacteria | 722 |
| 713 | Ga0207646_10007037 | 3300025922 | Bacteria | 11515 |
| 714 | Ga0207646_10074853 | 3300025922 | Bacteria | 3025 |
| 715 | Ga0207646_10082938 | 3300025922 | Bacteria | 2867 |
| 716 | Ga0207646_10734680 | 3300025922 | Bacteria | 881 |
| 717 | Ga0207681_10000718 | 3300025923 | Bacteria | 21752 |
| 718 | Ga0207681_10023163 | 3300025923 | Bacteria | 3969 |
| 719 | Ga0207681_10034751 | 3300025923 | Bacteria | 3317 |
| 720 | Ga0207681_10124693 | 3300025923 | Bacteria | 1894 |
| 721 | Ga0207681_10739357 | 3300025923 | Unclassified | 819 |
| 722 | Ga0207694_10103351 | 3300025924 | Unclassified | 2259 |
| 723 | Ga0207694_10465840 | 3300025924 | Bacteria | 1056 |
| 724 | Ga0207694_11294963 | 3300025924 | Bacteria | 616 |
| 725 | Ga0207650_10110791 | 3300025925 | Bacteria | 2125 |
| 726 | Ga0207650_10129778 | 3300025925 | Bacteria | 1971 |
| 727 | Ga0207650_10267056 | 3300025925 | Unclassified | 1390 |
| 728 | Ga0207650_10358845 | 3300025925 | Unclassified | 1200 |
| 729 | Ga0207650_10595361 | 3300025925 | Bacteria | 929 |
| 730 | Ga0207650_11872016 | 3300025925 | Unclassified | 507 |
| 731 | Ga0207659_10047504 | 3300025926 | Bacteria | 3036 |
| 732 | Ga0207659_10101691 | 3300025926 | Unclassified | 2168 |
| 733 | Ga0207659_10121102 | 3300025926 | Bacteria | 2005 |
| 734 | Ga0207659_10435082 | 3300025926 | Bacteria | 1102 |
| 735 | Ga0207659_10504512 | 3300025926 | Bacteria | 1024 |
| 736 | Ga0207687_10232707 | 3300025927 | Bacteria | 1456 |
| 737 | Ga0207687_10378203 | 3300025927 | Unclassified | 1160 |
| 738 | Ga0207687_10396303 | 3300025927 | Bacteria | 1134 |
| 739 | Ga0207687_10840111 | 3300025927 | Bacteria | 784 |
| 740 | Ga0207687_11065322 | 3300025927 | Bacteria | 694 |
| 741 | Ga0207700_10044053 | 3300025928 | Unclassified | 3282 |
| 742 | Ga0207700_10045283 | 3300025928 | Bacteria | 3245 |
| 743 | Ga0207700_10555516 | 3300025928 | Bacteria | 1019 |
| 744 | Ga0207700_11095110 | 3300025928 | Unclassified | 712 |
| 745 | Ga0207664_10027669 | 3300025929 | Bacteria | 4302 |
| 746 | Ga0207664_10041180 | 3300025929 | Bacteria | 3598 |
| 747 | Ga0207644_10043924 | 3300025931 | Bacteria | 3173 |
| 748 | Ga0207644_10081943 | 3300025931 | Bacteria | 2386 |
| 749 | Ga0207644_10113758 | 3300025931 | Unclassified | 2050 |
| 750 | Ga0207644_10175838 | 3300025931 | Bacteria | 1675 |
| 751 | Ga0207644_10308761 | 3300025931 | Bacteria | 1276 |
| 752 | Ga0207644_10586178 | 3300025931 | Bacteria | 925 |
| 753 | Ga0207690_10059298 | 3300025932 | Bacteria | 2593 |
| 754 | Ga0207690_10149559 | 3300025932 | Unclassified | 1730 |
| 755 | Ga0207690_10689105 | 3300025932 | Bacteria | 839 |
| 756 | Ga0207690_11585698 | 3300025932 | Bacteria | 547 |
| 757 | Ga0207706_10095915 | 3300025933 | Bacteria | 2608 |
| 758 | Ga0207706_10164172 | 3300025933 | Bacteria | 1952 |
| 759 | Ga0207706_10239036 | 3300025933 | Bacteria | 1588 |
| 760 | Ga0207706_10350873 | 3300025933 | Bacteria | 1283 |
| 761 | Ga0207686_10129047 | 3300025934 | Bacteria | 1732 |
| 762 | Ga0207686_10252233 | 3300025934 | Unclassified | 1290 |
| 763 | Ga0207686_10488662 | 3300025934 | Bacteria | 953 |
| 764 | Ga0207709_10064712 | 3300025935 | Bacteria | 2297 |
| 765 | Ga0207709_10538653 | 3300025935 | Bacteria | 916 |
| 766 | Ga0207709_10749054 | 3300025935 | Bacteria | 785 |
| 767 | Ga0207709_10969726 | 3300025935 | Bacteria | 694 |
| 768 | Ga0207670_10135522 | 3300025936 | Unclassified | 1809 |
| 769 | Ga0207670_10352296 | 3300025936 | Bacteria | 1166 |
| 770 | Ga0207669_10070059 | 3300025937 | Bacteria | 2197 |
| 771 | Ga0207669_10145491 | 3300025937 | Bacteria | 1652 |
| 772 | Ga0207669_10161058 | 3300025937 | Bacteria | 1585 |
| 773 | Ga0207669_10222289 | 3300025937 | Bacteria | 1387 |
| 774 | Ga0207704_10004959 | 3300025938 | Bacteria | 6121 |
| 775 | Ga0207704_10019528 | 3300025938 | Bacteria | 3561 |
| 776 | Ga0207704_10135374 | 3300025938 | Bacteria | 1714 |
| 777 | Ga0207704_10376165 | 3300025938 | Bacteria | 1114 |
| 778 | Ga0207704_10602622 | 3300025938 | Bacteria | 899 |
| 779 | Ga0207704_10696265 | 3300025938 | Bacteria | 841 |
| 780 | Ga0207704_11653214 | 3300025938 | Bacteria | 550 |
| 781 | Ga0207665_10047452 | 3300025939 | Bacteria | 2880 |
| 782 | Ga0207665_10259743 | 3300025939 | Bacteria | 1286 |
| 783 | Ga0207665_10932919 | 3300025939 | Bacteria | 689 |
| 784 | Ga0207691_10006396 | 3300025940 | Bacteria | 11377 |
| 785 | Ga0207691_10008070 | 3300025940 | Bacteria | 10115 |
| 786 | Ga0207691_10034694 | 3300025940 | Bacteria | 4690 |
| 787 | Ga0207691_10038379 | 3300025940 | Bacteria | 4433 |
| 788 | Ga0207691_10215428 | 3300025940 | Bacteria | 1667 |
| 789 | Ga0207691_10281956 | 3300025940 | Bacteria | 1429 |
| 790 | Ga0207691_10492285 | 3300025940 | Bacteria | 1041 |
| 791 | Ga0207711_10293681 | 3300025941 | Bacteria | 1498 |
| 792 | Ga0207711_10354370 | 3300025941 | Bacteria | 1359 |
| 793 | Ga0207711_10382861 | 3300025941 | Bacteria | 1305 |
| 794 | Ga0207711_10468404 | 3300025941 | Unclassified | 1173 |
| 795 | Ga0207711_10661323 | 3300025941 | Unclassified | 974 |
| 796 | Ga0207711_10736237 | 3300025941 | Bacteria | 919 |
| 797 | Ga0207689_10099509 | 3300025942 | Bacteria | 2389 |
| 798 | Ga0207689_10615213 | 3300025942 | Bacteria | 914 |
| 799 | Ga0207661_10000773 | 3300025944 | Bacteria | 20768 |
| 800 | Ga0207661_10003324 | 3300025944 | Bacteria | 11156 |
| 801 | Ga0207661_10025056 | 3300025944 | Bacteria | 4530 |
| 802 | Ga0207661_10027886 | 3300025944 | Bacteria | 4319 |
| 803 | Ga0207661_10096646 | 3300025944 | Bacteria | 2472 |
| 804 | Ga0207661_10101249 | 3300025944 | Bacteria | 2420 |
| 805 | Ga0207661_10126586 | 3300025944 | Unclassified | 2182 |
| 806 | Ga0207661_10132816 | 3300025944 | Bacteria | 2135 |
| 807 | Ga0207661_10218129 | 3300025944 | Unclassified | 1685 |
| 808 | Ga0207661_10230983 | 3300025944 | Bacteria | 1638 |
| 809 | Ga0207661_10231177 | 3300025944 | Bacteria | 1637 |
| 810 | Ga0207661_10272806 | 3300025944 | Bacteria | 1510 |
| 811 | Ga0207661_10512812 | 3300025944 | Bacteria | 1096 |
| 812 | Ga0207661_10527531 | 3300025944 | Unclassified | 1080 |
| 813 | Ga0207661_10847343 | 3300025944 | Bacteria | 842 |
| 814 | Ga0207661_10995049 | 3300025944 | Bacteria | 772 |
| 815 | Ga0207679_10011335 | 3300025945 | Bacteria | 5768 |
| 816 | Ga0207679_10014612 | 3300025945 | Bacteria | 5165 |
| 817 | Ga0207679_10035388 | 3300025945 | Bacteria | 3533 |
| 818 | Ga0207679_10042693 | 3300025945 | Bacteria | 3261 |
| 819 | Ga0207679_10060806 | 3300025945 | Unclassified | 2809 |
| 820 | Ga0207679_10115076 | 3300025945 | Bacteria | 2130 |
| 821 | Ga0207679_10219423 | 3300025945 | Bacteria | 1599 |
| 822 | Ga0207679_10243205 | 3300025945 | Unclassified | 1526 |
| 823 | Ga0207679_10741844 | 3300025945 | Bacteria | 893 |
| 824 | Ga0207679_10754073 | 3300025945 | Bacteria | 885 |
| 825 | Ga0207667_10010475 | 3300025949 | Bacteria | 10837 |
| 826 | Ga0207667_10037594 | 3300025949 | Bacteria | 5174 |
| 827 | Ga0207667_10073577 | 3300025949 | Bacteria | 3550 |
| 828 | Ga0207667_10088790 | 3300025949 | Bacteria | 3196 |
| 829 | Ga0207667_10181761 | 3300025949 | Bacteria | 2159 |
| 830 | Ga0207667_10483260 | 3300025949 | Bacteria | 1257 |
| 831 | Ga0207667_10746865 | 3300025949 | Bacteria | 978 |
| 832 | Ga0207667_10965469 | 3300025949 | Unclassified | 841 |
| 833 | Ga0207667_11300146 | 3300025949 | Bacteria | 704 |
| 834 | Ga0207667_11305099 | 3300025949 | Unclassified | 702 |
| 835 | Ga0207651_10073464 | 3300025960 | Unclassified | 2432 |
| 836 | Ga0207651_10117565 | 3300025960 | Bacteria | 2009 |
| 837 | Ga0207651_10203343 | 3300025960 | Bacteria | 1589 |
| 838 | Ga0207651_10272086 | 3300025960 | Bacteria | 1395 |
| 839 | Ga0207651_10301036 | 3300025960 | Bacteria | 1333 |
| 840 | Ga0207651_10872437 | 3300025960 | Bacteria | 800 |
| 841 | Ga0207651_11216466 | 3300025960 | Bacteria | 676 |
| 842 | Ga0207712_10000346 | 3300025961 | Bacteria | 41710 |
| 843 | Ga0207712_10054871 | 3300025961 | Unclassified | 2800 |
| 844 | Ga0207712_10967905 | 3300025961 | Bacteria | 754 |
| 845 | Ga0207668_10019176 | 3300025972 | Bacteria | 4318 |
| 846 | Ga0207668_10105113 | 3300025972 | Bacteria | 2107 |
| 847 | Ga0207668_10654962 | 3300025972 | Bacteria | 919 |
| 848 | Ga0207668_11084966 | 3300025972 | Bacteria | 717 |
| 849 | Ga0207668_11665799 | 3300025972 | Bacteria | 576 |
| 850 | Ga0207640_10002551 | 3300025981 | Bacteria | 9762 |
| 851 | Ga0207640_10004890 | 3300025981 | Bacteria | 7280 |
| 852 | Ga0207640_10052552 | 3300025981 | Bacteria | 2654 |
| 853 | Ga0207640_10646392 | 3300025981 | Bacteria | 901 |
| 854 | Ga0207640_11970463 | 3300025981 | Bacteria | 529 |
| 855 | Ga0207658_10023714 | 3300025986 | Unclassified | 4286 |
| 856 | Ga0207658_10045123 | 3300025986 | Bacteria | 3212 |
| 857 | Ga0207658_10324125 | 3300025986 | Bacteria | 1334 |
| 858 | Ga0207658_10331932 | 3300025986 | Bacteria | 1319 |
| 859 | Ga0207658_10394429 | 3300025986 | Bacteria | 1215 |
| 860 | Ga0207658_10662622 | 3300025986 | Bacteria | 941 |
| 861 | Ga0207677_10005642 | 3300026023 | Bacteria | 6804 |
| 862 | Ga0207677_10031481 | 3300026023 | Bacteria | 3398 |
| 863 | Ga0207677_10447218 | 3300026023 | Bacteria | 1106 |
| 864 | Ga0207677_10920271 | 3300026023 | Bacteria | 789 |
| 865 | Ga0207677_11205965 | 3300026023 | Bacteria | 693 |
| 866 | Ga0207677_11363063 | 3300026023 | Bacteria | 653 |
| 867 | Ga0207677_11865006 | 3300026023 | Bacteria | 558 |
| 868 | Ga0207703_10148733 | 3300026035 | Unclassified | 2040 |
| 869 | Ga0207703_10176562 | 3300026035 | Bacteria | 1882 |
| 870 | Ga0207639_10017793 | 3300026041 | Bacteria | 5039 |
| 871 | Ga0207639_10345808 | 3300026041 | Bacteria | 1327 |
| 872 | Ga0207639_10703683 | 3300026041 | Bacteria | 937 |
| 873 | Ga0207639_10811003 | 3300026041 | Bacteria | 872 |
| 874 | Ga0207639_10931214 | 3300026041 | Bacteria | 813 |
| 875 | Ga0207639_11670884 | 3300026041 | Bacteria | 597 |
| 876 | Ga0207678_10005989 | 3300026067 | Bacteria | 10818 |
| 877 | Ga0207678_10165263 | 3300026067 | Bacteria | 1890 |
| 878 | Ga0207678_10181623 | 3300026067 | Bacteria | 1797 |
| 879 | Ga0207678_10226531 | 3300026067 | Bacteria | 1600 |
| 880 | Ga0207708_10013573 | 3300026075 | Bacteria | 6090 |
| 881 | Ga0207708_10015945 | 3300026075 | Bacteria | 5643 |
| 882 | Ga0207708_10047116 | 3300026075 | Bacteria | 3283 |
| 883 | Ga0207708_10097011 | 3300026075 | Unclassified | 2278 |
| 884 | Ga0207708_10172929 | 3300026075 | Bacteria | 1712 |
| 885 | Ga0207708_10261267 | 3300026075 | Bacteria | 1398 |
| 886 | Ga0207708_10302639 | 3300026075 | Bacteria | 1301 |
| 887 | Ga0207708_10553425 | 3300026075 | Bacteria | 970 |
| 888 | Ga0207702_10051183 | 3300026078 | Bacteria | 3489 |
| 889 | Ga0207702_10220062 | 3300026078 | Bacteria | 1769 |
| 890 | Ga0207641_10184925 | 3300026088 | Bacteria | 1911 |
| 891 | Ga0207641_10216253 | 3300026088 | Unclassified | 1775 |
| 892 | Ga0207641_10610794 | 3300026088 | Unclassified | 1068 |
| 893 | Ga0207641_10693984 | 3300026088 | Bacteria | 1002 |
| 894 | Ga0207648_10003894 | 3300026089 | Bacteria | 15579 |
| 895 | Ga0207648_10014817 | 3300026089 | Bacteria | 7192 |
| 896 | Ga0207648_10029323 | 3300026089 | Bacteria | 4880 |
| 897 | Ga0207648_10051944 | 3300026089 | Bacteria | 3584 |
| 898 | Ga0207648_10090733 | 3300026089 | Bacteria | 2670 |
| 899 | Ga0207648_10133884 | 3300026089 | Bacteria | 2182 |
| 900 | Ga0207648_10150977 | 3300026089 | Bacteria | 2050 |
| 901 | Ga0207648_10156878 | 3300026089 | Bacteria | 2009 |
| 902 | Ga0207648_11359660 | 3300026089 | Bacteria | 667 |
| 903 | Ga0207676_10051055 | 3300026095 | Bacteria | 3227 |
| 904 | Ga0207676_10211503 | 3300026095 | Bacteria | 1721 |
| 905 | Ga0207676_10232820 | 3300026095 | Bacteria | 1648 |
| 906 | Ga0207676_10370538 | 3300026095 | Unclassified | 1330 |
| 907 | Ga0207676_11325770 | 3300026095 | Unclassified | 715 |
| 908 | Ga0207676_11758862 | 3300026095 | Unclassified | 618 |
| 909 | Ga0207674_10026779 | 3300026116 | Bacteria | 6116 |
| 910 | Ga0207674_10037266 | 3300026116 | Bacteria | 5059 |
| 911 | Ga0207674_10112645 | 3300026116 | Bacteria | 2694 |
| 912 | Ga0207674_10132898 | 3300026116 | Bacteria | 2451 |
| 913 | Ga0207674_10223343 | 3300026116 | Bacteria | 1832 |
| 914 | Ga0207674_10283051 | 3300026116 | Bacteria | 1606 |
| 915 | Ga0207674_10451898 | 3300026116 | Bacteria | 1242 |
| 916 | Ga0207674_11565886 | 3300026116 | Unclassified | 628 |
| 917 | Ga0207675_100067512 | 3300026118 | Bacteria | 3343 |
| 918 | Ga0207675_100174256 | 3300026118 | Bacteria | 2057 |
| 919 | Ga0207675_100765809 | 3300026118 | Bacteria | 977 |
| 920 | Ga0207683_10052970 | 3300026121 | Bacteria | 3556 |
| 921 | Ga0207683_10154425 | 3300026121 | Bacteria | 2073 |
| 922 | Ga0207683_10231694 | 3300026121 | Bacteria | 1685 |
| 923 | Ga0207683_10453372 | 3300026121 | Bacteria | 1183 |
| 924 | Ga0207683_10575410 | 3300026121 | Bacteria | 1042 |
| 925 | Ga0207698_10021544 | 3300026142 | Bacteria | 4461 |
| 926 | Ga0207698_10043215 | 3300026142 | Bacteria | 3375 |
| 927 | Ga0207698_10143952 | 3300026142 | Bacteria | 2058 |
| 928 | Ga0207698_10194266 | 3300026142 | Bacteria | 1811 |
| 929 | Ga0207698_11580954 | 3300026142 | Bacteria | 671 |
| 930 | Ga0209969_1054586 | 3300027360 | Bacteria | 628 |
| 931 | Ga0209996_1019201 | 3300027395 | Bacteria | 954 |
| 932 | Ga0210000_1032039 | 3300027462 | Bacteria | 824 |
| 933 | Ga0209995_1005218 | 3300027471 | Bacteria | 2088 |
| 934 | Ga0209995_1042443 | 3300027471 | Bacteria | 769 |
| 935 | Ga0209968_1001813 | 3300027526 | Bacteria | 3241 |
| 936 | Ga0209999_1012273 | 3300027543 | Bacteria | 1552 |
| 937 | Ga0209970_1002637 | 3300027614 | Bacteria | 3033 |
| 938 | Ga0209983_1033899 | 3300027665 | Bacteria | 1093 |
| 939 | Ga0209588_1073306 | 3300027671 | Bacteria | 1106 |
| 940 | Ga0209971_1008583 | 3300027682 | Bacteria | 2425 |
| 941 | Ga0209966_1000668 | 3300027695 | Bacteria | 7568 |
| 942 | Ga0209998_10000516 | 3300027717 | Bacteria | 10562 |
| 943 | Ga0209974_10005680 | 3300027876 | Bacteria | 4377 |
| 944 | Ga0209974_10047317 | 3300027876 | Bacteria | 1440 |
| 945 | Ga0207428_10165592 | 3300027907 | Bacteria | 1677 |
| 946 | Ga0207428_10462433 | 3300027907 | Bacteria | 924 |
| 947 | Ga0268266_10592042 | 3300028379 | Bacteria | 1065 |
| 948 | Ga0268266_11942260 | 3300028379 | Bacteria | 562 |
| 949 | Ga0268265_10000331 | 3300028380 | Bacteria | 51469 |
| 950 | Ga0268265_10055170 | 3300028380 | Unclassified | 3018 |
| 951 | Ga0268265_10128815 | 3300028380 | Bacteria | 2099 |
| 952 | Ga0268264_10180909 | 3300028381 | Bacteria | 1915 |
| 953 | Ga0268264_10257374 | 3300028381 | Unclassified | 1624 |
| 954 | Ga0268264_12060581 | 3300028381 | Bacteria | 579 |
| 955 | Ga0316182_1394427 | 3300030745 | Bacteria | 665 |
| 956 | Ga0265332_10014489 | 3300031238 | Bacteria | 3487 |
| 957 | Ga0265320_10271106 | 3300031240 | Bacteria | 752 |
| 958 | Ga0265340_10043989 | 3300031247 | Bacteria | 2186 |
| 959 | Ga0307408_100007956 | 3300031548 | Bacteria | 7011 |
| 960 | Ga0307408_100023930 | 3300031548 | Bacteria | 4165 |
| 961 | Ga0307408_100034723 | 3300031548 | Bacteria | 3534 |
| 962 | Ga0307408_100143892 | 3300031548 | Bacteria | 1874 |
| 963 | Ga0307408_100164448 | 3300031548 | Bacteria | 1766 |
| 964 | Ga0307408_100168672 | 3300031548 | Bacteria | 1746 |
| 965 | Ga0307408_100493694 | 3300031548 | Bacteria | 1070 |
| 966 | Ga0307408_101673133 | 3300031548 | Bacteria | 606 |
| 967 | Ga0265314_10015473 | 3300031711 | Bacteria | 6053 |
| 968 | Ga0265342_10458054 | 3300031712 | Bacteria | 654 |
| 969 | Ga0307405_10004252 | 3300031731 | Bacteria | 6737 |
| 970 | Ga0307405_10021190 | 3300031731 | Bacteria | 3649 |
| 971 | Ga0307405_10050253 | 3300031731 | Bacteria | 2581 |
| 972 | Ga0307405_10062898 | 3300031731 | Bacteria | 2352 |
| 973 | Ga0307405_10445820 | 3300031731 | Bacteria | 1025 |
| 974 | Ga0307405_10609183 | 3300031731 | Unclassified | 892 |
| 975 | Ga0307413_10000716 | 3300031824 | Bacteria | 11383 |
| 976 | Ga0307413_10013252 | 3300031824 | Bacteria | 4136 |
| 977 | Ga0307413_10064172 | 3300031824 | Bacteria | 2280 |
| 978 | Ga0307413_10064302 | 3300031824 | Bacteria | 2279 |
| 979 | Ga0307413_10347464 | 3300031824 | Bacteria | 1143 |
| 980 | Ga0307413_10506401 | 3300031824 | Unclassified | 970 |
| 981 | Ga0307413_10777907 | 3300031824 | Bacteria | 802 |
| 982 | Ga0307413_11799469 | 3300031824 | Bacteria | 548 |
| 983 | Ga0307413_11897906 | 3300031824 | Bacteria | 535 |
| 984 | Ga0307410_10000703 | 3300031852 | Bacteria | 13942 |
| 985 | Ga0307410_10005533 | 3300031852 | Bacteria | 6698 |
| 986 | Ga0307410_10015703 | 3300031852 | Bacteria | 4499 |
| 987 | Ga0307410_10062836 | 3300031852 | Bacteria | 2546 |
| 988 | Ga0307410_10084179 | 3300031852 | Bacteria | 2241 |
| 989 | Ga0307410_10089895 | 3300031852 | Bacteria | 2177 |
| 990 | Ga0307410_10099120 | 3300031852 | Bacteria | 2085 |
| 991 | Ga0307410_10119687 | 3300031852 | Bacteria | 1918 |
| 992 | Ga0307410_10292546 | 3300031852 | Bacteria | 1282 |
| 993 | Ga0307410_10579716 | 3300031852 | Bacteria | 933 |
| 994 | Ga0307410_10664268 | 3300031852 | Bacteria | 875 |
| 995 | Ga0307410_11446293 | 3300031852 | Bacteria | 604 |
| 996 | Ga0307406_10007225 | 3300031901 | Bacteria | 6153 |
| 997 | Ga0307406_10071378 | 3300031901 | Bacteria | 2276 |
| 998 | Ga0307406_10144526 | 3300031901 | Unclassified | 1688 |
| 999 | Ga0307406_10313234 | 3300031901 | Bacteria | 1211 |
| 1000 | Ga0307406_10381914 | 3300031901 | Bacteria | 1111 |
| 1001 | Ga0307406_10516533 | 3300031901 | Bacteria | 971 |
| 1002 | Ga0307406_10742134 | 3300031901 | Bacteria | 823 |
| 1003 | Ga0307406_11289451 | 3300031901 | Bacteria | 637 |
| 1004 | Ga0307407_10006979 | 3300031903 | Bacteria | 5076 |
| 1005 | Ga0307407_10013663 | 3300031903 | Bacteria | 3950 |
| 1006 | Ga0307407_10016328 | 3300031903 | Bacteria | 3694 |
| 1007 | Ga0307407_10077115 | 3300031903 | Bacteria | 2003 |
| 1008 | Ga0307407_10284787 | 3300031903 | Bacteria | 1146 |
| 1009 | Ga0307407_10287830 | 3300031903 | Unclassified | 1141 |
| 1010 | Ga0307407_10315099 | 3300031903 | Bacteria | 1096 |
| 1011 | Ga0307407_10568186 | 3300031903 | Bacteria | 840 |
| 1012 | Ga0307412_10003814 | 3300031911 | Bacteria | 8384 |
| 1013 | Ga0307412_10076019 | 3300031911 | Bacteria | 2306 |
| 1014 | Ga0307412_10096133 | 3300031911 | Bacteria | 2084 |
| 1015 | Ga0307412_10574921 | 3300031911 | Bacteria | 950 |
| 1016 | Ga0307412_10808539 | 3300031911 | Unclassified | 814 |
| 1017 | Ga0307412_11273805 | 3300031911 | Bacteria | 661 |
| 1018 | Ga0307409_100000828 | 3300031995 | Bacteria | 14225 |
| 1019 | Ga0307409_100014909 | 3300031995 | Bacteria | 5077 |
| 1020 | Ga0307409_100020440 | 3300031995 | Bacteria | 4513 |
| 1021 | Ga0307409_100026685 | 3300031995 | Bacteria | 4078 |
| 1022 | Ga0307409_100387313 | 3300031995 | Bacteria | 1331 |
| 1023 | Ga0307409_100548381 | 3300031995 | Unclassified | 1134 |
| 1024 | Ga0307409_100573955 | 3300031995 | Bacteria | 1111 |
| 1025 | Ga0307409_100744856 | 3300031995 | Bacteria | 983 |
| 1026 | Ga0307409_101024049 | 3300031995 | Unclassified | 844 |
| 1027 | Ga0307416_100020053 | 3300032002 | Bacteria | 4759 |
| 1028 | Ga0307416_100047869 | 3300032002 | Bacteria | 3388 |
| 1029 | Ga0307416_100052780 | 3300032002 | Bacteria | 3257 |
| 1030 | Ga0307416_100201815 | 3300032002 | Bacteria | 1887 |
| 1031 | Ga0307416_100205134 | 3300032002 | Unclassified | 1874 |
| 1032 | Ga0307416_100420076 | 3300032002 | Bacteria | 1381 |
| 1033 | Ga0307416_100643541 | 3300032002 | Bacteria | 1144 |
| 1034 | Ga0307416_100815326 | 3300032002 | Bacteria | 1030 |
| 1035 | Ga0307416_100848605 | 3300032002 | Bacteria | 1011 |
| 1036 | Ga0307416_100969175 | 3300032002 | Bacteria | 953 |
| 1037 | Ga0307416_101129349 | 3300032002 | Bacteria | 889 |
| 1038 | Ga0307416_101268111 | 3300032002 | Bacteria | 843 |
| 1039 | Ga0307416_101557968 | 3300032002 | Bacteria | 766 |
| 1040 | Ga0307416_102485730 | 3300032002 | Bacteria | 617 |
| 1041 | Ga0307416_103167767 | 3300032002 | Bacteria | 550 |
| 1042 | Ga0307414_10012996 | 3300032004 | Bacteria | 4943 |
| 1043 | Ga0307414_10047438 | 3300032004 | Bacteria | 2956 |
| 1044 | Ga0307414_10921909 | 3300032004 | Bacteria | 802 |
| 1045 | Ga0307414_11275059 | 3300032004 | Bacteria | 681 |
| 1046 | Ga0307414_11437686 | 3300032004 | Bacteria | 641 |
| 1047 | Ga0307414_11731355 | 3300032004 | Bacteria | 583 |
| 1048 | Ga0307411_10004747 | 3300032005 | Bacteria | 6571 |
| 1049 | Ga0307411_10061846 | 3300032005 | Bacteria | 2495 |
| 1050 | Ga0307411_10062197 | 3300032005 | Bacteria | 2489 |
| 1051 | Ga0307411_10122865 | 3300032005 | Bacteria | 1882 |
| 1052 | Ga0307411_10165208 | 3300032005 | Bacteria | 1663 |
| 1053 | Ga0307411_10172334 | 3300032005 | Bacteria | 1633 |
| 1054 | Ga0307411_10273468 | 3300032005 | Bacteria | 1341 |
| 1055 | Ga0307411_10325185 | 3300032005 | Bacteria | 1243 |
| 1056 | Ga0307411_10728760 | 3300032005 | Bacteria | 866 |
| 1057 | Ga0307415_100028600 | 3300032126 | Bacteria | 3549 |
| 1058 | Ga0307415_100039533 | 3300032126 | Bacteria | 3118 |
| 1059 | Ga0307415_100083254 | 3300032126 | Bacteria | 2291 |
| 1060 | Ga0307415_100095152 | 3300032126 | Bacteria | 2168 |
| 1061 | Ga0307415_100120672 | 3300032126 | Bacteria | 1965 |
| 1062 | Ga0307415_100146582 | 3300032126 | Bacteria | 1811 |
| 1063 | Ga0307415_100146802 | 3300032126 | Bacteria | 1809 |
| 1064 | Ga0307415_100234603 | 3300032126 | Bacteria | 1480 |
| 1065 | Ga0307415_100276935 | 3300032126 | Bacteria | 1377 |
| 1066 | Ga0307415_100620111 | 3300032126 | Bacteria | 965 |
| 1067 | Ga0307415_101307583 | 3300032126 | Bacteria | 687 |
| 1068 | Ga0307415_101365620 | 3300032126 | Bacteria | 673 |
| 1069 | Ga0373958_0077187 | 3300034819 | Bacteria | 749 |
| 1070 | Ga0373926_0041522 | 3300035083 | Bacteria | 1644 |
| 1071 | Ga0373934_0004281 | 3300035086 | Bacteria | 5268 |
| 1072 | Ga0373940_0041683 | 3300035088 | Bacteria | 1263 |
| 1073 | Ga0373952_0281639 | 3300035092 | Unclassified | 512 |
| 1074 | Ga0373936_0123559 | 3300035113 | Bacteria | 1108 |
| 1075 | Ga0373953_0025409 | 3300035117 | Bacteria | 2263 |
| 1076 | Ga0373954_0175400 | 3300035118 | Bacteria | 1050 |
| 1077 | Ga0373957_0232082 | 3300035120 | Bacteria | 774 |
| 1078 | Ga0373960_0014579 | 3300035121 | Bacteria | 1994 |
| 1079 | Ga0373943_0037919 | 3300035170 | Bacteria | 2315 |
| 1080 | Ga0373955_0221512 | 3300035172 | Bacteria | 1130 |
| 1081 | Ga0373942_0061911 | 3300035207 | Bacteria | 1074 |
| 1082 | Ga0373942_0204482 | 3300035207 | Unclassified | 656 |
| 1083 | Ga0373931_0428607 | 3300035691 | Bacteria | 842 |
| 1084 | Ga0373931_0752772 | 3300035691 | Bacteria | 647 |
| 1085 | Ga0373935_0063682 | 3300035692 | Unclassified | 2364 |
| 1086 | Ga0373927_0128798 | 3300035695 | Unclassified | 1653 |
| 1087 | Ga0373947_0010747 | 3300035725 | Bacteria | 5253 |
| 1088 | Ga0373937_0000448 | 3300036401 | Bacteria | 38003 |
| 1089 | Ga0373937_0062192 | 3300036401 | Bacteria | 3432 |
| 1090 | Ga0373925_0064153 | 3300037068 | Bacteria | 2764 |
| 1091 | Ga0395900_1067409 | 3300037418 | Unclassified | 726 |
| 1092 | Ga0395898_1707525 | 3300037466 | Unclassified | 552 |
| 1093 | Ga0395905_0060527 | 3300037471 | Bacteria | 3541 |
| 1094 | Ga0395905_1251418 | 3300037471 | Bacteria | 646 |
| 1095 | Ga0436364_0330143 | 3300037853 | Bacteria | 706 |
| 1096 | Ga0436364_0599470 | 3300037853 | Bacteria | 676 |
| 1097 | Ga0436365_0209545 | 3300039437 | Bacteria | 729 |
| 1098 | Ga0436365_0489964 | 3300039437 | Bacteria | 570 |
| 1099 | Ga0436365_0579517 | 3300039437 | Bacteria | 841 |
| 1100 | Ga0436365_0753661 | 3300039437 | Bacteria | 766 |
| 1101 | Ga0436365_0836229 | 3300039437 | Bacteria | 4708 |
| 1102 | Ga0436365_1353333 | 3300039437 | Bacteria | 1337 |
| 1103 | Ga0436365_1791379 | 3300039437 | Bacteria | 632 |
| 1104 | Ga0436363_1323611 | 3300039450 | Bacteria | 764 |
| 1105 | Ga0436362_0963725 | 3300039453 | Bacteria | 508 |
| 1106 | Ga0439461_0018554 | 3300041410 | Bacteria | 1362 |
| 1107 | Ga0451800_1305647 | 3300041459 | Bacteria | 789 |
| 1108 | Ga0451804_0951379 | 3300041463 | Unclassified | 595 |
| 1109 | Ga0451839_0204316 | 3300041496 | Bacteria | 552 |
| 1110 | Ga0451849_0487378 | 3300041505 | Bacteria | 638 |
| 1111 | Ga0451853_2286543 | 3300041512 | Bacteria | 682 |
| 1112 | Ga0439433_0082239 | 3300041999 | Bacteria | 784 |
| 1113 | Ga0450898_055793 | 3300042134 | Bacteria | 770 |
| 1114 | Ga0439434_0050174 | 3300042435 | Bacteria | 1292 |
| 1115 | Ga0439434_0310029 | 3300042435 | Bacteria | 547 |
| 1116 | Ga0451577_0257900 | 3300042876 | Bacteria | 1579 |
| 1117 | Ga0451577_0765816 | 3300042876 | Bacteria | 873 |
| 1118 | Ga0451577_0975175 | 3300042876 | Bacteria | 762 |
| 1119 | Ga0466966_0005142 | 3300044684 | Bacteria | 8593 |
| 1120 | Ga0466966_0077028 | 3300044684 | Bacteria | 2082 |
| 1121 | Ga0466966_0318317 | 3300044684 | Unclassified | 935 |
| 1122 | Ga0466961_0034916 | 3300044693 | Bacteria | 3229 |
| 1123 | Ga0466961_0093906 | 3300044693 | Bacteria | 1893 |
| 1124 | Ga0466961_0582121 | 3300044693 | Bacteria | 673 |
| 1125 | Ga0466963_0118109 | 3300044694 | Unclassified | 1824 |
| 1126 | Ga0466964_0211514 | 3300044706 | Bacteria | 937 |
| 1127 | Ga0466971_0564673 | 3300044719 | Bacteria | 565 |
| 1128 | Ga0466957_0889846 | 3300044842 | Bacteria | 636 |
| 1129 | Ga0466960_1032341 | 3300044901 | Bacteria | 506 |
| 1130 | Ga0466959_0043802 | 3300045049 | Bacteria | 3298 |
| 1131 | Ga0466959_0082347 | 3300045049 | Bacteria | 2318 |
| 1132 | Ga0466959_0125231 | 3300045049 | Bacteria | 1824 |
| 1133 | Ga0451576_0188169 | 3300045051 | Bacteria | 2156 |
| 1134 | Ga0451576_0540201 | 3300045051 | Bacteria | 1225 |
| 1135 | Ga0451576_0568652 | 3300045051 | Bacteria | 1191 |
| 1136 | Ga0451576_2428243 | 3300045051 | Unclassified | 536 |
| 1137 | Ga0466958_0215675 | 3300045836 | Bacteria | 1224 |
| 1138 | Ga0466967_0169522 | 3300045976 | Bacteria | 2053 |
| 1139 | Ga0466967_0327399 | 3300045976 | Bacteria | 1479 |
| 1140 | Ga0495603_0245819 | 3300046455 | Bacteria | 1030 |
| 1141 | Ga0495603_0480597 | 3300046455 | Bacteria | 711 |
| 1142 | Ga0495629_0038804 | 3300046459 | Bacteria | 3354 |
| 1143 | Ga0495629_0691555 | 3300046459 | Unclassified | 678 |
| 1144 | Ga0495651_0003975 | 3300046462 | Bacteria | 11300 |
| 1145 | Ga0495580_0008931 | 3300046472 | Bacteria | 7926 |
| 1146 | Ga0495582_0286299 | 3300046473 | Bacteria | 946 |
| 1147 | Ga0495639_0017578 | 3300046475 | Bacteria | 3108 |
| 1148 | Ga0495639_0037561 | 3300046475 | Bacteria | 2171 |
| 1149 | Ga0495664_0370387 | 3300046477 | Bacteria | 862 |
| 1150 | Ga0495584_0654420 | 3300046491 | Bacteria | 536 |
| 1151 | Ga0495585_0548564 | 3300046492 | Bacteria | 546 |
| 1152 | Ga0495594_0008015 | 3300046499 | Bacteria | 5432 |
| 1153 | Ga0495594_0012806 | 3300046499 | Bacteria | 4374 |
| 1154 | Ga0495594_0013642 | 3300046499 | Bacteria | 4246 |
| 1155 | Ga0495594_0194279 | 3300046499 | Bacteria | 1156 |
| 1156 | Ga0495630_0026084 | 3300046517 | Bacteria | 4325 |
| 1157 | Ga0495630_0752217 | 3300046517 | Bacteria | 745 |
| 1158 | Ga0495643_0310092 | 3300046522 | Bacteria | 716 |
| 1159 | Ga0495666_0008156 | 3300046526 | Bacteria | 5252 |
| 1160 | Ga0495642_0114228 | 3300046528 | Bacteria | 1156 |
| 1161 | Ga0495652_0131358 | 3300046529 | Bacteria | 1982 |
| 1162 | Ga0495665_0025157 | 3300046531 | Bacteria | 3198 |
| 1163 | Ga0495586_0076789 | 3300046535 | Bacteria | 1830 |
| 1164 | Ga0495586_0514359 | 3300046535 | Bacteria | 691 |
| 1165 | Ga0495587_0002752 | 3300046536 | Bacteria | 11734 |
| 1166 | Ga0495621_0098495 | 3300046539 | Bacteria | 1110 |
| 1167 | Ga0495621_0209663 | 3300046539 | Bacteria | 786 |
| 1168 | Ga0495621_0233258 | 3300046539 | Bacteria | 748 |
| 1169 | Ga0495645_0000804 | 3300046543 | Bacteria | 21498 |
| 1170 | Ga0495622_0361258 | 3300046557 | Bacteria | 628 |
| 1171 | Ga0495667_0008829 | 3300046559 | Bacteria | 6854 |
| 1172 | Ga0495667_0097780 | 3300046559 | Bacteria | 1901 |
| 1173 | Ga0495634_0197100 | 3300046642 | Bacteria | 1253 |
| 1174 | Ga0495635_0833408 | 3300046663 | Bacteria | 593 |
| 1175 | Ga0495659_0142888 | 3300046664 | Bacteria | 956 |
| 1176 | Ga0495588_0205466 | 3300046674 | Bacteria | 1040 |
| 1177 | Ga0495588_0266961 | 3300046674 | Bacteria | 902 |
| 1178 | Ga0495657_0129370 | 3300046675 | Bacteria | 1583 |
| 1179 | Ga0495599_0078495 | 3300046678 | Bacteria | 2061 |
| 1180 | Ga0495623_0001333 | 3300046679 | Bacteria | 16739 |
| 1181 | Ga0495623_0025809 | 3300046679 | Bacteria | 3784 |
| 1182 | Ga0495658_0778619 | 3300046683 | Bacteria | 612 |
| 1183 | Ga0495669_0058998 | 3300046684 | Bacteria | 1732 |
| 1184 | Ga0495669_0153021 | 3300046684 | Bacteria | 1092 |
| 1185 | Ga0495613_0061274 | 3300046689 | Bacteria | 2755 |
| 1186 | Ga0495613_0302562 | 3300046689 | Bacteria | 1107 |
| 1187 | Ga0495613_0318068 | 3300046689 | Bacteria | 1075 |
| 1188 | Ga0495624_0187116 | 3300046690 | Unclassified | 1260 |
| 1189 | Ga0495600_0029735 | 3300046809 | Bacteria | 3538 |
| 1190 | Ga0495600_0057993 | 3300046809 | Bacteria | 2529 |
| 1191 | Ga0495600_0499794 | 3300046809 | Bacteria | 747 |
| 1192 | Ga0495581_0124203 | 3300047315 | Bacteria | 1503 |
| 1193 | Ga0495581_0282360 | 3300047315 | Bacteria | 970 |
| 1194 | Ga0495674_0075611 | 3300047319 | Bacteria | 2898 |
| 1195 | Ga0495672_0005947 | 3300047320 | Bacteria | 9562 |
| 1196 | Ga0495675_0007163 | 3300047444 | Bacteria | 6866 |
| 1197 | Ga0495675_0025928 | 3300047444 | Bacteria | 3736 |
| 1198 | Ga0495677_0440844 | 3300047445 | Bacteria | 516 |
| 1199 | Ga0495684_0056960 | 3300047471 | Bacteria | 2979 |
| 1200 | Ga0495684_0132396 | 3300047471 | Bacteria | 1872 |
| 1201 | Ga0495602_0258837 | 3300048088 | Bacteria | 1292 |
| 1202 | Ga0495602_0437548 | 3300048088 | Bacteria | 925 |
| 1203 | Ga0496100_0033859 | 3300048903 | Bacteria | 3200 |
| 1204 | Ga0496100_0071846 | 3300048903 | Bacteria | 2312 |
| 1205 | Ga0496101_0063525 | 3300048904 | Bacteria | 2688 |
| 1206 | Ga0496105_0131297 | 3300048908 | Bacteria | 2065 |
| 1207 | Ga0496106_0031215 | 3300048909 | Bacteria | 3970 |
| 1208 | Ga0496106_0452888 | 3300048909 | Bacteria | 1031 |
| 1209 | Ga0496107_0113721 | 3300048910 | Bacteria | 1991 |
| 1210 | Ga0496108_0475266 | 3300048911 | Bacteria | 1092 |
| 1211 | Ga0496109_0357570 | 3300048912 | Bacteria | 1380 |
| 1212 | Ga0496109_0365026 | 3300048912 | Bacteria | 1364 |
| 1213 | Ga0496109_1188726 | 3300048912 | Unclassified | 699 |
| 1214 | Ga0496110_0284371 | 3300048913 | Unclassified | 1506 |
| 1215 | Ga0496110_0704935 | 3300048913 | Bacteria | 911 |
| 1216 | Ga0496111_0429111 | 3300048914 | Unclassified | 976 |
| 1217 | Ga0496112_0003755 | 3300048915 | Bacteria | 12685 |
| 1218 | Ga0496112_0011306 | 3300048915 | Bacteria | 8145 |
| 1219 | Ga0496112_0747424 | 3300048915 | Bacteria | 904 |
| 1220 | Ga0496112_1098261 | 3300048915 | Bacteria | 714 |
| 1221 | Ga0496113_0010290 | 3300048916 | Bacteria | 6181 |
| 1222 | Ga0496113_0653277 | 3300048916 | Bacteria | 841 |
| 1223 | Ga0496115_0059698 | 3300048918 | Bacteria | 3072 |
| 1224 | Ga0496115_0200863 | 3300048918 | Bacteria | 1647 |
| 1225 | Ga0501309_046492 | 3300049129 | Unclassified | 674 |
| 1226 | Ga0501291_093473 | 3300049514 | Unclassified | 617 |
| 1227 | Ga0501031_0018277 | 3300049568 | Bacteria | 4562 |
| 1228 | Ga0501033_0004681 | 3300049570 | Bacteria | 10947 |
| 1229 | Ga0501033_0072694 | 3300049570 | Bacteria | 2525 |
| 1230 | Ga0501034_0034768 | 3300049571 | Bacteria | 5110 |
| 1231 | Ga0501034_0040492 | 3300049571 | Bacteria | 4717 |
| 1232 | Ga0501034_0128703 | 3300049571 | Bacteria | 2516 |
| 1233 | Ga0501036_0132872 | 3300049572 | Bacteria | 2100 |
| 1234 | Ga0501036_0367837 | 3300049572 | Bacteria | 1200 |
| 1235 | Ga0501038_0185359 | 3300049574 | Bacteria | 1677 |
| 1236 | Ga0501040_0009071 | 3300049576 | Bacteria | 6472 |
| 1237 | Ga0501040_0266305 | 3300049576 | Bacteria | 1223 |
| 1238 | Ga0501041_0179921 | 3300049577 | Bacteria | 1324 |
| 1239 | Ga0501041_0698145 | 3300049577 | Bacteria | 649 |
| 1240 | Ga0501042_0127338 | 3300049578 | Bacteria | 1834 |
| 1241 | Ga0501042_1276809 | 3300049578 | Bacteria | 535 |
| 1242 | Ga0501043_0048107 | 3300049579 | Bacteria | 3353 |
| 1243 | Ga0501043_0114778 | 3300049579 | Bacteria | 2114 |
| 1244 | Ga0501046_0123251 | 3300049580 | Bacteria | 1971 |
| 1245 | Ga0501047_0014211 | 3300049581 | Bacteria | 7567 |
| 1246 | Ga0501047_0030687 | 3300049581 | Bacteria | 5181 |
| 1247 | Ga0501048_0103818 | 3300049582 | Bacteria | 2006 |
| 1248 | Ga0501048_0184214 | 3300049582 | Bacteria | 1480 |
| 1249 | Ga0501067_0038830 | 3300049583 | Unclassified | 2643 |
| 1250 | Ga0501067_0769376 | 3300049583 | Bacteria | 542 |
| 1251 | Ga0501070_0260163 | 3300049586 | Bacteria | 1418 |
| 1252 | Ga0501071_0117247 | 3300049587 | Bacteria | 1972 |
| 1253 | Ga0501072_1235084 | 3300049588 | Bacteria | 580 |
| 1254 | Ga0501073_0047690 | 3300049589 | Bacteria | 3010 |
| 1255 | Ga0501074_0438082 | 3300049590 | Bacteria | 927 |
| 1256 | Ga0501075_0148168 | 3300049591 | Bacteria | 1789 |
| 1257 | Ga0501075_0152227 | 3300049591 | Bacteria | 1763 |
| 1258 | Ga0501075_0377071 | 3300049591 | Bacteria | 1081 |
| 1259 | Ga0501076_0194401 | 3300049592 | Bacteria | 1656 |
| 1260 | Ga0501076_0203720 | 3300049592 | Bacteria | 1616 |
| 1261 | Ga0501076_1177277 | 3300049592 | Bacteria | 631 |
| 1262 | Ga0501077_0232705 | 3300049593 | Bacteria | 1171 |
| 1263 | Ga0501198_036905 | 3300049649 | Unclassified | 835 |
| 1264 | Ga0501202_022466 | 3300049652 | Bacteria | 1268 |
| 1265 | Ga0501202_071434 | 3300049652 | Bacteria | 801 |
| 1266 | Ga0501216_039971 | 3300049660 | Unclassified | 894 |
| 1267 | Ga0501216_101244 | 3300049660 | Unclassified | 635 |
| 1268 | Ga0501216_190236 | 3300049660 | Bacteria | 504 |
| 1269 | Ga0501223_011898 | 3300049663 | Unclassified | 1745 |
| 1270 | Ga0501224_038653 | 3300049664 | Bacteria | 720 |
| 1271 | Ga0501230_109663 | 3300049667 | Bacteria | 602 |
| 1272 | Ga0501233_030238 | 3300049668 | Bacteria | 1219 |
| 1273 | Ga0501235_002455 | 3300049669 | Bacteria | 3998 |
| 1274 | Ga0501239_003005 | 3300049672 | Bacteria | 1575 |
| 1275 | Ga0501239_033791 | 3300049672 | Bacteria | 682 |
| 1276 | Ga0501240_004237 | 3300049673 | Unclassified | 1652 |
| 1277 | Ga0501246_035869 | 3300049676 | Bacteria | 576 |
| 1278 | Ga0501247_071413 | 3300049677 | Unclassified | 548 |
| 1279 | Ga0501249_001158 | 3300049679 | Bacteria | 5550 |
| 1280 | Ga0501250_006768 | 3300049680 | Bacteria | 1220 |
| 1281 | Ga0501250_081788 | 3300049680 | Bacteria | 550 |
| 1282 | Ga0501251_088467 | 3300049681 | Bacteria | 553 |
| 1283 | Ga0501257_003684 | 3300049686 | Bacteria | 3308 |
| 1284 | Ga0501259_006356 | 3300049688 | Bacteria | 1879 |
| 1285 | Ga0501260_003681 | 3300049689 | Bacteria | 1387 |
| 1286 | Ga0501261_009664 | 3300049690 | Unclassified | 1261 |
| 1287 | Ga0501221_027992 | 3300049704 | Bacteria | 1156 |
| 1288 | Ga0501225_0034888 | 3300049705 | Bacteria | 1385 |
| 1289 | Ga0501234_026138 | 3300049707 | Unclassified | 937 |
| 1290 | Ga0501245_065160 | 3300049708 | Unclassified | 675 |
| 1291 | Ga0501079_0004591 | 3300049741 | Bacteria | 10244 |
| 1292 | Ga0501079_0802829 | 3300049741 | Bacteria | 741 |
| 1293 | Ga0501080_0094200 | 3300049742 | Bacteria | 2781 |
| 1294 | Ga0501080_0183927 | 3300049742 | Bacteria | 1922 |
| 1295 | Ga0501081_0344394 | 3300049743 | Bacteria | 1098 |
| 1296 | Ga0501081_0382252 | 3300049743 | Bacteria | 1040 |
| 1297 | Ga0501241_045376 | 3300049758 | Unclassified | 859 |
| 1298 | Ga0501262_022185 | 3300049759 | Unclassified | 876 |
| 1299 | Ga0501263_025365 | 3300049760 | Bacteria | 816 |
| 1300 | Ga0501266_005306 | 3300049763 | Bacteria | 1604 |
| 1301 | Ga0501267_021986 | 3300049764 | Bacteria | 709 |
| 1302 | Ga0501268_003463 | 3300049765 | Bacteria | 2161 |
| 1303 | Ga0501268_064088 | 3300049765 | Unclassified | 733 |
| 1304 | Ga0501268_106762 | 3300049765 | Bacteria | 606 |
| 1305 | Ga0501270_010744 | 3300049767 | Bacteria | 1213 |
| 1306 | Ga0501272_035657 | 3300049769 | Unclassified | 648 |
| 1307 | Ga0501273_011690 | 3300049770 | Bacteria | 1097 |
| 1308 | Ga0501273_075213 | 3300049770 | Unclassified | 554 |
| 1309 | Ga0501044_0003683 | 3300049823 | Bacteria | 17228 |
| 1310 | Ga0501044_0235840 | 3300049823 | Bacteria | 1775 |
| 1311 | Ga0501045_0014893 | 3300049824 | Bacteria | 5516 |
| 1312 | nmdc:mga05p37_1927118_c1 | 3300050507 | Bacteria | 563 |
| 1313 | nmdc:mga05p37_352966_c1 | 3300050507 | Unclassified | 946 |
| 1314 | nmdc:mga05p37_385546_c1 | 3300050507 | Bacteria | 1641 |
| 1315 | nmdc:mga05p37_60165_c1 | 3300050507 | Bacteria | 4677 |
| 1316 | nmdc:mga09592_1137302_c1 | 3300050508 | Bacteria | 648 |
| 1317 | nmdc:mga09592_1156241_c1 | 3300050508 | Unclassified | 641 |
| 1318 | nmdc:mga09592_130564_c1 | 3300050508 | Bacteria | 2161 |
| 1319 | nmdc:mga09592_1715814_c1 | 3300050508 | Bacteria | 506 |
| 1320 | nmdc:mga09592_238092_c1 | 3300050508 | Bacteria | 1577 |
| 1321 | nmdc:mga09592_25522_c1 | 3300050508 | Bacteria | 4892 |
| 1322 | nmdc:mga09592_512166_c1 | 3300050508 | Bacteria | 1032 |
| 1323 | nmdc:mga0qj67_1051269_c1 | 3300050509 | Bacteria | 637 |
| 1324 | nmdc:mga0qj67_127949_c1 | 3300050509 | Bacteria | 2056 |
| 1325 | nmdc:mga0qj67_1318174_c1 | 3300050509 | Bacteria | 559 |
| 1326 | nmdc:mga0qj67_138992_c1 | 3300050509 | Bacteria | 1969 |
| 1327 | nmdc:mga0qj67_158591_c1 | 3300050509 | Bacteria | 1837 |
| 1328 | nmdc:mga0qj67_19069_c1 | 3300050509 | Bacteria | 5237 |
| 1329 | nmdc:mga0qj67_20933_c1 | 3300050509 | Bacteria | 5012 |
| 1330 | nmdc:mga0qj67_26367_c1 | 3300050509 | Bacteria | 4499 |
| 1331 | nmdc:mga0qj67_690188_c1 | 3300050509 | Bacteria | 813 |
| 1332 | nmdc:mga06r32_1148651_c1 | 3300050510 | Bacteria | 724 |
| 1333 | nmdc:mga06r32_145013_c1 | 3300050510 | Bacteria | 2352 |
| 1334 | nmdc:mga06r32_182385_c1 | 3300050510 | Bacteria | 2085 |
| 1335 | nmdc:mga06r32_21909_c1 | 3300050510 | Bacteria | 5900 |
| 1336 | nmdc:mga06r32_312252_c1 | 3300050510 | Unclassified | 1558 |
| 1337 | nmdc:mga06r32_36042_c1 | 3300050510 | Bacteria | 4671 |
| 1338 | nmdc:mga06r32_561985_c1 | 3300050510 | Bacteria | 1114 |
| 1339 | nmdc:mga06r32_78254_c1 | 3300050510 | Bacteria | 3214 |
| 1340 | nmdc:mga08y16_343165_c1 | 3300050511 | Bacteria | 1535 |
| 1341 | nmdc:mga08y16_408998_c1 | 3300050511 | Bacteria | 1388 |
| 1342 | nmdc:mga0n895_100600_c1 | 3300050512 | Bacteria | 2900 |
| 1343 | nmdc:mga0n895_18096_c1 | 3300050512 | Bacteria | 6514 |
| 1344 | nmdc:mga0n895_295417_c1 | 3300050512 | Unclassified | 1642 |
| 1345 | nmdc:mga0n895_29871_c1 | 3300050512 | Bacteria | 5203 |
| 1346 | nmdc:mga0n895_333004_c1 | 3300050512 | Bacteria | 1538 |
| 1347 | nmdc:mga0n895_647163_c1 | 3300050512 | Bacteria | 1056 |
| 1348 | nmdc:mga0rr50_1099731_c1 | 3300050513 | Bacteria | 676 |
| 1349 | nmdc:mga0rr50_251480_c1 | 3300050513 | Bacteria | 1468 |
| 1350 | nmdc:mga0rr50_696998_c1 | 3300050513 | Unclassified | 867 |
| 1351 | nmdc:mga08x19_125037_c1 | 3300050514 | Bacteria | 1726 |
| 1352 | nmdc:mga08x19_24045_c1 | 3300050514 | Bacteria | 3783 |
| 1353 | nmdc:mga08x19_589444_c1 | 3300050514 | Unclassified | 788 |
| 1354 | nmdc:mga08x19_9458_c1 | 3300050514 | Bacteria | 5837 |
| 1355 | nmdc:mga0a205_131602_c1 | 3300050515 | Bacteria | 2402 |
| 1356 | nmdc:mga0a205_7731_c1 | 3300050515 | Bacteria | 9759 |
| 1357 | nmdc:mga0a205_854553_c1 | 3300050515 | Bacteria | 757 |
| 1358 | nmdc:mga0a205_8915_c1 | 3300050515 | Bacteria | 9141 |
| 1359 | Ga0495601_0441565 | 3300053077 | Bacteria | 842 |
| 1360 | Ga0495612_0237976 | 3300053078 | Bacteria | 808 |
| 1361 | Ga0495595_0042201 | 3300053084 | Bacteria | 2090 |
| 1362 | Ga0590071_029891 | 3300059421 | Bacteria | 1296 |
| 1363 | Ga0590071_036978 | 3300059421 | Bacteria | 1171 |
| 1364 | Ga0590075_069820 | 3300059424 | Bacteria | 907 |
| 1365 | Ga0590077_022527 | 3300059426 | Bacteria | 1345 |
| 1366 | Ga0587089_072147 | 3300059509 | Bacteria | 588 |
| 1367 | Ga0587090_111849 | 3300059510 | Unclassified | 583 |
| 1368 | Ga0587091_127973 | 3300059511 | Bacteria | 624 |
| 1369 | Ga0501082_0044913 | 3300060353 | Bacteria | 3811 |
| 1370 | Ga0501082_1419574 | 3300060353 | Bacteria | 606 |
| 1371 | Ga0070683_100000914 | |||
| 1372 | JGI24749J21850_1036818 | |||
| 1373 | JGI25406J46586_10059482 | |||
| 1374 | Ga0058859_11508720 | |||
| 1375 | Ga0058863_11460199 | |||
| 1376 | Ga0058863_11772184 | |||
| 1377 | Ga0058863_11915949 | |||
| 1378 | Ga0058861_11720212 | |||
| 1379 | Ga0058861_11993866 | |||
| 1380 | Ga0058862_12187540 | |||
| 1381 | Ga0058862_12796990 | |||
| 1382 | Ga0058862_12833528 | |||
| 1383 | Ga0058862_12863587 | |||
| 1384 | Ga0065712_10093097 | |||
| 1385 | Ga0065712_10386959 | |||
| 1386 | Ga0065715_10105782 | |||
| 1387 | Ga0065715_10211602 | |||
| 1388 | Ga0065715_10843969 | |||
| 1389 | Ga0065707_10499732 | |||
| 1390 | Ga0070658_10008963 | |||
| 1391 | Ga0070658_10079313 | |||
| 1392 | Ga0070658_10097101 | |||
| 1393 | Ga0070658_10242904 | |||
| 1394 | Ga0070658_10272792 | |||
| 1395 | Ga0070658_10517203 | |||
| 1396 | Ga0070658_10756607 | |||
| 1397 | Ga0070676_10024660 | |||
| 1398 | Ga0070676_10028080 | |||
| 1399 | Ga0070676_10075115 | |||
| 1400 | Ga0070676_10169483 | |||
| 1401 | Ga0070676_10196174 | |||
| 1402 | Ga0070676_10300379 | |||
| 1403 | Ga0070676_10408214 | |||
| 1404 | Ga0070676_10656702 | |||
| 1405 | Ga0070683_100004028 | |||
| 1406 | Ga0070683_100004580 | |||
| 1407 | Ga0070683_100011985 | |||
| 1408 | Ga0070683_100016824 | |||
| 1409 | Ga0070683_100024969 | |||
| 1410 | Ga0070683_100045674 | |||
| 1411 | Ga0070683_100084391 | |||
| 1412 | Ga0070683_100094410 | |||
| 1413 | Ga0070683_100232236 | |||
| 1414 | Ga0070683_100271521 | |||
| 1415 | Ga0070683_100326625 | |||
| 1416 | Ga0070683_100577685 | |||
| 1417 | Ga0070683_100799696 | |||
| 1418 | Ga0070683_100988192 | |||
| 1419 | Ga0070683_101201577 | |||
| 1420 | Ga0070690_100015139 | |||
| 1421 | Ga0070690_100040265 | |||
| 1422 | Ga0070690_100534174 | |||
| 1423 | Ga0070690_100736596 | |||
| 1424 | Ga0070690_100759827 | |||
| 1425 | Ga0070670_100033354 | |||
| 1426 | Ga0070670_100078982 | |||
| 1427 | Ga0070670_100165222 | |||
| 1428 | Ga0070670_100351366 | |||
| 1429 | Ga0070670_100700422 | |||
| 1430 | Ga0070670_100779322 | |||
| 1431 | Ga0070670_100816618 | |||
| 1432 | Ga0070677_10091326 | |||
| 1433 | Ga0070677_10256846 | |||
| 1434 | Ga0068869_100627944 | |||
| 1435 | Ga0068869_100895018 | |||
| 1436 | Ga0070666_10378477 | |||
| 1437 | Ga0070680_100000010 | |||
| 1438 | Ga0070680_100016417 | |||
| 1439 | Ga0070680_100051986 | |||
| 1440 | Ga0070680_100062216 | |||
| 1441 | Ga0070680_100077514 | |||
| 1442 | Ga0070680_100077788 | |||
| 1443 | Ga0070680_100081540 | |||
| 1444 | Ga0070680_100335218 | |||
| 1445 | Ga0070680_100843550 | |||
| 1446 | Ga0070680_100957835 | |||
| 1447 | Ga0070680_101036659 | |||
| 1448 | Ga0070682_100020205 | |||
| 1449 | Ga0070682_100122456 | |||
| 1450 | Ga0070682_100132192 | |||
| 1451 | Ga0070682_100216705 | |||
| 1452 | Ga0070682_100456526 | |||
| 1453 | Ga0070682_100489176 | |||
| 1454 | Ga0068868_100015799 | |||
| 1455 | Ga0068868_100048702 | |||
| 1456 | Ga0068868_100239599 | |||
| 1457 | Ga0068868_100293905 | |||
| 1458 | Ga0068868_101634798 | |||
| 1459 | Ga0070660_100014384 | |||
| 1460 | Ga0070660_100397643 | |||
| 1461 | Ga0070660_100437087 | |||
| 1462 | Ga0070689_100024708 | |||
| 1463 | Ga0070689_100170598 | |||
| 1464 | Ga0070689_100404994 | |||
| 1465 | Ga0070691_10014564 | |||
| 1466 | Ga0070691_10031926 | |||
| 1467 | Ga0070691_10033433 | |||
| 1468 | Ga0070691_10085438 | |||
| 1469 | Ga0070691_10140722 | |||
| 1470 | Ga0070691_10360368 | |||
| 1471 | Ga0070687_100004192 | |||
| 1472 | Ga0070687_100041059 | |||
| 1473 | Ga0070687_100062846 | |||
| 1474 | Ga0070661_100008603 | |||
| 1475 | Ga0070661_100013325 | |||
| 1476 | Ga0070661_100078583 | |||
| 1477 | Ga0070661_100137691 | |||
| 1478 | Ga0070661_101888662 | |||
| 1479 | Ga0070692_10051290 | |||
| 1480 | Ga0070692_10265842 | |||
| 1481 | Ga0070692_10492311 | |||
| 1482 | Ga0070668_100022290 | |||
| 1483 | Ga0070668_100112425 | |||
| 1484 | Ga0070668_100160374 | |||
| 1485 | Ga0070668_101187431 | |||
| 1486 | Ga0070668_101243833 | |||
| 1487 | Ga0070668_101819402 | |||
| 1488 | Ga0070669_100000431 | |||
| 1489 | Ga0070669_100007862 | |||
| 1490 | Ga0070669_100040274 | |||
| 1491 | Ga0070669_100042955 | |||
| 1492 | Ga0070669_100132355 | |||
| 1493 | Ga0070669_100265810 | |||
| 1494 | Ga0070669_101464147 | |||
| 1495 | Ga0070675_100006006 | |||
| 1496 | Ga0070675_100031034 | |||
| 1497 | Ga0070675_100045778 | |||
| 1498 | Ga0070675_100046593 | |||
| 1499 | Ga0070675_100127922 | |||
| 1500 | Ga0070675_100156956 | |||
| 1501 | Ga0070675_100645516 | |||
| 1502 | Ga0070675_101300632 | |||
| 1503 | Ga0070671_100145737 | |||
| 1504 | Ga0070671_100206372 | |||
| 1505 | Ga0070671_100378861 | |||
| 1506 | Ga0070671_100685991 | |||
| 1507 | Ga0070674_100068016 | |||
| 1508 | Ga0070674_100111523 | |||
| 1509 | Ga0070674_100246574 | |||
| 1510 | Ga0070674_100301803 | |||
| 1511 | Ga0070674_100500303 | |||
| 1512 | Ga0070674_100611255 | |||
| 1513 | Ga0070674_101106202 | |||
| 1514 | Ga0070673_100051016 | |||
| 1515 | Ga0070673_100146946 | |||
| 1516 | Ga0070673_100234503 | |||
| 1517 | Ga0070673_100245940 | |||
| 1518 | Ga0070673_100448308 | |||
| 1519 | Ga0070673_101827010 | |||
| 1520 | Ga0070673_101957736 | |||
| 1521 | Ga0070688_100046871 | |||
| 1522 | Ga0070688_100076527 | |||
| 1523 | Ga0070688_100102832 | |||
| 1524 | Ga0070688_100151422 | |||
| 1525 | Ga0070659_100044995 | |||
| 1526 | Ga0070659_100188505 | |||
| 1527 | Ga0070659_100513955 | |||
| 1528 | Ga0070659_100711727 | |||
| 1529 | Ga0070659_101143478 | |||
| 1530 | Ga0070667_100030245 | |||
| 1531 | Ga0070667_100036770 | |||
| 1532 | Ga0070667_100076515 | |||
| 1533 | Ga0070667_100084208 | |||
| 1534 | Ga0070667_100096057 | |||
| 1535 | Ga0070667_100144813 | |||
| 1536 | Ga0070667_100425422 | |||
| 1537 | Ga0070709_10002485 | |||
| 1538 | Ga0070709_10010493 | |||
| 1539 | Ga0070709_10340334 | |||
| 1540 | Ga0070709_10923485 | |||
| 1541 | Ga0070714_100004586 | |||
| 1542 | Ga0070714_100049437 | |||
| 1543 | Ga0070714_100167165 | |||
| 1544 | Ga0070714_100370251 | |||
| 1545 | Ga0070713_100000196 | |||
| 1546 | Ga0070713_100015290 | |||
| 1547 | Ga0070713_100066727 | |||
| 1548 | Ga0070710_10027153 | |||
| 1549 | Ga0070710_11354728 | |||
| 1550 | Ga0070701_10008088 | |||
| 1551 | Ga0070701_10180897 | |||
| 1552 | Ga0070711_100135598 | |||
| 1553 | Ga0070711_100430570 | |||
| 1554 | Ga0070705_100028775 | |||
| 1555 | Ga0070700_100053030 | |||
| 1556 | Ga0070700_100127439 | |||
| 1557 | Ga0070700_100194942 | |||
| 1558 | Ga0070700_100252388 | |||
| 1559 | Ga0070700_100803035 | |||
| 1560 | Ga0070700_101034780 | |||
| 1561 | Ga0070700_101306024 | |||
| 1562 | Ga0070694_100070264 | |||
| 1563 | Ga0070694_100137090 | |||
| 1564 | Ga0070694_100168061 | |||
| 1565 | Ga0070694_100197646 | |||
| 1566 | Ga0070694_100314148 | |||
| 1567 | Ga0070708_100000025 | |||
| 1568 | Ga0070708_100014311 | |||
| 1569 | Ga0070708_100550537 | |||
| 1570 | Ga0070663_100103275 | |||
| 1571 | Ga0070663_100129361 | |||
| 1572 | Ga0070678_100076827 | |||
| 1573 | Ga0070678_100188247 | |||
| 1574 | Ga0070678_100650231 | |||
| 1575 | Ga0070678_101224314 | |||
| 1576 | Ga0070662_100010644 | |||
| 1577 | Ga0070662_100202818 | |||
| 1578 | Ga0070662_100660780 | |||
| 1579 | Ga0070681_10007819 | |||
| 1580 | Ga0070681_10008138 | |||
| 1581 | Ga0070681_10031391 | |||
| 1582 | Ga0070681_10039500 | |||
| 1583 | Ga0070681_10080795 | |||
| 1584 | Ga0070681_10103118 | |||
| 1585 | Ga0070681_10250291 | |||
| 1586 | Ga0070681_10277496 | |||
| 1587 | Ga0070681_10400357 | |||
| 1588 | Ga0070681_10438187 | |||
| 1589 | Ga0068867_100027571 | |||
| 1590 | Ga0068867_100089882 | |||
| 1591 | Ga0068867_100093105 | |||
| 1592 | Ga0068867_100129305 | |||
| 1593 | Ga0068867_100261223 | |||
| 1594 | Ga0068867_100299558 | |||
| 1595 | Ga0068867_100435738 | |||
| 1596 | Ga0070685_10012072 | |||
| 1597 | Ga0070685_10039975 | |||
| 1598 | Ga0070685_10366462 | |||
| 1599 | Ga0070685_10381812 | |||
| 1600 | Ga0070685_10838654 | |||
| 1601 | Ga0070706_100061780 | |||
| 1602 | Ga0070706_100149082 | |||
| 1603 | Ga0070707_100004196 | |||
| 1604 | Ga0070707_100233677 | |||
| 1605 | Ga0070707_100670230 | |||
| 1606 | Ga0070698_100037275 | |||
| 1607 | Ga0070698_100151048 | |||
| 1608 | Ga0070698_100343810 | |||
| 1609 | Ga0070698_100389326 | |||
| 1610 | Ga0070698_100617553 | |||
| 1611 | Ga0070699_100013240 | |||
| 1612 | Ga0070699_100023699 | |||
| 1613 | Ga0070699_100068820 | |||
| 1614 | Ga0070699_100358501 | |||
| 1615 | Ga0070679_100003720 | |||
| 1616 | Ga0070679_100016597 | |||
| 1617 | Ga0070679_100061388 | |||
| 1618 | Ga0070679_100074759 | |||
| 1619 | Ga0070679_100094722 | |||
| 1620 | Ga0070679_100114728 | |||
| 1621 | Ga0070679_100120874 | |||
| 1622 | Ga0070679_100152145 | |||
| 1623 | Ga0070679_100232458 | |||
| 1624 | Ga0070679_100241404 | |||
| 1625 | Ga0070679_100294389 | |||
| 1626 | Ga0070679_101848092 | |||
| 1627 | Ga0070684_100004941 | |||
| 1628 | Ga0070684_100021662 | |||
| 1629 | Ga0070684_100022792 | |||
| 1630 | Ga0070684_100032908 | |||
| 1631 | Ga0070684_100057872 | |||
| 1632 | Ga0070684_100086975 | |||
| 1633 | Ga0070684_100104767 | |||
| 1634 | Ga0070684_100129972 | |||
| 1635 | Ga0070684_100184656 | |||
| 1636 | Ga0070684_100211512 | |||
| 1637 | Ga0070684_100269916 | |||
| 1638 | Ga0070684_100335863 | |||
| 1639 | Ga0070684_100340927 | |||
| 1640 | Ga0070684_101615162 | |||
| 1641 | Ga0070697_100032152 | |||
| 1642 | Ga0070697_100073961 | |||
| 1643 | Ga0068853_100155549 | |||
| 1644 | Ga0068853_100234821 | |||
| 1645 | Ga0068853_100284881 | |||
| 1646 | Ga0068853_101452525 | |||
| 1647 | Ga0070672_100017769 | |||
| 1648 | Ga0070672_100093488 | |||
| 1649 | Ga0070672_100099391 | |||
| 1650 | Ga0070672_100127755 | |||
| 1651 | Ga0070672_100168226 | |||
| 1652 | Ga0070672_100251410 | |||
| 1653 | Ga0070672_100279578 | |||
| 1654 | Ga0070672_100717978 | |||
| 1655 | Ga0070672_101384489 | |||
| 1656 | Ga0070686_100098968 | |||
| 1657 | Ga0070695_100316837 | |||
| 1658 | Ga0070695_100796229 | |||
| 1659 | Ga0070695_100862937 | |||
| 1660 | Ga0070696_100000569 | |||
| 1661 | Ga0070696_100001843 | |||
| 1662 | Ga0070696_100022547 | |||
| 1663 | Ga0070696_100032961 | |||
| 1664 | Ga0070696_100061706 | |||
| 1665 | Ga0070696_100116243 | |||
| 1666 | Ga0070693_100028201 | |||
| 1667 | Ga0070693_100066254 | |||
| 1668 | Ga0070693_100596771 | |||
| 1669 | Ga0070665_100328730 | |||
| 1670 | Ga0070665_101487667 | |||
| 1671 | Ga0070665_101832396 | |||
| 1672 | Ga0070704_100002736 | |||
| 1673 | Ga0070704_100019323 | |||
| 1674 | Ga0070704_100025886 | |||
| 1675 | Ga0070704_100190860 | |||
| 1676 | Ga0068855_100010843 | |||
| 1677 | Ga0068855_100067864 | |||
| 1678 | Ga0068855_100099477 | |||
| 1679 | Ga0068855_100237577 | |||
| 1680 | Ga0068855_100599515 | |||
| 1681 | Ga0068855_100746249 | |||
| 1682 | Ga0068855_100861870 | |||
| 1683 | Ga0068855_101116712 | |||
| 1684 | Ga0068855_101146963 | |||
| 1685 | Ga0068855_101671446 | |||
| 1686 | Ga0070664_100001163 | |||
| 1687 | Ga0070664_100032756 | |||
| 1688 | Ga0070664_100042123 | |||
| 1689 | Ga0070664_100053851 | |||
| 1690 | Ga0070664_100058462 | |||
| 1691 | Ga0070664_100091594 | |||
| 1692 | Ga0070664_100117959 | |||
| 1693 | Ga0070664_100236253 | |||
| 1694 | Ga0070664_100521792 | |||
| 1695 | Ga0070664_100591583 | |||
| 1696 | Ga0070664_100633580 | |||
| 1697 | Ga0070664_101702702 | |||
| 1698 | Ga0068857_100018350 | |||
| 1699 | Ga0068857_100112463 | |||
| 1700 | Ga0068857_100204113 | |||
| 1701 | Ga0068857_100266308 | |||
| 1702 | Ga0068857_100500254 | |||
| 1703 | Ga0068857_100741812 | |||
| 1704 | Ga0068857_101751430 | |||
| 1705 | Ga0068854_100009778 | |||
| 1706 | Ga0068854_100023349 | |||
| 1707 | Ga0068854_100025031 | |||
| 1708 | Ga0068854_100346876 | |||
| 1709 | Ga0068854_100537748 | |||
| 1710 | Ga0068854_100859417 | |||
| 1711 | Ga0068854_101345134 | |||
| 1712 | Ga0068854_101832262 | |||
| 1713 | Ga0068856_100141013 | |||
| 1714 | Ga0068856_100271486 | |||
| 1715 | Ga0068856_100485469 | |||
| 1716 | Ga0068856_102134213 | |||
| 1717 | Ga0070702_100065010 | |||
| 1718 | Ga0070702_101177249 | |||
| 1719 | Ga0068852_100015330 | |||
| 1720 | Ga0068852_100028072 | |||
| 1721 | Ga0068852_100052592 | |||
| 1722 | Ga0068852_100059930 | |||
| 1723 | Ga0068852_100531315 | |||
| 1724 | Ga0068852_100989559 | |||
| 1725 | Ga0068859_100038158 | |||
| 1726 | Ga0068859_100083687 | |||
| 1727 | Ga0068859_100084282 | |||
| 1728 | Ga0068859_100370831 | |||
| 1729 | Ga0068864_100052106 | |||
| 1730 | Ga0068864_100062593 | |||
| 1731 | Ga0068864_100469716 | |||
| 1732 | Ga0068864_101431584 | |||
| 1733 | Ga0068864_101731111 | |||
| 1734 | Ga0068866_10055185 | |||
| 1735 | Ga0068866_10229586 | |||
| 1736 | Ga0068866_10474794 | |||
| 1737 | Ga0068861_100071518 | |||
| 1738 | Ga0068861_100895797 | |||
| 1739 | Ga0068851_10070172 | |||
| 1740 | Ga0068851_10208775 | |||
| 1741 | Ga0068851_10281974 | |||
| 1742 | Ga0068851_10458262 | |||
| 1743 | Ga0068870_10015290 | |||
| 1744 | Ga0068870_10045962 | |||
| 1745 | Ga0068863_100077222 | |||
| 1746 | Ga0068863_100288446 | |||
| 1747 | Ga0068863_100477226 | |||
| 1748 | Ga0068863_100885579 | |||
| 1749 | Ga0068863_101815222 | |||
| 1750 | Ga0068858_100208622 | |||
| 1751 | Ga0068860_100178786 | |||
| 1752 | Ga0068860_100181900 | |||
| 1753 | Ga0068860_100235724 | |||
| 1754 | Ga0068860_100395778 | |||
| 1755 | Ga0068860_101111028 | |||
| 1756 | Ga0068862_100000345 | |||
| 1757 | Ga0068862_100112879 | |||
| 1758 | Ga0068862_100151593 | |||
| 1759 | Ga0081455_10089316 | |||
| 1760 | Ga0081539_10000221 | |||
| 1761 | Ga0070717_10001614 | |||
| 1762 | Ga0070712_100050871 | |||
| 1763 | Ga0070712_100055819 | |||
| 1764 | Ga0097621_100101720 | |||
| 1765 | Ga0097621_100689497 | |||
| 1766 | Ga0068871_100141038 | |||
| 1767 | Ga0068871_100460887 | |||
| 1768 | Ga0068871_100482611 | |||
| 1769 | Ga0068871_100751601 | |||
| 1770 | Ga0075428_100202153 | |||
| 1771 | Ga0075428_100842328 | |||
| 1772 | Ga0075430_100006599 | |||
| 1773 | Ga0075430_100032971 | |||
| 1774 | Ga0075430_100039156 | |||
| 1775 | Ga0075430_100082368 | |||
| 1776 | Ga0075430_100159699 | |||
| 1777 | Ga0075430_100694011 | |||
| 1778 | Ga0075430_101157904 | |||
| 1779 | Ga0075431_100003201 | |||
| 1780 | Ga0075431_100097822 | |||
| 1781 | Ga0075431_100156632 | |||
| 1782 | Ga0075431_100297065 | |||
| 1783 | Ga0075431_100312989 | |||
| 1784 | Ga0075431_100568716 | |||
| 1785 | Ga0075431_101121870 | |||
| 1786 | Ga0075431_101661809 | |||
| 1787 | Ga0075433_10002069 | |||
| 1788 | Ga0075433_10047897 | |||
| 1789 | Ga0075434_100015554 | |||
| 1790 | Ga0075434_100036023 | |||
| 1791 | Ga0075434_100043530 | |||
| 1792 | Ga0075434_100777511 | |||
| 1793 | Ga0075429_100003639 | |||
| 1794 | Ga0075429_100048519 | |||
| 1795 | Ga0075429_100206334 | |||
| 1796 | Ga0075429_100261267 | |||
| 1797 | Ga0075429_100524559 | |||
| 1798 | Ga0075429_100577651 | |||
| 1799 | Ga0068865_100007652 | |||
| 1800 | Ga0068865_100043303 | |||
| 1801 | Ga0068865_100156493 | |||
| 1802 | Ga0068865_100527710 | |||
| 1803 | Ga0068865_101265731 | |||
| 1804 | Ga0075436_100002301 | |||
| 1805 | Ga0075436_100013028 | |||
| 1806 | Ga0075436_100048982 | |||
| 1807 | Ga0097620_100038159 | |||
| 1808 | Ga0097620_100083689 | |||
| 1809 | Ga0097620_100084286 | |||
| 1810 | Ga0097620_100370860 | |||
| 1811 | Ga0075435_100438974 | |||
| 1812 | Ga0105240_10004437 | |||
| 1813 | Ga0105240_10023119 | |||
| 1814 | Ga0105240_10057070 | |||
| 1815 | Ga0105240_10134011 | |||
| 1816 | Ga0105240_10763615 | |||
| 1817 | Ga0105240_10923511 | |||
| 1818 | Ga0105240_11664833 | |||
| 1819 | Ga0111539_10018859 | |||
| 1820 | Ga0111539_10083002 | |||
| 1821 | Ga0111539_11394404 | |||
| 1822 | Ga0105245_10200643 | |||
| 1823 | Ga0105245_10280170 | |||
| 1824 | Ga0105245_10288039 | |||
| 1825 | Ga0105245_10819580 | |||
| 1826 | Ga0105245_11158592 | |||
| 1827 | Ga0105245_11181373 | |||
| 1828 | Ga0105245_11386390 | |||
| 1829 | Ga0105245_11387830 | |||
| 1830 | Ga0105247_10147270 | |||
| 1831 | Ga0114129_10141803 | |||
| 1832 | Ga0114129_10280082 | |||
| 1833 | Ga0114129_11881448 | |||
| 1834 | Ga0105243_10205789 | |||
| 1835 | Ga0105243_10942439 | |||
| 1836 | Ga0105243_11767242 | |||
| 1837 | Ga0105241_10012411 | |||
| 1838 | Ga0105241_10106603 | |||
| 1839 | Ga0105241_10150260 | |||
| 1840 | Ga0105242_10015286 | |||
| 1841 | Ga0105242_10044869 | |||
| 1842 | Ga0105242_10085069 | |||
| 1843 | Ga0105242_10703948 | |||
| 1844 | Ga0105248_10010930 | |||
| 1845 | Ga0105248_10053946 | |||
| 1846 | Ga0105248_10069952 | |||
| 1847 | Ga0105248_10309714 | |||
| 1848 | Ga0105248_10438966 | |||
| 1849 | Ga0105248_10641304 | |||
| 1850 | Ga0105248_10706521 | |||
| 1851 | Ga0105248_10709083 | |||
| 1852 | Ga0105237_10026780 | |||
| 1853 | Ga0105237_10186091 | |||
| 1854 | Ga0105237_10276573 | |||
| 1855 | Ga0105237_11031213 | |||
| 1856 | Ga0105238_10060734 | |||
| 1857 | Ga0105238_10141799 | |||
| 1858 | Ga0105238_10573937 | |||
| 1859 | Ga0105249_10000276 | |||
| 1860 | Ga0105249_10025588 | |||
| 1861 | Ga0105249_10135183 | |||
| 1862 | Ga0105239_10321020 | |||
| 1863 | Ga0105239_11323371 | |||
| 1864 | Ga0105239_13450511 | |||
| 1865 | Ga0105246_10090990 | |||
| 1866 | Ga0105246_10325804 | |||
| 1867 | Ga0105246_10725057 | |||
| 1868 | Ga0157373_10000674 | |||
| 1869 | Ga0157373_10083963 | |||
| 1870 | Ga0157373_10175732 | |||
| 1871 | Ga0157373_10242259 | |||
| 1872 | Ga0157373_10648950 | |||
| 1873 | Ga0157371_10007249 | |||
| 1874 | Ga0157371_10086632 | |||
| 1875 | Ga0157371_10174992 | |||
| 1876 | Ga0157371_10489199 | |||
| 1877 | Ga0157371_10631511 | |||
| 1878 | Ga0157370_10005892 | |||
| 1879 | Ga0157370_10006750 | |||
| 1880 | Ga0157370_10042235 | |||
| 1881 | Ga0157370_10055314 | |||
| 1882 | Ga0157370_10063356 | |||
| 1883 | Ga0157370_10155255 | |||
| 1884 | Ga0157370_10290124 | |||
| 1885 | Ga0157370_10373213 | |||
| 1886 | Ga0157370_10708497 | |||
| 1887 | Ga0157370_11137233 | |||
| 1888 | Ga0157370_11598944 | |||
| 1889 | Ga0157369_10010955 | |||
| 1890 | Ga0157369_10028668 | |||
| 1891 | Ga0157369_10099704 | |||
| 1892 | Ga0157369_10129696 | |||
| 1893 | Ga0157369_10301239 | |||
| 1894 | Ga0157369_10635063 | |||
| 1895 | Ga0157369_10757009 | |||
| 1896 | Ga0157369_10950489 | |||
| 1897 | Ga0157369_11159981 | |||
| 1898 | Ga0157374_10015504 | |||
| 1899 | Ga0157374_10133952 | |||
| 1900 | Ga0157374_10216006 | |||
| 1901 | Ga0157374_10249779 | |||
| 1902 | Ga0157374_11283545 | |||
| 1903 | Ga0157378_10029108 | |||
| 1904 | Ga0157378_10060345 | |||
| 1905 | Ga0157378_10092357 | |||
| 1906 | Ga0157378_10179396 | |||
| 1907 | Ga0157378_10260006 | |||
| 1908 | Ga0157378_10470850 | |||
| 1909 | Ga0163162_10075611 | |||
| 1910 | Ga0163162_10078881 | |||
| 1911 | Ga0163162_10104238 | |||
| 1912 | Ga0163162_10568651 | |||
| 1913 | Ga0163162_10722095 | |||
| 1914 | Ga0157372_10011736 | |||
| 1915 | Ga0157372_10036892 | |||
| 1916 | Ga0157372_10052954 | |||
| 1917 | Ga0157372_10056818 | |||
| 1918 | Ga0157372_10097004 | |||
| 1919 | Ga0157372_10098929 | |||
| 1920 | Ga0157372_10129228 | |||
| 1921 | Ga0157372_10174213 | |||
| 1922 | Ga0157372_10515700 | |||
| 1923 | Ga0157372_10643682 | |||
| 1924 | Ga0157372_11347820 | |||
| 1925 | Ga0157372_11851538 | |||
| 1926 | Ga0157372_12251215 | |||
| 1927 | Ga0157375_10015641 | |||
| 1928 | Ga0157375_10033974 | |||
| 1929 | Ga0157375_10034069 | |||
| 1930 | Ga0157375_10052054 | |||
| 1931 | Ga0157375_10078385 | |||
| 1932 | Ga0157375_10080902 | |||
| 1933 | Ga0157375_10242986 | |||
| 1934 | Ga0157375_10366758 | |||
| 1935 | Ga0157375_10512092 | |||
| 1936 | Ga0163163_10215396 | |||
| 1937 | Ga0163163_10811635 | |||
| 1938 | Ga0157380_10009657 | |||
| 1939 | Ga0157380_10124883 | |||
| 1940 | Ga0157380_12886611 | |||
| 1941 | Ga0157377_10032521 | |||
| 1942 | Ga0157379_10964651 | |||
| 1943 | Ga0182007_10049935 | |||
| 1944 | Ga0182005_1200827 | |||
| 1945 | Ga0163161_10102435 | |||
| 1946 | Ga0163161_10225197 | |||
| 1947 | Ga0163161_10404345 | |||
| 1948 | Ga0163161_10589222 | |||
| 1949 | Ga0197907_10300930 | |||
| 1950 | Ga0197907_10335747 | |||
| 1951 | Ga0197907_10694383 | |||
| 1952 | Ga0206356_11166277 | |||
| 1953 | Ga0206355_1021136 | |||
| 1954 | Ga0206355_1195921 | |||
| 1955 | Ga0206352_10376517 | |||
| 1956 | Ga0206350_10779916 | |||
| 1957 | Ga0206350_10804192 | |||
| 1958 | Ga0206354_10528991 | |||
| 1959 | Ga0206354_11308762 | |||
| 1960 | Ga0206353_10548619 | |||
| 1961 | Ga0206353_11927621 | |||
| 1962 | Ga0213876_10049722 | |||
| 1963 | Ga0213876_10056960 | |||
| 1964 | Ga0224712_10075175 | |||
| 1965 | Ga0224712_10181660 | |||
| 1966 | Ga0224712_10353641 | |||
| 1967 | Ga0207656_10011423 | |||
| 1968 | Ga0207656_10176164 | |||
| 1969 | Ga0207656_10292518 | |||
| 1970 | Ga0207682_10025320 | |||
| 1971 | Ga0207682_10194326 | |||
| 1972 | Ga0207692_10071496 | |||
| 1973 | Ga0207692_10215920 | |||
| 1974 | Ga0207692_10749304 | |||
| 1975 | Ga0207642_10007202 | |||
| 1976 | Ga0207642_10035667 | |||
| 1977 | Ga0207688_10069540 | |||
| 1978 | Ga0207688_10527562 | |||
| 1979 | Ga0207688_10911683 | |||
| 1980 | Ga0207680_10107631 | |||
| 1981 | Ga0207680_10378155 | |||
| 1982 | Ga0207647_10369324 | |||
| 1983 | Ga0207699_10008689 | |||
| 1984 | Ga0207699_10008886 | |||
| 1985 | Ga0207699_10021920 | |||
| 1986 | Ga0207699_10121357 | |||
| 1987 | Ga0207699_10475370 | |||
| 1988 | Ga0207645_10037165 | |||
| 1989 | Ga0207645_10083887 | |||
| 1990 | Ga0207645_10095920 | |||
| 1991 | Ga0207645_10171647 | |||
| 1992 | Ga0207645_10183254 | |||
| 1993 | Ga0207645_10283889 | |||
| 1994 | Ga0207645_10703160 | |||
| 1995 | Ga0207643_10038892 | |||
| 1996 | Ga0207643_10046398 | |||
| 1997 | Ga0207643_10061108 | |||
| 1998 | Ga0207705_10001964 | |||
| 1999 | Ga0207705_10003814 | |||
| 2000 | Ga0207705_10088802 | |||
| 2001 | Ga0207705_10091858 | |||
| 2002 | Ga0207705_10121294 | |||
| 2003 | Ga0207705_10229631 | |||
| 2004 | Ga0207705_10610855 | |||
| 2005 | Ga0207705_11320602 | |||
| 2006 | Ga0207684_10071570 | |||
| 2007 | Ga0207684_10086348 | |||
| 2008 | Ga0207684_10758080 | |||
| 2009 | Ga0207654_10047074 | |||
| 2010 | Ga0207654_10138424 | |||
| 2011 | Ga0207707_10001832 | |||
| 2012 | Ga0207707_10003256 | |||
| 2013 | Ga0207707_10007887 | |||
| 2014 | Ga0207707_10012641 | |||
| 2015 | Ga0207707_10025337 | |||
| 2016 | Ga0207707_10048537 | |||
| 2017 | Ga0207707_10077973 | |||
| 2018 | Ga0207707_10113684 | |||
| 2019 | Ga0207707_10129275 | |||
| 2020 | Ga0207707_10339436 | |||
| 2021 | Ga0207707_11170911 | |||
| 2022 | Ga0207695_10003486 | |||
| 2023 | Ga0207695_10017609 | |||
| 2024 | Ga0207695_10019830 | |||
| 2025 | Ga0207695_10023027 | |||
| 2026 | Ga0207695_10062168 | |||
| 2027 | Ga0207695_10139100 | |||
| 2028 | Ga0207695_10766503 | |||
| 2029 | Ga0207695_10781330 | |||
| 2030 | Ga0207695_10987763 | |||
| 2031 | Ga0207695_11680433 | |||
| 2032 | Ga0207671_10146011 | |||
| 2033 | Ga0207671_10158570 | |||
| 2034 | Ga0207671_10336824 | |||
| 2035 | Ga0207693_10018764 | |||
| 2036 | Ga0207693_10101397 | |||
| 2037 | Ga0207693_10605541 | |||
| 2038 | Ga0207663_10070604 | |||
| 2039 | Ga0207663_10405262 | |||
| 2040 | Ga0207663_10729702 | |||
| 2041 | Ga0207660_10000760 | |||
| 2042 | Ga0207660_10002967 | |||
| 2043 | Ga0207660_10011047 | |||
| 2044 | Ga0207660_10011960 | |||
| 2045 | Ga0207660_10035829 | |||
| 2046 | Ga0207660_10064879 | |||
| 2047 | Ga0207660_10156849 | |||
| 2048 | Ga0207660_10234408 | |||
| 2049 | Ga0207660_10769942 | |||
| 2050 | Ga0207662_10001809 | |||
| 2051 | Ga0207662_10050281 | |||
| 2052 | Ga0207662_10061356 | |||
| 2053 | Ga0207657_10014509 | |||
| 2054 | Ga0207657_10023382 | |||
| 2055 | Ga0207657_10054816 | |||
| 2056 | Ga0207657_10059270 | |||
| 2057 | Ga0207657_10268800 | |||
| 2058 | Ga0207649_10036512 | |||
| 2059 | Ga0207649_10040407 | |||
| 2060 | Ga0207649_10050794 | |||
| 2061 | Ga0207649_10071537 | |||
| 2062 | Ga0207649_10098899 | |||
| 2063 | Ga0207649_10100201 | |||
| 2064 | Ga0207649_10180594 | |||
| 2065 | Ga0207649_10194535 | |||
| 2066 | Ga0207649_10631063 | |||
| 2067 | Ga0207649_10674465 | |||
| 2068 | Ga0207652_10000783 | |||
| 2069 | Ga0207652_10005886 | |||
| 2070 | Ga0207652_10017563 | |||
| 2071 | Ga0207652_10027000 | |||
| 2072 | Ga0207652_10057791 | |||
| 2073 | Ga0207652_10073673 | |||
| 2074 | Ga0207652_10116909 | |||
| 2075 | Ga0207652_10121793 | |||
| 2076 | Ga0207652_10124231 | |||
| 2077 | Ga0207652_10284849 | |||
| 2078 | Ga0207652_10323423 | |||
| 2079 | Ga0207652_10324908 | |||
| 2080 | Ga0207652_10326119 | |||
| 2081 | Ga0207652_10753397 | |||
| 2082 | Ga0207652_11031750 | |||
| 2083 | Ga0207646_10007037 | |||
| 2084 | Ga0207646_10074853 | |||
| 2085 | Ga0207646_10082938 | |||
| 2086 | Ga0207646_10734680 | |||
| 2087 | Ga0207681_10000718 | |||
| 2088 | Ga0207681_10023163 | |||
| 2089 | Ga0207681_10034751 | |||
| 2090 | Ga0207681_10124693 | |||
| 2091 | Ga0207681_10739357 | |||
| 2092 | Ga0207694_10103351 | |||
| 2093 | Ga0207694_10465840 | |||
| 2094 | Ga0207694_11294963 | |||
| 2095 | Ga0207650_10110791 | |||
| 2096 | Ga0207650_10129778 | |||
| 2097 | Ga0207650_10267056 | |||
| 2098 | Ga0207650_10358845 | |||
| 2099 | Ga0207650_10595361 | |||
| 2100 | Ga0207650_11872016 | |||
| 2101 | Ga0207659_10047504 | |||
| 2102 | Ga0207659_10101691 | |||
| 2103 | Ga0207659_10121102 | |||
| 2104 | Ga0207659_10435082 | |||
| 2105 | Ga0207659_10504512 | |||
| 2106 | Ga0207687_10232707 | |||
| 2107 | Ga0207687_10378203 | |||
| 2108 | Ga0207687_10396303 | |||
| 2109 | Ga0207687_10840111 | |||
| 2110 | Ga0207687_11065322 | |||
| 2111 | Ga0207700_10044053 | |||
| 2112 | Ga0207700_10045283 | |||
| 2113 | Ga0207700_10555516 | |||
| 2114 | Ga0207700_11095110 | |||
| 2115 | Ga0207664_10027669 | |||
| 2116 | Ga0207664_10041180 | |||
| 2117 | Ga0207644_10043924 | |||
| 2118 | Ga0207644_10081943 | |||
| 2119 | Ga0207644_10113758 | |||
| 2120 | Ga0207644_10175838 | |||
| 2121 | Ga0207644_10308761 | |||
| 2122 | Ga0207644_10586178 | |||
| 2123 | Ga0207690_10059298 | |||
| 2124 | Ga0207690_10149559 | |||
| 2125 | Ga0207690_10689105 | |||
| 2126 | Ga0207690_11585698 | |||
| 2127 | Ga0207706_10095915 | |||
| 2128 | Ga0207706_10164172 | |||
| 2129 | Ga0207706_10239036 | |||
| 2130 | Ga0207706_10350873 | |||
| 2131 | Ga0207686_10129047 | |||
| 2132 | Ga0207686_10252233 | |||
| 2133 | Ga0207686_10488662 | |||
| 2134 | Ga0207709_10064712 | |||
| 2135 | Ga0207709_10538653 | |||
| 2136 | Ga0207709_10749054 | |||
| 2137 | Ga0207709_10969726 | |||
| 2138 | Ga0207670_10135522 | |||
| 2139 | Ga0207670_10352296 | |||
| 2140 | Ga0207669_10070059 | |||
| 2141 | Ga0207669_10145491 | |||
| 2142 | Ga0207669_10161058 | |||
| 2143 | Ga0207669_10222289 | |||
| 2144 | Ga0207704_10004959 | |||
| 2145 | Ga0207704_10019528 | |||
| 2146 | Ga0207704_10135374 | |||
| 2147 | Ga0207704_10376165 | |||
| 2148 | Ga0207704_10602622 | |||
| 2149 | Ga0207704_10696265 | |||
| 2150 | Ga0207704_11653214 | |||
| 2151 | Ga0207665_10047452 | |||
| 2152 | Ga0207665_10259743 | |||
| 2153 | Ga0207665_10932919 | |||
| 2154 | Ga0207691_10006396 | |||
| 2155 | Ga0207691_10008070 | |||
| 2156 | Ga0207691_10034694 | |||
| 2157 | Ga0207691_10038379 | |||
| 2158 | Ga0207691_10215428 | |||
| 2159 | Ga0207691_10281956 | |||
| 2160 | Ga0207691_10492285 | |||
| 2161 | Ga0207711_10293681 | |||
| 2162 | Ga0207711_10354370 | |||
| 2163 | Ga0207711_10382861 | |||
| 2164 | Ga0207711_10468404 | |||
| 2165 | Ga0207711_10661323 | |||
| 2166 | Ga0207711_10736237 | |||
| 2167 | Ga0207689_10099509 | |||
| 2168 | Ga0207689_10615213 | |||
| 2169 | Ga0207661_10000773 | |||
| 2170 | Ga0207661_10003324 | |||
| 2171 | Ga0207661_10025056 | |||
| 2172 | Ga0207661_10027886 | |||
| 2173 | Ga0207661_10096646 | |||
| 2174 | Ga0207661_10101249 | |||
| 2175 | Ga0207661_10126586 | |||
| 2176 | Ga0207661_10132816 | |||
| 2177 | Ga0207661_10218129 | |||
| 2178 | Ga0207661_10230983 | |||
| 2179 | Ga0207661_10231177 | |||
| 2180 | Ga0207661_10272806 | |||
| 2181 | Ga0207661_10512812 | |||
| 2182 | Ga0207661_10527531 | |||
| 2183 | Ga0207661_10847343 | |||
| 2184 | Ga0207661_10995049 | |||
| 2185 | Ga0207679_10011335 | |||
| 2186 | Ga0207679_10014612 | |||
| 2187 | Ga0207679_10035388 | |||
| 2188 | Ga0207679_10042693 | |||
| 2189 | Ga0207679_10060806 | |||
| 2190 | Ga0207679_10115076 | |||
| 2191 | Ga0207679_10219423 | |||
| 2192 | Ga0207679_10243205 | |||
| 2193 | Ga0207679_10741844 | |||
| 2194 | Ga0207679_10754073 | |||
| 2195 | Ga0207667_10010475 | |||
| 2196 | Ga0207667_10037594 | |||
| 2197 | Ga0207667_10073577 | |||
| 2198 | Ga0207667_10088790 | |||
| 2199 | Ga0207667_10181761 | |||
| 2200 | Ga0207667_10483260 | |||
| 2201 | Ga0207667_10746865 | |||
| 2202 | Ga0207667_10965469 | |||
| 2203 | Ga0207667_11300146 | |||
| 2204 | Ga0207667_11305099 | |||
| 2205 | Ga0207651_10073464 | |||
| 2206 | Ga0207651_10117565 | |||
| 2207 | Ga0207651_10203343 | |||
| 2208 | Ga0207651_10272086 | |||
| 2209 | Ga0207651_10301036 | |||
| 2210 | Ga0207651_10872437 | |||
| 2211 | Ga0207651_11216466 | |||
| 2212 | Ga0207712_10000346 | |||
| 2213 | Ga0207712_10054871 | |||
| 2214 | Ga0207712_10967905 | |||
| 2215 | Ga0207668_10019176 | |||
| 2216 | Ga0207668_10105113 | |||
| 2217 | Ga0207668_10654962 | |||
| 2218 | Ga0207668_11084966 | |||
| 2219 | Ga0207668_11665799 | |||
| 2220 | Ga0207640_10002551 | |||
| 2221 | Ga0207640_10004890 | |||
| 2222 | Ga0207640_10052552 | |||
| 2223 | Ga0207640_10646392 | |||
| 2224 | Ga0207640_11970463 | |||
| 2225 | Ga0207658_10023714 | |||
| 2226 | Ga0207658_10045123 | |||
| 2227 | Ga0207658_10324125 | |||
| 2228 | Ga0207658_10331932 | |||
| 2229 | Ga0207658_10394429 | |||
| 2230 | Ga0207658_10662622 | |||
| 2231 | Ga0207677_10005642 | |||
| 2232 | Ga0207677_10031481 | |||
| 2233 | Ga0207677_10447218 | |||
| 2234 | Ga0207677_10920271 | |||
| 2235 | Ga0207677_11205965 | |||
| 2236 | Ga0207677_11363063 | |||
| 2237 | Ga0207677_11865006 | |||
| 2238 | Ga0207703_10148733 | |||
| 2239 | Ga0207703_10176562 | |||
| 2240 | Ga0207639_10017793 | |||
| 2241 | Ga0207639_10345808 | |||
| 2242 | Ga0207639_10703683 | |||
| 2243 | Ga0207639_10811003 | |||
| 2244 | Ga0207639_10931214 | |||
| 2245 | Ga0207639_11670884 | |||
| 2246 | Ga0207678_10005989 | |||
| 2247 | Ga0207678_10165263 | |||
| 2248 | Ga0207678_10181623 | |||
| 2249 | Ga0207678_10226531 | |||
| 2250 | Ga0207708_10013573 | |||
| 2251 | Ga0207708_10015945 | |||
| 2252 | Ga0207708_10047116 | |||
| 2253 | Ga0207708_10097011 | |||
| 2254 | Ga0207708_10172929 | |||
| 2255 | Ga0207708_10261267 | |||
| 2256 | Ga0207708_10302639 | |||
| 2257 | Ga0207708_10553425 | |||
| 2258 | Ga0207702_10051183 | |||
| 2259 | Ga0207702_10220062 | |||
| 2260 | Ga0207641_10184925 | |||
| 2261 | Ga0207641_10216253 | |||
| 2262 | Ga0207641_10610794 | |||
| 2263 | Ga0207641_10693984 | |||
| 2264 | Ga0207648_10003894 | |||
| 2265 | Ga0207648_10014817 | |||
| 2266 | Ga0207648_10029323 | |||
| 2267 | Ga0207648_10051944 | |||
| 2268 | Ga0207648_10090733 | |||
| 2269 | Ga0207648_10133884 | |||
| 2270 | Ga0207648_10150977 | |||
| 2271 | Ga0207648_10156878 | |||
| 2272 | Ga0207648_11359660 | |||
| 2273 | Ga0207676_10051055 | |||
| 2274 | Ga0207676_10211503 | |||
| 2275 | Ga0207676_10232820 | |||
| 2276 | Ga0207676_10370538 | |||
| 2277 | Ga0207676_11325770 | |||
| 2278 | Ga0207676_11758862 | |||
| 2279 | Ga0207674_10026779 | |||
| 2280 | Ga0207674_10037266 | |||
| 2281 | Ga0207674_10112645 | |||
| 2282 | Ga0207674_10132898 | |||
| 2283 | Ga0207674_10223343 | |||
| 2284 | Ga0207674_10283051 | |||
| 2285 | Ga0207674_10451898 | |||
| 2286 | Ga0207674_11565886 | |||
| 2287 | Ga0207675_100067512 | |||
| 2288 | Ga0207675_100174256 | |||
| 2289 | Ga0207675_100765809 | |||
| 2290 | Ga0207683_10052970 | |||
| 2291 | Ga0207683_10154425 | |||
| 2292 | Ga0207683_10231694 | |||
| 2293 | Ga0207683_10453372 | |||
| 2294 | Ga0207683_10575410 | |||
| 2295 | Ga0207698_10021544 | |||
| 2296 | Ga0207698_10043215 | |||
| 2297 | Ga0207698_10143952 | |||
| 2298 | Ga0207698_10194266 | |||
| 2299 | Ga0207698_11580954 | |||
| 2300 | Ga0209969_1054586 | |||
| 2301 | Ga0209996_1019201 | |||
| 2302 | Ga0210000_1032039 | |||
| 2303 | Ga0209995_1005218 | |||
| 2304 | Ga0209995_1042443 | |||
| 2305 | Ga0209968_1001813 | |||
| 2306 | Ga0209999_1012273 | |||
| 2307 | Ga0209970_1002637 | |||
| 2308 | Ga0209983_1033899 | |||
| 2309 | Ga0209588_1073306 | |||
| 2310 | Ga0209971_1008583 | |||
| 2311 | Ga0209966_1000668 | |||
| 2312 | Ga0209998_10000516 | |||
| 2313 | Ga0209974_10005680 | |||
| 2314 | Ga0209974_10047317 | |||
| 2315 | Ga0207428_10165592 | |||
| 2316 | Ga0207428_10462433 | |||
| 2317 | Ga0268266_10592042 | |||
| 2318 | Ga0268266_11942260 | |||
| 2319 | Ga0268265_10000331 | |||
| 2320 | Ga0268265_10055170 | |||
| 2321 | Ga0268265_10128815 | |||
| 2322 | Ga0268264_10180909 | |||
| 2323 | Ga0268264_10257374 | |||
| 2324 | Ga0268264_12060581 | |||
| 2325 | Ga0316182_1394427 | |||
| 2326 | Ga0265332_10014489 | |||
| 2327 | Ga0265320_10271106 | |||
| 2328 | Ga0265340_10043989 | |||
| 2329 | Ga0307408_100007956 | |||
| 2330 | Ga0307408_100023930 | |||
| 2331 | Ga0307408_100034723 | |||
| 2332 | Ga0307408_100143892 | |||
| 2333 | Ga0307408_100164448 | |||
| 2334 | Ga0307408_100168672 | |||
| 2335 | Ga0307408_100493694 | |||
| 2336 | Ga0307408_101673133 | |||
| 2337 | Ga0265314_10015473 | |||
| 2338 | Ga0265342_10458054 | |||
| 2339 | Ga0307405_10004252 | |||
| 2340 | Ga0307405_10021190 | |||
| 2341 | Ga0307405_10050253 | |||
| 2342 | Ga0307405_10062898 | |||
| 2343 | Ga0307405_10445820 | |||
| 2344 | Ga0307405_10609183 | |||
| 2345 | Ga0307413_10000716 | |||
| 2346 | Ga0307413_10013252 | |||
| 2347 | Ga0307413_10064172 | |||
| 2348 | Ga0307413_10064302 | |||
| 2349 | Ga0307413_10347464 | |||
| 2350 | Ga0307413_10506401 | |||
| 2351 | Ga0307413_10777907 | |||
| 2352 | Ga0307413_11799469 | |||
| 2353 | Ga0307413_11897906 | |||
| 2354 | Ga0307410_10000703 | |||
| 2355 | Ga0307410_10005533 | |||
| 2356 | Ga0307410_10015703 | |||
| 2357 | Ga0307410_10062836 | |||
| 2358 | Ga0307410_10084179 | |||
| 2359 | Ga0307410_10089895 | |||
| 2360 | Ga0307410_10099120 | |||
| 2361 | Ga0307410_10119687 | |||
| 2362 | Ga0307410_10292546 | |||
| 2363 | Ga0307410_10579716 | |||
| 2364 | Ga0307410_10664268 | |||
| 2365 | Ga0307410_11446293 | |||
| 2366 | Ga0307406_10007225 | |||
| 2367 | Ga0307406_10071378 | |||
| 2368 | Ga0307406_10144526 | |||
| 2369 | Ga0307406_10313234 | |||
| 2370 | Ga0307406_10381914 | |||
| 2371 | Ga0307406_10516533 | |||
| 2372 | Ga0307406_10742134 | |||
| 2373 | Ga0307406_11289451 | |||
| 2374 | Ga0307407_10006979 | |||
| 2375 | Ga0307407_10013663 | |||
| 2376 | Ga0307407_10016328 | |||
| 2377 | Ga0307407_10077115 | |||
| 2378 | Ga0307407_10284787 | |||
| 2379 | Ga0307407_10287830 | |||
| 2380 | Ga0307407_10315099 | |||
| 2381 | Ga0307407_10568186 | |||
| 2382 | Ga0307412_10003814 | |||
| 2383 | Ga0307412_10076019 | |||
| 2384 | Ga0307412_10096133 | |||
| 2385 | Ga0307412_10574921 | |||
| 2386 | Ga0307412_10808539 | |||
| 2387 | Ga0307412_11273805 | |||
| 2388 | Ga0307409_100000828 | |||
| 2389 | Ga0307409_100014909 | |||
| 2390 | Ga0307409_100020440 | |||
| 2391 | Ga0307409_100026685 | |||
| 2392 | Ga0307409_100387313 | |||
| 2393 | Ga0307409_100548381 | |||
| 2394 | Ga0307409_100573955 | |||
| 2395 | Ga0307409_100744856 | |||
| 2396 | Ga0307409_101024049 | |||
| 2397 | Ga0307416_100020053 | |||
| 2398 | Ga0307416_100047869 | |||
| 2399 | Ga0307416_100052780 | |||
| 2400 | Ga0307416_100201815 | |||
| 2401 | Ga0307416_100205134 | |||
| 2402 | Ga0307416_100420076 | |||
| 2403 | Ga0307416_100643541 | |||
| 2404 | Ga0307416_100815326 | |||
| 2405 | Ga0307416_100848605 | |||
| 2406 | Ga0307416_100969175 | |||
| 2407 | Ga0307416_101129349 | |||
| 2408 | Ga0307416_101268111 | |||
| 2409 | Ga0307416_101557968 | |||
| 2410 | Ga0307416_102485730 | |||
| 2411 | Ga0307416_103167767 | |||
| 2412 | Ga0307414_10012996 | |||
| 2413 | Ga0307414_10047438 | |||
| 2414 | Ga0307414_10921909 | |||
| 2415 | Ga0307414_11275059 | |||
| 2416 | Ga0307414_11437686 | |||
| 2417 | Ga0307414_11731355 | |||
| 2418 | Ga0307411_10004747 | |||
| 2419 | Ga0307411_10061846 | |||
| 2420 | Ga0307411_10062197 | |||
| 2421 | Ga0307411_10122865 | |||
| 2422 | Ga0307411_10165208 | |||
| 2423 | Ga0307411_10172334 | |||
| 2424 | Ga0307411_10273468 | |||
| 2425 | Ga0307411_10325185 | |||
| 2426 | Ga0307411_10728760 | |||
| 2427 | Ga0307415_100028600 | |||
| 2428 | Ga0307415_100039533 | |||
| 2429 | Ga0307415_100083254 | |||
| 2430 | Ga0307415_100095152 | |||
| 2431 | Ga0307415_100120672 | |||
| 2432 | Ga0307415_100146582 | |||
| 2433 | Ga0307415_100146802 | |||
| 2434 | Ga0307415_100234603 | |||
| 2435 | Ga0307415_100276935 | |||
| 2436 | Ga0307415_100620111 | |||
| 2437 | Ga0307415_101307583 | |||
| 2438 | Ga0307415_101365620 | |||
| 2439 | Ga0373958_0077187 | |||
| 2440 | Ga0373926_0041522 | |||
| 2441 | Ga0373934_0004281 | |||
| 2442 | Ga0373940_0041683 | |||
| 2443 | Ga0373952_0281639 | |||
| 2444 | Ga0373936_0123559 | |||
| 2445 | Ga0373953_0025409 | |||
| 2446 | Ga0373954_0175400 | |||
| 2447 | Ga0373957_0232082 | |||
| 2448 | Ga0373960_0014579 | |||
| 2449 | Ga0373943_0037919 | |||
| 2450 | Ga0373955_0221512 | |||
| 2451 | Ga0373942_0061911 | |||
| 2452 | Ga0373942_0204482 | |||
| 2453 | Ga0373931_0428607 | |||
| 2454 | Ga0373931_0752772 | |||
| 2455 | Ga0373935_0063682 | |||
| 2456 | Ga0373927_0128798 | |||
| 2457 | Ga0373947_0010747 | |||
| 2458 | Ga0373937_0000448 | |||
| 2459 | Ga0373937_0062192 | |||
| 2460 | Ga0373925_0064153 | |||
| 2461 | Ga0395900_1067409 | |||
| 2462 | Ga0395898_1707525 | |||
| 2463 | Ga0395905_0060527 | |||
| 2464 | Ga0395905_1251418 | |||
| 2465 | Ga0436364_0330143 | |||
| 2466 | Ga0436364_0599470 | |||
| 2467 | Ga0436365_0209545 | |||
| 2468 | Ga0436365_0489964 | |||
| 2469 | Ga0436365_0579517 | |||
| 2470 | Ga0436365_0753661 | |||
| 2471 | Ga0436365_0836229 | |||
| 2472 | Ga0436365_1353333 | |||
| 2473 | Ga0436365_1791379 | |||
| 2474 | Ga0436363_1323611 | |||
| 2475 | Ga0436362_0963725 | |||
| 2476 | Ga0439461_0018554 | |||
| 2477 | Ga0451800_1305647 | |||
| 2478 | Ga0451804_0951379 | |||
| 2479 | Ga0451839_0204316 | |||
| 2480 | Ga0451849_0487378 | |||
| 2481 | Ga0451853_2286543 | |||
| 2482 | Ga0439433_0082239 | |||
| 2483 | Ga0450898_055793 | |||
| 2484 | Ga0439434_0050174 | |||
| 2485 | Ga0439434_0310029 | |||
| 2486 | Ga0451577_0257900 | |||
| 2487 | Ga0451577_0765816 | |||
| 2488 | Ga0451577_0975175 | |||
| 2489 | Ga0466966_0005142 | |||
| 2490 | Ga0466966_0077028 | |||
| 2491 | Ga0466966_0318317 | |||
| 2492 | Ga0466961_0034916 | |||
| 2493 | Ga0466961_0093906 | |||
| 2494 | Ga0466961_0582121 | |||
| 2495 | Ga0466963_0118109 | |||
| 2496 | Ga0466964_0211514 | |||
| 2497 | Ga0466971_0564673 | |||
| 2498 | Ga0466957_0889846 | |||
| 2499 | Ga0466960_1032341 | |||
| 2500 | Ga0466959_0043802 | |||
| 2501 | Ga0466959_0082347 | |||
| 2502 | Ga0466959_0125231 | |||
| 2503 | Ga0451576_0188169 | |||
| 2504 | Ga0451576_0540201 | |||
| 2505 | Ga0451576_0568652 | |||
| 2506 | Ga0451576_2428243 | |||
| 2507 | Ga0466958_0215675 | |||
| 2508 | Ga0466967_0169522 | |||
| 2509 | Ga0466967_0327399 | |||
| 2510 | Ga0495603_0245819 | |||
| 2511 | Ga0495603_0480597 | |||
| 2512 | Ga0495629_0038804 | |||
| 2513 | Ga0495629_0691555 | |||
| 2514 | Ga0495651_0003975 | |||
| 2515 | Ga0495580_0008931 | |||
| 2516 | Ga0495582_0286299 | |||
| 2517 | Ga0495639_0017578 | |||
| 2518 | Ga0495639_0037561 | |||
| 2519 | Ga0495664_0370387 | |||
| 2520 | Ga0495584_0654420 | |||
| 2521 | Ga0495585_0548564 | |||
| 2522 | Ga0495594_0008015 | |||
| 2523 | Ga0495594_0012806 | |||
| 2524 | Ga0495594_0013642 | |||
| 2525 | Ga0495594_0194279 | |||
| 2526 | Ga0495630_0026084 | |||
| 2527 | Ga0495630_0752217 | |||
| 2528 | Ga0495643_0310092 | |||
| 2529 | Ga0495666_0008156 | |||
| 2530 | Ga0495642_0114228 | |||
| 2531 | Ga0495652_0131358 | |||
| 2532 | Ga0495665_0025157 | |||
| 2533 | Ga0495586_0076789 | |||
| 2534 | Ga0495586_0514359 | |||
| 2535 | Ga0495587_0002752 | |||
| 2536 | Ga0495621_0098495 | |||
| 2537 | Ga0495621_0209663 | |||
| 2538 | Ga0495621_0233258 | |||
| 2539 | Ga0495645_0000804 | |||
| 2540 | Ga0495622_0361258 | |||
| 2541 | Ga0495667_0008829 | |||
| 2542 | Ga0495667_0097780 | |||
| 2543 | Ga0495634_0197100 | |||
| 2544 | Ga0495635_0833408 | |||
| 2545 | Ga0495659_0142888 | |||
| 2546 | Ga0495588_0205466 | |||
| 2547 | Ga0495588_0266961 | |||
| 2548 | Ga0495657_0129370 | |||
| 2549 | Ga0495599_0078495 | |||
| 2550 | Ga0495623_0001333 | |||
| 2551 | Ga0495623_0025809 | |||
| 2552 | Ga0495658_0778619 | |||
| 2553 | Ga0495669_0058998 | |||
| 2554 | Ga0495669_0153021 | |||
| 2555 | Ga0495613_0061274 | |||
| 2556 | Ga0495613_0302562 | |||
| 2557 | Ga0495613_0318068 | |||
| 2558 | Ga0495624_0187116 | |||
| 2559 | Ga0495600_0029735 | |||
| 2560 | Ga0495600_0057993 | |||
| 2561 | Ga0495600_0499794 | |||
| 2562 | Ga0495581_0124203 | |||
| 2563 | Ga0495581_0282360 | |||
| 2564 | Ga0495674_0075611 | |||
| 2565 | Ga0495672_0005947 | |||
| 2566 | Ga0495675_0007163 | |||
| 2567 | Ga0495675_0025928 | |||
| 2568 | Ga0495677_0440844 | |||
| 2569 | Ga0495684_0056960 | |||
| 2570 | Ga0495684_0132396 | |||
| 2571 | Ga0495602_0258837 | |||
| 2572 | Ga0495602_0437548 | |||
| 2573 | Ga0496100_0033859 | |||
| 2574 | Ga0496100_0071846 | |||
| 2575 | Ga0496101_0063525 | |||
| 2576 | Ga0496105_0131297 | |||
| 2577 | Ga0496106_0031215 | |||
| 2578 | Ga0496106_0452888 | |||
| 2579 | Ga0496107_0113721 | |||
| 2580 | Ga0496108_0475266 | |||
| 2581 | Ga0496109_0357570 | |||
| 2582 | Ga0496109_0365026 | |||
| 2583 | Ga0496109_1188726 | |||
| 2584 | Ga0496110_0284371 | |||
| 2585 | Ga0496110_0704935 | |||
| 2586 | Ga0496111_0429111 | |||
| 2587 | Ga0496112_0003755 | |||
| 2588 | Ga0496112_0011306 | |||
| 2589 | Ga0496112_0747424 | |||
| 2590 | Ga0496112_1098261 | |||
| 2591 | Ga0496113_0010290 | |||
| 2592 | Ga0496113_0653277 | |||
| 2593 | Ga0496115_0059698 | |||
| 2594 | Ga0496115_0200863 | |||
| 2595 | Ga0501309_046492 | |||
| 2596 | Ga0501291_093473 | |||
| 2597 | Ga0501031_0018277 | |||
| 2598 | Ga0501033_0004681 | |||
| 2599 | Ga0501033_0072694 | |||
| 2600 | Ga0501034_0034768 | |||
| 2601 | Ga0501034_0040492 | |||
| 2602 | Ga0501034_0128703 | |||
| 2603 | Ga0501036_0132872 | |||
| 2604 | Ga0501036_0367837 | |||
| 2605 | Ga0501038_0185359 | |||
| 2606 | Ga0501040_0009071 | |||
| 2607 | Ga0501040_0266305 | |||
| 2608 | Ga0501041_0179921 | |||
| 2609 | Ga0501041_0698145 | |||
| 2610 | Ga0501042_0127338 | |||
| 2611 | Ga0501042_1276809 | |||
| 2612 | Ga0501043_0048107 | |||
| 2613 | Ga0501043_0114778 | |||
| 2614 | Ga0501046_0123251 | |||
| 2615 | Ga0501047_0014211 | |||
| 2616 | Ga0501047_0030687 | |||
| 2617 | Ga0501048_0103818 | |||
| 2618 | Ga0501048_0184214 | |||
| 2619 | Ga0501067_0038830 | |||
| 2620 | Ga0501067_0769376 | |||
| 2621 | Ga0501070_0260163 | |||
| 2622 | Ga0501071_0117247 | |||
| 2623 | Ga0501072_1235084 | |||
| 2624 | Ga0501073_0047690 | |||
| 2625 | Ga0501074_0438082 | |||
| 2626 | Ga0501075_0148168 | |||
| 2627 | Ga0501075_0152227 | |||
| 2628 | Ga0501075_0377071 | |||
| 2629 | Ga0501076_0194401 | |||
| 2630 | Ga0501076_0203720 | |||
| 2631 | Ga0501076_1177277 | |||
| 2632 | Ga0501077_0232705 | |||
| 2633 | Ga0501198_036905 | |||
| 2634 | Ga0501202_022466 | |||
| 2635 | Ga0501202_071434 | |||
| 2636 | Ga0501216_039971 | |||
| 2637 | Ga0501216_101244 | |||
| 2638 | Ga0501216_190236 | |||
| 2639 | Ga0501223_011898 | |||
| 2640 | Ga0501224_038653 | |||
| 2641 | Ga0501230_109663 | |||
| 2642 | Ga0501233_030238 | |||
| 2643 | Ga0501235_002455 | |||
| 2644 | Ga0501239_003005 | |||
| 2645 | Ga0501239_033791 | |||
| 2646 | Ga0501240_004237 | |||
| 2647 | Ga0501246_035869 | |||
| 2648 | Ga0501247_071413 | |||
| 2649 | Ga0501249_001158 | |||
| 2650 | Ga0501250_006768 | |||
| 2651 | Ga0501250_081788 | |||
| 2652 | Ga0501251_088467 | |||
| 2653 | Ga0501257_003684 | |||
| 2654 | Ga0501259_006356 | |||
| 2655 | Ga0501260_003681 | |||
| 2656 | Ga0501261_009664 | |||
| 2657 | Ga0501221_027992 | |||
| 2658 | Ga0501225_0034888 | |||
| 2659 | Ga0501234_026138 | |||
| 2660 | Ga0501245_065160 | |||
| 2661 | Ga0501079_0004591 | |||
| 2662 | Ga0501079_0802829 | |||
| 2663 | Ga0501080_0094200 | |||
| 2664 | Ga0501080_0183927 | |||
| 2665 | Ga0501081_0344394 | |||
| 2666 | Ga0501081_0382252 | |||
| 2667 | Ga0501241_045376 | |||
| 2668 | Ga0501262_022185 | |||
| 2669 | Ga0501263_025365 | |||
| 2670 | Ga0501266_005306 | |||
| 2671 | Ga0501267_021986 | |||
| 2672 | Ga0501268_003463 | |||
| 2673 | Ga0501268_064088 | |||
| 2674 | Ga0501268_106762 | |||
| 2675 | Ga0501270_010744 | |||
| 2676 | Ga0501272_035657 | |||
| 2677 | Ga0501273_011690 | |||
| 2678 | Ga0501273_075213 | |||
| 2679 | Ga0501044_0003683 | |||
| 2680 | Ga0501044_0235840 | |||
| 2681 | Ga0501045_0014893 | |||
| 2682 | nmdc:mga05p37_1927118_c1 | |||
| 2683 | nmdc:mga05p37_352966_c1 | |||
| 2684 | nmdc:mga05p37_385546_c1 | |||
| 2685 | nmdc:mga05p37_60165_c1 | |||
| 2686 | nmdc:mga09592_1137302_c1 | |||
| 2687 | nmdc:mga09592_1156241_c1 | |||
| 2688 | nmdc:mga09592_130564_c1 | |||
| 2689 | nmdc:mga09592_1715814_c1 | |||
| 2690 | nmdc:mga09592_238092_c1 | |||
| 2691 | nmdc:mga09592_25522_c1 | |||
| 2692 | nmdc:mga09592_512166_c1 | |||
| 2693 | nmdc:mga0qj67_1051269_c1 | |||
| 2694 | nmdc:mga0qj67_127949_c1 | |||
| 2695 | nmdc:mga0qj67_1318174_c1 | |||
| 2696 | nmdc:mga0qj67_138992_c1 | |||
| 2697 | nmdc:mga0qj67_158591_c1 | |||
| 2698 | nmdc:mga0qj67_19069_c1 | |||
| 2699 | nmdc:mga0qj67_20933_c1 | |||
| 2700 | nmdc:mga0qj67_26367_c1 | |||
| 2701 | nmdc:mga0qj67_690188_c1 | |||
| 2702 | nmdc:mga06r32_1148651_c1 | |||
| 2703 | nmdc:mga06r32_145013_c1 | |||
| 2704 | nmdc:mga06r32_182385_c1 | |||
| 2705 | nmdc:mga06r32_21909_c1 | |||
| 2706 | nmdc:mga06r32_312252_c1 | |||
| 2707 | nmdc:mga06r32_36042_c1 | |||
| 2708 | nmdc:mga06r32_561985_c1 | |||
| 2709 | nmdc:mga06r32_78254_c1 | |||
| 2710 | nmdc:mga08y16_343165_c1 | |||
| 2711 | nmdc:mga08y16_408998_c1 | |||
| 2712 | nmdc:mga0n895_100600_c1 | |||
| 2713 | nmdc:mga0n895_18096_c1 | |||
| 2714 | nmdc:mga0n895_295417_c1 | |||
| 2715 | nmdc:mga0n895_29871_c1 | |||
| 2716 | nmdc:mga0n895_333004_c1 | |||
| 2717 | nmdc:mga0n895_647163_c1 | |||
| 2718 | nmdc:mga0rr50_1099731_c1 | |||
| 2719 | nmdc:mga0rr50_251480_c1 | |||
| 2720 | nmdc:mga0rr50_696998_c1 | |||
| 2721 | nmdc:mga08x19_125037_c1 | |||
| 2722 | nmdc:mga08x19_24045_c1 | |||
| 2723 | nmdc:mga08x19_589444_c1 | |||
| 2724 | nmdc:mga08x19_9458_c1 | |||
| 2725 | nmdc:mga0a205_131602_c1 | |||
| 2726 | nmdc:mga0a205_7731_c1 | |||
| 2727 | nmdc:mga0a205_854553_c1 | |||
| 2728 | nmdc:mga0a205_8915_c1 | |||
| 2729 | Ga0495601_0441565 | |||
| 2730 | Ga0495612_0237976 | |||
| 2731 | Ga0495595_0042201 | |||
| 2732 | Ga0590071_029891 | |||
| 2733 | Ga0590071_036978 | |||
| 2734 | Ga0590075_069820 | |||
| 2735 | Ga0590077_022527 | |||
| 2736 | Ga0587089_072147 | |||
| 2737 | Ga0587090_111849 | |||
| 2738 | Ga0587091_127973 | |||
| 2739 | Ga0501082_0044913 | |||
| 2740 | Ga0501082_1419574 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.711 | 13 | 130 |
| 6ptg-assembly2.cif.gz_A | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.7077 | 13 | 130 |
| 7o5y-assembly1.cif.gz_B | pila minor pilin of streptococcus sanguinis type iv pili | 0.6762 | 13 | 50 |
| 6ptg-assembly3.cif.gz_B | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.6689 | 13 | 130 |
| 6ptg-assembly2.cif.gz_A | structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) | 0.6651 | 13 | 130 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.6614 | 14 | 131 | 1.20.120.910 |
| 4ijjA00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.5861 | 14 | 131 | 1.20.120.910 |
| 1tjlB00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.5552 | 13 | 131 | 1.20.120.910 |
| af_Q55DK5_17_291_1.20.1270.60 | Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain | 0.5135 | 15 | 90 | 1.20.1270.60 |
| 2kq9A00 | Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain | 0.5019 | 11 | 126 | 1.20.120.910 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7Z9JQQ5-F1-model_v4 | RNA polymerase-binding protein DksA | 0.8807 | 71 | 129 |
GO:0008270
|
| AF-A0A7Z9JQQ5-F1-model_v4 | RNA polymerase-binding protein DksA | 0.8427 | 71 | 129 |
GO:0008270
|
| AF-A0A379H9W7-F1-model_v4 | deleted | 0.7428 | 13 | 131 |
|
| AF-A0A1J5JB83-F1-model_v4 | Zinc finger DksA/TraR C4-type domain-containing protein | 0.7175 | 13 | 131 |
GO:0008270
|
| AF-A0A1R3FMC2-F1-model_v4 | Zinc finger DksA/TraR C4-type domain-containing protein | 0.7073 | 13 | 131 |
GO:0008270
|