F493403

General Info

Members Datasets Scaffolds Average Seq Length
1370 416 2740 137

Family's Representative Sequence

Representative Sequence 3300005329|Ga0070683_100000914|Ga0070683_1000009148
Length 155
Sequence MARTLKSPWRGLVRSMATAAKGKKPKAMPKKNLQHFEKRLLEERKRVLKELGHYDETFGSTPQGADGDLSAYSFHMADQGTDAMEREKAFLFASQEGRFLWHIDEALRRLYRNPEQFGKCHNCGKDISFERLDALPHARYCIECKQREEDGKRQA

Samples

Sample ID Description Type Environment
1 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
2 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
3 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
4 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
5 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
6 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
7 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
8 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
9 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
10 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
11 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
12 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
13 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
14 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
15 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
16 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
17 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
18 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
19 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
20 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
21 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
22 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
23 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
24 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
25 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
26 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
27 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
28 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
29 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
30 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
31 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
32 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
33 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
34 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
35 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
36 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
37 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
38 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
39 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
40 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
41 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
42 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
43 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
67 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
68 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
69 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
70 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
71 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
72 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
73 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
74 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
75 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
76 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
77 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
78 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
79 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
80 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
81 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
82 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
83 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
84 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
85 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
86 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
91 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
92 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
93 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
94 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
95 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
96 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
97 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
98 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
100 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
101 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
102 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
103 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
104 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
105 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
106 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
107 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
108 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
109 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
110 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
111 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
112 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
113 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
114 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
115 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
116 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
117 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
118 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
119 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
120 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
121 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
122 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
123 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
124 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
125 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
126 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
129 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
130 3300020069 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
131 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
133 3300020078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
134 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
135 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
136 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
137 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
138 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
139 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
204 3300027395 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 PM (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027462 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027471 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027526 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 AM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
217 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
218 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300030745 Rhizosphere soil microbial communities in a healthy wheat plant from a non-infected Wellcamp field in Toowoomba, Australia - sample 8 Metagenome Rhizosphere
221 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
222 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
223 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
224 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
225 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
226 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
231 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
232 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
233 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
234 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
235 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
236 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
237 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
238 3300034819 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_1 Metagenome Rhizosphere
239 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
240 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
241 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
242 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
243 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
246 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
247 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
248 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
251 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
252 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
254 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
255 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
256 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
257 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
258 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
259 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
260 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
261 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
262 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
263 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
264 3300041410 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116DE14Z082817_5596 Metagenome Rhizosphere
265 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
266 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
271 3300042134 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_070716_126 Metagenome Rhizosphere
272 3300042435 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 Metagenome Rhizosphere
273 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
274 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
275 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
276 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
277 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
278 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
279 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
280 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
281 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
282 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
283 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
284 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
285 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
286 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
287 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
288 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
289 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
290 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
291 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
292 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
293 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
294 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
297 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
298 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
299 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
300 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
301 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
302 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
303 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
304 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
305 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
306 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
307 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
308 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
309 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
312 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
313 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
314 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
315 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
316 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
317 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
318 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
319 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
320 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
321 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
322 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
323 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
324 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
329 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
330 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
331 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
332 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
333 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
334 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
335 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
336 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
337 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
338 3300049129 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I2_B_0_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300049514 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A25_B_5_drought Metagenome Rhizosphere
340 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
341 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
342 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
343 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
344 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
346 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
347 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
348 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
349 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
350 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
351 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
352 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
353 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
354 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
358 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
359 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
360 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
361 3300049649 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J5_A_0_drought Metagenome Rhizosphere
362 3300049652 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B1_A_0_drought Metagenome Rhizosphere
363 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
364 3300049663 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_A_2_drought Metagenome Rhizosphere
365 3300049664 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_A_2_drought Metagenome Rhizosphere
366 3300049667 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G5_B_2_control Metagenome Rhizosphere
367 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
368 3300049669 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_B_2_drought Metagenome Rhizosphere
369 3300049672 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_A_3_drought Metagenome Rhizosphere
370 3300049673 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_A_3_drought Metagenome Rhizosphere
371 3300049676 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G12_A_3_control Metagenome Rhizosphere
372 3300049677 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_A_3_control Metagenome Rhizosphere
373 3300049679 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G11_B_3_drought Metagenome Rhizosphere
374 3300049680 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I13_B_3_drought Metagenome Rhizosphere
375 3300049681 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_B_3_drought Metagenome Rhizosphere
376 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
377 3300049688 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_A_4_drought Metagenome Rhizosphere
378 3300049689 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_A_4_drought Metagenome Rhizosphere
379 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
380 3300049704 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G2_A_2_control Metagenome Rhizosphere
381 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
382 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
383 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
384 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
385 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
386 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
387 3300049758 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D15_A_3_drought Metagenome Rhizosphere
388 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
389 3300049760 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_A_4_control Metagenome Rhizosphere
390 3300049763 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C11_A_4_control Metagenome Rhizosphere
391 3300049764 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - J12_A_4_control Metagenome Rhizosphere
392 3300049765 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_B_4_drought Metagenome Rhizosphere
393 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
394 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
395 3300049770 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F12_B_4_control Metagenome Rhizosphere
396 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
397 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
398 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
399 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
400 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
401 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
402 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
403 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
404 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
405 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
406 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
407 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
408 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
409 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
410 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
411 3300059424 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
412 3300059426 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 11_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
413 3300059509 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 54R_CD_T2_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
414 3300059510 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 55R_CD_T2_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
415 3300059511 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 56R_CD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
416 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 97.81
Metatranscriptomes 2.19
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 1.75
Rhizosphere 97.08
Stem 0
Stem Tuber 0
Unclassified 13.5

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0070683_100000914 3300005329 Bacteria 21921
2 JGI24749J21850_1036818 3300002076 Bacteria 711
3 JGI25406J46586_10059482 3300003203 Bacteria 1240
4 Ga0058859_11508720 3300004798 Bacteria 884
5 Ga0058863_11460199 3300004799 Bacteria 1020
6 Ga0058863_11772184 3300004799 Bacteria 1389
7 Ga0058863_11915949 3300004799 Bacteria 1974
8 Ga0058861_11720212 3300004800 Bacteria 786
9 Ga0058861_11993866 3300004800 Bacteria 1166
10 Ga0058862_12187540 3300004803 Bacteria 859
11 Ga0058862_12796990 3300004803 Bacteria 1848
12 Ga0058862_12833528 3300004803 Bacteria 1103
13 Ga0058862_12863587 3300004803 Bacteria 1608
14 Ga0065712_10093097 3300005290 Bacteria 2306
15 Ga0065712_10386959 3300005290 Bacteria 746
16 Ga0065715_10105782 3300005293 Bacteria 2872
17 Ga0065715_10211602 3300005293 Unclassified 1312
18 Ga0065715_10843969 3300005293 Unclassified 594
19 Ga0065707_10499732 3300005295 Bacteria 758
20 Ga0070658_10008963 3300005327 Bacteria 8041
21 Ga0070658_10079313 3300005327 Bacteria 2696
22 Ga0070658_10097101 3300005327 Bacteria 2433
23 Ga0070658_10242904 3300005327 Unclassified 1526
24 Ga0070658_10272792 3300005327 Bacteria 1439
25 Ga0070658_10517203 3300005327 Bacteria 1032
26 Ga0070658_10756607 3300005327 Bacteria 844
27 Ga0070676_10024660 3300005328 Bacteria 3391
28 Ga0070676_10028080 3300005328 Bacteria 3194
29 Ga0070676_10075115 3300005328 Unclassified 2037
30 Ga0070676_10169483 3300005328 Bacteria 1411
31 Ga0070676_10196174 3300005328 Bacteria 1321
32 Ga0070676_10300379 3300005328 Bacteria 1088
33 Ga0070676_10408214 3300005328 Bacteria 947
34 Ga0070676_10656702 3300005328 Bacteria 762
35 Ga0070683_100004028 3300005329 Bacteria 12027
36 Ga0070683_100004580 3300005329 Bacteria 11411
37 Ga0070683_100011985 3300005329 Bacteria 7521
38 Ga0070683_100016824 3300005329 Bacteria 6452
39 Ga0070683_100024969 3300005329 Bacteria 5360
40 Ga0070683_100045674 3300005329 Bacteria 4043
41 Ga0070683_100084391 3300005329 Bacteria 2976
42 Ga0070683_100094410 3300005329 Bacteria 2811
43 Ga0070683_100232236 3300005329 Bacteria 1754
44 Ga0070683_100271521 3300005329 Bacteria 1613
45 Ga0070683_100326625 3300005329 Bacteria 1460
46 Ga0070683_100577685 3300005329 Bacteria 1075
47 Ga0070683_100799696 3300005329 Bacteria 904
48 Ga0070683_100988192 3300005329 Unclassified 808
49 Ga0070683_101201577 3300005329 Bacteria 729
50 Ga0070690_100015139 3300005330 Bacteria 4594
51 Ga0070690_100040265 3300005330 Bacteria 2955
52 Ga0070690_100534174 3300005330 Bacteria 882
53 Ga0070690_100736596 3300005330 Bacteria 760
54 Ga0070690_100759827 3300005330 Unclassified 749
55 Ga0070670_100033354 3300005331 Bacteria 4434
56 Ga0070670_100078982 3300005331 Bacteria 2827
57 Ga0070670_100165222 3300005331 Bacteria 1919
58 Ga0070670_100351366 3300005331 Bacteria 1295
59 Ga0070670_100700422 3300005331 Bacteria 911
60 Ga0070670_100779322 3300005331 Unclassified 863
61 Ga0070670_100816618 3300005331 Bacteria 843
62 Ga0070677_10091326 3300005333 Bacteria 1325
63 Ga0070677_10256846 3300005333 Bacteria 870
64 Ga0068869_100627944 3300005334 Bacteria 910
65 Ga0068869_100895018 3300005334 Bacteria 768
66 Ga0070666_10378477 3300005335 Bacteria 1016
67 Ga0070680_100000010 3300005336 Bacteria 97194
68 Ga0070680_100016417 3300005336 Bacteria 5828
69 Ga0070680_100051986 3300005336 Bacteria 3345
70 Ga0070680_100062216 3300005336 Bacteria 3056
71 Ga0070680_100077514 3300005336 Bacteria 2737
72 Ga0070680_100077788 3300005336 Bacteria 2732
73 Ga0070680_100081540 3300005336 Bacteria 2669
74 Ga0070680_100335218 3300005336 Bacteria 1285
75 Ga0070680_100843550 3300005336 Bacteria 790
76 Ga0070680_100957835 3300005336 Bacteria 739
77 Ga0070680_101036659 3300005336 Bacteria 709
78 Ga0070682_100020205 3300005337 Unclassified 3916
79 Ga0070682_100122456 3300005337 Bacteria 1748
80 Ga0070682_100132192 3300005337 Bacteria 1690
81 Ga0070682_100216705 3300005337 Bacteria 1360
82 Ga0070682_100456526 3300005337 Bacteria 980
83 Ga0070682_100489176 3300005337 Bacteria 951
84 Ga0068868_100015799 3300005338 Bacteria 5593
85 Ga0068868_100048702 3300005338 Bacteria 3324
86 Ga0068868_100239599 3300005338 Bacteria 1523
87 Ga0068868_100293905 3300005338 Bacteria 1378
88 Ga0068868_101634798 3300005338 Unclassified 606
89 Ga0070660_100014384 3300005339 Bacteria 5697
90 Ga0070660_100397643 3300005339 Unclassified 1139
91 Ga0070660_100437087 3300005339 Unclassified 1084
92 Ga0070689_100024708 3300005340 Unclassified 4507
93 Ga0070689_100170598 3300005340 Bacteria 1763
94 Ga0070689_100404994 3300005340 Unclassified 1154
95 Ga0070691_10014564 3300005341 Bacteria 3609
96 Ga0070691_10031926 3300005341 Bacteria 2472
97 Ga0070691_10033433 3300005341 Bacteria 2420
98 Ga0070691_10085438 3300005341 Unclassified 1550
99 Ga0070691_10140722 3300005341 Bacteria 1229
100 Ga0070691_10360368 3300005341 Bacteria 810
101 Ga0070687_100004192 3300005343 Bacteria 5714
102 Ga0070687_100041059 3300005343 Bacteria 2335
103 Ga0070687_100062846 3300005343 Bacteria 1967
104 Ga0070661_100008603 3300005344 Bacteria 7059
105 Ga0070661_100013325 3300005344 Bacteria 5772
106 Ga0070661_100078583 3300005344 Bacteria 2434
107 Ga0070661_100137691 3300005344 Bacteria 1838
108 Ga0070661_101888662 3300005344 Bacteria 507
109 Ga0070692_10051290 3300005345 Bacteria 2145
110 Ga0070692_10265842 3300005345 Bacteria 1033
111 Ga0070692_10492311 3300005345 Bacteria 793
112 Ga0070668_100022290 3300005347 Bacteria 4787
113 Ga0070668_100112425 3300005347 Unclassified 2169
114 Ga0070668_100160374 3300005347 Bacteria 1824
115 Ga0070668_101187431 3300005347 Bacteria 691
116 Ga0070668_101243833 3300005347 Bacteria 675
117 Ga0070668_101819402 3300005347 Unclassified 560
118 Ga0070669_100000431 3300005353 Bacteria 32024
119 Ga0070669_100007862 3300005353 Bacteria 7623
120 Ga0070669_100040274 3300005353 Bacteria 3396
121 Ga0070669_100042955 3300005353 Bacteria 3290
122 Ga0070669_100132355 3300005353 Bacteria 1915
123 Ga0070669_100265810 3300005353 Bacteria 1370
124 Ga0070669_101464147 3300005353 Unclassified 593
125 Ga0070675_100006006 3300005354 Bacteria 9307
126 Ga0070675_100031034 3300005354 Bacteria 4318
127 Ga0070675_100045778 3300005354 Bacteria 3581
128 Ga0070675_100046593 3300005354 Bacteria 3551
129 Ga0070675_100127922 3300005354 Bacteria 2163
130 Ga0070675_100156956 3300005354 Bacteria 1954
131 Ga0070675_100645516 3300005354 Unclassified 962
132 Ga0070675_101300632 3300005354 Bacteria 670
133 Ga0070671_100145737 3300005355 Bacteria 1999
134 Ga0070671_100206372 3300005355 Bacteria 1666
135 Ga0070671_100378861 3300005355 Bacteria 1209
136 Ga0070671_100685991 3300005355 Bacteria 888
137 Ga0070674_100068016 3300005356 Bacteria 2508
138 Ga0070674_100111523 3300005356 Bacteria 2009
139 Ga0070674_100246574 3300005356 Bacteria 1401
140 Ga0070674_100301803 3300005356 Bacteria 1277
141 Ga0070674_100500303 3300005356 Bacteria 1012
142 Ga0070674_100611255 3300005356 Bacteria 922
143 Ga0070674_101106202 3300005356 Unclassified 700
144 Ga0070673_100051016 3300005364 Bacteria 3237
145 Ga0070673_100146946 3300005364 Bacteria 1993
146 Ga0070673_100234503 3300005364 Bacteria 1593
147 Ga0070673_100245940 3300005364 Bacteria 1557
148 Ga0070673_100448308 3300005364 Bacteria 1160
149 Ga0070673_101827010 3300005364 Bacteria 576
150 Ga0070673_101957736 3300005364 Unclassified 556
151 Ga0070688_100046871 3300005365 Unclassified 2678
152 Ga0070688_100076527 3300005365 Bacteria 2154
153 Ga0070688_100102832 3300005365 Bacteria 1887
154 Ga0070688_100151422 3300005365 Unclassified 1586
155 Ga0070659_100044995 3300005366 Bacteria 3458
156 Ga0070659_100188505 3300005366 Unclassified 1695
157 Ga0070659_100513955 3300005366 Bacteria 1022
158 Ga0070659_100711727 3300005366 Unclassified 869
159 Ga0070659_101143478 3300005366 Unclassified 687
160 Ga0070667_100030245 3300005367 Bacteria 4516
161 Ga0070667_100036770 3300005367 Unclassified 4105
162 Ga0070667_100076515 3300005367 Bacteria 2858
163 Ga0070667_100084208 3300005367 Bacteria 2725
164 Ga0070667_100096057 3300005367 Bacteria 2556
165 Ga0070667_100144813 3300005367 Bacteria 2083
166 Ga0070667_100425422 3300005367 Unclassified 1211
167 Ga0070709_10002485 3300005434 Bacteria 9984
168 Ga0070709_10010493 3300005434 Bacteria 5134
169 Ga0070709_10340334 3300005434 Bacteria 1106
170 Ga0070709_10923485 3300005434 Unclassified 691
171 Ga0070714_100004586 3300005435 Bacteria 10421
172 Ga0070714_100049437 3300005435 Bacteria 3579
173 Ga0070714_100167165 3300005435 Unclassified 1994
174 Ga0070714_100370251 3300005435 Unclassified 1349
175 Ga0070713_100000196 3300005436 Bacteria 40355
176 Ga0070713_100015290 3300005436 Bacteria 5729
177 Ga0070713_100066727 3300005436 Bacteria 3026
178 Ga0070710_10027153 3300005437 Bacteria 3051
179 Ga0070710_11354728 3300005437 Bacteria 531
180 Ga0070701_10008088 3300005438 Bacteria 4527
181 Ga0070701_10180897 3300005438 Bacteria 1234
182 Ga0070711_100135598 3300005439 Bacteria 1839
183 Ga0070711_100430570 3300005439 Unclassified 1077
184 Ga0070705_100028775 3300005440 Bacteria 3047
185 Ga0070700_100053030 3300005441 Bacteria 2530
186 Ga0070700_100127439 3300005441 Bacteria 1713
187 Ga0070700_100194942 3300005441 Unclassified 1419
188 Ga0070700_100252388 3300005441 Bacteria 1266
189 Ga0070700_100803035 3300005441 Bacteria 758
190 Ga0070700_101034780 3300005441 Bacteria 677
191 Ga0070700_101306024 3300005441 Bacteria 610
192 Ga0070694_100070264 3300005444 Bacteria 2410
193 Ga0070694_100137090 3300005444 Bacteria 1774
194 Ga0070694_100168061 3300005444 Bacteria 1614
195 Ga0070694_100197646 3300005444 Bacteria 1497
196 Ga0070694_100314148 3300005444 Bacteria 1204
197 Ga0070708_100000025 3300005445 Bacteria 98091
198 Ga0070708_100014311 3300005445 Bacteria 6523
199 Ga0070708_100550537 3300005445 Bacteria 1088
200 Ga0070663_100103275 3300005455 Bacteria 2130
201 Ga0070663_100129361 3300005455 Bacteria 1916
202 Ga0070678_100076827 3300005456 Unclassified 2517
203 Ga0070678_100188247 3300005456 Bacteria 1695
204 Ga0070678_100650231 3300005456 Bacteria 946
205 Ga0070678_101224314 3300005456 Unclassified 697
206 Ga0070662_100010644 3300005457 Bacteria 6048
207 Ga0070662_100202818 3300005457 Unclassified 1575
208 Ga0070662_100660780 3300005457 Bacteria 882
209 Ga0070681_10007819 3300005458 Bacteria 10456
210 Ga0070681_10008138 3300005458 Bacteria 10264
211 Ga0070681_10031391 3300005458 Bacteria 5333
212 Ga0070681_10039500 3300005458 Unclassified 4730
213 Ga0070681_10080795 3300005458 Bacteria 3207
214 Ga0070681_10103118 3300005458 Bacteria 2797
215 Ga0070681_10250291 3300005458 Unclassified 1685
216 Ga0070681_10277496 3300005458 Bacteria 1587
217 Ga0070681_10400357 3300005458 Bacteria 1284
218 Ga0070681_10438187 3300005458 Bacteria 1219
219 Ga0068867_100027571 3300005459 Bacteria 4084
220 Ga0068867_100089882 3300005459 Bacteria 2329
221 Ga0068867_100093105 3300005459 Bacteria 2290
222 Ga0068867_100129305 3300005459 Bacteria 1961
223 Ga0068867_100261223 3300005459 Bacteria 1412
224 Ga0068867_100299558 3300005459 Bacteria 1325
225 Ga0068867_100435738 3300005459 Bacteria 1113
226 Ga0070685_10012072 3300005466 Bacteria 4531
227 Ga0070685_10039975 3300005466 Bacteria 2667
228 Ga0070685_10366462 3300005466 Bacteria 989
229 Ga0070685_10381812 3300005466 Bacteria 971
230 Ga0070685_10838654 3300005466 Unclassified 680
231 Ga0070706_100061780 3300005467 Bacteria 3460
232 Ga0070706_100149082 3300005467 Bacteria 2184
233 Ga0070707_100004196 3300005468 Bacteria 13511
234 Ga0070707_100233677 3300005468 Bacteria 1789
235 Ga0070707_100670230 3300005468 Bacteria 1000
236 Ga0070698_100037275 3300005471 Bacteria 5013
237 Ga0070698_100151048 3300005471 Bacteria 2270
238 Ga0070698_100343810 3300005471 Bacteria 1423
239 Ga0070698_100389326 3300005471 Bacteria 1327
240 Ga0070698_100617553 3300005471 Bacteria 1025
241 Ga0070699_100013240 3300005518 Bacteria 7113
242 Ga0070699_100023699 3300005518 Bacteria 5288
243 Ga0070699_100068820 3300005518 Bacteria 3075
244 Ga0070699_100358501 3300005518 Bacteria 1314
245 Ga0070679_100003720 3300005530 Bacteria 13984
246 Ga0070679_100016597 3300005530 Bacteria 7110
247 Ga0070679_100061388 3300005530 Bacteria 3746
248 Ga0070679_100074759 3300005530 Unclassified 3378
249 Ga0070679_100094722 3300005530 Bacteria 2973
250 Ga0070679_100114728 3300005530 Bacteria 2679
251 Ga0070679_100120874 3300005530 Bacteria 2604
252 Ga0070679_100152145 3300005530 Bacteria 2290
253 Ga0070679_100232458 3300005530 Bacteria 1803
254 Ga0070679_100241404 3300005530 Bacteria 1764
255 Ga0070679_100294389 3300005530 Bacteria 1574
256 Ga0070679_101848092 3300005530 Unclassified 552
257 Ga0070684_100004941 3300005535 Bacteria 10176
258 Ga0070684_100021662 3300005535 Bacteria 5354
259 Ga0070684_100022792 3300005535 Bacteria 5229
260 Ga0070684_100032908 3300005535 Bacteria 4423
261 Ga0070684_100057872 3300005535 Bacteria 3386
262 Ga0070684_100086975 3300005535 Unclassified 2775
263 Ga0070684_100104767 3300005535 Bacteria 2530
264 Ga0070684_100129972 3300005535 Bacteria 2271
265 Ga0070684_100184656 3300005535 Bacteria 1896
266 Ga0070684_100211512 3300005535 Bacteria 1768
267 Ga0070684_100269916 3300005535 Bacteria 1557
268 Ga0070684_100335863 3300005535 Unclassified 1389
269 Ga0070684_100340927 3300005535 Bacteria 1378
270 Ga0070684_101615162 3300005535 Unclassified 611
271 Ga0070697_100032152 3300005536 Bacteria 4221
272 Ga0070697_100073961 3300005536 Unclassified 2798
273 Ga0068853_100155549 3300005539 Bacteria 2060
274 Ga0068853_100234821 3300005539 Bacteria 1679
275 Ga0068853_100284881 3300005539 Bacteria 1524
276 Ga0068853_101452525 3300005539 Unclassified 664
277 Ga0070672_100017769 3300005543 Bacteria 5125
278 Ga0070672_100093488 3300005543 Bacteria 2429
279 Ga0070672_100099391 3300005543 Bacteria 2358
280 Ga0070672_100127755 3300005543 Bacteria 2087
281 Ga0070672_100168226 3300005543 Bacteria 1822
282 Ga0070672_100251410 3300005543 Unclassified 1489
283 Ga0070672_100279578 3300005543 Bacteria 1411
284 Ga0070672_100717978 3300005543 Bacteria 876
285 Ga0070672_101384489 3300005543 Bacteria 629
286 Ga0070686_100098968 3300005544 Bacteria 1967
287 Ga0070695_100316837 3300005545 Bacteria 1158
288 Ga0070695_100796229 3300005545 Bacteria 757
289 Ga0070695_100862937 3300005545 Bacteria 729
290 Ga0070696_100000569 3300005546 Bacteria 23540
291 Ga0070696_100001843 3300005546 Bacteria 13928
292 Ga0070696_100022547 3300005546 Bacteria 4279
293 Ga0070696_100032961 3300005546 Bacteria 3556
294 Ga0070696_100061706 3300005546 Bacteria 2622
295 Ga0070696_100116243 3300005546 Bacteria 1931
296 Ga0070693_100028201 3300005547 Bacteria 3050
297 Ga0070693_100066254 3300005547 Bacteria 2113
298 Ga0070693_100596771 3300005547 Unclassified 797
299 Ga0070665_100328730 3300005548 Unclassified 1533
300 Ga0070665_101487667 3300005548 Bacteria 686
301 Ga0070665_101832396 3300005548 Bacteria 613
302 Ga0070704_100002736 3300005549 Bacteria 9967
303 Ga0070704_100019323 3300005549 Bacteria 4376
304 Ga0070704_100025886 3300005549 Bacteria 3868
305 Ga0070704_100190860 3300005549 Bacteria 1647
306 Ga0068855_100010843 3300005563 Bacteria 11003
307 Ga0068855_100067864 3300005563 Bacteria 4153
308 Ga0068855_100099477 3300005563 Bacteria 3350
309 Ga0068855_100237577 3300005563 Unclassified 2037
310 Ga0068855_100599515 3300005563 Bacteria 1188
311 Ga0068855_100746249 3300005563 Bacteria 1044
312 Ga0068855_100861870 3300005563 Bacteria 959
313 Ga0068855_101116712 3300005563 Unclassified 823
314 Ga0068855_101146963 3300005563 Bacteria 810
315 Ga0068855_101671446 3300005563 Bacteria 650
316 Ga0070664_100001163 3300005564 Bacteria 20879
317 Ga0070664_100032756 3300005564 Bacteria 4348
318 Ga0070664_100042123 3300005564 Bacteria 3855
319 Ga0070664_100053851 3300005564 Unclassified 3412
320 Ga0070664_100058462 3300005564 Bacteria 3279
321 Ga0070664_100091594 3300005564 Bacteria 2632
322 Ga0070664_100117959 3300005564 Bacteria 2321
323 Ga0070664_100236253 3300005564 Bacteria 1639
324 Ga0070664_100521792 3300005564 Bacteria 1096
325 Ga0070664_100591583 3300005564 Bacteria 1028
326 Ga0070664_100633580 3300005564 Bacteria 993
327 Ga0070664_101702702 3300005564 Unclassified 598
328 Ga0068857_100018350 3300005577 Bacteria 6138
329 Ga0068857_100112463 3300005577 Bacteria 2448
330 Ga0068857_100204113 3300005577 Bacteria 1802
331 Ga0068857_100266308 3300005577 Bacteria 1574
332 Ga0068857_100500254 3300005577 Bacteria 1141
333 Ga0068857_100741812 3300005577 Bacteria 935
334 Ga0068857_101751430 3300005577 Unclassified 608
335 Ga0068854_100009778 3300005578 Bacteria 6199
336 Ga0068854_100023349 3300005578 Bacteria 4223
337 Ga0068854_100025031 3300005578 Bacteria 4094
338 Ga0068854_100346876 3300005578 Bacteria 1214
339 Ga0068854_100537748 3300005578 Bacteria 989
340 Ga0068854_100859417 3300005578 Bacteria 795
341 Ga0068854_101345134 3300005578 Unclassified 644
342 Ga0068854_101832262 3300005578 Bacteria 557
343 Ga0068856_100141013 3300005614 Unclassified 2417
344 Ga0068856_100271486 3300005614 Bacteria 1712
345 Ga0068856_100485469 3300005614 Bacteria 1256
346 Ga0068856_102134213 3300005614 Bacteria 570
347 Ga0070702_100065010 3300005615 Bacteria 2135
348 Ga0070702_101177249 3300005615 Bacteria 617
349 Ga0068852_100015330 3300005616 Bacteria 5938
350 Ga0068852_100028072 3300005616 Bacteria 4600
351 Ga0068852_100052592 3300005616 Bacteria 3501
352 Ga0068852_100059930 3300005616 Bacteria 3303
353 Ga0068852_100531315 3300005616 Unclassified 1175
354 Ga0068852_100989559 3300005616 Bacteria 859
355 Ga0068859_100038158 3300005617 Bacteria 4820
356 Ga0068859_100083687 3300005617 Bacteria 3234
357 Ga0068859_100084282 3300005617 Bacteria 3223
358 Ga0068859_100370831 3300005617 Bacteria 1527
359 Ga0068864_100052106 3300005618 Unclassified 3527
360 Ga0068864_100062593 3300005618 Bacteria 3224
361 Ga0068864_100469716 3300005618 Bacteria 1206
362 Ga0068864_101431584 3300005618 Unclassified 693
363 Ga0068864_101731111 3300005618 Unclassified 630
364 Ga0068866_10055185 3300005718 Bacteria 2039
365 Ga0068866_10229586 3300005718 Bacteria 1125
366 Ga0068866_10474794 3300005718 Unclassified 822
367 Ga0068861_100071518 3300005719 Bacteria 2689
368 Ga0068861_100895797 3300005719 Bacteria 840
369 Ga0068851_10070172 3300005834 Unclassified 1811
370 Ga0068851_10208775 3300005834 Bacteria 1093
371 Ga0068851_10281974 3300005834 Bacteria 950
372 Ga0068851_10458262 3300005834 Unclassified 759
373 Ga0068870_10015290 3300005840 Bacteria 3638
374 Ga0068870_10045962 3300005840 Unclassified 2288
375 Ga0068863_100077222 3300005841 Bacteria 3152
376 Ga0068863_100288446 3300005841 Bacteria 1591
377 Ga0068863_100477226 3300005841 Bacteria 1226
378 Ga0068863_100885579 3300005841 Unclassified 892
379 Ga0068863_101815222 3300005841 Bacteria 620
380 Ga0068858_100208622 3300005842 Bacteria 1849
381 Ga0068860_100178786 3300005843 Bacteria 2051
382 Ga0068860_100181900 3300005843 Bacteria 2032
383 Ga0068860_100235724 3300005843 Bacteria 1779
384 Ga0068860_100395778 3300005843 Bacteria 1366
385 Ga0068860_101111028 3300005843 Bacteria 810
386 Ga0068862_100000345 3300005844 Bacteria 50340
387 Ga0068862_100112879 3300005844 Unclassified 2387
388 Ga0068862_100151593 3300005844 Bacteria 2064
389 Ga0081455_10089316 3300005937 Bacteria 2501
390 Ga0081539_10000221 3300005985 Bacteria 133216
391 Ga0070717_10001614 3300006028 Bacteria 15615
392 Ga0070712_100050871 3300006175 Bacteria 2885
393 Ga0070712_100055819 3300006175 Bacteria 2768
394 Ga0097621_100101720 3300006237 Bacteria 2418
395 Ga0097621_100689497 3300006237 Unclassified 940
396 Ga0068871_100141038 3300006358 Bacteria 2049
397 Ga0068871_100460887 3300006358 Bacteria 1141
398 Ga0068871_100482611 3300006358 Bacteria 1115
399 Ga0068871_100751601 3300006358 Bacteria 896
400 Ga0075428_100202153 3300006844 Bacteria 2147
401 Ga0075428_100842328 3300006844 Bacteria 974
402 Ga0075430_100006599 3300006846 Bacteria 9779
403 Ga0075430_100032971 3300006846 Bacteria 4396
404 Ga0075430_100039156 3300006846 Bacteria 4015
405 Ga0075430_100082368 3300006846 Bacteria 2696
406 Ga0075430_100159699 3300006846 Unclassified 1876
407 Ga0075430_100694011 3300006846 Bacteria 839
408 Ga0075430_101157904 3300006846 Bacteria 637
409 Ga0075431_100003201 3300006847 Bacteria 15836
410 Ga0075431_100097822 3300006847 Bacteria 3030
411 Ga0075431_100156632 3300006847 Bacteria 2343
412 Ga0075431_100297065 3300006847 Bacteria 1632
413 Ga0075431_100312989 3300006847 Bacteria 1584
414 Ga0075431_100568716 3300006847 Bacteria 1120
415 Ga0075431_101121870 3300006847 Bacteria 751
416 Ga0075431_101661809 3300006847 Unclassified 596
417 Ga0075433_10002069 3300006852 Bacteria 15164
418 Ga0075433_10047897 3300006852 Bacteria 3717
419 Ga0075434_100015554 3300006871 Bacteria 7302
420 Ga0075434_100036023 3300006871 Bacteria 4893
421 Ga0075434_100043530 3300006871 Bacteria 4453
422 Ga0075434_100777511 3300006871 Bacteria 974
423 Ga0075429_100003639 3300006880 Bacteria 13128
424 Ga0075429_100048519 3300006880 Bacteria 3693
425 Ga0075429_100206334 3300006880 Unclassified 1722
426 Ga0075429_100261267 3300006880 Bacteria 1516
427 Ga0075429_100524559 3300006880 Bacteria 1038
428 Ga0075429_100577651 3300006880 Bacteria 985
429 Ga0068865_100007652 3300006881 Bacteria 6656
430 Ga0068865_100043303 3300006881 Bacteria 3075
431 Ga0068865_100156493 3300006881 Bacteria 1734
432 Ga0068865_100527710 3300006881 Bacteria 988
433 Ga0068865_101265731 3300006881 Unclassified 655
434 Ga0075436_100002301 3300006914 Bacteria 13163
435 Ga0075436_100013028 3300006914 Bacteria 5701
436 Ga0075436_100048982 3300006914 Bacteria 2915
437 Ga0097620_100038159 3300006931 Bacteria 4820
438 Ga0097620_100083689 3300006931 Bacteria 3234
439 Ga0097620_100084286 3300006931 Bacteria 3223
440 Ga0097620_100370860 3300006931 Bacteria 1527
441 Ga0075435_100438974 3300007076 Unclassified 1125
442 Ga0105240_10004437 3300009093 Bacteria 21401
443 Ga0105240_10023119 3300009093 Bacteria 8230
444 Ga0105240_10057070 3300009093 Bacteria 4882
445 Ga0105240_10134011 3300009093 Bacteria 2968
446 Ga0105240_10763615 3300009093 Bacteria 1050
447 Ga0105240_10923511 3300009093 Unclassified 938
448 Ga0105240_11664833 3300009093 Bacteria 667
449 Ga0111539_10018859 3300009094 Bacteria 8535
450 Ga0111539_10083002 3300009094 Bacteria 3769
451 Ga0111539_11394404 3300009094 Unclassified 813
452 Ga0105245_10200643 3300009098 Bacteria 1915
453 Ga0105245_10280170 3300009098 Bacteria 1629
454 Ga0105245_10288039 3300009098 Bacteria 1608
455 Ga0105245_10819580 3300009098 Unclassified 969
456 Ga0105245_11158592 3300009098 Bacteria 820
457 Ga0105245_11181373 3300009098 Bacteria 813
458 Ga0105245_11386390 3300009098 Bacteria 753
459 Ga0105245_11387830 3300009098 Bacteria 752
460 Ga0105247_10147270 3300009101 Bacteria 1549
461 Ga0114129_10141803 3300009147 Bacteria 3293
462 Ga0114129_10280082 3300009147 Bacteria 2228
463 Ga0114129_11881448 3300009147 Bacteria 726
464 Ga0105243_10205789 3300009148 Bacteria 1729
465 Ga0105243_10942439 3300009148 Bacteria 862
466 Ga0105243_11767242 3300009148 Bacteria 649
467 Ga0105241_10012411 3300009174 Bacteria 6245
468 Ga0105241_10106603 3300009174 Unclassified 2237
469 Ga0105241_10150260 3300009174 Bacteria 1905
470 Ga0105242_10015286 3300009176 Bacteria 5961
471 Ga0105242_10044869 3300009176 Bacteria 3581
472 Ga0105242_10085069 3300009176 Bacteria 2652
473 Ga0105242_10703948 3300009176 Bacteria 989
474 Ga0105248_10010930 3300009177 Bacteria 10015
475 Ga0105248_10053946 3300009177 Bacteria 4509
476 Ga0105248_10069952 3300009177 Bacteria 3941
477 Ga0105248_10309714 3300009177 Bacteria 1778
478 Ga0105248_10438966 3300009177 Unclassified 1470
479 Ga0105248_10641304 3300009177 Bacteria 1198
480 Ga0105248_10706521 3300009177 Bacteria 1137
481 Ga0105248_10709083 3300009177 Bacteria 1135
482 Ga0105237_10026780 3300009545 Bacteria 5892
483 Ga0105237_10186091 3300009545 Bacteria 2077
484 Ga0105237_10276573 3300009545 Bacteria 1681
485 Ga0105237_11031213 3300009545 Bacteria 829
486 Ga0105238_10060734 3300009551 Bacteria 3784
487 Ga0105238_10141799 3300009551 Unclassified 2380
488 Ga0105238_10573937 3300009551 Bacteria 1134
489 Ga0105249_10000276 3300009553 Bacteria 54132
490 Ga0105249_10025588 3300009553 Bacteria 5315
491 Ga0105249_10135183 3300009553 Bacteria 2358
492 Ga0105239_10321020 3300010375 Bacteria 1746
493 Ga0105239_11323371 3300010375 Bacteria 831
494 Ga0105239_13450511 3300010375 Bacteria 514
495 Ga0105246_10090990 3300011119 Bacteria 2198
496 Ga0105246_10325804 3300011119 Bacteria 1250
497 Ga0105246_10725057 3300011119 Bacteria 874
498 Ga0157373_10000674 3300013100 Bacteria 26717
499 Ga0157373_10083963 3300013100 Bacteria 2245
500 Ga0157373_10175732 3300013100 Bacteria 1507
501 Ga0157373_10242259 3300013100 Bacteria 1275
502 Ga0157373_10648950 3300013100 Unclassified 771
503 Ga0157371_10007249 3300013102 Bacteria 9004
504 Ga0157371_10086632 3300013102 Bacteria 2218
505 Ga0157371_10174992 3300013102 Bacteria 1534
506 Ga0157371_10489199 3300013102 Bacteria 908
507 Ga0157371_10631511 3300013102 Bacteria 798
508 Ga0157370_10005892 3300013104 Bacteria 13661
509 Ga0157370_10006750 3300013104 Bacteria 12588
510 Ga0157370_10042235 3300013104 Bacteria 4395
511 Ga0157370_10055314 3300013104 Bacteria 3781
512 Ga0157370_10063356 3300013104 Bacteria 3503
513 Ga0157370_10155255 3300013104 Bacteria 2129
514 Ga0157370_10290124 3300013104 Unclassified 1511
515 Ga0157370_10373213 3300013104 Bacteria 1314
516 Ga0157370_10708497 3300013104 Bacteria 919
517 Ga0157370_11137233 3300013104 Bacteria 705
518 Ga0157370_11598944 3300013104 Bacteria 586
519 Ga0157369_10010955 3300013105 Bacteria 10322
520 Ga0157369_10028668 3300013105 Bacteria 6158
521 Ga0157369_10099704 3300013105 Bacteria 3097
522 Ga0157369_10129696 3300013105 Bacteria 2672
523 Ga0157369_10301239 3300013105 Bacteria 1667
524 Ga0157369_10635063 3300013105 Bacteria 1101
525 Ga0157369_10757009 3300013105 Bacteria 999
526 Ga0157369_10950489 3300013105 Bacteria 881
527 Ga0157369_11159981 3300013105 Bacteria 789
528 Ga0157374_10015504 3300013296 Bacteria 6685
529 Ga0157374_10133952 3300013296 Unclassified 2400
530 Ga0157374_10216006 3300013296 Bacteria 1881
531 Ga0157374_10249779 3300013296 Bacteria 1745
532 Ga0157374_11283545 3300013296 Bacteria 754
533 Ga0157378_10029108 3300013297 Bacteria 4876
534 Ga0157378_10060345 3300013297 Unclassified 3385
535 Ga0157378_10092357 3300013297 Bacteria 2754
536 Ga0157378_10179396 3300013297 Unclassified 1991
537 Ga0157378_10260006 3300013297 Bacteria 1665
538 Ga0157378_10470850 3300013297 Bacteria 1250
539 Ga0163162_10075611 3300013306 Bacteria 3429
540 Ga0163162_10078881 3300013306 Bacteria 3358
541 Ga0163162_10104238 3300013306 Unclassified 2930
542 Ga0163162_10568651 3300013306 Bacteria 1261
543 Ga0163162_10722095 3300013306 Bacteria 1117
544 Ga0157372_10011736 3300013307 Bacteria 9329
545 Ga0157372_10036892 3300013307 Bacteria 5390
546 Ga0157372_10052954 3300013307 Bacteria 4521
547 Ga0157372_10056818 3300013307 Bacteria 4373
548 Ga0157372_10097004 3300013307 Bacteria 3361
549 Ga0157372_10098929 3300013307 Unclassified 3327
550 Ga0157372_10129228 3300013307 Bacteria 2906
551 Ga0157372_10174213 3300013307 Bacteria 2490
552 Ga0157372_10515700 3300013307 Unclassified 1394
553 Ga0157372_10643682 3300013307 Bacteria 1235
554 Ga0157372_11347820 3300013307 Bacteria 823
555 Ga0157372_11851538 3300013307 Bacteria 694
556 Ga0157372_12251215 3300013307 Unclassified 626
557 Ga0157375_10015641 3300013308 Bacteria 6797
558 Ga0157375_10033974 3300013308 Bacteria 4853
559 Ga0157375_10034069 3300013308 Bacteria 4847
560 Ga0157375_10052054 3300013308 Bacteria 4024
561 Ga0157375_10078385 3300013308 Bacteria 3337
562 Ga0157375_10080902 3300013308 Bacteria 3287
563 Ga0157375_10242986 3300013308 Bacteria 1960
564 Ga0157375_10366758 3300013308 Bacteria 1606
565 Ga0157375_10512092 3300013308 Bacteria 1364
566 Ga0163163_10215396 3300014325 Unclassified 1969
567 Ga0163163_10811635 3300014325 Bacteria 999
568 Ga0157380_10009657 3300014326 Bacteria 6918
569 Ga0157380_10124883 3300014326 Bacteria 2186
570 Ga0157380_12886611 3300014326 Bacteria 547
571 Ga0157377_10032521 3300014745 Bacteria 2841
572 Ga0157379_10964651 3300014968 Unclassified 811
573 Ga0182007_10049935 3300015262 Bacteria 1381
574 Ga0182005_1200827 3300015265 Bacteria 599
575 Ga0163161_10102435 3300017792 Unclassified 2132
576 Ga0163161_10225197 3300017792 Bacteria 1454
577 Ga0163161_10404345 3300017792 Bacteria 1095
578 Ga0163161_10589222 3300017792 Bacteria 915
579 Ga0197907_10300930 3300020069 Bacteria 963
580 Ga0197907_10335747 3300020069 Bacteria 1891
581 Ga0197907_10694383 3300020069 Unclassified 916
582 Ga0206356_11166277 3300020070 Bacteria 1166
583 Ga0206355_1021136 3300020076 Bacteria 1109
584 Ga0206355_1195921 3300020076 Bacteria 1307
585 Ga0206352_10376517 3300020078 Bacteria 2212
586 Ga0206350_10779916 3300020080 Bacteria 1093
587 Ga0206350_10804192 3300020080 Bacteria 1320
588 Ga0206354_10528991 3300020081 Bacteria 1950
589 Ga0206354_11308762 3300020081 Bacteria 655
590 Ga0206353_10548619 3300020082 Bacteria 969
591 Ga0206353_11927621 3300020082 Unclassified 944
592 Ga0213876_10049722 3300021384 Bacteria 2215
593 Ga0213876_10056960 3300021384 Unclassified 2063
594 Ga0224712_10075175 3300022467 Bacteria 1381
595 Ga0224712_10181660 3300022467 Bacteria 948
596 Ga0224712_10353641 3300022467 Bacteria 694
597 Ga0207656_10011423 3300025321 Bacteria 3355
598 Ga0207656_10176164 3300025321 Bacteria 1024
599 Ga0207656_10292518 3300025321 Unclassified 805
600 Ga0207682_10025320 3300025893 Bacteria 2353
601 Ga0207682_10194326 3300025893 Bacteria 931
602 Ga0207692_10071496 3300025898 Bacteria 1830
603 Ga0207692_10215920 3300025898 Unclassified 1135
604 Ga0207692_10749304 3300025898 Bacteria 636
605 Ga0207642_10007202 3300025899 Bacteria 3744
606 Ga0207642_10035667 3300025899 Bacteria 2127
607 Ga0207688_10069540 3300025901 Bacteria 1995
608 Ga0207688_10527562 3300025901 Bacteria 741
609 Ga0207688_10911683 3300025901 Bacteria 556
610 Ga0207680_10107631 3300025903 Bacteria 1802
611 Ga0207680_10378155 3300025903 Bacteria 998
612 Ga0207647_10369324 3300025904 Bacteria 811
613 Ga0207699_10008689 3300025906 Bacteria 5024
614 Ga0207699_10008886 3300025906 Bacteria 4979
615 Ga0207699_10021920 3300025906 Bacteria 3452
616 Ga0207699_10121357 3300025906 Bacteria 1691
617 Ga0207699_10475370 3300025906 Bacteria 899
618 Ga0207645_10037165 3300025907 Bacteria 3126
619 Ga0207645_10083887 3300025907 Bacteria 2044
620 Ga0207645_10095920 3300025907 Unclassified 1910
621 Ga0207645_10171647 3300025907 Bacteria 1421
622 Ga0207645_10183254 3300025907 Bacteria 1374
623 Ga0207645_10283889 3300025907 Bacteria 1100
624 Ga0207645_10703160 3300025907 Bacteria 687
625 Ga0207643_10038892 3300025908 Bacteria 2674
626 Ga0207643_10046398 3300025908 Bacteria 2456
627 Ga0207643_10061108 3300025908 Unclassified 2151
628 Ga0207705_10001964 3300025909 Bacteria 16042
629 Ga0207705_10003814 3300025909 Bacteria 11463
630 Ga0207705_10088802 3300025909 Bacteria 2261
631 Ga0207705_10091858 3300025909 Bacteria 2224
632 Ga0207705_10121294 3300025909 Bacteria 1940
633 Ga0207705_10229631 3300025909 Unclassified 1411
634 Ga0207705_10610855 3300025909 Bacteria 848
635 Ga0207705_11320602 3300025909 Unclassified 550
636 Ga0207684_10071570 3300025910 Bacteria 2946
637 Ga0207684_10086348 3300025910 Bacteria 2672
638 Ga0207684_10758080 3300025910 Bacteria 822
639 Ga0207654_10047074 3300025911 Bacteria 2462
640 Ga0207654_10138424 3300025911 Bacteria 1549
641 Ga0207707_10001832 3300025912 Bacteria 19501
642 Ga0207707_10003256 3300025912 Bacteria 14427
643 Ga0207707_10007887 3300025912 Bacteria 9259
644 Ga0207707_10012641 3300025912 Bacteria 7337
645 Ga0207707_10025337 3300025912 Bacteria 5188
646 Ga0207707_10048537 3300025912 Bacteria 3698
647 Ga0207707_10077973 3300025912 Bacteria 2893
648 Ga0207707_10113684 3300025912 Unclassified 2366
649 Ga0207707_10129275 3300025912 Bacteria 2209
650 Ga0207707_10339436 3300025912 Bacteria 1295
651 Ga0207707_11170911 3300025912 Bacteria 623
652 Ga0207695_10003486 3300025913 Bacteria 22123
653 Ga0207695_10017609 3300025913 Bacteria 8304
654 Ga0207695_10019830 3300025913 Bacteria 7729
655 Ga0207695_10023027 3300025913 Bacteria 7052
656 Ga0207695_10062168 3300025913 Bacteria 3857
657 Ga0207695_10139100 3300025913 Bacteria 2379
658 Ga0207695_10766503 3300025913 Bacteria 845
659 Ga0207695_10781330 3300025913 Bacteria 835
660 Ga0207695_10987763 3300025913 Bacteria 721
661 Ga0207695_11680433 3300025913 Bacteria 516
662 Ga0207671_10146011 3300025914 Unclassified 1825
663 Ga0207671_10158570 3300025914 Bacteria 1751
664 Ga0207671_10336824 3300025914 Bacteria 1195
665 Ga0207693_10018764 3300025915 Bacteria 5504
666 Ga0207693_10101397 3300025915 Bacteria 2257
667 Ga0207693_10605541 3300025915 Bacteria 853
668 Ga0207663_10070604 3300025916 Bacteria 2251
669 Ga0207663_10405262 3300025916 Bacteria 1044
670 Ga0207663_10729702 3300025916 Bacteria 786
671 Ga0207660_10000760 3300025917 Bacteria 21451
672 Ga0207660_10002967 3300025917 Bacteria 11095
673 Ga0207660_10011047 3300025917 Bacteria 5873
674 Ga0207660_10011960 3300025917 Bacteria 5666
675 Ga0207660_10035829 3300025917 Bacteria 3447
676 Ga0207660_10064879 3300025917 Bacteria 2637
677 Ga0207660_10156849 3300025917 Bacteria 1753
678 Ga0207660_10234408 3300025917 Bacteria 1444
679 Ga0207660_10769942 3300025917 Bacteria 785
680 Ga0207662_10001809 3300025918 Bacteria 10497
681 Ga0207662_10050281 3300025918 Unclassified 2475
682 Ga0207662_10061356 3300025918 Unclassified 2257
683 Ga0207657_10014509 3300025919 Bacteria 7684
684 Ga0207657_10023382 3300025919 Bacteria 5755
685 Ga0207657_10054816 3300025919 Bacteria 3446
686 Ga0207657_10059270 3300025919 Bacteria 3291
687 Ga0207657_10268800 3300025919 Bacteria 1356
688 Ga0207649_10036512 3300025920 Bacteria 2960
689 Ga0207649_10040407 3300025920 Bacteria 2835
690 Ga0207649_10050794 3300025920 Bacteria 2566
691 Ga0207649_10071537 3300025920 Bacteria 2215
692 Ga0207649_10098899 3300025920 Bacteria 1926
693 Ga0207649_10100201 3300025920 Bacteria 1916
694 Ga0207649_10180594 3300025920 Bacteria 1477
695 Ga0207649_10194535 3300025920 Bacteria 1428
696 Ga0207649_10631063 3300025920 Bacteria 826
697 Ga0207649_10674465 3300025920 Bacteria 800
698 Ga0207652_10000783 3300025921 Bacteria 30376
699 Ga0207652_10005886 3300025921 Bacteria 9922
700 Ga0207652_10017563 3300025921 Bacteria 5856
701 Ga0207652_10027000 3300025921 Bacteria 4784
702 Ga0207652_10057791 3300025921 Bacteria 3341
703 Ga0207652_10073673 3300025921 Bacteria 2972
704 Ga0207652_10116909 3300025921 Bacteria 2369
705 Ga0207652_10121793 3300025921 Bacteria 2321
706 Ga0207652_10124231 3300025921 Unclassified 2298
707 Ga0207652_10284849 3300025921 Bacteria 1491
708 Ga0207652_10323423 3300025921 Bacteria 1392
709 Ga0207652_10324908 3300025921 Bacteria 1389
710 Ga0207652_10326119 3300025921 Bacteria 1386
711 Ga0207652_10753397 3300025921 Bacteria 867
712 Ga0207652_11031750 3300025921 Bacteria 722
713 Ga0207646_10007037 3300025922 Bacteria 11515
714 Ga0207646_10074853 3300025922 Bacteria 3025
715 Ga0207646_10082938 3300025922 Bacteria 2867
716 Ga0207646_10734680 3300025922 Bacteria 881
717 Ga0207681_10000718 3300025923 Bacteria 21752
718 Ga0207681_10023163 3300025923 Bacteria 3969
719 Ga0207681_10034751 3300025923 Bacteria 3317
720 Ga0207681_10124693 3300025923 Bacteria 1894
721 Ga0207681_10739357 3300025923 Unclassified 819
722 Ga0207694_10103351 3300025924 Unclassified 2259
723 Ga0207694_10465840 3300025924 Bacteria 1056
724 Ga0207694_11294963 3300025924 Bacteria 616
725 Ga0207650_10110791 3300025925 Bacteria 2125
726 Ga0207650_10129778 3300025925 Bacteria 1971
727 Ga0207650_10267056 3300025925 Unclassified 1390
728 Ga0207650_10358845 3300025925 Unclassified 1200
729 Ga0207650_10595361 3300025925 Bacteria 929
730 Ga0207650_11872016 3300025925 Unclassified 507
731 Ga0207659_10047504 3300025926 Bacteria 3036
732 Ga0207659_10101691 3300025926 Unclassified 2168
733 Ga0207659_10121102 3300025926 Bacteria 2005
734 Ga0207659_10435082 3300025926 Bacteria 1102
735 Ga0207659_10504512 3300025926 Bacteria 1024
736 Ga0207687_10232707 3300025927 Bacteria 1456
737 Ga0207687_10378203 3300025927 Unclassified 1160
738 Ga0207687_10396303 3300025927 Bacteria 1134
739 Ga0207687_10840111 3300025927 Bacteria 784
740 Ga0207687_11065322 3300025927 Bacteria 694
741 Ga0207700_10044053 3300025928 Unclassified 3282
742 Ga0207700_10045283 3300025928 Bacteria 3245
743 Ga0207700_10555516 3300025928 Bacteria 1019
744 Ga0207700_11095110 3300025928 Unclassified 712
745 Ga0207664_10027669 3300025929 Bacteria 4302
746 Ga0207664_10041180 3300025929 Bacteria 3598
747 Ga0207644_10043924 3300025931 Bacteria 3173
748 Ga0207644_10081943 3300025931 Bacteria 2386
749 Ga0207644_10113758 3300025931 Unclassified 2050
750 Ga0207644_10175838 3300025931 Bacteria 1675
751 Ga0207644_10308761 3300025931 Bacteria 1276
752 Ga0207644_10586178 3300025931 Bacteria 925
753 Ga0207690_10059298 3300025932 Bacteria 2593
754 Ga0207690_10149559 3300025932 Unclassified 1730
755 Ga0207690_10689105 3300025932 Bacteria 839
756 Ga0207690_11585698 3300025932 Bacteria 547
757 Ga0207706_10095915 3300025933 Bacteria 2608
758 Ga0207706_10164172 3300025933 Bacteria 1952
759 Ga0207706_10239036 3300025933 Bacteria 1588
760 Ga0207706_10350873 3300025933 Bacteria 1283
761 Ga0207686_10129047 3300025934 Bacteria 1732
762 Ga0207686_10252233 3300025934 Unclassified 1290
763 Ga0207686_10488662 3300025934 Bacteria 953
764 Ga0207709_10064712 3300025935 Bacteria 2297
765 Ga0207709_10538653 3300025935 Bacteria 916
766 Ga0207709_10749054 3300025935 Bacteria 785
767 Ga0207709_10969726 3300025935 Bacteria 694
768 Ga0207670_10135522 3300025936 Unclassified 1809
769 Ga0207670_10352296 3300025936 Bacteria 1166
770 Ga0207669_10070059 3300025937 Bacteria 2197
771 Ga0207669_10145491 3300025937 Bacteria 1652
772 Ga0207669_10161058 3300025937 Bacteria 1585
773 Ga0207669_10222289 3300025937 Bacteria 1387
774 Ga0207704_10004959 3300025938 Bacteria 6121
775 Ga0207704_10019528 3300025938 Bacteria 3561
776 Ga0207704_10135374 3300025938 Bacteria 1714
777 Ga0207704_10376165 3300025938 Bacteria 1114
778 Ga0207704_10602622 3300025938 Bacteria 899
779 Ga0207704_10696265 3300025938 Bacteria 841
780 Ga0207704_11653214 3300025938 Bacteria 550
781 Ga0207665_10047452 3300025939 Bacteria 2880
782 Ga0207665_10259743 3300025939 Bacteria 1286
783 Ga0207665_10932919 3300025939 Bacteria 689
784 Ga0207691_10006396 3300025940 Bacteria 11377
785 Ga0207691_10008070 3300025940 Bacteria 10115
786 Ga0207691_10034694 3300025940 Bacteria 4690
787 Ga0207691_10038379 3300025940 Bacteria 4433
788 Ga0207691_10215428 3300025940 Bacteria 1667
789 Ga0207691_10281956 3300025940 Bacteria 1429
790 Ga0207691_10492285 3300025940 Bacteria 1041
791 Ga0207711_10293681 3300025941 Bacteria 1498
792 Ga0207711_10354370 3300025941 Bacteria 1359
793 Ga0207711_10382861 3300025941 Bacteria 1305
794 Ga0207711_10468404 3300025941 Unclassified 1173
795 Ga0207711_10661323 3300025941 Unclassified 974
796 Ga0207711_10736237 3300025941 Bacteria 919
797 Ga0207689_10099509 3300025942 Bacteria 2389
798 Ga0207689_10615213 3300025942 Bacteria 914
799 Ga0207661_10000773 3300025944 Bacteria 20768
800 Ga0207661_10003324 3300025944 Bacteria 11156
801 Ga0207661_10025056 3300025944 Bacteria 4530
802 Ga0207661_10027886 3300025944 Bacteria 4319
803 Ga0207661_10096646 3300025944 Bacteria 2472
804 Ga0207661_10101249 3300025944 Bacteria 2420
805 Ga0207661_10126586 3300025944 Unclassified 2182
806 Ga0207661_10132816 3300025944 Bacteria 2135
807 Ga0207661_10218129 3300025944 Unclassified 1685
808 Ga0207661_10230983 3300025944 Bacteria 1638
809 Ga0207661_10231177 3300025944 Bacteria 1637
810 Ga0207661_10272806 3300025944 Bacteria 1510
811 Ga0207661_10512812 3300025944 Bacteria 1096
812 Ga0207661_10527531 3300025944 Unclassified 1080
813 Ga0207661_10847343 3300025944 Bacteria 842
814 Ga0207661_10995049 3300025944 Bacteria 772
815 Ga0207679_10011335 3300025945 Bacteria 5768
816 Ga0207679_10014612 3300025945 Bacteria 5165
817 Ga0207679_10035388 3300025945 Bacteria 3533
818 Ga0207679_10042693 3300025945 Bacteria 3261
819 Ga0207679_10060806 3300025945 Unclassified 2809
820 Ga0207679_10115076 3300025945 Bacteria 2130
821 Ga0207679_10219423 3300025945 Bacteria 1599
822 Ga0207679_10243205 3300025945 Unclassified 1526
823 Ga0207679_10741844 3300025945 Bacteria 893
824 Ga0207679_10754073 3300025945 Bacteria 885
825 Ga0207667_10010475 3300025949 Bacteria 10837
826 Ga0207667_10037594 3300025949 Bacteria 5174
827 Ga0207667_10073577 3300025949 Bacteria 3550
828 Ga0207667_10088790 3300025949 Bacteria 3196
829 Ga0207667_10181761 3300025949 Bacteria 2159
830 Ga0207667_10483260 3300025949 Bacteria 1257
831 Ga0207667_10746865 3300025949 Bacteria 978
832 Ga0207667_10965469 3300025949 Unclassified 841
833 Ga0207667_11300146 3300025949 Bacteria 704
834 Ga0207667_11305099 3300025949 Unclassified 702
835 Ga0207651_10073464 3300025960 Unclassified 2432
836 Ga0207651_10117565 3300025960 Bacteria 2009
837 Ga0207651_10203343 3300025960 Bacteria 1589
838 Ga0207651_10272086 3300025960 Bacteria 1395
839 Ga0207651_10301036 3300025960 Bacteria 1333
840 Ga0207651_10872437 3300025960 Bacteria 800
841 Ga0207651_11216466 3300025960 Bacteria 676
842 Ga0207712_10000346 3300025961 Bacteria 41710
843 Ga0207712_10054871 3300025961 Unclassified 2800
844 Ga0207712_10967905 3300025961 Bacteria 754
845 Ga0207668_10019176 3300025972 Bacteria 4318
846 Ga0207668_10105113 3300025972 Bacteria 2107
847 Ga0207668_10654962 3300025972 Bacteria 919
848 Ga0207668_11084966 3300025972 Bacteria 717
849 Ga0207668_11665799 3300025972 Bacteria 576
850 Ga0207640_10002551 3300025981 Bacteria 9762
851 Ga0207640_10004890 3300025981 Bacteria 7280
852 Ga0207640_10052552 3300025981 Bacteria 2654
853 Ga0207640_10646392 3300025981 Bacteria 901
854 Ga0207640_11970463 3300025981 Bacteria 529
855 Ga0207658_10023714 3300025986 Unclassified 4286
856 Ga0207658_10045123 3300025986 Bacteria 3212
857 Ga0207658_10324125 3300025986 Bacteria 1334
858 Ga0207658_10331932 3300025986 Bacteria 1319
859 Ga0207658_10394429 3300025986 Bacteria 1215
860 Ga0207658_10662622 3300025986 Bacteria 941
861 Ga0207677_10005642 3300026023 Bacteria 6804
862 Ga0207677_10031481 3300026023 Bacteria 3398
863 Ga0207677_10447218 3300026023 Bacteria 1106
864 Ga0207677_10920271 3300026023 Bacteria 789
865 Ga0207677_11205965 3300026023 Bacteria 693
866 Ga0207677_11363063 3300026023 Bacteria 653
867 Ga0207677_11865006 3300026023 Bacteria 558
868 Ga0207703_10148733 3300026035 Unclassified 2040
869 Ga0207703_10176562 3300026035 Bacteria 1882
870 Ga0207639_10017793 3300026041 Bacteria 5039
871 Ga0207639_10345808 3300026041 Bacteria 1327
872 Ga0207639_10703683 3300026041 Bacteria 937
873 Ga0207639_10811003 3300026041 Bacteria 872
874 Ga0207639_10931214 3300026041 Bacteria 813
875 Ga0207639_11670884 3300026041 Bacteria 597
876 Ga0207678_10005989 3300026067 Bacteria 10818
877 Ga0207678_10165263 3300026067 Bacteria 1890
878 Ga0207678_10181623 3300026067 Bacteria 1797
879 Ga0207678_10226531 3300026067 Bacteria 1600
880 Ga0207708_10013573 3300026075 Bacteria 6090
881 Ga0207708_10015945 3300026075 Bacteria 5643
882 Ga0207708_10047116 3300026075 Bacteria 3283
883 Ga0207708_10097011 3300026075 Unclassified 2278
884 Ga0207708_10172929 3300026075 Bacteria 1712
885 Ga0207708_10261267 3300026075 Bacteria 1398
886 Ga0207708_10302639 3300026075 Bacteria 1301
887 Ga0207708_10553425 3300026075 Bacteria 970
888 Ga0207702_10051183 3300026078 Bacteria 3489
889 Ga0207702_10220062 3300026078 Bacteria 1769
890 Ga0207641_10184925 3300026088 Bacteria 1911
891 Ga0207641_10216253 3300026088 Unclassified 1775
892 Ga0207641_10610794 3300026088 Unclassified 1068
893 Ga0207641_10693984 3300026088 Bacteria 1002
894 Ga0207648_10003894 3300026089 Bacteria 15579
895 Ga0207648_10014817 3300026089 Bacteria 7192
896 Ga0207648_10029323 3300026089 Bacteria 4880
897 Ga0207648_10051944 3300026089 Bacteria 3584
898 Ga0207648_10090733 3300026089 Bacteria 2670
899 Ga0207648_10133884 3300026089 Bacteria 2182
900 Ga0207648_10150977 3300026089 Bacteria 2050
901 Ga0207648_10156878 3300026089 Bacteria 2009
902 Ga0207648_11359660 3300026089 Bacteria 667
903 Ga0207676_10051055 3300026095 Bacteria 3227
904 Ga0207676_10211503 3300026095 Bacteria 1721
905 Ga0207676_10232820 3300026095 Bacteria 1648
906 Ga0207676_10370538 3300026095 Unclassified 1330
907 Ga0207676_11325770 3300026095 Unclassified 715
908 Ga0207676_11758862 3300026095 Unclassified 618
909 Ga0207674_10026779 3300026116 Bacteria 6116
910 Ga0207674_10037266 3300026116 Bacteria 5059
911 Ga0207674_10112645 3300026116 Bacteria 2694
912 Ga0207674_10132898 3300026116 Bacteria 2451
913 Ga0207674_10223343 3300026116 Bacteria 1832
914 Ga0207674_10283051 3300026116 Bacteria 1606
915 Ga0207674_10451898 3300026116 Bacteria 1242
916 Ga0207674_11565886 3300026116 Unclassified 628
917 Ga0207675_100067512 3300026118 Bacteria 3343
918 Ga0207675_100174256 3300026118 Bacteria 2057
919 Ga0207675_100765809 3300026118 Bacteria 977
920 Ga0207683_10052970 3300026121 Bacteria 3556
921 Ga0207683_10154425 3300026121 Bacteria 2073
922 Ga0207683_10231694 3300026121 Bacteria 1685
923 Ga0207683_10453372 3300026121 Bacteria 1183
924 Ga0207683_10575410 3300026121 Bacteria 1042
925 Ga0207698_10021544 3300026142 Bacteria 4461
926 Ga0207698_10043215 3300026142 Bacteria 3375
927 Ga0207698_10143952 3300026142 Bacteria 2058
928 Ga0207698_10194266 3300026142 Bacteria 1811
929 Ga0207698_11580954 3300026142 Bacteria 671
930 Ga0209969_1054586 3300027360 Bacteria 628
931 Ga0209996_1019201 3300027395 Bacteria 954
932 Ga0210000_1032039 3300027462 Bacteria 824
933 Ga0209995_1005218 3300027471 Bacteria 2088
934 Ga0209995_1042443 3300027471 Bacteria 769
935 Ga0209968_1001813 3300027526 Bacteria 3241
936 Ga0209999_1012273 3300027543 Bacteria 1552
937 Ga0209970_1002637 3300027614 Bacteria 3033
938 Ga0209983_1033899 3300027665 Bacteria 1093
939 Ga0209588_1073306 3300027671 Bacteria 1106
940 Ga0209971_1008583 3300027682 Bacteria 2425
941 Ga0209966_1000668 3300027695 Bacteria 7568
942 Ga0209998_10000516 3300027717 Bacteria 10562
943 Ga0209974_10005680 3300027876 Bacteria 4377
944 Ga0209974_10047317 3300027876 Bacteria 1440
945 Ga0207428_10165592 3300027907 Bacteria 1677
946 Ga0207428_10462433 3300027907 Bacteria 924
947 Ga0268266_10592042 3300028379 Bacteria 1065
948 Ga0268266_11942260 3300028379 Bacteria 562
949 Ga0268265_10000331 3300028380 Bacteria 51469
950 Ga0268265_10055170 3300028380 Unclassified 3018
951 Ga0268265_10128815 3300028380 Bacteria 2099
952 Ga0268264_10180909 3300028381 Bacteria 1915
953 Ga0268264_10257374 3300028381 Unclassified 1624
954 Ga0268264_12060581 3300028381 Bacteria 579
955 Ga0316182_1394427 3300030745 Bacteria 665
956 Ga0265332_10014489 3300031238 Bacteria 3487
957 Ga0265320_10271106 3300031240 Bacteria 752
958 Ga0265340_10043989 3300031247 Bacteria 2186
959 Ga0307408_100007956 3300031548 Bacteria 7011
960 Ga0307408_100023930 3300031548 Bacteria 4165
961 Ga0307408_100034723 3300031548 Bacteria 3534
962 Ga0307408_100143892 3300031548 Bacteria 1874
963 Ga0307408_100164448 3300031548 Bacteria 1766
964 Ga0307408_100168672 3300031548 Bacteria 1746
965 Ga0307408_100493694 3300031548 Bacteria 1070
966 Ga0307408_101673133 3300031548 Bacteria 606
967 Ga0265314_10015473 3300031711 Bacteria 6053
968 Ga0265342_10458054 3300031712 Bacteria 654
969 Ga0307405_10004252 3300031731 Bacteria 6737
970 Ga0307405_10021190 3300031731 Bacteria 3649
971 Ga0307405_10050253 3300031731 Bacteria 2581
972 Ga0307405_10062898 3300031731 Bacteria 2352
973 Ga0307405_10445820 3300031731 Bacteria 1025
974 Ga0307405_10609183 3300031731 Unclassified 892
975 Ga0307413_10000716 3300031824 Bacteria 11383
976 Ga0307413_10013252 3300031824 Bacteria 4136
977 Ga0307413_10064172 3300031824 Bacteria 2280
978 Ga0307413_10064302 3300031824 Bacteria 2279
979 Ga0307413_10347464 3300031824 Bacteria 1143
980 Ga0307413_10506401 3300031824 Unclassified 970
981 Ga0307413_10777907 3300031824 Bacteria 802
982 Ga0307413_11799469 3300031824 Bacteria 548
983 Ga0307413_11897906 3300031824 Bacteria 535
984 Ga0307410_10000703 3300031852 Bacteria 13942
985 Ga0307410_10005533 3300031852 Bacteria 6698
986 Ga0307410_10015703 3300031852 Bacteria 4499
987 Ga0307410_10062836 3300031852 Bacteria 2546
988 Ga0307410_10084179 3300031852 Bacteria 2241
989 Ga0307410_10089895 3300031852 Bacteria 2177
990 Ga0307410_10099120 3300031852 Bacteria 2085
991 Ga0307410_10119687 3300031852 Bacteria 1918
992 Ga0307410_10292546 3300031852 Bacteria 1282
993 Ga0307410_10579716 3300031852 Bacteria 933
994 Ga0307410_10664268 3300031852 Bacteria 875
995 Ga0307410_11446293 3300031852 Bacteria 604
996 Ga0307406_10007225 3300031901 Bacteria 6153
997 Ga0307406_10071378 3300031901 Bacteria 2276
998 Ga0307406_10144526 3300031901 Unclassified 1688
999 Ga0307406_10313234 3300031901 Bacteria 1211
1000 Ga0307406_10381914 3300031901 Bacteria 1111
1001 Ga0307406_10516533 3300031901 Bacteria 971
1002 Ga0307406_10742134 3300031901 Bacteria 823
1003 Ga0307406_11289451 3300031901 Bacteria 637
1004 Ga0307407_10006979 3300031903 Bacteria 5076
1005 Ga0307407_10013663 3300031903 Bacteria 3950
1006 Ga0307407_10016328 3300031903 Bacteria 3694
1007 Ga0307407_10077115 3300031903 Bacteria 2003
1008 Ga0307407_10284787 3300031903 Bacteria 1146
1009 Ga0307407_10287830 3300031903 Unclassified 1141
1010 Ga0307407_10315099 3300031903 Bacteria 1096
1011 Ga0307407_10568186 3300031903 Bacteria 840
1012 Ga0307412_10003814 3300031911 Bacteria 8384
1013 Ga0307412_10076019 3300031911 Bacteria 2306
1014 Ga0307412_10096133 3300031911 Bacteria 2084
1015 Ga0307412_10574921 3300031911 Bacteria 950
1016 Ga0307412_10808539 3300031911 Unclassified 814
1017 Ga0307412_11273805 3300031911 Bacteria 661
1018 Ga0307409_100000828 3300031995 Bacteria 14225
1019 Ga0307409_100014909 3300031995 Bacteria 5077
1020 Ga0307409_100020440 3300031995 Bacteria 4513
1021 Ga0307409_100026685 3300031995 Bacteria 4078
1022 Ga0307409_100387313 3300031995 Bacteria 1331
1023 Ga0307409_100548381 3300031995 Unclassified 1134
1024 Ga0307409_100573955 3300031995 Bacteria 1111
1025 Ga0307409_100744856 3300031995 Bacteria 983
1026 Ga0307409_101024049 3300031995 Unclassified 844
1027 Ga0307416_100020053 3300032002 Bacteria 4759
1028 Ga0307416_100047869 3300032002 Bacteria 3388
1029 Ga0307416_100052780 3300032002 Bacteria 3257
1030 Ga0307416_100201815 3300032002 Bacteria 1887
1031 Ga0307416_100205134 3300032002 Unclassified 1874
1032 Ga0307416_100420076 3300032002 Bacteria 1381
1033 Ga0307416_100643541 3300032002 Bacteria 1144
1034 Ga0307416_100815326 3300032002 Bacteria 1030
1035 Ga0307416_100848605 3300032002 Bacteria 1011
1036 Ga0307416_100969175 3300032002 Bacteria 953
1037 Ga0307416_101129349 3300032002 Bacteria 889
1038 Ga0307416_101268111 3300032002 Bacteria 843
1039 Ga0307416_101557968 3300032002 Bacteria 766
1040 Ga0307416_102485730 3300032002 Bacteria 617
1041 Ga0307416_103167767 3300032002 Bacteria 550
1042 Ga0307414_10012996 3300032004 Bacteria 4943
1043 Ga0307414_10047438 3300032004 Bacteria 2956
1044 Ga0307414_10921909 3300032004 Bacteria 802
1045 Ga0307414_11275059 3300032004 Bacteria 681
1046 Ga0307414_11437686 3300032004 Bacteria 641
1047 Ga0307414_11731355 3300032004 Bacteria 583
1048 Ga0307411_10004747 3300032005 Bacteria 6571
1049 Ga0307411_10061846 3300032005 Bacteria 2495
1050 Ga0307411_10062197 3300032005 Bacteria 2489
1051 Ga0307411_10122865 3300032005 Bacteria 1882
1052 Ga0307411_10165208 3300032005 Bacteria 1663
1053 Ga0307411_10172334 3300032005 Bacteria 1633
1054 Ga0307411_10273468 3300032005 Bacteria 1341
1055 Ga0307411_10325185 3300032005 Bacteria 1243
1056 Ga0307411_10728760 3300032005 Bacteria 866
1057 Ga0307415_100028600 3300032126 Bacteria 3549
1058 Ga0307415_100039533 3300032126 Bacteria 3118
1059 Ga0307415_100083254 3300032126 Bacteria 2291
1060 Ga0307415_100095152 3300032126 Bacteria 2168
1061 Ga0307415_100120672 3300032126 Bacteria 1965
1062 Ga0307415_100146582 3300032126 Bacteria 1811
1063 Ga0307415_100146802 3300032126 Bacteria 1809
1064 Ga0307415_100234603 3300032126 Bacteria 1480
1065 Ga0307415_100276935 3300032126 Bacteria 1377
1066 Ga0307415_100620111 3300032126 Bacteria 965
1067 Ga0307415_101307583 3300032126 Bacteria 687
1068 Ga0307415_101365620 3300032126 Bacteria 673
1069 Ga0373958_0077187 3300034819 Bacteria 749
1070 Ga0373926_0041522 3300035083 Bacteria 1644
1071 Ga0373934_0004281 3300035086 Bacteria 5268
1072 Ga0373940_0041683 3300035088 Bacteria 1263
1073 Ga0373952_0281639 3300035092 Unclassified 512
1074 Ga0373936_0123559 3300035113 Bacteria 1108
1075 Ga0373953_0025409 3300035117 Bacteria 2263
1076 Ga0373954_0175400 3300035118 Bacteria 1050
1077 Ga0373957_0232082 3300035120 Bacteria 774
1078 Ga0373960_0014579 3300035121 Bacteria 1994
1079 Ga0373943_0037919 3300035170 Bacteria 2315
1080 Ga0373955_0221512 3300035172 Bacteria 1130
1081 Ga0373942_0061911 3300035207 Bacteria 1074
1082 Ga0373942_0204482 3300035207 Unclassified 656
1083 Ga0373931_0428607 3300035691 Bacteria 842
1084 Ga0373931_0752772 3300035691 Bacteria 647
1085 Ga0373935_0063682 3300035692 Unclassified 2364
1086 Ga0373927_0128798 3300035695 Unclassified 1653
1087 Ga0373947_0010747 3300035725 Bacteria 5253
1088 Ga0373937_0000448 3300036401 Bacteria 38003
1089 Ga0373937_0062192 3300036401 Bacteria 3432
1090 Ga0373925_0064153 3300037068 Bacteria 2764
1091 Ga0395900_1067409 3300037418 Unclassified 726
1092 Ga0395898_1707525 3300037466 Unclassified 552
1093 Ga0395905_0060527 3300037471 Bacteria 3541
1094 Ga0395905_1251418 3300037471 Bacteria 646
1095 Ga0436364_0330143 3300037853 Bacteria 706
1096 Ga0436364_0599470 3300037853 Bacteria 676
1097 Ga0436365_0209545 3300039437 Bacteria 729
1098 Ga0436365_0489964 3300039437 Bacteria 570
1099 Ga0436365_0579517 3300039437 Bacteria 841
1100 Ga0436365_0753661 3300039437 Bacteria 766
1101 Ga0436365_0836229 3300039437 Bacteria 4708
1102 Ga0436365_1353333 3300039437 Bacteria 1337
1103 Ga0436365_1791379 3300039437 Bacteria 632
1104 Ga0436363_1323611 3300039450 Bacteria 764
1105 Ga0436362_0963725 3300039453 Bacteria 508
1106 Ga0439461_0018554 3300041410 Bacteria 1362
1107 Ga0451800_1305647 3300041459 Bacteria 789
1108 Ga0451804_0951379 3300041463 Unclassified 595
1109 Ga0451839_0204316 3300041496 Bacteria 552
1110 Ga0451849_0487378 3300041505 Bacteria 638
1111 Ga0451853_2286543 3300041512 Bacteria 682
1112 Ga0439433_0082239 3300041999 Bacteria 784
1113 Ga0450898_055793 3300042134 Bacteria 770
1114 Ga0439434_0050174 3300042435 Bacteria 1292
1115 Ga0439434_0310029 3300042435 Bacteria 547
1116 Ga0451577_0257900 3300042876 Bacteria 1579
1117 Ga0451577_0765816 3300042876 Bacteria 873
1118 Ga0451577_0975175 3300042876 Bacteria 762
1119 Ga0466966_0005142 3300044684 Bacteria 8593
1120 Ga0466966_0077028 3300044684 Bacteria 2082
1121 Ga0466966_0318317 3300044684 Unclassified 935
1122 Ga0466961_0034916 3300044693 Bacteria 3229
1123 Ga0466961_0093906 3300044693 Bacteria 1893
1124 Ga0466961_0582121 3300044693 Bacteria 673
1125 Ga0466963_0118109 3300044694 Unclassified 1824
1126 Ga0466964_0211514 3300044706 Bacteria 937
1127 Ga0466971_0564673 3300044719 Bacteria 565
1128 Ga0466957_0889846 3300044842 Bacteria 636
1129 Ga0466960_1032341 3300044901 Bacteria 506
1130 Ga0466959_0043802 3300045049 Bacteria 3298
1131 Ga0466959_0082347 3300045049 Bacteria 2318
1132 Ga0466959_0125231 3300045049 Bacteria 1824
1133 Ga0451576_0188169 3300045051 Bacteria 2156
1134 Ga0451576_0540201 3300045051 Bacteria 1225
1135 Ga0451576_0568652 3300045051 Bacteria 1191
1136 Ga0451576_2428243 3300045051 Unclassified 536
1137 Ga0466958_0215675 3300045836 Bacteria 1224
1138 Ga0466967_0169522 3300045976 Bacteria 2053
1139 Ga0466967_0327399 3300045976 Bacteria 1479
1140 Ga0495603_0245819 3300046455 Bacteria 1030
1141 Ga0495603_0480597 3300046455 Bacteria 711
1142 Ga0495629_0038804 3300046459 Bacteria 3354
1143 Ga0495629_0691555 3300046459 Unclassified 678
1144 Ga0495651_0003975 3300046462 Bacteria 11300
1145 Ga0495580_0008931 3300046472 Bacteria 7926
1146 Ga0495582_0286299 3300046473 Bacteria 946
1147 Ga0495639_0017578 3300046475 Bacteria 3108
1148 Ga0495639_0037561 3300046475 Bacteria 2171
1149 Ga0495664_0370387 3300046477 Bacteria 862
1150 Ga0495584_0654420 3300046491 Bacteria 536
1151 Ga0495585_0548564 3300046492 Bacteria 546
1152 Ga0495594_0008015 3300046499 Bacteria 5432
1153 Ga0495594_0012806 3300046499 Bacteria 4374
1154 Ga0495594_0013642 3300046499 Bacteria 4246
1155 Ga0495594_0194279 3300046499 Bacteria 1156
1156 Ga0495630_0026084 3300046517 Bacteria 4325
1157 Ga0495630_0752217 3300046517 Bacteria 745
1158 Ga0495643_0310092 3300046522 Bacteria 716
1159 Ga0495666_0008156 3300046526 Bacteria 5252
1160 Ga0495642_0114228 3300046528 Bacteria 1156
1161 Ga0495652_0131358 3300046529 Bacteria 1982
1162 Ga0495665_0025157 3300046531 Bacteria 3198
1163 Ga0495586_0076789 3300046535 Bacteria 1830
1164 Ga0495586_0514359 3300046535 Bacteria 691
1165 Ga0495587_0002752 3300046536 Bacteria 11734
1166 Ga0495621_0098495 3300046539 Bacteria 1110
1167 Ga0495621_0209663 3300046539 Bacteria 786
1168 Ga0495621_0233258 3300046539 Bacteria 748
1169 Ga0495645_0000804 3300046543 Bacteria 21498
1170 Ga0495622_0361258 3300046557 Bacteria 628
1171 Ga0495667_0008829 3300046559 Bacteria 6854
1172 Ga0495667_0097780 3300046559 Bacteria 1901
1173 Ga0495634_0197100 3300046642 Bacteria 1253
1174 Ga0495635_0833408 3300046663 Bacteria 593
1175 Ga0495659_0142888 3300046664 Bacteria 956
1176 Ga0495588_0205466 3300046674 Bacteria 1040
1177 Ga0495588_0266961 3300046674 Bacteria 902
1178 Ga0495657_0129370 3300046675 Bacteria 1583
1179 Ga0495599_0078495 3300046678 Bacteria 2061
1180 Ga0495623_0001333 3300046679 Bacteria 16739
1181 Ga0495623_0025809 3300046679 Bacteria 3784
1182 Ga0495658_0778619 3300046683 Bacteria 612
1183 Ga0495669_0058998 3300046684 Bacteria 1732
1184 Ga0495669_0153021 3300046684 Bacteria 1092
1185 Ga0495613_0061274 3300046689 Bacteria 2755
1186 Ga0495613_0302562 3300046689 Bacteria 1107
1187 Ga0495613_0318068 3300046689 Bacteria 1075
1188 Ga0495624_0187116 3300046690 Unclassified 1260
1189 Ga0495600_0029735 3300046809 Bacteria 3538
1190 Ga0495600_0057993 3300046809 Bacteria 2529
1191 Ga0495600_0499794 3300046809 Bacteria 747
1192 Ga0495581_0124203 3300047315 Bacteria 1503
1193 Ga0495581_0282360 3300047315 Bacteria 970
1194 Ga0495674_0075611 3300047319 Bacteria 2898
1195 Ga0495672_0005947 3300047320 Bacteria 9562
1196 Ga0495675_0007163 3300047444 Bacteria 6866
1197 Ga0495675_0025928 3300047444 Bacteria 3736
1198 Ga0495677_0440844 3300047445 Bacteria 516
1199 Ga0495684_0056960 3300047471 Bacteria 2979
1200 Ga0495684_0132396 3300047471 Bacteria 1872
1201 Ga0495602_0258837 3300048088 Bacteria 1292
1202 Ga0495602_0437548 3300048088 Bacteria 925
1203 Ga0496100_0033859 3300048903 Bacteria 3200
1204 Ga0496100_0071846 3300048903 Bacteria 2312
1205 Ga0496101_0063525 3300048904 Bacteria 2688
1206 Ga0496105_0131297 3300048908 Bacteria 2065
1207 Ga0496106_0031215 3300048909 Bacteria 3970
1208 Ga0496106_0452888 3300048909 Bacteria 1031
1209 Ga0496107_0113721 3300048910 Bacteria 1991
1210 Ga0496108_0475266 3300048911 Bacteria 1092
1211 Ga0496109_0357570 3300048912 Bacteria 1380
1212 Ga0496109_0365026 3300048912 Bacteria 1364
1213 Ga0496109_1188726 3300048912 Unclassified 699
1214 Ga0496110_0284371 3300048913 Unclassified 1506
1215 Ga0496110_0704935 3300048913 Bacteria 911
1216 Ga0496111_0429111 3300048914 Unclassified 976
1217 Ga0496112_0003755 3300048915 Bacteria 12685
1218 Ga0496112_0011306 3300048915 Bacteria 8145
1219 Ga0496112_0747424 3300048915 Bacteria 904
1220 Ga0496112_1098261 3300048915 Bacteria 714
1221 Ga0496113_0010290 3300048916 Bacteria 6181
1222 Ga0496113_0653277 3300048916 Bacteria 841
1223 Ga0496115_0059698 3300048918 Bacteria 3072
1224 Ga0496115_0200863 3300048918 Bacteria 1647
1225 Ga0501309_046492 3300049129 Unclassified 674
1226 Ga0501291_093473 3300049514 Unclassified 617
1227 Ga0501031_0018277 3300049568 Bacteria 4562
1228 Ga0501033_0004681 3300049570 Bacteria 10947
1229 Ga0501033_0072694 3300049570 Bacteria 2525
1230 Ga0501034_0034768 3300049571 Bacteria 5110
1231 Ga0501034_0040492 3300049571 Bacteria 4717
1232 Ga0501034_0128703 3300049571 Bacteria 2516
1233 Ga0501036_0132872 3300049572 Bacteria 2100
1234 Ga0501036_0367837 3300049572 Bacteria 1200
1235 Ga0501038_0185359 3300049574 Bacteria 1677
1236 Ga0501040_0009071 3300049576 Bacteria 6472
1237 Ga0501040_0266305 3300049576 Bacteria 1223
1238 Ga0501041_0179921 3300049577 Bacteria 1324
1239 Ga0501041_0698145 3300049577 Bacteria 649
1240 Ga0501042_0127338 3300049578 Bacteria 1834
1241 Ga0501042_1276809 3300049578 Bacteria 535
1242 Ga0501043_0048107 3300049579 Bacteria 3353
1243 Ga0501043_0114778 3300049579 Bacteria 2114
1244 Ga0501046_0123251 3300049580 Bacteria 1971
1245 Ga0501047_0014211 3300049581 Bacteria 7567
1246 Ga0501047_0030687 3300049581 Bacteria 5181
1247 Ga0501048_0103818 3300049582 Bacteria 2006
1248 Ga0501048_0184214 3300049582 Bacteria 1480
1249 Ga0501067_0038830 3300049583 Unclassified 2643
1250 Ga0501067_0769376 3300049583 Bacteria 542
1251 Ga0501070_0260163 3300049586 Bacteria 1418
1252 Ga0501071_0117247 3300049587 Bacteria 1972
1253 Ga0501072_1235084 3300049588 Bacteria 580
1254 Ga0501073_0047690 3300049589 Bacteria 3010
1255 Ga0501074_0438082 3300049590 Bacteria 927
1256 Ga0501075_0148168 3300049591 Bacteria 1789
1257 Ga0501075_0152227 3300049591 Bacteria 1763
1258 Ga0501075_0377071 3300049591 Bacteria 1081
1259 Ga0501076_0194401 3300049592 Bacteria 1656
1260 Ga0501076_0203720 3300049592 Bacteria 1616
1261 Ga0501076_1177277 3300049592 Bacteria 631
1262 Ga0501077_0232705 3300049593 Bacteria 1171
1263 Ga0501198_036905 3300049649 Unclassified 835
1264 Ga0501202_022466 3300049652 Bacteria 1268
1265 Ga0501202_071434 3300049652 Bacteria 801
1266 Ga0501216_039971 3300049660 Unclassified 894
1267 Ga0501216_101244 3300049660 Unclassified 635
1268 Ga0501216_190236 3300049660 Bacteria 504
1269 Ga0501223_011898 3300049663 Unclassified 1745
1270 Ga0501224_038653 3300049664 Bacteria 720
1271 Ga0501230_109663 3300049667 Bacteria 602
1272 Ga0501233_030238 3300049668 Bacteria 1219
1273 Ga0501235_002455 3300049669 Bacteria 3998
1274 Ga0501239_003005 3300049672 Bacteria 1575
1275 Ga0501239_033791 3300049672 Bacteria 682
1276 Ga0501240_004237 3300049673 Unclassified 1652
1277 Ga0501246_035869 3300049676 Bacteria 576
1278 Ga0501247_071413 3300049677 Unclassified 548
1279 Ga0501249_001158 3300049679 Bacteria 5550
1280 Ga0501250_006768 3300049680 Bacteria 1220
1281 Ga0501250_081788 3300049680 Bacteria 550
1282 Ga0501251_088467 3300049681 Bacteria 553
1283 Ga0501257_003684 3300049686 Bacteria 3308
1284 Ga0501259_006356 3300049688 Bacteria 1879
1285 Ga0501260_003681 3300049689 Bacteria 1387
1286 Ga0501261_009664 3300049690 Unclassified 1261
1287 Ga0501221_027992 3300049704 Bacteria 1156
1288 Ga0501225_0034888 3300049705 Bacteria 1385
1289 Ga0501234_026138 3300049707 Unclassified 937
1290 Ga0501245_065160 3300049708 Unclassified 675
1291 Ga0501079_0004591 3300049741 Bacteria 10244
1292 Ga0501079_0802829 3300049741 Bacteria 741
1293 Ga0501080_0094200 3300049742 Bacteria 2781
1294 Ga0501080_0183927 3300049742 Bacteria 1922
1295 Ga0501081_0344394 3300049743 Bacteria 1098
1296 Ga0501081_0382252 3300049743 Bacteria 1040
1297 Ga0501241_045376 3300049758 Unclassified 859
1298 Ga0501262_022185 3300049759 Unclassified 876
1299 Ga0501263_025365 3300049760 Bacteria 816
1300 Ga0501266_005306 3300049763 Bacteria 1604
1301 Ga0501267_021986 3300049764 Bacteria 709
1302 Ga0501268_003463 3300049765 Bacteria 2161
1303 Ga0501268_064088 3300049765 Unclassified 733
1304 Ga0501268_106762 3300049765 Bacteria 606
1305 Ga0501270_010744 3300049767 Bacteria 1213
1306 Ga0501272_035657 3300049769 Unclassified 648
1307 Ga0501273_011690 3300049770 Bacteria 1097
1308 Ga0501273_075213 3300049770 Unclassified 554
1309 Ga0501044_0003683 3300049823 Bacteria 17228
1310 Ga0501044_0235840 3300049823 Bacteria 1775
1311 Ga0501045_0014893 3300049824 Bacteria 5516
1312 nmdc:mga05p37_1927118_c1 3300050507 Bacteria 563
1313 nmdc:mga05p37_352966_c1 3300050507 Unclassified 946
1314 nmdc:mga05p37_385546_c1 3300050507 Bacteria 1641
1315 nmdc:mga05p37_60165_c1 3300050507 Bacteria 4677
1316 nmdc:mga09592_1137302_c1 3300050508 Bacteria 648
1317 nmdc:mga09592_1156241_c1 3300050508 Unclassified 641
1318 nmdc:mga09592_130564_c1 3300050508 Bacteria 2161
1319 nmdc:mga09592_1715814_c1 3300050508 Bacteria 506
1320 nmdc:mga09592_238092_c1 3300050508 Bacteria 1577
1321 nmdc:mga09592_25522_c1 3300050508 Bacteria 4892
1322 nmdc:mga09592_512166_c1 3300050508 Bacteria 1032
1323 nmdc:mga0qj67_1051269_c1 3300050509 Bacteria 637
1324 nmdc:mga0qj67_127949_c1 3300050509 Bacteria 2056
1325 nmdc:mga0qj67_1318174_c1 3300050509 Bacteria 559
1326 nmdc:mga0qj67_138992_c1 3300050509 Bacteria 1969
1327 nmdc:mga0qj67_158591_c1 3300050509 Bacteria 1837
1328 nmdc:mga0qj67_19069_c1 3300050509 Bacteria 5237
1329 nmdc:mga0qj67_20933_c1 3300050509 Bacteria 5012
1330 nmdc:mga0qj67_26367_c1 3300050509 Bacteria 4499
1331 nmdc:mga0qj67_690188_c1 3300050509 Bacteria 813
1332 nmdc:mga06r32_1148651_c1 3300050510 Bacteria 724
1333 nmdc:mga06r32_145013_c1 3300050510 Bacteria 2352
1334 nmdc:mga06r32_182385_c1 3300050510 Bacteria 2085
1335 nmdc:mga06r32_21909_c1 3300050510 Bacteria 5900
1336 nmdc:mga06r32_312252_c1 3300050510 Unclassified 1558
1337 nmdc:mga06r32_36042_c1 3300050510 Bacteria 4671
1338 nmdc:mga06r32_561985_c1 3300050510 Bacteria 1114
1339 nmdc:mga06r32_78254_c1 3300050510 Bacteria 3214
1340 nmdc:mga08y16_343165_c1 3300050511 Bacteria 1535
1341 nmdc:mga08y16_408998_c1 3300050511 Bacteria 1388
1342 nmdc:mga0n895_100600_c1 3300050512 Bacteria 2900
1343 nmdc:mga0n895_18096_c1 3300050512 Bacteria 6514
1344 nmdc:mga0n895_295417_c1 3300050512 Unclassified 1642
1345 nmdc:mga0n895_29871_c1 3300050512 Bacteria 5203
1346 nmdc:mga0n895_333004_c1 3300050512 Bacteria 1538
1347 nmdc:mga0n895_647163_c1 3300050512 Bacteria 1056
1348 nmdc:mga0rr50_1099731_c1 3300050513 Bacteria 676
1349 nmdc:mga0rr50_251480_c1 3300050513 Bacteria 1468
1350 nmdc:mga0rr50_696998_c1 3300050513 Unclassified 867
1351 nmdc:mga08x19_125037_c1 3300050514 Bacteria 1726
1352 nmdc:mga08x19_24045_c1 3300050514 Bacteria 3783
1353 nmdc:mga08x19_589444_c1 3300050514 Unclassified 788
1354 nmdc:mga08x19_9458_c1 3300050514 Bacteria 5837
1355 nmdc:mga0a205_131602_c1 3300050515 Bacteria 2402
1356 nmdc:mga0a205_7731_c1 3300050515 Bacteria 9759
1357 nmdc:mga0a205_854553_c1 3300050515 Bacteria 757
1358 nmdc:mga0a205_8915_c1 3300050515 Bacteria 9141
1359 Ga0495601_0441565 3300053077 Bacteria 842
1360 Ga0495612_0237976 3300053078 Bacteria 808
1361 Ga0495595_0042201 3300053084 Bacteria 2090
1362 Ga0590071_029891 3300059421 Bacteria 1296
1363 Ga0590071_036978 3300059421 Bacteria 1171
1364 Ga0590075_069820 3300059424 Bacteria 907
1365 Ga0590077_022527 3300059426 Bacteria 1345
1366 Ga0587089_072147 3300059509 Bacteria 588
1367 Ga0587090_111849 3300059510 Unclassified 583
1368 Ga0587091_127973 3300059511 Bacteria 624
1369 Ga0501082_0044913 3300060353 Bacteria 3811
1370 Ga0501082_1419574 3300060353 Bacteria 606
1371 Ga0070683_100000914
1372 JGI24749J21850_1036818
1373 JGI25406J46586_10059482
1374 Ga0058859_11508720
1375 Ga0058863_11460199
1376 Ga0058863_11772184
1377 Ga0058863_11915949
1378 Ga0058861_11720212
1379 Ga0058861_11993866
1380 Ga0058862_12187540
1381 Ga0058862_12796990
1382 Ga0058862_12833528
1383 Ga0058862_12863587
1384 Ga0065712_10093097
1385 Ga0065712_10386959
1386 Ga0065715_10105782
1387 Ga0065715_10211602
1388 Ga0065715_10843969
1389 Ga0065707_10499732
1390 Ga0070658_10008963
1391 Ga0070658_10079313
1392 Ga0070658_10097101
1393 Ga0070658_10242904
1394 Ga0070658_10272792
1395 Ga0070658_10517203
1396 Ga0070658_10756607
1397 Ga0070676_10024660
1398 Ga0070676_10028080
1399 Ga0070676_10075115
1400 Ga0070676_10169483
1401 Ga0070676_10196174
1402 Ga0070676_10300379
1403 Ga0070676_10408214
1404 Ga0070676_10656702
1405 Ga0070683_100004028
1406 Ga0070683_100004580
1407 Ga0070683_100011985
1408 Ga0070683_100016824
1409 Ga0070683_100024969
1410 Ga0070683_100045674
1411 Ga0070683_100084391
1412 Ga0070683_100094410
1413 Ga0070683_100232236
1414 Ga0070683_100271521
1415 Ga0070683_100326625
1416 Ga0070683_100577685
1417 Ga0070683_100799696
1418 Ga0070683_100988192
1419 Ga0070683_101201577
1420 Ga0070690_100015139
1421 Ga0070690_100040265
1422 Ga0070690_100534174
1423 Ga0070690_100736596
1424 Ga0070690_100759827
1425 Ga0070670_100033354
1426 Ga0070670_100078982
1427 Ga0070670_100165222
1428 Ga0070670_100351366
1429 Ga0070670_100700422
1430 Ga0070670_100779322
1431 Ga0070670_100816618
1432 Ga0070677_10091326
1433 Ga0070677_10256846
1434 Ga0068869_100627944
1435 Ga0068869_100895018
1436 Ga0070666_10378477
1437 Ga0070680_100000010
1438 Ga0070680_100016417
1439 Ga0070680_100051986
1440 Ga0070680_100062216
1441 Ga0070680_100077514
1442 Ga0070680_100077788
1443 Ga0070680_100081540
1444 Ga0070680_100335218
1445 Ga0070680_100843550
1446 Ga0070680_100957835
1447 Ga0070680_101036659
1448 Ga0070682_100020205
1449 Ga0070682_100122456
1450 Ga0070682_100132192
1451 Ga0070682_100216705
1452 Ga0070682_100456526
1453 Ga0070682_100489176
1454 Ga0068868_100015799
1455 Ga0068868_100048702
1456 Ga0068868_100239599
1457 Ga0068868_100293905
1458 Ga0068868_101634798
1459 Ga0070660_100014384
1460 Ga0070660_100397643
1461 Ga0070660_100437087
1462 Ga0070689_100024708
1463 Ga0070689_100170598
1464 Ga0070689_100404994
1465 Ga0070691_10014564
1466 Ga0070691_10031926
1467 Ga0070691_10033433
1468 Ga0070691_10085438
1469 Ga0070691_10140722
1470 Ga0070691_10360368
1471 Ga0070687_100004192
1472 Ga0070687_100041059
1473 Ga0070687_100062846
1474 Ga0070661_100008603
1475 Ga0070661_100013325
1476 Ga0070661_100078583
1477 Ga0070661_100137691
1478 Ga0070661_101888662
1479 Ga0070692_10051290
1480 Ga0070692_10265842
1481 Ga0070692_10492311
1482 Ga0070668_100022290
1483 Ga0070668_100112425
1484 Ga0070668_100160374
1485 Ga0070668_101187431
1486 Ga0070668_101243833
1487 Ga0070668_101819402
1488 Ga0070669_100000431
1489 Ga0070669_100007862
1490 Ga0070669_100040274
1491 Ga0070669_100042955
1492 Ga0070669_100132355
1493 Ga0070669_100265810
1494 Ga0070669_101464147
1495 Ga0070675_100006006
1496 Ga0070675_100031034
1497 Ga0070675_100045778
1498 Ga0070675_100046593
1499 Ga0070675_100127922
1500 Ga0070675_100156956
1501 Ga0070675_100645516
1502 Ga0070675_101300632
1503 Ga0070671_100145737
1504 Ga0070671_100206372
1505 Ga0070671_100378861
1506 Ga0070671_100685991
1507 Ga0070674_100068016
1508 Ga0070674_100111523
1509 Ga0070674_100246574
1510 Ga0070674_100301803
1511 Ga0070674_100500303
1512 Ga0070674_100611255
1513 Ga0070674_101106202
1514 Ga0070673_100051016
1515 Ga0070673_100146946
1516 Ga0070673_100234503
1517 Ga0070673_100245940
1518 Ga0070673_100448308
1519 Ga0070673_101827010
1520 Ga0070673_101957736
1521 Ga0070688_100046871
1522 Ga0070688_100076527
1523 Ga0070688_100102832
1524 Ga0070688_100151422
1525 Ga0070659_100044995
1526 Ga0070659_100188505
1527 Ga0070659_100513955
1528 Ga0070659_100711727
1529 Ga0070659_101143478
1530 Ga0070667_100030245
1531 Ga0070667_100036770
1532 Ga0070667_100076515
1533 Ga0070667_100084208
1534 Ga0070667_100096057
1535 Ga0070667_100144813
1536 Ga0070667_100425422
1537 Ga0070709_10002485
1538 Ga0070709_10010493
1539 Ga0070709_10340334
1540 Ga0070709_10923485
1541 Ga0070714_100004586
1542 Ga0070714_100049437
1543 Ga0070714_100167165
1544 Ga0070714_100370251
1545 Ga0070713_100000196
1546 Ga0070713_100015290
1547 Ga0070713_100066727
1548 Ga0070710_10027153
1549 Ga0070710_11354728
1550 Ga0070701_10008088
1551 Ga0070701_10180897
1552 Ga0070711_100135598
1553 Ga0070711_100430570
1554 Ga0070705_100028775
1555 Ga0070700_100053030
1556 Ga0070700_100127439
1557 Ga0070700_100194942
1558 Ga0070700_100252388
1559 Ga0070700_100803035
1560 Ga0070700_101034780
1561 Ga0070700_101306024
1562 Ga0070694_100070264
1563 Ga0070694_100137090
1564 Ga0070694_100168061
1565 Ga0070694_100197646
1566 Ga0070694_100314148
1567 Ga0070708_100000025
1568 Ga0070708_100014311
1569 Ga0070708_100550537
1570 Ga0070663_100103275
1571 Ga0070663_100129361
1572 Ga0070678_100076827
1573 Ga0070678_100188247
1574 Ga0070678_100650231
1575 Ga0070678_101224314
1576 Ga0070662_100010644
1577 Ga0070662_100202818
1578 Ga0070662_100660780
1579 Ga0070681_10007819
1580 Ga0070681_10008138
1581 Ga0070681_10031391
1582 Ga0070681_10039500
1583 Ga0070681_10080795
1584 Ga0070681_10103118
1585 Ga0070681_10250291
1586 Ga0070681_10277496
1587 Ga0070681_10400357
1588 Ga0070681_10438187
1589 Ga0068867_100027571
1590 Ga0068867_100089882
1591 Ga0068867_100093105
1592 Ga0068867_100129305
1593 Ga0068867_100261223
1594 Ga0068867_100299558
1595 Ga0068867_100435738
1596 Ga0070685_10012072
1597 Ga0070685_10039975
1598 Ga0070685_10366462
1599 Ga0070685_10381812
1600 Ga0070685_10838654
1601 Ga0070706_100061780
1602 Ga0070706_100149082
1603 Ga0070707_100004196
1604 Ga0070707_100233677
1605 Ga0070707_100670230
1606 Ga0070698_100037275
1607 Ga0070698_100151048
1608 Ga0070698_100343810
1609 Ga0070698_100389326
1610 Ga0070698_100617553
1611 Ga0070699_100013240
1612 Ga0070699_100023699
1613 Ga0070699_100068820
1614 Ga0070699_100358501
1615 Ga0070679_100003720
1616 Ga0070679_100016597
1617 Ga0070679_100061388
1618 Ga0070679_100074759
1619 Ga0070679_100094722
1620 Ga0070679_100114728
1621 Ga0070679_100120874
1622 Ga0070679_100152145
1623 Ga0070679_100232458
1624 Ga0070679_100241404
1625 Ga0070679_100294389
1626 Ga0070679_101848092
1627 Ga0070684_100004941
1628 Ga0070684_100021662
1629 Ga0070684_100022792
1630 Ga0070684_100032908
1631 Ga0070684_100057872
1632 Ga0070684_100086975
1633 Ga0070684_100104767
1634 Ga0070684_100129972
1635 Ga0070684_100184656
1636 Ga0070684_100211512
1637 Ga0070684_100269916
1638 Ga0070684_100335863
1639 Ga0070684_100340927
1640 Ga0070684_101615162
1641 Ga0070697_100032152
1642 Ga0070697_100073961
1643 Ga0068853_100155549
1644 Ga0068853_100234821
1645 Ga0068853_100284881
1646 Ga0068853_101452525
1647 Ga0070672_100017769
1648 Ga0070672_100093488
1649 Ga0070672_100099391
1650 Ga0070672_100127755
1651 Ga0070672_100168226
1652 Ga0070672_100251410
1653 Ga0070672_100279578
1654 Ga0070672_100717978
1655 Ga0070672_101384489
1656 Ga0070686_100098968
1657 Ga0070695_100316837
1658 Ga0070695_100796229
1659 Ga0070695_100862937
1660 Ga0070696_100000569
1661 Ga0070696_100001843
1662 Ga0070696_100022547
1663 Ga0070696_100032961
1664 Ga0070696_100061706
1665 Ga0070696_100116243
1666 Ga0070693_100028201
1667 Ga0070693_100066254
1668 Ga0070693_100596771
1669 Ga0070665_100328730
1670 Ga0070665_101487667
1671 Ga0070665_101832396
1672 Ga0070704_100002736
1673 Ga0070704_100019323
1674 Ga0070704_100025886
1675 Ga0070704_100190860
1676 Ga0068855_100010843
1677 Ga0068855_100067864
1678 Ga0068855_100099477
1679 Ga0068855_100237577
1680 Ga0068855_100599515
1681 Ga0068855_100746249
1682 Ga0068855_100861870
1683 Ga0068855_101116712
1684 Ga0068855_101146963
1685 Ga0068855_101671446
1686 Ga0070664_100001163
1687 Ga0070664_100032756
1688 Ga0070664_100042123
1689 Ga0070664_100053851
1690 Ga0070664_100058462
1691 Ga0070664_100091594
1692 Ga0070664_100117959
1693 Ga0070664_100236253
1694 Ga0070664_100521792
1695 Ga0070664_100591583
1696 Ga0070664_100633580
1697 Ga0070664_101702702
1698 Ga0068857_100018350
1699 Ga0068857_100112463
1700 Ga0068857_100204113
1701 Ga0068857_100266308
1702 Ga0068857_100500254
1703 Ga0068857_100741812
1704 Ga0068857_101751430
1705 Ga0068854_100009778
1706 Ga0068854_100023349
1707 Ga0068854_100025031
1708 Ga0068854_100346876
1709 Ga0068854_100537748
1710 Ga0068854_100859417
1711 Ga0068854_101345134
1712 Ga0068854_101832262
1713 Ga0068856_100141013
1714 Ga0068856_100271486
1715 Ga0068856_100485469
1716 Ga0068856_102134213
1717 Ga0070702_100065010
1718 Ga0070702_101177249
1719 Ga0068852_100015330
1720 Ga0068852_100028072
1721 Ga0068852_100052592
1722 Ga0068852_100059930
1723 Ga0068852_100531315
1724 Ga0068852_100989559
1725 Ga0068859_100038158
1726 Ga0068859_100083687
1727 Ga0068859_100084282
1728 Ga0068859_100370831
1729 Ga0068864_100052106
1730 Ga0068864_100062593
1731 Ga0068864_100469716
1732 Ga0068864_101431584
1733 Ga0068864_101731111
1734 Ga0068866_10055185
1735 Ga0068866_10229586
1736 Ga0068866_10474794
1737 Ga0068861_100071518
1738 Ga0068861_100895797
1739 Ga0068851_10070172
1740 Ga0068851_10208775
1741 Ga0068851_10281974
1742 Ga0068851_10458262
1743 Ga0068870_10015290
1744 Ga0068870_10045962
1745 Ga0068863_100077222
1746 Ga0068863_100288446
1747 Ga0068863_100477226
1748 Ga0068863_100885579
1749 Ga0068863_101815222
1750 Ga0068858_100208622
1751 Ga0068860_100178786
1752 Ga0068860_100181900
1753 Ga0068860_100235724
1754 Ga0068860_100395778
1755 Ga0068860_101111028
1756 Ga0068862_100000345
1757 Ga0068862_100112879
1758 Ga0068862_100151593
1759 Ga0081455_10089316
1760 Ga0081539_10000221
1761 Ga0070717_10001614
1762 Ga0070712_100050871
1763 Ga0070712_100055819
1764 Ga0097621_100101720
1765 Ga0097621_100689497
1766 Ga0068871_100141038
1767 Ga0068871_100460887
1768 Ga0068871_100482611
1769 Ga0068871_100751601
1770 Ga0075428_100202153
1771 Ga0075428_100842328
1772 Ga0075430_100006599
1773 Ga0075430_100032971
1774 Ga0075430_100039156
1775 Ga0075430_100082368
1776 Ga0075430_100159699
1777 Ga0075430_100694011
1778 Ga0075430_101157904
1779 Ga0075431_100003201
1780 Ga0075431_100097822
1781 Ga0075431_100156632
1782 Ga0075431_100297065
1783 Ga0075431_100312989
1784 Ga0075431_100568716
1785 Ga0075431_101121870
1786 Ga0075431_101661809
1787 Ga0075433_10002069
1788 Ga0075433_10047897
1789 Ga0075434_100015554
1790 Ga0075434_100036023
1791 Ga0075434_100043530
1792 Ga0075434_100777511
1793 Ga0075429_100003639
1794 Ga0075429_100048519
1795 Ga0075429_100206334
1796 Ga0075429_100261267
1797 Ga0075429_100524559
1798 Ga0075429_100577651
1799 Ga0068865_100007652
1800 Ga0068865_100043303
1801 Ga0068865_100156493
1802 Ga0068865_100527710
1803 Ga0068865_101265731
1804 Ga0075436_100002301
1805 Ga0075436_100013028
1806 Ga0075436_100048982
1807 Ga0097620_100038159
1808 Ga0097620_100083689
1809 Ga0097620_100084286
1810 Ga0097620_100370860
1811 Ga0075435_100438974
1812 Ga0105240_10004437
1813 Ga0105240_10023119
1814 Ga0105240_10057070
1815 Ga0105240_10134011
1816 Ga0105240_10763615
1817 Ga0105240_10923511
1818 Ga0105240_11664833
1819 Ga0111539_10018859
1820 Ga0111539_10083002
1821 Ga0111539_11394404
1822 Ga0105245_10200643
1823 Ga0105245_10280170
1824 Ga0105245_10288039
1825 Ga0105245_10819580
1826 Ga0105245_11158592
1827 Ga0105245_11181373
1828 Ga0105245_11386390
1829 Ga0105245_11387830
1830 Ga0105247_10147270
1831 Ga0114129_10141803
1832 Ga0114129_10280082
1833 Ga0114129_11881448
1834 Ga0105243_10205789
1835 Ga0105243_10942439
1836 Ga0105243_11767242
1837 Ga0105241_10012411
1838 Ga0105241_10106603
1839 Ga0105241_10150260
1840 Ga0105242_10015286
1841 Ga0105242_10044869
1842 Ga0105242_10085069
1843 Ga0105242_10703948
1844 Ga0105248_10010930
1845 Ga0105248_10053946
1846 Ga0105248_10069952
1847 Ga0105248_10309714
1848 Ga0105248_10438966
1849 Ga0105248_10641304
1850 Ga0105248_10706521
1851 Ga0105248_10709083
1852 Ga0105237_10026780
1853 Ga0105237_10186091
1854 Ga0105237_10276573
1855 Ga0105237_11031213
1856 Ga0105238_10060734
1857 Ga0105238_10141799
1858 Ga0105238_10573937
1859 Ga0105249_10000276
1860 Ga0105249_10025588
1861 Ga0105249_10135183
1862 Ga0105239_10321020
1863 Ga0105239_11323371
1864 Ga0105239_13450511
1865 Ga0105246_10090990
1866 Ga0105246_10325804
1867 Ga0105246_10725057
1868 Ga0157373_10000674
1869 Ga0157373_10083963
1870 Ga0157373_10175732
1871 Ga0157373_10242259
1872 Ga0157373_10648950
1873 Ga0157371_10007249
1874 Ga0157371_10086632
1875 Ga0157371_10174992
1876 Ga0157371_10489199
1877 Ga0157371_10631511
1878 Ga0157370_10005892
1879 Ga0157370_10006750
1880 Ga0157370_10042235
1881 Ga0157370_10055314
1882 Ga0157370_10063356
1883 Ga0157370_10155255
1884 Ga0157370_10290124
1885 Ga0157370_10373213
1886 Ga0157370_10708497
1887 Ga0157370_11137233
1888 Ga0157370_11598944
1889 Ga0157369_10010955
1890 Ga0157369_10028668
1891 Ga0157369_10099704
1892 Ga0157369_10129696
1893 Ga0157369_10301239
1894 Ga0157369_10635063
1895 Ga0157369_10757009
1896 Ga0157369_10950489
1897 Ga0157369_11159981
1898 Ga0157374_10015504
1899 Ga0157374_10133952
1900 Ga0157374_10216006
1901 Ga0157374_10249779
1902 Ga0157374_11283545
1903 Ga0157378_10029108
1904 Ga0157378_10060345
1905 Ga0157378_10092357
1906 Ga0157378_10179396
1907 Ga0157378_10260006
1908 Ga0157378_10470850
1909 Ga0163162_10075611
1910 Ga0163162_10078881
1911 Ga0163162_10104238
1912 Ga0163162_10568651
1913 Ga0163162_10722095
1914 Ga0157372_10011736
1915 Ga0157372_10036892
1916 Ga0157372_10052954
1917 Ga0157372_10056818
1918 Ga0157372_10097004
1919 Ga0157372_10098929
1920 Ga0157372_10129228
1921 Ga0157372_10174213
1922 Ga0157372_10515700
1923 Ga0157372_10643682
1924 Ga0157372_11347820
1925 Ga0157372_11851538
1926 Ga0157372_12251215
1927 Ga0157375_10015641
1928 Ga0157375_10033974
1929 Ga0157375_10034069
1930 Ga0157375_10052054
1931 Ga0157375_10078385
1932 Ga0157375_10080902
1933 Ga0157375_10242986
1934 Ga0157375_10366758
1935 Ga0157375_10512092
1936 Ga0163163_10215396
1937 Ga0163163_10811635
1938 Ga0157380_10009657
1939 Ga0157380_10124883
1940 Ga0157380_12886611
1941 Ga0157377_10032521
1942 Ga0157379_10964651
1943 Ga0182007_10049935
1944 Ga0182005_1200827
1945 Ga0163161_10102435
1946 Ga0163161_10225197
1947 Ga0163161_10404345
1948 Ga0163161_10589222
1949 Ga0197907_10300930
1950 Ga0197907_10335747
1951 Ga0197907_10694383
1952 Ga0206356_11166277
1953 Ga0206355_1021136
1954 Ga0206355_1195921
1955 Ga0206352_10376517
1956 Ga0206350_10779916
1957 Ga0206350_10804192
1958 Ga0206354_10528991
1959 Ga0206354_11308762
1960 Ga0206353_10548619
1961 Ga0206353_11927621
1962 Ga0213876_10049722
1963 Ga0213876_10056960
1964 Ga0224712_10075175
1965 Ga0224712_10181660
1966 Ga0224712_10353641
1967 Ga0207656_10011423
1968 Ga0207656_10176164
1969 Ga0207656_10292518
1970 Ga0207682_10025320
1971 Ga0207682_10194326
1972 Ga0207692_10071496
1973 Ga0207692_10215920
1974 Ga0207692_10749304
1975 Ga0207642_10007202
1976 Ga0207642_10035667
1977 Ga0207688_10069540
1978 Ga0207688_10527562
1979 Ga0207688_10911683
1980 Ga0207680_10107631
1981 Ga0207680_10378155
1982 Ga0207647_10369324
1983 Ga0207699_10008689
1984 Ga0207699_10008886
1985 Ga0207699_10021920
1986 Ga0207699_10121357
1987 Ga0207699_10475370
1988 Ga0207645_10037165
1989 Ga0207645_10083887
1990 Ga0207645_10095920
1991 Ga0207645_10171647
1992 Ga0207645_10183254
1993 Ga0207645_10283889
1994 Ga0207645_10703160
1995 Ga0207643_10038892
1996 Ga0207643_10046398
1997 Ga0207643_10061108
1998 Ga0207705_10001964
1999 Ga0207705_10003814
2000 Ga0207705_10088802
2001 Ga0207705_10091858
2002 Ga0207705_10121294
2003 Ga0207705_10229631
2004 Ga0207705_10610855
2005 Ga0207705_11320602
2006 Ga0207684_10071570
2007 Ga0207684_10086348
2008 Ga0207684_10758080
2009 Ga0207654_10047074
2010 Ga0207654_10138424
2011 Ga0207707_10001832
2012 Ga0207707_10003256
2013 Ga0207707_10007887
2014 Ga0207707_10012641
2015 Ga0207707_10025337
2016 Ga0207707_10048537
2017 Ga0207707_10077973
2018 Ga0207707_10113684
2019 Ga0207707_10129275
2020 Ga0207707_10339436
2021 Ga0207707_11170911
2022 Ga0207695_10003486
2023 Ga0207695_10017609
2024 Ga0207695_10019830
2025 Ga0207695_10023027
2026 Ga0207695_10062168
2027 Ga0207695_10139100
2028 Ga0207695_10766503
2029 Ga0207695_10781330
2030 Ga0207695_10987763
2031 Ga0207695_11680433
2032 Ga0207671_10146011
2033 Ga0207671_10158570
2034 Ga0207671_10336824
2035 Ga0207693_10018764
2036 Ga0207693_10101397
2037 Ga0207693_10605541
2038 Ga0207663_10070604
2039 Ga0207663_10405262
2040 Ga0207663_10729702
2041 Ga0207660_10000760
2042 Ga0207660_10002967
2043 Ga0207660_10011047
2044 Ga0207660_10011960
2045 Ga0207660_10035829
2046 Ga0207660_10064879
2047 Ga0207660_10156849
2048 Ga0207660_10234408
2049 Ga0207660_10769942
2050 Ga0207662_10001809
2051 Ga0207662_10050281
2052 Ga0207662_10061356
2053 Ga0207657_10014509
2054 Ga0207657_10023382
2055 Ga0207657_10054816
2056 Ga0207657_10059270
2057 Ga0207657_10268800
2058 Ga0207649_10036512
2059 Ga0207649_10040407
2060 Ga0207649_10050794
2061 Ga0207649_10071537
2062 Ga0207649_10098899
2063 Ga0207649_10100201
2064 Ga0207649_10180594
2065 Ga0207649_10194535
2066 Ga0207649_10631063
2067 Ga0207649_10674465
2068 Ga0207652_10000783
2069 Ga0207652_10005886
2070 Ga0207652_10017563
2071 Ga0207652_10027000
2072 Ga0207652_10057791
2073 Ga0207652_10073673
2074 Ga0207652_10116909
2075 Ga0207652_10121793
2076 Ga0207652_10124231
2077 Ga0207652_10284849
2078 Ga0207652_10323423
2079 Ga0207652_10324908
2080 Ga0207652_10326119
2081 Ga0207652_10753397
2082 Ga0207652_11031750
2083 Ga0207646_10007037
2084 Ga0207646_10074853
2085 Ga0207646_10082938
2086 Ga0207646_10734680
2087 Ga0207681_10000718
2088 Ga0207681_10023163
2089 Ga0207681_10034751
2090 Ga0207681_10124693
2091 Ga0207681_10739357
2092 Ga0207694_10103351
2093 Ga0207694_10465840
2094 Ga0207694_11294963
2095 Ga0207650_10110791
2096 Ga0207650_10129778
2097 Ga0207650_10267056
2098 Ga0207650_10358845
2099 Ga0207650_10595361
2100 Ga0207650_11872016
2101 Ga0207659_10047504
2102 Ga0207659_10101691
2103 Ga0207659_10121102
2104 Ga0207659_10435082
2105 Ga0207659_10504512
2106 Ga0207687_10232707
2107 Ga0207687_10378203
2108 Ga0207687_10396303
2109 Ga0207687_10840111
2110 Ga0207687_11065322
2111 Ga0207700_10044053
2112 Ga0207700_10045283
2113 Ga0207700_10555516
2114 Ga0207700_11095110
2115 Ga0207664_10027669
2116 Ga0207664_10041180
2117 Ga0207644_10043924
2118 Ga0207644_10081943
2119 Ga0207644_10113758
2120 Ga0207644_10175838
2121 Ga0207644_10308761
2122 Ga0207644_10586178
2123 Ga0207690_10059298
2124 Ga0207690_10149559
2125 Ga0207690_10689105
2126 Ga0207690_11585698
2127 Ga0207706_10095915
2128 Ga0207706_10164172
2129 Ga0207706_10239036
2130 Ga0207706_10350873
2131 Ga0207686_10129047
2132 Ga0207686_10252233
2133 Ga0207686_10488662
2134 Ga0207709_10064712
2135 Ga0207709_10538653
2136 Ga0207709_10749054
2137 Ga0207709_10969726
2138 Ga0207670_10135522
2139 Ga0207670_10352296
2140 Ga0207669_10070059
2141 Ga0207669_10145491
2142 Ga0207669_10161058
2143 Ga0207669_10222289
2144 Ga0207704_10004959
2145 Ga0207704_10019528
2146 Ga0207704_10135374
2147 Ga0207704_10376165
2148 Ga0207704_10602622
2149 Ga0207704_10696265
2150 Ga0207704_11653214
2151 Ga0207665_10047452
2152 Ga0207665_10259743
2153 Ga0207665_10932919
2154 Ga0207691_10006396
2155 Ga0207691_10008070
2156 Ga0207691_10034694
2157 Ga0207691_10038379
2158 Ga0207691_10215428
2159 Ga0207691_10281956
2160 Ga0207691_10492285
2161 Ga0207711_10293681
2162 Ga0207711_10354370
2163 Ga0207711_10382861
2164 Ga0207711_10468404
2165 Ga0207711_10661323
2166 Ga0207711_10736237
2167 Ga0207689_10099509
2168 Ga0207689_10615213
2169 Ga0207661_10000773
2170 Ga0207661_10003324
2171 Ga0207661_10025056
2172 Ga0207661_10027886
2173 Ga0207661_10096646
2174 Ga0207661_10101249
2175 Ga0207661_10126586
2176 Ga0207661_10132816
2177 Ga0207661_10218129
2178 Ga0207661_10230983
2179 Ga0207661_10231177
2180 Ga0207661_10272806
2181 Ga0207661_10512812
2182 Ga0207661_10527531
2183 Ga0207661_10847343
2184 Ga0207661_10995049
2185 Ga0207679_10011335
2186 Ga0207679_10014612
2187 Ga0207679_10035388
2188 Ga0207679_10042693
2189 Ga0207679_10060806
2190 Ga0207679_10115076
2191 Ga0207679_10219423
2192 Ga0207679_10243205
2193 Ga0207679_10741844
2194 Ga0207679_10754073
2195 Ga0207667_10010475
2196 Ga0207667_10037594
2197 Ga0207667_10073577
2198 Ga0207667_10088790
2199 Ga0207667_10181761
2200 Ga0207667_10483260
2201 Ga0207667_10746865
2202 Ga0207667_10965469
2203 Ga0207667_11300146
2204 Ga0207667_11305099
2205 Ga0207651_10073464
2206 Ga0207651_10117565
2207 Ga0207651_10203343
2208 Ga0207651_10272086
2209 Ga0207651_10301036
2210 Ga0207651_10872437
2211 Ga0207651_11216466
2212 Ga0207712_10000346
2213 Ga0207712_10054871
2214 Ga0207712_10967905
2215 Ga0207668_10019176
2216 Ga0207668_10105113
2217 Ga0207668_10654962
2218 Ga0207668_11084966
2219 Ga0207668_11665799
2220 Ga0207640_10002551
2221 Ga0207640_10004890
2222 Ga0207640_10052552
2223 Ga0207640_10646392
2224 Ga0207640_11970463
2225 Ga0207658_10023714
2226 Ga0207658_10045123
2227 Ga0207658_10324125
2228 Ga0207658_10331932
2229 Ga0207658_10394429
2230 Ga0207658_10662622
2231 Ga0207677_10005642
2232 Ga0207677_10031481
2233 Ga0207677_10447218
2234 Ga0207677_10920271
2235 Ga0207677_11205965
2236 Ga0207677_11363063
2237 Ga0207677_11865006
2238 Ga0207703_10148733
2239 Ga0207703_10176562
2240 Ga0207639_10017793
2241 Ga0207639_10345808
2242 Ga0207639_10703683
2243 Ga0207639_10811003
2244 Ga0207639_10931214
2245 Ga0207639_11670884
2246 Ga0207678_10005989
2247 Ga0207678_10165263
2248 Ga0207678_10181623
2249 Ga0207678_10226531
2250 Ga0207708_10013573
2251 Ga0207708_10015945
2252 Ga0207708_10047116
2253 Ga0207708_10097011
2254 Ga0207708_10172929
2255 Ga0207708_10261267
2256 Ga0207708_10302639
2257 Ga0207708_10553425
2258 Ga0207702_10051183
2259 Ga0207702_10220062
2260 Ga0207641_10184925
2261 Ga0207641_10216253
2262 Ga0207641_10610794
2263 Ga0207641_10693984
2264 Ga0207648_10003894
2265 Ga0207648_10014817
2266 Ga0207648_10029323
2267 Ga0207648_10051944
2268 Ga0207648_10090733
2269 Ga0207648_10133884
2270 Ga0207648_10150977
2271 Ga0207648_10156878
2272 Ga0207648_11359660
2273 Ga0207676_10051055
2274 Ga0207676_10211503
2275 Ga0207676_10232820
2276 Ga0207676_10370538
2277 Ga0207676_11325770
2278 Ga0207676_11758862
2279 Ga0207674_10026779
2280 Ga0207674_10037266
2281 Ga0207674_10112645
2282 Ga0207674_10132898
2283 Ga0207674_10223343
2284 Ga0207674_10283051
2285 Ga0207674_10451898
2286 Ga0207674_11565886
2287 Ga0207675_100067512
2288 Ga0207675_100174256
2289 Ga0207675_100765809
2290 Ga0207683_10052970
2291 Ga0207683_10154425
2292 Ga0207683_10231694
2293 Ga0207683_10453372
2294 Ga0207683_10575410
2295 Ga0207698_10021544
2296 Ga0207698_10043215
2297 Ga0207698_10143952
2298 Ga0207698_10194266
2299 Ga0207698_11580954
2300 Ga0209969_1054586
2301 Ga0209996_1019201
2302 Ga0210000_1032039
2303 Ga0209995_1005218
2304 Ga0209995_1042443
2305 Ga0209968_1001813
2306 Ga0209999_1012273
2307 Ga0209970_1002637
2308 Ga0209983_1033899
2309 Ga0209588_1073306
2310 Ga0209971_1008583
2311 Ga0209966_1000668
2312 Ga0209998_10000516
2313 Ga0209974_10005680
2314 Ga0209974_10047317
2315 Ga0207428_10165592
2316 Ga0207428_10462433
2317 Ga0268266_10592042
2318 Ga0268266_11942260
2319 Ga0268265_10000331
2320 Ga0268265_10055170
2321 Ga0268265_10128815
2322 Ga0268264_10180909
2323 Ga0268264_10257374
2324 Ga0268264_12060581
2325 Ga0316182_1394427
2326 Ga0265332_10014489
2327 Ga0265320_10271106
2328 Ga0265340_10043989
2329 Ga0307408_100007956
2330 Ga0307408_100023930
2331 Ga0307408_100034723
2332 Ga0307408_100143892
2333 Ga0307408_100164448
2334 Ga0307408_100168672
2335 Ga0307408_100493694
2336 Ga0307408_101673133
2337 Ga0265314_10015473
2338 Ga0265342_10458054
2339 Ga0307405_10004252
2340 Ga0307405_10021190
2341 Ga0307405_10050253
2342 Ga0307405_10062898
2343 Ga0307405_10445820
2344 Ga0307405_10609183
2345 Ga0307413_10000716
2346 Ga0307413_10013252
2347 Ga0307413_10064172
2348 Ga0307413_10064302
2349 Ga0307413_10347464
2350 Ga0307413_10506401
2351 Ga0307413_10777907
2352 Ga0307413_11799469
2353 Ga0307413_11897906
2354 Ga0307410_10000703
2355 Ga0307410_10005533
2356 Ga0307410_10015703
2357 Ga0307410_10062836
2358 Ga0307410_10084179
2359 Ga0307410_10089895
2360 Ga0307410_10099120
2361 Ga0307410_10119687
2362 Ga0307410_10292546
2363 Ga0307410_10579716
2364 Ga0307410_10664268
2365 Ga0307410_11446293
2366 Ga0307406_10007225
2367 Ga0307406_10071378
2368 Ga0307406_10144526
2369 Ga0307406_10313234
2370 Ga0307406_10381914
2371 Ga0307406_10516533
2372 Ga0307406_10742134
2373 Ga0307406_11289451
2374 Ga0307407_10006979
2375 Ga0307407_10013663
2376 Ga0307407_10016328
2377 Ga0307407_10077115
2378 Ga0307407_10284787
2379 Ga0307407_10287830
2380 Ga0307407_10315099
2381 Ga0307407_10568186
2382 Ga0307412_10003814
2383 Ga0307412_10076019
2384 Ga0307412_10096133
2385 Ga0307412_10574921
2386 Ga0307412_10808539
2387 Ga0307412_11273805
2388 Ga0307409_100000828
2389 Ga0307409_100014909
2390 Ga0307409_100020440
2391 Ga0307409_100026685
2392 Ga0307409_100387313
2393 Ga0307409_100548381
2394 Ga0307409_100573955
2395 Ga0307409_100744856
2396 Ga0307409_101024049
2397 Ga0307416_100020053
2398 Ga0307416_100047869
2399 Ga0307416_100052780
2400 Ga0307416_100201815
2401 Ga0307416_100205134
2402 Ga0307416_100420076
2403 Ga0307416_100643541
2404 Ga0307416_100815326
2405 Ga0307416_100848605
2406 Ga0307416_100969175
2407 Ga0307416_101129349
2408 Ga0307416_101268111
2409 Ga0307416_101557968
2410 Ga0307416_102485730
2411 Ga0307416_103167767
2412 Ga0307414_10012996
2413 Ga0307414_10047438
2414 Ga0307414_10921909
2415 Ga0307414_11275059
2416 Ga0307414_11437686
2417 Ga0307414_11731355
2418 Ga0307411_10004747
2419 Ga0307411_10061846
2420 Ga0307411_10062197
2421 Ga0307411_10122865
2422 Ga0307411_10165208
2423 Ga0307411_10172334
2424 Ga0307411_10273468
2425 Ga0307411_10325185
2426 Ga0307411_10728760
2427 Ga0307415_100028600
2428 Ga0307415_100039533
2429 Ga0307415_100083254
2430 Ga0307415_100095152
2431 Ga0307415_100120672
2432 Ga0307415_100146582
2433 Ga0307415_100146802
2434 Ga0307415_100234603
2435 Ga0307415_100276935
2436 Ga0307415_100620111
2437 Ga0307415_101307583
2438 Ga0307415_101365620
2439 Ga0373958_0077187
2440 Ga0373926_0041522
2441 Ga0373934_0004281
2442 Ga0373940_0041683
2443 Ga0373952_0281639
2444 Ga0373936_0123559
2445 Ga0373953_0025409
2446 Ga0373954_0175400
2447 Ga0373957_0232082
2448 Ga0373960_0014579
2449 Ga0373943_0037919
2450 Ga0373955_0221512
2451 Ga0373942_0061911
2452 Ga0373942_0204482
2453 Ga0373931_0428607
2454 Ga0373931_0752772
2455 Ga0373935_0063682
2456 Ga0373927_0128798
2457 Ga0373947_0010747
2458 Ga0373937_0000448
2459 Ga0373937_0062192
2460 Ga0373925_0064153
2461 Ga0395900_1067409
2462 Ga0395898_1707525
2463 Ga0395905_0060527
2464 Ga0395905_1251418
2465 Ga0436364_0330143
2466 Ga0436364_0599470
2467 Ga0436365_0209545
2468 Ga0436365_0489964
2469 Ga0436365_0579517
2470 Ga0436365_0753661
2471 Ga0436365_0836229
2472 Ga0436365_1353333
2473 Ga0436365_1791379
2474 Ga0436363_1323611
2475 Ga0436362_0963725
2476 Ga0439461_0018554
2477 Ga0451800_1305647
2478 Ga0451804_0951379
2479 Ga0451839_0204316
2480 Ga0451849_0487378
2481 Ga0451853_2286543
2482 Ga0439433_0082239
2483 Ga0450898_055793
2484 Ga0439434_0050174
2485 Ga0439434_0310029
2486 Ga0451577_0257900
2487 Ga0451577_0765816
2488 Ga0451577_0975175
2489 Ga0466966_0005142
2490 Ga0466966_0077028
2491 Ga0466966_0318317
2492 Ga0466961_0034916
2493 Ga0466961_0093906
2494 Ga0466961_0582121
2495 Ga0466963_0118109
2496 Ga0466964_0211514
2497 Ga0466971_0564673
2498 Ga0466957_0889846
2499 Ga0466960_1032341
2500 Ga0466959_0043802
2501 Ga0466959_0082347
2502 Ga0466959_0125231
2503 Ga0451576_0188169
2504 Ga0451576_0540201
2505 Ga0451576_0568652
2506 Ga0451576_2428243
2507 Ga0466958_0215675
2508 Ga0466967_0169522
2509 Ga0466967_0327399
2510 Ga0495603_0245819
2511 Ga0495603_0480597
2512 Ga0495629_0038804
2513 Ga0495629_0691555
2514 Ga0495651_0003975
2515 Ga0495580_0008931
2516 Ga0495582_0286299
2517 Ga0495639_0017578
2518 Ga0495639_0037561
2519 Ga0495664_0370387
2520 Ga0495584_0654420
2521 Ga0495585_0548564
2522 Ga0495594_0008015
2523 Ga0495594_0012806
2524 Ga0495594_0013642
2525 Ga0495594_0194279
2526 Ga0495630_0026084
2527 Ga0495630_0752217
2528 Ga0495643_0310092
2529 Ga0495666_0008156
2530 Ga0495642_0114228
2531 Ga0495652_0131358
2532 Ga0495665_0025157
2533 Ga0495586_0076789
2534 Ga0495586_0514359
2535 Ga0495587_0002752
2536 Ga0495621_0098495
2537 Ga0495621_0209663
2538 Ga0495621_0233258
2539 Ga0495645_0000804
2540 Ga0495622_0361258
2541 Ga0495667_0008829
2542 Ga0495667_0097780
2543 Ga0495634_0197100
2544 Ga0495635_0833408
2545 Ga0495659_0142888
2546 Ga0495588_0205466
2547 Ga0495588_0266961
2548 Ga0495657_0129370
2549 Ga0495599_0078495
2550 Ga0495623_0001333
2551 Ga0495623_0025809
2552 Ga0495658_0778619
2553 Ga0495669_0058998
2554 Ga0495669_0153021
2555 Ga0495613_0061274
2556 Ga0495613_0302562
2557 Ga0495613_0318068
2558 Ga0495624_0187116
2559 Ga0495600_0029735
2560 Ga0495600_0057993
2561 Ga0495600_0499794
2562 Ga0495581_0124203
2563 Ga0495581_0282360
2564 Ga0495674_0075611
2565 Ga0495672_0005947
2566 Ga0495675_0007163
2567 Ga0495675_0025928
2568 Ga0495677_0440844
2569 Ga0495684_0056960
2570 Ga0495684_0132396
2571 Ga0495602_0258837
2572 Ga0495602_0437548
2573 Ga0496100_0033859
2574 Ga0496100_0071846
2575 Ga0496101_0063525
2576 Ga0496105_0131297
2577 Ga0496106_0031215
2578 Ga0496106_0452888
2579 Ga0496107_0113721
2580 Ga0496108_0475266
2581 Ga0496109_0357570
2582 Ga0496109_0365026
2583 Ga0496109_1188726
2584 Ga0496110_0284371
2585 Ga0496110_0704935
2586 Ga0496111_0429111
2587 Ga0496112_0003755
2588 Ga0496112_0011306
2589 Ga0496112_0747424
2590 Ga0496112_1098261
2591 Ga0496113_0010290
2592 Ga0496113_0653277
2593 Ga0496115_0059698
2594 Ga0496115_0200863
2595 Ga0501309_046492
2596 Ga0501291_093473
2597 Ga0501031_0018277
2598 Ga0501033_0004681
2599 Ga0501033_0072694
2600 Ga0501034_0034768
2601 Ga0501034_0040492
2602 Ga0501034_0128703
2603 Ga0501036_0132872
2604 Ga0501036_0367837
2605 Ga0501038_0185359
2606 Ga0501040_0009071
2607 Ga0501040_0266305
2608 Ga0501041_0179921
2609 Ga0501041_0698145
2610 Ga0501042_0127338
2611 Ga0501042_1276809
2612 Ga0501043_0048107
2613 Ga0501043_0114778
2614 Ga0501046_0123251
2615 Ga0501047_0014211
2616 Ga0501047_0030687
2617 Ga0501048_0103818
2618 Ga0501048_0184214
2619 Ga0501067_0038830
2620 Ga0501067_0769376
2621 Ga0501070_0260163
2622 Ga0501071_0117247
2623 Ga0501072_1235084
2624 Ga0501073_0047690
2625 Ga0501074_0438082
2626 Ga0501075_0148168
2627 Ga0501075_0152227
2628 Ga0501075_0377071
2629 Ga0501076_0194401
2630 Ga0501076_0203720
2631 Ga0501076_1177277
2632 Ga0501077_0232705
2633 Ga0501198_036905
2634 Ga0501202_022466
2635 Ga0501202_071434
2636 Ga0501216_039971
2637 Ga0501216_101244
2638 Ga0501216_190236
2639 Ga0501223_011898
2640 Ga0501224_038653
2641 Ga0501230_109663
2642 Ga0501233_030238
2643 Ga0501235_002455
2644 Ga0501239_003005
2645 Ga0501239_033791
2646 Ga0501240_004237
2647 Ga0501246_035869
2648 Ga0501247_071413
2649 Ga0501249_001158
2650 Ga0501250_006768
2651 Ga0501250_081788
2652 Ga0501251_088467
2653 Ga0501257_003684
2654 Ga0501259_006356
2655 Ga0501260_003681
2656 Ga0501261_009664
2657 Ga0501221_027992
2658 Ga0501225_0034888
2659 Ga0501234_026138
2660 Ga0501245_065160
2661 Ga0501079_0004591
2662 Ga0501079_0802829
2663 Ga0501080_0094200
2664 Ga0501080_0183927
2665 Ga0501081_0344394
2666 Ga0501081_0382252
2667 Ga0501241_045376
2668 Ga0501262_022185
2669 Ga0501263_025365
2670 Ga0501266_005306
2671 Ga0501267_021986
2672 Ga0501268_003463
2673 Ga0501268_064088
2674 Ga0501268_106762
2675 Ga0501270_010744
2676 Ga0501272_035657
2677 Ga0501273_011690
2678 Ga0501273_075213
2679 Ga0501044_0003683
2680 Ga0501044_0235840
2681 Ga0501045_0014893
2682 nmdc:mga05p37_1927118_c1
2683 nmdc:mga05p37_352966_c1
2684 nmdc:mga05p37_385546_c1
2685 nmdc:mga05p37_60165_c1
2686 nmdc:mga09592_1137302_c1
2687 nmdc:mga09592_1156241_c1
2688 nmdc:mga09592_130564_c1
2689 nmdc:mga09592_1715814_c1
2690 nmdc:mga09592_238092_c1
2691 nmdc:mga09592_25522_c1
2692 nmdc:mga09592_512166_c1
2693 nmdc:mga0qj67_1051269_c1
2694 nmdc:mga0qj67_127949_c1
2695 nmdc:mga0qj67_1318174_c1
2696 nmdc:mga0qj67_138992_c1
2697 nmdc:mga0qj67_158591_c1
2698 nmdc:mga0qj67_19069_c1
2699 nmdc:mga0qj67_20933_c1
2700 nmdc:mga0qj67_26367_c1
2701 nmdc:mga0qj67_690188_c1
2702 nmdc:mga06r32_1148651_c1
2703 nmdc:mga06r32_145013_c1
2704 nmdc:mga06r32_182385_c1
2705 nmdc:mga06r32_21909_c1
2706 nmdc:mga06r32_312252_c1
2707 nmdc:mga06r32_36042_c1
2708 nmdc:mga06r32_561985_c1
2709 nmdc:mga06r32_78254_c1
2710 nmdc:mga08y16_343165_c1
2711 nmdc:mga08y16_408998_c1
2712 nmdc:mga0n895_100600_c1
2713 nmdc:mga0n895_18096_c1
2714 nmdc:mga0n895_295417_c1
2715 nmdc:mga0n895_29871_c1
2716 nmdc:mga0n895_333004_c1
2717 nmdc:mga0n895_647163_c1
2718 nmdc:mga0rr50_1099731_c1
2719 nmdc:mga0rr50_251480_c1
2720 nmdc:mga0rr50_696998_c1
2721 nmdc:mga08x19_125037_c1
2722 nmdc:mga08x19_24045_c1
2723 nmdc:mga08x19_589444_c1
2724 nmdc:mga08x19_9458_c1
2725 nmdc:mga0a205_131602_c1
2726 nmdc:mga0a205_7731_c1
2727 nmdc:mga0a205_854553_c1
2728 nmdc:mga0a205_8915_c1
2729 Ga0495601_0441565
2730 Ga0495612_0237976
2731 Ga0495595_0042201
2732 Ga0590071_029891
2733 Ga0590071_036978
2734 Ga0590075_069820
2735 Ga0590077_022527
2736 Ga0587089_072147
2737 Ga0587090_111849
2738 Ga0587091_127973
2739 Ga0501082_0044913
2740 Ga0501082_1419574

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF01258

zf-dskA_traR

Prokaryotic dksA/traR C4-type zinc finger

115

150

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.711 13 130
6ptg-assembly2.cif.gz_A structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.7077 13 130
7o5y-assembly1.cif.gz_B pila minor pilin of streptococcus sanguinis type iv pili 0.6762 13 50
6ptg-assembly3.cif.gz_B structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.6689 13 130
6ptg-assembly2.cif.gz_A structure of rna polymerase binding protein and transcriptional regulator dks from chlamydia trachomatis l2 (lgv434) 0.6651 13 130
ID Description Score Start End Superfamily
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.6614 14 131 1.20.120.910
4ijjA00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.5861 14 131 1.20.120.910
1tjlB00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.5552 13 131 1.20.120.910
af_Q55DK5_17_291_1.20.1270.60 Mainly Alpha;Up-down Bundle;Substrate Binding Domain Of Dnak; Chain:A; Domain 2;Arfaptin homology (AH) domain/BAR domain 0.5135 15 90 1.20.1270.60
2kq9A00 Mainly Alpha;Up-down Bundle;Four Helix Bundle (Hemerythrin (Met), subunit A);DksA, coiled-coil domain 0.5019 11 126 1.20.120.910
ID Description Score Start End GO Terms
AF-A0A7Z9JQQ5-F1-model_v4 RNA polymerase-binding protein DksA 0.8807 71 129 GO:0008270
AF-A0A7Z9JQQ5-F1-model_v4 RNA polymerase-binding protein DksA 0.8427 71 129 GO:0008270
AF-A0A379H9W7-F1-model_v4 deleted 0.7428 13 131
AF-A0A1J5JB83-F1-model_v4 Zinc finger DksA/TraR C4-type domain-containing protein 0.7175 13 131 GO:0008270
AF-A0A1R3FMC2-F1-model_v4 Zinc finger DksA/TraR C4-type domain-containing protein 0.7073 13 131 GO:0008270

Map