F493364
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1364 | 719 | 1055 | 332 |
Family's Representative Sequence
| Representative Sequence | 3300035088|Ga0373940_0017126|Ga0373940_0017126_71_1252 |
| Length | 393 |
| Sequence | MRVRWAGRGHAELFHRPAGYRTMSMIPAQPDSGPDRRVPLSVLDLAPIVQGGDAADAFRRSLDLAQHAERWGYRRFWLAEHHGLPGIASAATAVVIGHVAGGTSTIRVGAGGVMLPNHAPLVIAEQFGTLASLFPGRIDLGLGRAPGSDQLTARALRRSPLAADTFADDVVELMDYFRPPHPRQLVRAVPGAGLDVPVWILGSSLFGAQLAADLGLPYAFASHFAPAALDEALELYRARFKPSAQLDRPYVMLGVNLFAAESDDEGRRLFTSLQQAFVNLRRGHPGPLPPPVDGFVERLHPGDRRLLDEMLSCSVVGSPATVERGLEAFVARTGADELMLASQIYDHGARLRSYELAAGTSGPRQQPIEPSVDIDGSPFQGTATLGGNRLANS |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2010549000 | Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes | Metagenome | Endosphere |
| 2 | 2506783011 | Frankia datiscae Dg1 | Isolate | Nodule |
| 3 | 2508501039 | Frankia saprophytica CN3 | Isolate | Nodule |
| 4 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 5 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 6 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 7 | 2510461069 | Rhizobium sp. PDO1-076 | Isolate | Rhizosphere |
| 8 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 9 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 10 | 2510917026 | Rhizobium sp. CF80 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 14 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 15 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 16 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 17 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 18 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 19 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 20 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 21 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 22 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 23 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 24 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 25 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 26 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 27 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 28 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 29 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 30 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 31 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 32 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 33 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 34 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 35 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 36 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 37 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 38 | 2563366752 | Paenibacillus pini JCM 16418 | Isolate | Rhizosphere |
| 39 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 40 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 41 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 42 | 2582581304 | Rhizobium sp. YR519 | Isolate | Rhizosphere |
| 43 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 44 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 45 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 46 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 47 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 48 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 49 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 50 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 51 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 52 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 53 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 54 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 55 | 2585427594 | Rhizobium sp. YR528 | Isolate | Rhizosphere |
| 56 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 57 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 58 | 2585427633 | Neorhizobium galegae bv. officinalis HAMBI 1141 | Isolate | Nodule |
| 59 | 2585427634 | Neorhizobium galegae bv. orientalis HAMBI 540 | Isolate | Nodule |
| 60 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 61 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 62 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 63 | 2599185236 | Rhizobium sp. NFR07 | Isolate | Rhizoplane |
| 64 | 2600254933 | Rhizobium sp. NFR12 | Isolate | Rhizoplane |
| 65 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 66 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 67 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 68 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 69 | 2643221558 | Rhizobium sp. Root149 | Isolate | Unclassified |
| 70 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 71 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 72 | 2643221643 | Rhizobium sp. Root1220 | Isolate | Unclassified |
| 73 | 2643221653 | Rhizobium sp. Root1240 | Isolate | Unclassified |
| 74 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 75 | 2643221719 | Rhizobium sp. Root274 | Isolate | Unclassified |
| 76 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 77 | 2675902999 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 78 | 2687453737 | Frankia sp. BMG5.36 | Isolate | Nodule |
| 79 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 80 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 81 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 82 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 83 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 84 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 85 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 86 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 87 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 88 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 89 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 90 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 91 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 92 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 93 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 94 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 95 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 96 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 97 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 98 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 99 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 100 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 101 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 102 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 103 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 104 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 105 | 2738541293 | Rhizobium sp. GV031 | Isolate | Unclassified |
| 106 | 2738541317 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 107 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 108 | 2738543013 | Variovorax sp. BT01 | Isolate | Unclassified |
| 109 | 2739367756 | Asticcacaulis sp. CF398 | Isolate | Unclassified |
| 110 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 111 | 2773857921 | Frankia asymbiotica NRRL B-16386 | Isolate | Nodule |
| 112 | 2773857933 | Frankia sp. BMG5.30 | Isolate | Nodule |
| 113 | 2775507049 | Rhizobium sp. ACO-34A | Isolate | Unclassified |
| 114 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 115 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 116 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 117 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 118 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 119 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 120 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 121 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 122 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 123 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 124 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 125 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 126 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 127 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 128 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 129 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 130 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 131 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 132 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 133 | 2818991272 | Rhizobium sp. SLBN-4 | Isolate | Unclassified |
| 134 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 135 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 136 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 137 | 2818991461 | Neorhizobium alkalisoli 1225 | Isolate | Unclassified |
| 138 | 2821123053 | Rhizobium cellulosilyticum 1193 | Isolate | Unclassified |
| 139 | 2835188231 | Isoptericola variabilis JZ7 | Isolate | Unclassified |
| 140 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 141 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 142 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 143 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 144 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 145 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 146 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 147 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 148 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 149 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 150 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 151 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 152 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 153 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 154 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 155 | 2838729681 | Rhizobium leguminosarum SEMIA 445 | Isolate | Nodule |
| 156 | 2838736955 | Rhizobium cellulosilyticum SEMIA 448 | Isolate | Nodule |
| 157 | 2838742623 | Rhizobium leguminosarum SEMIA 449 | Isolate | Nodule |
| 158 | 2841840854 | Rhizobium cellulosilyticum SEMIA 444 | Isolate | Nodule |
| 159 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 160 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 161 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 162 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 163 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 164 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 165 | 2842140634 | Rhizobium cellulosilyticum SEMIA 452 | Isolate | Nodule |
| 166 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 167 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 168 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 169 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 170 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 171 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 172 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 173 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 174 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 175 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 176 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 177 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 178 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 179 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 180 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 181 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 182 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 183 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 184 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 185 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 186 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 187 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 188 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 189 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 190 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 191 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 192 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 193 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 194 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 195 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 196 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 197 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 198 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 199 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 200 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 201 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 202 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 203 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 204 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 205 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 206 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 207 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 208 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 209 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 210 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 211 | 2842733646 | Variovorax sp. R-72446 | Isolate | Unclassified |
| 212 | 2842747753 | Variovorax sp. R-72060 | Isolate | Unclassified |
| 213 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 214 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 215 | 2854896431 | Neorhizobium alkalisoli DSM 21826 | Isolate | Unclassified |
| 216 | 2854916844 | Neorhizobium huautlense DSM 21817 | Isolate | Unclassified |
| 217 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 218 | 2857531043 | Neorhizobium sp. R-72160 | Isolate | Unclassified |
| 219 | 2869162929 | Mesorhizobium sanjuanii BSA136 | Isolate | Nodule |
| 220 | 2885192300 | Variovorax sp. MHTC-1 | Isolate | Rhizosphere |
| 221 | 2885305155 | Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 | Isolate | Nodule |
| 222 | 2885326080 | Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 | Isolate | Nodule |
| 223 | 2885334103 | Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 | Isolate | Nodule |
| 224 | 2887375801 | Parapusillimonas sp. SGNA-6 | Isolate | Rhizosphere |
| 225 | 2894772417 | Roseomonas oryzicola KCTC 22478 | Isolate | Rhizosphere |
| 226 | 2895511927 | Pseudoxanthomonas sp. SGD-5-1 | Isolate | Rhizosphere |
| 227 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 228 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 229 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 230 | 2899924645 | Variovorax sp. 369 | Isolate | Unclassified |
| 231 | 2904541872 | Variovorax sp. 1615 | Isolate | Rhizosphere |
| 232 | 2913308742 | Rhizobium halophytocola DSM 21600 | Isolate | Unclassified |
| 233 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 234 | 2919171160 | Neorhizobium sp. 2083 | Isolate | Unclassified |
| 235 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 236 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 237 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 238 | 2928044640 | Variovorax sp. 1128 | Isolate | Unclassified |
| 239 | 2928051484 | Variovorax sp. 1133 | Isolate | Unclassified |
| 240 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 241 | 2929160207 | Variovorax sp. R-72349 Hybrid assembly | Isolate | Unclassified |
| 242 | 2929206907 | Paenibacillus sp. R-74146 Hybrid assembly | Isolate | Unclassified |
| 243 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 244 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 245 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 246 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 247 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 248 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 249 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 250 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 251 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 252 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 253 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 254 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 255 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 256 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 257 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 258 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 259 | 2989776772 | Rhizobium glycinendophyticum CL12 | Isolate | Unclassified |
| 260 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 261 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 262 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 263 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 264 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 265 | 3300001904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 | Metagenome | Rhizosphere |
| 266 | 3300001915 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 | Metagenome | Rhizosphere |
| 267 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 268 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 269 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 270 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 271 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 272 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 273 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 274 | 3300002774 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA | Metagenome | Endosphere |
| 275 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 276 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 277 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 278 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 279 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 280 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 281 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 282 | 3300003752 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 | Metagenome | Endosphere |
| 283 | 3300003759 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 | Metagenome | Endosphere |
| 284 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 285 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 286 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 287 | 3300003784 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 | Metagenome | Endosphere |
| 288 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 289 | 3300003791 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 | Metagenome | Endosphere |
| 290 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 291 | 3300003794 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 | Metagenome | Endosphere |
| 292 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 293 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 294 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 295 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 296 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 297 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 298 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 299 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 300 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 301 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 302 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 303 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 304 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 305 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 306 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 307 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 308 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 309 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 310 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 311 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 312 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 313 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 314 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 315 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 316 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 317 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 318 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 319 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 320 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 321 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 322 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 323 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 324 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 325 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 326 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 327 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 328 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 329 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 330 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 331 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 332 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 333 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 334 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 335 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 336 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 337 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 338 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 339 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 340 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 341 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 342 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 343 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 344 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 345 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 346 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 347 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 348 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 349 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 350 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 351 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 352 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 353 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 354 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 355 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 356 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 357 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 358 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 359 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 360 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 361 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 362 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 363 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 364 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 365 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 366 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 367 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 368 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 369 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 370 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 371 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 372 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 373 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 374 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 375 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 376 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 377 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 378 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 379 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 380 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 381 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 382 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 383 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 384 | 3300015683 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 | Metagenome | Rhizosphere |
| 385 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 386 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 387 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 388 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 389 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 390 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 391 | 3300020610 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 392 | 3300021361 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 | Metagenome | Rhizosphere |
| 393 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 394 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 395 | 3300025207 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 396 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 397 | 3300025230 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 398 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 399 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 400 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 401 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 402 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 403 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 404 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 405 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 406 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 407 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 408 | 3300025291 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 409 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 410 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 411 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 412 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 413 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 414 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 415 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 416 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 417 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 418 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 419 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 420 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 421 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 422 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 423 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 424 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 425 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 426 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 427 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 428 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 429 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 430 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 431 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 432 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 433 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 434 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 435 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 436 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 437 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 438 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 439 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 440 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 441 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 442 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 443 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 444 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 445 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 446 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 447 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 448 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 449 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 450 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 451 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 452 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 453 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 454 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 455 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 456 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 457 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 458 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 459 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 460 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 461 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 462 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 463 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 464 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 465 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 466 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 467 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 468 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 469 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 470 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 471 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 472 | 3300030521 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM | Metagenome | Unclassified |
| 473 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 474 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 475 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 476 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 477 | 3300031242 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG | Metagenome | Rhizosphere |
| 478 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 479 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 480 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 481 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 482 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 483 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 484 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 485 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 486 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 487 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 488 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 489 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 490 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 491 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 492 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 493 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 494 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 495 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 496 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 497 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 498 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 499 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 500 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 501 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 502 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 503 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 504 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 505 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 506 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 507 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 508 | 3300039447 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 | Metagenome | Rhizosphere |
| 509 | 3300041411 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 | Metagenome | Rhizosphere |
| 510 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 511 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 512 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 513 | 3300041497 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT | Metatranscriptome | Unclassified |
| 514 | 3300041502 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT | Metatranscriptome | Unclassified |
| 515 | 3300041503 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG | Metagenome | Unclassified |
| 516 | 3300041505 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG | Metagenome | Unclassified |
| 517 | 3300041510 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT | Metatranscriptome | Unclassified |
| 518 | 3300041907 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run | Metatranscriptome | Unclassified |
| 519 | 3300042004 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 | Metagenome | Rhizosphere |
| 520 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 521 | 3300042010 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 | Metagenome | Rhizosphere |
| 522 | 3300042014 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 | Metagenome | Rhizosphere |
| 523 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 524 | 3300042115 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 | Metagenome | Rhizosphere |
| 525 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 526 | 3300044672 | Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E | Metagenome | Unclassified |
| 527 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 528 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 529 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 530 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 531 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 532 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 533 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 534 | 3300046452 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere | Metagenome | Rhizosphere |
| 535 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 536 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 537 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 538 | 3300046457 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere | Metagenome | Rhizosphere |
| 539 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 540 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 541 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 542 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 543 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 544 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 545 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 546 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 547 | 3300046506 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere | Metagenome | Rhizosphere |
| 548 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 549 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 550 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 551 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 552 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 553 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 554 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 555 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 556 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 557 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 558 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 559 | 3300046530 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere | Metagenome | Rhizosphere |
| 560 | 3300046538 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere | Metagenome | Rhizosphere |
| 561 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 562 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 563 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 564 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 565 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 566 | 3300046648 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere | Metagenome | Rhizosphere |
| 567 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 568 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 569 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 570 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 571 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 572 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 573 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 574 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 575 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 576 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 577 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 578 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 579 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 580 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 581 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 582 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 583 | 3300047469 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere | Metagenome | Rhizosphere |
| 584 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 585 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 586 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 587 | 3300048090 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere | Metagenome | Rhizosphere |
| 588 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 589 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 590 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 591 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 592 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 593 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 594 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 595 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 596 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 597 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 598 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 599 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 600 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 601 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 602 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 603 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 604 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 605 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 606 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 607 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 608 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 609 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 610 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 611 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 612 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 613 | 3300049459 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere | Metagenome | Rhizosphere |
| 614 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 615 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 616 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 617 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 618 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 619 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 620 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 621 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 622 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 623 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 624 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 625 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 626 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 627 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 628 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 629 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 630 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 631 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 632 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 633 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 634 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 635 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 636 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 637 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 638 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 639 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 640 | 3300049776 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought | Metagenome | Rhizosphere |
| 641 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 642 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 643 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 644 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 645 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 646 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 647 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 648 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 649 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 650 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 651 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 652 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 653 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 654 | 3300053092 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere | Metagenome | Endosphere |
| 655 | 3300053105 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere | Metagenome | Endosphere |
| 656 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 657 | 3300053117 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere | Metagenome | Endosphere |
| 658 | 3300053118 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere | Metagenome | Endosphere |
| 659 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 660 | 3300053133 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere | Metagenome | Endosphere |
| 661 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 662 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 663 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 664 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 665 | 3300053148 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere | Metagenome | Endosphere |
| 666 | 3300053151 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere | Metagenome | Endosphere |
| 667 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 668 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 669 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 670 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 671 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 672 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 673 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 674 | 639633007 | Azoarcus olearius BH72 | Isolate | Unclassified |
| 675 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 676 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 677 | 8005246636 | Rhizobium wuzhouense W44 | Isolate | Rhizosphere |
| 678 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 679 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 680 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 681 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 682 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 683 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 684 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 685 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 686 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 687 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 688 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 689 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 690 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 691 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 692 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 693 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 694 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 695 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 696 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 697 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 698 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 699 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 700 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 701 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 702 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 703 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 704 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 705 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 706 | 8018150411 | Rhizobium straminoryzae SM12 | Isolate | Rhizosphere |
| 707 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 708 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 709 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 710 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 711 | 8024486573 | Rhizobium tubonense CCBAU 85046 | Isolate | Nodule |
| 712 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 713 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 714 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 715 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 716 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 717 | 8056875544 | Rhizobium halophilum TRM95001 | Isolate | Rhizosphere |
| 718 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 719 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 76.47 |
| Metatranscriptomes | 0.88 |
| Isolates | 22.65 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.29 |
| Bulb | 0 |
| Endosphere | 13.56 |
| Nodule | 14.66 |
| Rhizoplane | 2.93 |
| Rhizosphere | 56.09 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 12.46 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | RicEn_C5165 | 2010549000 | Bacteria | 1417 |
| 2 | JGI24736J21556_1001796 | 3300001904 | Bacteria | 3852 |
| 3 | JGI24741J21665_1000582 | 3300001915 | Bacteria | 11068 |
| 4 | JGI24740J21852_10002373 | 3300001979 | Bacteria | 8560 |
| 5 | JGI24740J21852_10003345 | 3300001979 | Bacteria | 7067 |
| 6 | JGI25155J39150_1000007 | 3300002704 | Bacteria | 238857 |
| 7 | JGI25156J39149_1000066 | 3300002705 | Bacteria | 82816 |
| 8 | JGI25162J39368_1000488 | 3300002737 | Bacteria | 30289 |
| 9 | JGI25162J39368_1001297 | 3300002737 | Bacteria | 14115 |
| 10 | JGI25154J39366_1000035 | 3300002738 | Bacteria | 172224 |
| 11 | JGI25157J39369_1000036 | 3300002741 | Bacteria | 133671 |
| 12 | JGI25152J39213_1004590 | 3300002773 | Bacteria | 4302 |
| 13 | JGI25152J39213_1014814 | 3300002773 | Bacteria | 1563 |
| 14 | JGI25150J39212_1000144 | 3300002774 | Bacteria | 40186 |
| 15 | JGI25159J45721_1000463 | 3300002987 | Bacteria | 18770 |
| 16 | JGI25159J45721_1001920 | 3300002987 | Bacteria | 8309 |
| 17 | JGI25151J46595_10000031 | 3300003187 | Bacteria | 197865 |
| 18 | JGI25151J46595_10001277 | 3300003187 | Bacteria | 17761 |
| 19 | JGI25151J46595_10032082 | 3300003187 | Bacteria | 2041 |
| 20 | JGI25165J46597_1000676 | 3300003214 | Bacteria | 27457 |
| 21 | JGI25165J46597_1001184 | 3300003214 | Bacteria | 15921 |
| 22 | JGI25153J46596_10004925 | 3300003215 | Bacteria | 7096 |
| 23 | JGI25153J46596_10004998 | 3300003215 | Bacteria | 7037 |
| 24 | rootL2_10026958 | 3300003322 | Bacteria | 10783 |
| 25 | JGI25160J50197_1000100 | 3300003354 | Bacteria | 86646 |
| 26 | JGI25160J50197_1001130 | 3300003354 | Bacteria | 13639 |
| 27 | JGI25160J50197_1006336 | 3300003354 | Bacteria | 4805 |
| 28 | JGI25161J50226_1000072 | 3300003374 | Bacteria | 86646 |
| 29 | JGI25161J50226_1000104 | 3300003374 | Bacteria | 67942 |
| 30 | JGI25161J50226_1000396 | 3300003374 | Bacteria | 21728 |
| 31 | Ga0055539_1002732 | 3300003752 | Bacteria | 2605 |
| 32 | Ga0055525_1000036 | 3300003759 | Bacteria | 298878 |
| 33 | Ga0055526_1001414 | 3300003771 | Bacteria | 17081 |
| 34 | Ga0055526_1012623 | 3300003771 | Bacteria | 3664 |
| 35 | Ga0055526_1023211 | 3300003771 | Bacteria | 2078 |
| 36 | Ga0055526_1024203 | 3300003771 | Bacteria | 1996 |
| 37 | Ga0055524_1008292 | 3300003775 | Bacteria | 4327 |
| 38 | Ga0055524_1015401 | 3300003775 | Bacteria | 2790 |
| 39 | Ga0055536_1005370 | 3300003781 | Bacteria | 6283 |
| 40 | Ga0055534_1001811 | 3300003784 | Bacteria | 8005 |
| 41 | Ga0055528_1000695 | 3300003790 | Bacteria | 23949 |
| 42 | Ga0055528_1001150 | 3300003790 | Bacteria | 17214 |
| 43 | Ga0055528_1003280 | 3300003790 | Bacteria | 8231 |
| 44 | Ga0055528_1008246 | 3300003790 | Bacteria | 4499 |
| 45 | Ga0055528_1011300 | 3300003790 | Bacteria | 3559 |
| 46 | Ga0055530_10022910 | 3300003791 | Bacteria | 1807 |
| 47 | Ga0055540_1000752 | 3300003792 | Bacteria | 21989 |
| 48 | Ga0055540_1004512 | 3300003792 | Bacteria | 6237 |
| 49 | Ga0055540_1005410 | 3300003792 | Bacteria | 5379 |
| 50 | Ga0055540_1007583 | 3300003792 | Bacteria | 4061 |
| 51 | Ga0055540_1012146 | 3300003792 | Bacteria | 2724 |
| 52 | Ga0055531_10003153 | 3300003794 | Bacteria | 10605 |
| 53 | Ga0055531_10003943 | 3300003794 | Bacteria | 9215 |
| 54 | Ga0058692_1002399 | 3300003856 | Bacteria | 6287 |
| 55 | Ga0055543_1000078 | 3300004625 | Bacteria | 85340 |
| 56 | Ga0055543_1000280 | 3300004625 | Bacteria | 37509 |
| 57 | Ga0065165_1000623 | 3300005262 | Bacteria | 51455 |
| 58 | Ga0065165_1002557 | 3300005262 | Bacteria | 15059 |
| 59 | Ga0065165_1026404 | 3300005262 | Bacteria | 1911 |
| 60 | Ga0070658_10000253 | 3300005327 | Bacteria | 46941 |
| 61 | Ga0070658_10034330 | 3300005327 | Bacteria | 4081 |
| 62 | Ga0070658_10046534 | 3300005327 | Bacteria | 3510 |
| 63 | Ga0070683_100023206 | 3300005329 | Bacteria | 5548 |
| 64 | Ga0070683_100023540 | 3300005329 | Bacteria | 5509 |
| 65 | Ga0070683_100038909 | 3300005329 | Bacteria | 4363 |
| 66 | Ga0070683_100121335 | 3300005329 | Bacteria | 2469 |
| 67 | Ga0068869_100135223 | 3300005334 | Bacteria | 1899 |
| 68 | Ga0070666_10035138 | 3300005335 | Bacteria | 3323 |
| 69 | Ga0070680_100004729 | 3300005336 | Bacteria | 10247 |
| 70 | Ga0070680_100019004 | 3300005336 | Bacteria | 5439 |
| 71 | Ga0070680_100019667 | 3300005336 | Bacteria | 5355 |
| 72 | Ga0070680_100046207 | 3300005336 | Bacteria | 3541 |
| 73 | Ga0070680_100097355 | 3300005336 | Bacteria | 2440 |
| 74 | Ga0070680_100116211 | 3300005336 | Bacteria | 2230 |
| 75 | Ga0070680_100293576 | 3300005336 | Bacteria | 1378 |
| 76 | Ga0070682_100049310 | 3300005337 | Bacteria | 2625 |
| 77 | Ga0070682_100085439 | 3300005337 | Bacteria | 2053 |
| 78 | Ga0070682_100113963 | 3300005337 | Bacteria | 1806 |
| 79 | Ga0068868_100193279 | 3300005338 | Bacteria | 1693 |
| 80 | Ga0070660_100035735 | 3300005339 | Bacteria | 3761 |
| 81 | Ga0070660_100250026 | 3300005339 | Bacteria | 1445 |
| 82 | Ga0070691_10000346 | 3300005341 | Bacteria | 16494 |
| 83 | Ga0070661_100011899 | 3300005344 | Bacteria | 6073 |
| 84 | Ga0070661_100032241 | 3300005344 | Bacteria | 3792 |
| 85 | Ga0070661_100128804 | 3300005344 | Bacteria | 1900 |
| 86 | Ga0070692_10006692 | 3300005345 | Bacteria | 5022 |
| 87 | Ga0070692_10012767 | 3300005345 | Bacteria | 3900 |
| 88 | Ga0070668_100132243 | 3300005347 | Bacteria | 2004 |
| 89 | Ga0070669_100036844 | 3300005353 | Bacteria | 3546 |
| 90 | Ga0070669_100211508 | 3300005353 | Bacteria | 1530 |
| 91 | Ga0070669_100212799 | 3300005353 | Bacteria | 1526 |
| 92 | Ga0070669_100225018 | 3300005353 | Bacteria | 1485 |
| 93 | Ga0070671_100004730 | 3300005355 | Bacteria | 10811 |
| 94 | Ga0070671_100029091 | 3300005355 | Bacteria | 4555 |
| 95 | Ga0070667_100008497 | 3300005367 | Bacteria | 8513 |
| 96 | Ga0070667_100113050 | 3300005367 | Bacteria | 2356 |
| 97 | Ga0070709_10035983 | 3300005434 | Bacteria | 3012 |
| 98 | Ga0070709_10109793 | 3300005434 | Bacteria | 1852 |
| 99 | Ga0070714_100034690 | 3300005435 | Bacteria | 4226 |
| 100 | Ga0070714_100048057 | 3300005435 | Bacteria | 3628 |
| 101 | Ga0070714_100049230 | 3300005435 | Bacteria | 3587 |
| 102 | Ga0070713_100002078 | 3300005436 | Bacteria | 12941 |
| 103 | Ga0070713_100019647 | 3300005436 | Bacteria | 5165 |
| 104 | Ga0070711_100168028 | 3300005439 | Bacteria | 1669 |
| 105 | Ga0070700_100176122 | 3300005441 | Bacteria | 1485 |
| 106 | Ga0070708_100000241 | 3300005445 | Bacteria | 40642 |
| 107 | Ga0070708_100004969 | 3300005445 | Bacteria | 10506 |
| 108 | Ga0070663_100096368 | 3300005455 | Bacteria | 2200 |
| 109 | Ga0070678_100047817 | 3300005456 | Bacteria | 3076 |
| 110 | Ga0070662_100015877 | 3300005457 | Bacteria | 5051 |
| 111 | Ga0070681_10000944 | 3300005458 | Bacteria | 24477 |
| 112 | Ga0070681_10024374 | 3300005458 | Bacteria | 6091 |
| 113 | Ga0070681_10042102 | 3300005458 | Bacteria | 4577 |
| 114 | Ga0070681_10051581 | 3300005458 | Bacteria | 4103 |
| 115 | Ga0070681_10077426 | 3300005458 | Bacteria | 3283 |
| 116 | Ga0070681_10079325 | 3300005458 | Bacteria | 3239 |
| 117 | Ga0070707_100132667 | 3300005468 | Bacteria | 2423 |
| 118 | Ga0070707_100291758 | 3300005468 | Bacteria | 1585 |
| 119 | Ga0070699_100029109 | 3300005518 | Bacteria | 4763 |
| 120 | Ga0070679_100001195 | 3300005530 | Bacteria | 22809 |
| 121 | Ga0070679_100034303 | 3300005530 | Bacteria | 5029 |
| 122 | Ga0070679_100041528 | 3300005530 | Bacteria | 4577 |
| 123 | Ga0070679_100041890 | 3300005530 | Bacteria | 4559 |
| 124 | Ga0070679_100080762 | 3300005530 | Bacteria | 3241 |
| 125 | Ga0070679_100087266 | 3300005530 | Bacteria | 3107 |
| 126 | Ga0070679_100259093 | 3300005530 | Bacteria | 1694 |
| 127 | Ga0070679_100321496 | 3300005530 | Bacteria | 1497 |
| 128 | Ga0070684_100011755 | 3300005535 | Bacteria | 6983 |
| 129 | Ga0070684_100030837 | 3300005535 | Bacteria | 4560 |
| 130 | Ga0070684_100033388 | 3300005535 | Bacteria | 4393 |
| 131 | Ga0070684_100073917 | 3300005535 | Bacteria | 3004 |
| 132 | Ga0068853_100060825 | 3300005539 | Bacteria | 3264 |
| 133 | Ga0068853_100325541 | 3300005539 | Bacteria | 1425 |
| 134 | Ga0070672_100077333 | 3300005543 | Bacteria | 2661 |
| 135 | Ga0070696_100021029 | 3300005546 | Bacteria | 4422 |
| 136 | Ga0070665_100018720 | 3300005548 | Bacteria | 6943 |
| 137 | Ga0070665_100025227 | 3300005548 | Bacteria | 5989 |
| 138 | Ga0070665_100055026 | 3300005548 | Bacteria | 3991 |
| 139 | Ga0070665_100080487 | 3300005548 | Bacteria | 3263 |
| 140 | Ga0070665_100288661 | 3300005548 | Bacteria | 1643 |
| 141 | Ga0070665_100360853 | 3300005548 | Bacteria | 1459 |
| 142 | Ga0068855_100007019 | 3300005563 | Bacteria | 13668 |
| 143 | Ga0068855_100016173 | 3300005563 | Bacteria | 8970 |
| 144 | Ga0068855_100067798 | 3300005563 | Bacteria | 4155 |
| 145 | Ga0068855_100086230 | 3300005563 | Bacteria | 3631 |
| 146 | Ga0068855_100210331 | 3300005563 | Bacteria | 2186 |
| 147 | Ga0068855_100531508 | 3300005563 | Bacteria | 1275 |
| 148 | Ga0070664_100000477 | 3300005564 | Bacteria | 30247 |
| 149 | Ga0070664_100020672 | 3300005564 | Bacteria | 5422 |
| 150 | Ga0070664_100024731 | 3300005564 | Bacteria | 4971 |
| 151 | Ga0070664_100047232 | 3300005564 | Bacteria | 3637 |
| 152 | Ga0068857_100004249 | 3300005577 | Bacteria | 12073 |
| 153 | Ga0068857_100035167 | 3300005577 | Bacteria | 4435 |
| 154 | Ga0068857_100047477 | 3300005577 | Bacteria | 3813 |
| 155 | Ga0068857_100084204 | 3300005577 | Bacteria | 2841 |
| 156 | Ga0068857_100191711 | 3300005577 | Bacteria | 1862 |
| 157 | Ga0068854_100035067 | 3300005578 | Bacteria | 3510 |
| 158 | Ga0068854_100160848 | 3300005578 | Bacteria | 1739 |
| 159 | Ga0068856_100025937 | 3300005614 | Bacteria | 5715 |
| 160 | Ga0068856_100064087 | 3300005614 | Bacteria | 3631 |
| 161 | Ga0068856_100465197 | 3300005614 | Bacteria | 1285 |
| 162 | Ga0068852_100037601 | 3300005616 | Bacteria | 4060 |
| 163 | Ga0068852_100379177 | 3300005616 | Bacteria | 1387 |
| 164 | Ga0068859_100000421 | 3300005617 | Bacteria | 42369 |
| 165 | Ga0068859_100001222 | 3300005617 | Bacteria | 26208 |
| 166 | Ga0068859_100048247 | 3300005617 | Bacteria | 4278 |
| 167 | Ga0068864_100067294 | 3300005618 | Bacteria | 3111 |
| 168 | Ga0068864_100135764 | 3300005618 | Bacteria | 2215 |
| 169 | Ga0068863_100162433 | 3300005841 | Bacteria | 2140 |
| 170 | Ga0068858_100002701 | 3300005842 | Bacteria | 17882 |
| 171 | Ga0068858_100014485 | 3300005842 | Bacteria | 7430 |
| 172 | Ga0068858_100268723 | 3300005842 | Bacteria | 1622 |
| 173 | Ga0068858_100291860 | 3300005842 | Bacteria | 1555 |
| 174 | Ga0068860_100047094 | 3300005843 | Bacteria | 4110 |
| 175 | Ga0068860_100139263 | 3300005843 | Bacteria | 2331 |
| 176 | Ga0068862_100000433 | 3300005844 | Bacteria | 45464 |
| 177 | Ga0070717_10051681 | 3300006028 | Bacteria | 3384 |
| 178 | Ga0075365_10001634 | 3300006038 | Bacteria | 10333 |
| 179 | Ga0075365_10019376 | 3300006038 | Bacteria | 4199 |
| 180 | Ga0075365_10203020 | 3300006038 | Bacteria | 1389 |
| 181 | Ga0075368_10044867 | 3300006042 | Bacteria | 1745 |
| 182 | Ga0075363_100000517 | 3300006048 | Bacteria | 12410 |
| 183 | Ga0075363_100141446 | 3300006048 | Bacteria | 1355 |
| 184 | Ga0070712_100006701 | 3300006175 | Bacteria | 7161 |
| 185 | Ga0075362_10006339 | 3300006177 | Bacteria | 4406 |
| 186 | Ga0075362_10049176 | 3300006177 | Bacteria | 1883 |
| 187 | Ga0075367_10000817 | 3300006178 | Bacteria | 12303 |
| 188 | Ga0075367_10001171 | 3300006178 | Bacteria | 10976 |
| 189 | Ga0075367_10058543 | 3300006178 | Bacteria | 2293 |
| 190 | Ga0075369_10013607 | 3300006186 | Bacteria | 3235 |
| 191 | Ga0075369_10021040 | 3300006186 | Bacteria | 2676 |
| 192 | Ga0075366_10003864 | 3300006195 | Bacteria | 7981 |
| 193 | Ga0075366_10014213 | 3300006195 | Bacteria | 4545 |
| 194 | Ga0075366_10041272 | 3300006195 | Bacteria | 2732 |
| 195 | Ga0075370_10007174 | 3300006353 | Bacteria | 5661 |
| 196 | Ga0075370_10027065 | 3300006353 | Bacteria | 3180 |
| 197 | Ga0075370_10075881 | 3300006353 | Bacteria | 1927 |
| 198 | Ga0075428_100241623 | 3300006844 | Bacteria | 1948 |
| 199 | Ga0075428_100394322 | 3300006844 | Bacteria | 1484 |
| 200 | Ga0075430_100013283 | 3300006846 | Bacteria | 7020 |
| 201 | Ga0075430_100047465 | 3300006846 | Bacteria | 3627 |
| 202 | Ga0075431_100008297 | 3300006847 | Bacteria | 10388 |
| 203 | Ga0075431_100157557 | 3300006847 | Bacteria | 2336 |
| 204 | Ga0075434_100286532 | 3300006871 | Bacteria | 1667 |
| 205 | Ga0075429_100052920 | 3300006880 | Bacteria | 3532 |
| 206 | Ga0097620_100000421 | 3300006931 | Bacteria | 42369 |
| 207 | Ga0097620_100001222 | 3300006931 | Bacteria | 26208 |
| 208 | Ga0097620_100048249 | 3300006931 | Bacteria | 4278 |
| 209 | Ga0079104_1000015 | 3300006946 | Bacteria | 321803 |
| 210 | Ga0099794_10001158 | 3300007265 | Bacteria | 9054 |
| 211 | Ga0099794_10012174 | 3300007265 | Bacteria | 3702 |
| 212 | Ga0099794_10041302 | 3300007265 | Bacteria | 2196 |
| 213 | Ga0099794_10054135 | 3300007265 | Bacteria | 1936 |
| 214 | Ga0105251_10029058 | 3300009011 | Bacteria | 2788 |
| 215 | Ga0105240_10000019 | 3300009093 | Bacteria | 406211 |
| 216 | Ga0105240_10017115 | 3300009093 | Bacteria | 9787 |
| 217 | Ga0105240_10389256 | 3300009093 | Bacteria | 1573 |
| 218 | Ga0105247_10000248 | 3300009101 | Bacteria | 50108 |
| 219 | Ga0114129_10117336 | 3300009147 | Bacteria | 3667 |
| 220 | Ga0105243_10009086 | 3300009148 | Bacteria | 7594 |
| 221 | Ga0105242_10451008 | 3300009176 | Bacteria | 1212 |
| 222 | Ga0105248_10000043 | 3300009177 | Bacteria | 167170 |
| 223 | Ga0105248_10053339 | 3300009177 | Bacteria | 4537 |
| 224 | Ga0105248_10119445 | 3300009177 | Bacteria | 2973 |
| 225 | Ga0105248_10194685 | 3300009177 | Bacteria | 2284 |
| 226 | Ga0105248_10307717 | 3300009177 | Bacteria | 1784 |
| 227 | Ga0105248_10310526 | 3300009177 | Bacteria | 1776 |
| 228 | Ga0105237_10000734 | 3300009545 | Bacteria | 45223 |
| 229 | Ga0105237_10004792 | 3300009545 | Bacteria | 15543 |
| 230 | Ga0105238_10009734 | 3300009551 | Bacteria | 9625 |
| 231 | Ga0105238_10508408 | 3300009551 | Bacteria | 1206 |
| 232 | Ga0105249_10004888 | 3300009553 | Bacteria | 11562 |
| 233 | Ga0105249_10021341 | 3300009553 | Bacteria | 5798 |
| 234 | Ga0105249_10093171 | 3300009553 | Bacteria | 2821 |
| 235 | Ga0123341_1000014 | 3300009765 | Bacteria | 91980 |
| 236 | Ga0123342_1017304 | 3300009766 | Bacteria | 6025 |
| 237 | Ga0105239_10000574 | 3300010375 | Bacteria | 52563 |
| 238 | Ga0105246_10063299 | 3300011119 | Bacteria | 2579 |
| 239 | Ga0157373_10006166 | 3300013100 | Bacteria | 8958 |
| 240 | Ga0157373_10109717 | 3300013100 | Bacteria | 1940 |
| 241 | Ga0157373_10175927 | 3300013100 | Bacteria | 1506 |
| 242 | Ga0157371_10000002 | 3300013102 | Bacteria | 665040 |
| 243 | Ga0157371_10021219 | 3300013102 | Bacteria | 4771 |
| 244 | Ga0157370_10000131 | 3300013104 | Bacteria | 89805 |
| 245 | Ga0157370_10000246 | 3300013104 | Bacteria | 69424 |
| 246 | Ga0157370_10032044 | 3300013104 | Bacteria | 5136 |
| 247 | Ga0157370_10036865 | 3300013104 | Bacteria | 4743 |
| 248 | Ga0157370_10059372 | 3300013104 | Bacteria | 3634 |
| 249 | Ga0157369_10028777 | 3300013105 | Bacteria | 6145 |
| 250 | Ga0157369_10041336 | 3300013105 | Bacteria | 5032 |
| 251 | Ga0157369_10081484 | 3300013105 | Bacteria | 3463 |
| 252 | Ga0163162_10056641 | 3300013306 | Bacteria | 3947 |
| 253 | Ga0163162_10403786 | 3300013306 | Bacteria | 1499 |
| 254 | Ga0157372_10007498 | 3300013307 | Bacteria | 11602 |
| 255 | Ga0157372_10011309 | 3300013307 | Bacteria | 9494 |
| 256 | Ga0157372_10045183 | 3300013307 | Bacteria | 4884 |
| 257 | Ga0157372_10083943 | 3300013307 | Bacteria | 3608 |
| 258 | Ga0157372_10086408 | 3300013307 | Bacteria | 3558 |
| 259 | Ga0163163_10016430 | 3300014325 | Bacteria | 6879 |
| 260 | Ga0163163_10023142 | 3300014325 | Bacteria | 5894 |
| 261 | Ga0163163_10037715 | 3300014325 | Bacteria | 4703 |
| 262 | Ga0163163_10103767 | 3300014325 | Bacteria | 2868 |
| 263 | Ga0163163_10169354 | 3300014325 | Bacteria | 2230 |
| 264 | Ga0157380_10106070 | 3300014326 | Bacteria | 2350 |
| 265 | Ga0182008_10001809 | 3300014497 | Bacteria | 13962 |
| 266 | Ga0182008_10010338 | 3300014497 | Bacteria | 4996 |
| 267 | Ga0182008_10017006 | 3300014497 | Bacteria | 3773 |
| 268 | Ga0157379_10004041 | 3300014968 | Bacteria | 12507 |
| 269 | Ga0182007_10003916 | 3300015262 | Bacteria | 6902 |
| 270 | Ga0182007_10035634 | 3300015262 | Bacteria | 1677 |
| 271 | Ga0182005_1003936 | 3300015265 | Bacteria | 4902 |
| 272 | Ga0183362_10019 | 3300015683 | Bacteria | 17730 |
| 273 | Ga0163161_10186179 | 3300017792 | Bacteria | 1594 |
| 274 | Ga0206356_11279593 | 3300020070 | Bacteria | 5893 |
| 275 | Ga0206351_10870896 | 3300020077 | Bacteria | 1868 |
| 276 | Ga0206350_10446903 | 3300020080 | Bacteria | 2097 |
| 277 | Ga0206354_10899802 | 3300020081 | Bacteria | 5894 |
| 278 | Ga0206353_11006691 | 3300020082 | Bacteria | 2640 |
| 279 | Ga0206353_11673663 | 3300020082 | Bacteria | 3698 |
| 280 | Ga0206353_12066740 | 3300020082 | Bacteria | 4773 |
| 281 | Ga0154015_1215416 | 3300020610 | Bacteria | 6226 |
| 282 | Ga0213872_10000017 | 3300021361 | Bacteria | 178787 |
| 283 | Ga0213872_10000073 | 3300021361 | Bacteria | 91302 |
| 284 | Ga0213872_10000154 | 3300021361 | Bacteria | 63158 |
| 285 | Ga0213872_10001077 | 3300021361 | Bacteria | 18803 |
| 286 | Ga0213876_10093465 | 3300021384 | Bacteria | 1593 |
| 287 | Ga0209435_100005 | 3300025206 | Bacteria | 573745 |
| 288 | Ga0209760_101522 | 3300025207 | Bacteria | 2405 |
| 289 | Ga0209436_100023 | 3300025208 | Bacteria | 96401 |
| 290 | Ga0209436_100027 | 3300025208 | Bacteria | 87534 |
| 291 | Ga0209563_100014 | 3300025230 | Bacteria | 940582 |
| 292 | Ga0209437_100058 | 3300025233 | Bacteria | 357279 |
| 293 | Ga0209437_100313 | 3300025233 | Bacteria | 64057 |
| 294 | Ga0209437_104360 | 3300025233 | Bacteria | 2502 |
| 295 | Ga0207425_1000058 | 3300025245 | Bacteria | 149214 |
| 296 | Ga0207425_1001260 | 3300025245 | Bacteria | 11068 |
| 297 | Ga0209646_1000011 | 3300025246 | Bacteria | 573745 |
| 298 | Ga0209646_1000097 | 3300025246 | Bacteria | 181432 |
| 299 | Ga0209026_1000008 | 3300025250 | Bacteria | 573745 |
| 300 | Ga0209677_100475 | 3300025253 | Bacteria | 22964 |
| 301 | Ga0209759_1000004 | 3300025256 | Bacteria | 573745 |
| 302 | Ga0209129_1000080 | 3300025258 | Bacteria | 186416 |
| 303 | Ga0209129_1000107 | 3300025258 | Bacteria | 154705 |
| 304 | Ga0209129_1000605 | 3300025258 | Bacteria | 24282 |
| 305 | Ga0209129_1000714 | 3300025258 | Bacteria | 21436 |
| 306 | Ga0209129_1006349 | 3300025258 | Bacteria | 3853 |
| 307 | Ga0209129_1009869 | 3300025258 | Bacteria | 2453 |
| 308 | Ga0209233_1000157 | 3300025261 | Bacteria | 164269 |
| 309 | Ga0209233_1000354 | 3300025261 | Bacteria | 42911 |
| 310 | Ga0209233_1000380 | 3300025261 | Bacteria | 38801 |
| 311 | Ga0209673_1000060 | 3300025273 | Bacteria | 263602 |
| 312 | Ga0209673_1000233 | 3300025273 | Bacteria | 108504 |
| 313 | Ga0209673_1000781 | 3300025273 | Bacteria | 42606 |
| 314 | Ga0209673_1001374 | 3300025273 | Bacteria | 23942 |
| 315 | Ga0209673_1001992 | 3300025273 | Bacteria | 15810 |
| 316 | Ga0209673_1005142 | 3300025273 | Bacteria | 6693 |
| 317 | Ga0209130_1000083 | 3300025284 | Bacteria | 162582 |
| 318 | Ga0209130_1000173 | 3300025284 | Bacteria | 92248 |
| 319 | Ga0209130_1003722 | 3300025284 | Bacteria | 6248 |
| 320 | Ga0209675_1000981 | 3300025291 | Bacteria | 18059 |
| 321 | Ga0209676_1010510 | 3300025292 | Bacteria | 3843 |
| 322 | Ga0209025_1000083 | 3300025294 | Bacteria | 265556 |
| 323 | Ga0209025_1000255 | 3300025294 | Bacteria | 125764 |
| 324 | Ga0209025_1000350 | 3300025294 | Bacteria | 99649 |
| 325 | Ga0209025_1000359 | 3300025294 | Bacteria | 97475 |
| 326 | Ga0209025_1000749 | 3300025294 | Bacteria | 54530 |
| 327 | Ga0209025_1004200 | 3300025294 | Bacteria | 12708 |
| 328 | Ga0209025_1009200 | 3300025294 | Bacteria | 6936 |
| 329 | Ga0209025_1010819 | 3300025294 | Bacteria | 6121 |
| 330 | Ga0209025_1041452 | 3300025294 | Bacteria | 1972 |
| 331 | Ga0209564_1000116 | 3300025295 | Bacteria | 207889 |
| 332 | Ga0209564_1000125 | 3300025295 | Bacteria | 201709 |
| 333 | Ga0209564_1001273 | 3300025295 | Bacteria | 27736 |
| 334 | Ga0209564_1011141 | 3300025295 | Bacteria | 4059 |
| 335 | Ga0209758_1000090 | 3300025297 | Bacteria | 246564 |
| 336 | Ga0209758_1000839 | 3300025297 | Bacteria | 42882 |
| 337 | Ga0209758_1000928 | 3300025297 | Bacteria | 39646 |
| 338 | Ga0209758_1001034 | 3300025297 | Bacteria | 36440 |
| 339 | Ga0209758_1001969 | 3300025297 | Bacteria | 22184 |
| 340 | Ga0209758_1003215 | 3300025297 | Bacteria | 15224 |
| 341 | Ga0209758_1015048 | 3300025297 | Bacteria | 4043 |
| 342 | Ga0209758_1015938 | 3300025297 | Bacteria | 3853 |
| 343 | Ga0209758_1037329 | 3300025297 | Bacteria | 1880 |
| 344 | Ga0209050_1003361 | 3300025298 | Bacteria | 11915 |
| 345 | Ga0209050_1005007 | 3300025298 | Bacteria | 8609 |
| 346 | Ga0209050_1010907 | 3300025298 | Bacteria | 4398 |
| 347 | Ga0209256_1000302 | 3300025299 | Bacteria | 86634 |
| 348 | Ga0209256_1001684 | 3300025299 | Bacteria | 21424 |
| 349 | Ga0209256_1001904 | 3300025299 | Bacteria | 19087 |
| 350 | Ga0209256_1006695 | 3300025299 | Bacteria | 5984 |
| 351 | Ga0209256_1028614 | 3300025299 | Bacteria | 1569 |
| 352 | Ga0207426_1000047 | 3300025302 | Bacteria | 417011 |
| 353 | Ga0207426_1000173 | 3300025302 | Bacteria | 162697 |
| 354 | Ga0207426_1000276 | 3300025302 | Bacteria | 106148 |
| 355 | Ga0207426_1001540 | 3300025302 | Bacteria | 18739 |
| 356 | Ga0209051_1000025 | 3300025303 | Bacteria | 415397 |
| 357 | Ga0209051_1000217 | 3300025303 | Bacteria | 97218 |
| 358 | Ga0209051_1001815 | 3300025303 | Bacteria | 16899 |
| 359 | Ga0209051_1003071 | 3300025303 | Bacteria | 11278 |
| 360 | Ga0209051_1017149 | 3300025303 | Bacteria | 3246 |
| 361 | Ga0209051_1028197 | 3300025303 | Bacteria | 2222 |
| 362 | Ga0209051_1048586 | 3300025303 | Bacteria | 1437 |
| 363 | Ga0209257_1000039 | 3300025304 | Bacteria | 591694 |
| 364 | Ga0209257_1002359 | 3300025304 | Bacteria | 18962 |
| 365 | Ga0209257_1003258 | 3300025304 | Bacteria | 14215 |
| 366 | Ga0209257_1003715 | 3300025304 | Bacteria | 12680 |
| 367 | Ga0207710_10000333 | 3300025900 | Bacteria | 35381 |
| 368 | Ga0207688_10185509 | 3300025901 | Bacteria | 1242 |
| 369 | Ga0207647_10000677 | 3300025904 | Bacteria | 26730 |
| 370 | Ga0207647_10001610 | 3300025904 | Bacteria | 17365 |
| 371 | Ga0207647_10023607 | 3300025904 | Bacteria | 4066 |
| 372 | Ga0207699_10019657 | 3300025906 | Bacteria | 3607 |
| 373 | Ga0207699_10097873 | 3300025906 | Bacteria | 1855 |
| 374 | Ga0207705_10001829 | 3300025909 | Bacteria | 16749 |
| 375 | Ga0207705_10002514 | 3300025909 | Bacteria | 14134 |
| 376 | Ga0207705_10004985 | 3300025909 | Bacteria | 9962 |
| 377 | Ga0207705_10016011 | 3300025909 | Bacteria | 5381 |
| 378 | Ga0207705_10033838 | 3300025909 | Bacteria | 3652 |
| 379 | Ga0207705_10066289 | 3300025909 | Bacteria | 2611 |
| 380 | Ga0207707_10001419 | 3300025912 | Bacteria | 22162 |
| 381 | Ga0207707_10003100 | 3300025912 | Bacteria | 14752 |
| 382 | Ga0207707_10014148 | 3300025912 | Bacteria | 6952 |
| 383 | Ga0207707_10032224 | 3300025912 | Bacteria | 4587 |
| 384 | Ga0207707_10082705 | 3300025912 | Bacteria | 2803 |
| 385 | Ga0207707_10136521 | 3300025912 | Bacteria | 2144 |
| 386 | Ga0207707_10259308 | 3300025912 | Bacteria | 1509 |
| 387 | Ga0207695_10000049 | 3300025913 | Bacteria | 406233 |
| 388 | Ga0207695_10004738 | 3300025913 | Bacteria | 18411 |
| 389 | Ga0207695_10016841 | 3300025913 | Bacteria | 8533 |
| 390 | Ga0207695_10020794 | 3300025913 | Bacteria | 7507 |
| 391 | Ga0207695_10089322 | 3300025913 | Bacteria | 3099 |
| 392 | Ga0207695_10118060 | 3300025913 | Bacteria | 2624 |
| 393 | Ga0207671_10000423 | 3300025914 | Bacteria | 58526 |
| 394 | Ga0207671_10011955 | 3300025914 | Bacteria | 7017 |
| 395 | Ga0207671_10171881 | 3300025914 | Bacteria | 1683 |
| 396 | Ga0207693_10020804 | 3300025915 | Bacteria | 5218 |
| 397 | Ga0207660_10001517 | 3300025917 | Bacteria | 15597 |
| 398 | Ga0207660_10007012 | 3300025917 | Bacteria | 7298 |
| 399 | Ga0207660_10015836 | 3300025917 | Bacteria | 4984 |
| 400 | Ga0207660_10018280 | 3300025917 | Bacteria | 4669 |
| 401 | Ga0207660_10043401 | 3300025917 | Bacteria | 3160 |
| 402 | Ga0207660_10204946 | 3300025917 | Bacteria | 1542 |
| 403 | Ga0207660_10205888 | 3300025917 | Bacteria | 1538 |
| 404 | Ga0207657_10008479 | 3300025919 | Bacteria | 10427 |
| 405 | Ga0207657_10008724 | 3300025919 | Bacteria | 10261 |
| 406 | Ga0207657_10018265 | 3300025919 | Bacteria | 6705 |
| 407 | Ga0207657_10024698 | 3300025919 | Bacteria | 5557 |
| 408 | Ga0207657_10094172 | 3300025919 | Bacteria | 2494 |
| 409 | Ga0207649_10002686 | 3300025920 | Bacteria | 9858 |
| 410 | Ga0207649_10009032 | 3300025920 | Bacteria | 5444 |
| 411 | Ga0207649_10010440 | 3300025920 | Bacteria | 5102 |
| 412 | Ga0207649_10022348 | 3300025920 | Bacteria | 3653 |
| 413 | Ga0207649_10029373 | 3300025920 | Bacteria | 3246 |
| 414 | Ga0207649_10143812 | 3300025920 | Bacteria | 1635 |
| 415 | Ga0207652_10000022 | 3300025921 | Bacteria | 158642 |
| 416 | Ga0207652_10003362 | 3300025921 | Bacteria | 13211 |
| 417 | Ga0207652_10005539 | 3300025921 | Bacteria | 10237 |
| 418 | Ga0207652_10023709 | 3300025921 | Bacteria | 5086 |
| 419 | Ga0207652_10059508 | 3300025921 | Bacteria | 3293 |
| 420 | Ga0207652_10325159 | 3300025921 | Bacteria | 1388 |
| 421 | Ga0207652_10391359 | 3300025921 | Bacteria | 1254 |
| 422 | Ga0207681_10001417 | 3300025923 | Bacteria | 15465 |
| 423 | Ga0207681_10270633 | 3300025923 | Bacteria | 1333 |
| 424 | Ga0207694_10021429 | 3300025924 | Bacteria | 4897 |
| 425 | Ga0207694_10097465 | 3300025924 | Bacteria | 2326 |
| 426 | Ga0207700_10001779 | 3300025928 | Bacteria | 12230 |
| 427 | Ga0207700_10005150 | 3300025928 | Bacteria | 7778 |
| 428 | Ga0207664_10043228 | 3300025929 | Bacteria | 3523 |
| 429 | Ga0207664_10145881 | 3300025929 | Bacteria | 2007 |
| 430 | Ga0207644_10003506 | 3300025931 | Bacteria | 10154 |
| 431 | Ga0207644_10013039 | 3300025931 | Bacteria | 5532 |
| 432 | Ga0207690_10000913 | 3300025932 | Bacteria | 18868 |
| 433 | Ga0207690_10025978 | 3300025932 | Bacteria | 3685 |
| 434 | Ga0207690_10147463 | 3300025932 | Bacteria | 1741 |
| 435 | Ga0207690_10195532 | 3300025932 | Bacteria | 1532 |
| 436 | Ga0207706_10023167 | 3300025933 | Bacteria | 5578 |
| 437 | Ga0207704_10151506 | 3300025938 | Bacteria | 1637 |
| 438 | Ga0207711_10000049 | 3300025941 | Bacteria | 147090 |
| 439 | Ga0207711_10123572 | 3300025941 | Bacteria | 2313 |
| 440 | Ga0207661_10004890 | 3300025944 | Bacteria | 9390 |
| 441 | Ga0207661_10224154 | 3300025944 | Bacteria | 1662 |
| 442 | Ga0207679_10033427 | 3300025945 | Bacteria | 3618 |
| 443 | Ga0207679_10036372 | 3300025945 | Bacteria | 3492 |
| 444 | Ga0207679_10057463 | 3300025945 | Bacteria | 2878 |
| 445 | Ga0207679_10062086 | 3300025945 | Bacteria | 2783 |
| 446 | Ga0207679_10177404 | 3300025945 | Bacteria | 1759 |
| 447 | Ga0207667_10008048 | 3300025949 | Bacteria | 12572 |
| 448 | Ga0207667_10008565 | 3300025949 | Bacteria | 12139 |
| 449 | Ga0207667_10010015 | 3300025949 | Bacteria | 11118 |
| 450 | Ga0207667_10010275 | 3300025949 | Bacteria | 10956 |
| 451 | Ga0207667_10024202 | 3300025949 | Bacteria | 6672 |
| 452 | Ga0207667_10044605 | 3300025949 | Bacteria | 4697 |
| 453 | Ga0207667_10159902 | 3300025949 | Bacteria | 2317 |
| 454 | Ga0207651_10100285 | 3300025960 | Bacteria | 2147 |
| 455 | Ga0207712_10010624 | 3300025961 | Bacteria | 5845 |
| 456 | Ga0207712_10096928 | 3300025961 | Bacteria | 2184 |
| 457 | Ga0207640_10002697 | 3300025981 | Bacteria | 9505 |
| 458 | Ga0207640_10007005 | 3300025981 | Bacteria | 6205 |
| 459 | Ga0207640_10049946 | 3300025981 | Bacteria | 2711 |
| 460 | Ga0207640_10174289 | 3300025981 | Bacteria | 1606 |
| 461 | Ga0207658_10002111 | 3300025986 | Bacteria | 14799 |
| 462 | Ga0207658_10191576 | 3300025986 | Bacteria | 1700 |
| 463 | Ga0207677_10164895 | 3300026023 | Bacteria | 1726 |
| 464 | Ga0207703_10004984 | 3300026035 | Bacteria | 10776 |
| 465 | Ga0207703_10010204 | 3300026035 | Bacteria | 7362 |
| 466 | Ga0207639_10005288 | 3300026041 | Bacteria | 8715 |
| 467 | Ga0207639_10009223 | 3300026041 | Bacteria | 6802 |
| 468 | Ga0207639_10018414 | 3300026041 | Bacteria | 4961 |
| 469 | Ga0207639_10028040 | 3300026041 | Bacteria | 4107 |
| 470 | Ga0207639_10100476 | 3300026041 | Bacteria | 2337 |
| 471 | Ga0207639_10207337 | 3300026041 | Bacteria | 1685 |
| 472 | Ga0207678_10004139 | 3300026067 | Bacteria | 13034 |
| 473 | Ga0207678_10005965 | 3300026067 | Bacteria | 10848 |
| 474 | Ga0207678_10016535 | 3300026067 | Bacteria | 6479 |
| 475 | Ga0207678_10024028 | 3300026067 | Bacteria | 5326 |
| 476 | Ga0207708_10090026 | 3300026075 | Bacteria | 2365 |
| 477 | Ga0207702_10003761 | 3300026078 | Bacteria | 13704 |
| 478 | Ga0207702_10021577 | 3300026078 | Bacteria | 5332 |
| 479 | Ga0207641_10176543 | 3300026088 | Bacteria | 1953 |
| 480 | Ga0207641_10344561 | 3300026088 | Bacteria | 1419 |
| 481 | Ga0207676_10092593 | 3300026095 | Bacteria | 2486 |
| 482 | Ga0207674_10000379 | 3300026116 | Bacteria | 57925 |
| 483 | Ga0207674_10001397 | 3300026116 | Bacteria | 31130 |
| 484 | Ga0207674_10016247 | 3300026116 | Bacteria | 8152 |
| 485 | Ga0207674_10024476 | 3300026116 | Bacteria | 6452 |
| 486 | Ga0207674_10099047 | 3300026116 | Bacteria | 2898 |
| 487 | Ga0207674_10209486 | 3300026116 | Bacteria | 1898 |
| 488 | Ga0207683_10014618 | 3300026121 | Bacteria | 6685 |
| 489 | Ga0207683_10021474 | 3300026121 | Bacteria | 5528 |
| 490 | Ga0207683_10360889 | 3300026121 | Bacteria | 1334 |
| 491 | Ga0207698_10001610 | 3300026142 | Bacteria | 13138 |
| 492 | Ga0207698_10005754 | 3300026142 | Bacteria | 7692 |
| 493 | Ga0207698_10012640 | 3300026142 | Bacteria | 5533 |
| 494 | Ga0207698_10098851 | 3300026142 | Bacteria | 2412 |
| 495 | Ga0207698_10212521 | 3300026142 | Bacteria | 1741 |
| 496 | Ga0209281_1000068 | 3300027111 | Bacteria | 280238 |
| 497 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 498 | Ga0209371_1001970 | 3300027312 | Bacteria | 12422 |
| 499 | Ga0209371_1005272 | 3300027312 | Bacteria | 5209 |
| 500 | Ga0209588_1002399 | 3300027671 | Bacteria | 5073 |
| 501 | Ga0209588_1020191 | 3300027671 | Bacteria | 2086 |
| 502 | Ga0209813_10002642 | 3300027866 | Bacteria | 4120 |
| 503 | Ga0268266_10000103 | 3300028379 | Bacteria | 179736 |
| 504 | Ga0268266_10018839 | 3300028379 | Bacteria | 5883 |
| 505 | Ga0268266_10059413 | 3300028379 | Bacteria | 3294 |
| 506 | Ga0268266_10068412 | 3300028379 | Bacteria | 3075 |
| 507 | Ga0268266_10092961 | 3300028379 | Bacteria | 2647 |
| 508 | Ga0268266_10215456 | 3300028379 | Bacteria | 1763 |
| 509 | Ga0268265_10000422 | 3300028380 | Bacteria | 45478 |
| 510 | Ga0268264_10034697 | 3300028381 | Bacteria | 4151 |
| 511 | Ga0265326_10013540 | 3300028558 | Bacteria | 2384 |
| 512 | Ga0265319_1000349 | 3300028563 | Bacteria | 33705 |
| 513 | Ga0265319_1007401 | 3300028563 | Bacteria | 4943 |
| 514 | Ga0265319_1012116 | 3300028563 | Bacteria | 3497 |
| 515 | Ga0265334_10003454 | 3300028573 | Bacteria | 7185 |
| 516 | Ga0265318_10001215 | 3300028577 | Bacteria | 15658 |
| 517 | Ga0265318_10002906 | 3300028577 | Bacteria | 8905 |
| 518 | Ga0307515_10000386 | 3300028794 | Bacteria | 107196 |
| 519 | Ga0307515_10000651 | 3300028794 | Bacteria | 80257 |
| 520 | Ga0307515_10001447 | 3300028794 | Bacteria | 53309 |
| 521 | Ga0307515_10086697 | 3300028794 | Bacteria | 3987 |
| 522 | Ga0265338_10005969 | 3300028800 | Bacteria | 15663 |
| 523 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 524 | Ga0268256_1001045 | 3300030500 | Bacteria | 18558 |
| 525 | Ga0268256_1002352 | 3300030500 | Bacteria | 9744 |
| 526 | Ga0307511_10000077 | 3300030521 | Bacteria | 82357 |
| 527 | Ga0307511_10000851 | 3300030521 | Bacteria | 32500 |
| 528 | Ga0265332_10001462 | 3300031238 | Bacteria | 13214 |
| 529 | Ga0265328_10091898 | 3300031239 | Bacteria | 1121 |
| 530 | Ga0265320_10002610 | 3300031240 | Bacteria | 12509 |
| 531 | Ga0265320_10008784 | 3300031240 | Bacteria | 6150 |
| 532 | Ga0265325_10005974 | 3300031241 | Bacteria | 7453 |
| 533 | Ga0265329_10001757 | 3300031242 | Bacteria | 10315 |
| 534 | Ga0265339_10000691 | 3300031249 | Bacteria | 26070 |
| 535 | Ga0265339_10013975 | 3300031249 | Bacteria | 4855 |
| 536 | Ga0265331_10007443 | 3300031250 | Bacteria | 6332 |
| 537 | Ga0265331_10102430 | 3300031250 | Bacteria | 1317 |
| 538 | Ga0265327_10000083 | 3300031251 | Bacteria | 204923 |
| 539 | Ga0265327_10023427 | 3300031251 | Bacteria | 3656 |
| 540 | Ga0265327_10111898 | 3300031251 | Bacteria | 1303 |
| 541 | Ga0265316_10001019 | 3300031344 | Bacteria | 30433 |
| 542 | Ga0265316_10009140 | 3300031344 | Bacteria | 9129 |
| 543 | Ga0307513_10022270 | 3300031456 | Bacteria | 7454 |
| 544 | Ga0307513_10029600 | 3300031456 | Bacteria | 6238 |
| 545 | Ga0307408_100355402 | 3300031548 | Bacteria | 1245 |
| 546 | Ga0265313_10006665 | 3300031595 | Bacteria | 8097 |
| 547 | Ga0307514_10001548 | 3300031649 | Bacteria | 27327 |
| 548 | Ga0307514_10089318 | 3300031649 | Bacteria | 2251 |
| 549 | Ga0265314_10000003 | 3300031711 | Bacteria | 1653386 |
| 550 | Ga0265314_10006556 | 3300031711 | Bacteria | 10266 |
| 551 | Ga0265342_10002161 | 3300031712 | Bacteria | 17328 |
| 552 | Ga0307405_10005651 | 3300031731 | Bacteria | 6059 |
| 553 | Ga0307413_10008271 | 3300031824 | Bacteria | 4899 |
| 554 | Ga0307413_10037912 | 3300031824 | Bacteria | 2788 |
| 555 | Ga0307413_10046628 | 3300031824 | Bacteria | 2579 |
| 556 | Ga0307410_10294034 | 3300031852 | Bacteria | 1279 |
| 557 | Ga0307406_10013167 | 3300031901 | Bacteria | 4733 |
| 558 | Ga0307406_10022197 | 3300031901 | Bacteria | 3763 |
| 559 | Ga0307406_10226006 | 3300031901 | Bacteria | 1394 |
| 560 | Ga0307407_10014441 | 3300031903 | Bacteria | 3868 |
| 561 | Ga0307412_10001366 | 3300031911 | Bacteria | 13566 |
| 562 | Ga0307412_10090045 | 3300031911 | Bacteria | 2144 |
| 563 | Ga0307409_100183640 | 3300031995 | Bacteria | 1854 |
| 564 | Ga0307409_100219575 | 3300031995 | Bacteria | 1715 |
| 565 | Ga0307416_100027749 | 3300032002 | Bacteria | 4198 |
| 566 | Ga0307416_100122995 | 3300032002 | Bacteria | 2318 |
| 567 | Ga0307416_100273224 | 3300032002 | Bacteria | 1661 |
| 568 | Ga0307414_10155932 | 3300032004 | Bacteria | 1807 |
| 569 | Ga0307414_10222628 | 3300032004 | Bacteria | 1550 |
| 570 | Ga0307414_10284064 | 3300032004 | Bacteria | 1392 |
| 571 | Ga0307411_10015733 | 3300032005 | Bacteria | 4260 |
| 572 | Ga0307411_10269961 | 3300032005 | Bacteria | 1348 |
| 573 | Ga0307411_10360205 | 3300032005 | Bacteria | 1189 |
| 574 | Ga0307507_10023456 | 3300033179 | Bacteria | 6773 |
| 575 | Ga0307507_10121353 | 3300033179 | Bacteria | 2089 |
| 576 | Ga0373940_0017126 | 3300035088 | Bacteria | 1804 |
| 577 | Ga0373937_0381280 | 3300036401 | Bacteria | 1337 |
| 578 | Ga0316582_0165885 | 3300036647 | Bacteria | 1497 |
| 579 | Ga0395899_0000644 | 3300037312 | Bacteria | 35945 |
| 580 | Ga0395899_0000662 | 3300037312 | Bacteria | 35000 |
| 581 | Ga0395899_0023290 | 3300037312 | Bacteria | 4693 |
| 582 | Ga0395899_0025702 | 3300037312 | Bacteria | 4445 |
| 583 | Ga0395899_0239167 | 3300037312 | Bacteria | 1250 |
| 584 | Ga0395900_0074477 | 3300037418 | Bacteria | 3490 |
| 585 | Ga0395900_0075570 | 3300037418 | Bacteria | 3463 |
| 586 | Ga0395900_0118560 | 3300037418 | Bacteria | 2716 |
| 587 | Ga0395900_0145690 | 3300037418 | Bacteria | 2422 |
| 588 | Ga0395900_0154710 | 3300037418 | Bacteria | 2342 |
| 589 | Ga0395900_0158821 | 3300037418 | Bacteria | 2307 |
| 590 | Ga0395900_0258829 | 3300037418 | Bacteria | 1739 |
| 591 | Ga0395900_0394358 | 3300037418 | Bacteria | 1350 |
| 592 | Ga0395898_0020217 | 3300037466 | Bacteria | 6763 |
| 593 | Ga0395898_0022748 | 3300037466 | Bacteria | 6344 |
| 594 | Ga0395898_0025292 | 3300037466 | Bacteria | 5984 |
| 595 | Ga0395898_0030101 | 3300037466 | Bacteria | 5434 |
| 596 | Ga0395905_0000126 | 3300037471 | Bacteria | 126035 |
| 597 | Ga0395905_0000741 | 3300037471 | Bacteria | 42960 |
| 598 | Ga0395905_0001192 | 3300037471 | Bacteria | 32515 |
| 599 | Ga0395905_0005488 | 3300037471 | Bacteria | 12939 |
| 600 | Ga0395905_0023045 | 3300037471 | Bacteria | 5886 |
| 601 | Ga0395905_0078544 | 3300037471 | Bacteria | 3093 |
| 602 | Ga0395905_0086219 | 3300037471 | Bacteria | 2943 |
| 603 | Ga0395905_0122288 | 3300037471 | Bacteria | 2447 |
| 604 | Ga0395905_0248862 | 3300037471 | Bacteria | 1660 |
| 605 | Ga0395905_0420516 | 3300037471 | Bacteria | 1232 |
| 606 | Ga0395901_0065755 | 3300038443 | Bacteria | 3776 |
| 607 | Ga0395901_0097650 | 3300038443 | Bacteria | 3080 |
| 608 | Ga0395901_0442911 | 3300038443 | Bacteria | 1329 |
| 609 | Ga0395901_0442946 | 3300038443 | Bacteria | 1329 |
| 610 | Ga0436365_0471224 | 3300039437 | Bacteria | 4505 |
| 611 | Ga0436361_0004189 | 3300039447 | Bacteria | 6648 |
| 612 | Ga0436361_0197147 | 3300039447 | Bacteria | 66813 |
| 613 | Ga0436361_0472104 | 3300039447 | Bacteria | 4396 |
| 614 | Ga0436361_0530495 | 3300039447 | Bacteria | 101563 |
| 615 | Ga0436361_0736070 | 3300039447 | Bacteria | 84726 |
| 616 | Ga0436361_1101954 | 3300039447 | Bacteria | 36014 |
| 617 | Ga0439466_0011166 | 3300041411 | Bacteria | 3325 |
| 618 | Ga0439465_0006254 | 3300041413 | Bacteria | 3783 |
| 619 | Ga0439465_0010269 | 3300041413 | Bacteria | 2944 |
| 620 | Ga0439465_0010635 | 3300041413 | Bacteria | 2887 |
| 621 | Ga0439465_0029736 | 3300041413 | Bacteria | 1736 |
| 622 | Ga0439465_0039107 | 3300041413 | Bacteria | 1530 |
| 623 | Ga0451835_0532047 | 3300041492 | Bacteria | 1180 |
| 624 | Ga0451839_0268071 | 3300041496 | Bacteria | 3058 |
| 625 | Ga0451840_01892 | 3300041497 | Bacteria | 1188 |
| 626 | Ga0451846_65077 | 3300041502 | Bacteria | 1987 |
| 627 | Ga0451847_0036653 | 3300041503 | Bacteria | 1733 |
| 628 | Ga0451849_0249873 | 3300041505 | Bacteria | 2624 |
| 629 | Ga0451854_08073 | 3300041510 | Bacteria | 1548 |
| 630 | Ga0452268_51778 | 3300041907 | Bacteria | 1256 |
| 631 | Ga0439445_0012513 | 3300042004 | Bacteria | 2041 |
| 632 | Ga0439449_0005817 | 3300042007 | Bacteria | 4716 |
| 633 | Ga0439449_0025227 | 3300042007 | Bacteria | 2222 |
| 634 | Ga0439449_0038752 | 3300042007 | Bacteria | 1772 |
| 635 | Ga0439452_005324 | 3300042010 | Bacteria | 4151 |
| 636 | Ga0439457_008408 | 3300042014 | Bacteria | 2436 |
| 637 | Ga0439462_0039767 | 3300042015 | Bacteria | 1254 |
| 638 | Ga0450911_000141 | 3300042115 | Bacteria | 29229 |
| 639 | Ga0466969_0000373 | 3300044656 | Bacteria | 24574 |
| 640 | Ga0466982_0210788 | 3300044672 | Bacteria | 1159 |
| 641 | Ga0453683_0000198 | 3300044673 | Bacteria | 81903 |
| 642 | Ga0466966_0005580 | 3300044684 | Bacteria | 8274 |
| 643 | Ga0466961_0044120 | 3300044693 | Bacteria | 2853 |
| 644 | Ga0466960_0070385 | 3300044901 | Bacteria | 1740 |
| 645 | Ga0466959_0030345 | 3300045049 | Bacteria | 4003 |
| 646 | Ga0466959_0089428 | 3300045049 | Bacteria | 2212 |
| 647 | Ga0451576_0192238 | 3300045051 | Bacteria | 2132 |
| 648 | Ga0466967_0196632 | 3300045976 | Bacteria | 1908 |
| 649 | Ga0466967_0254682 | 3300045976 | Bacteria | 1678 |
| 650 | Ga0495617_000022 | 3300046452 | Bacteria | 185975 |
| 651 | Ga0495617_004123 | 3300046452 | Bacteria | 5325 |
| 652 | Ga0495617_026952 | 3300046452 | Bacteria | 1935 |
| 653 | Ga0495627_000222 | 3300046453 | Bacteria | 61109 |
| 654 | Ga0495592_0300675 | 3300046454 | Bacteria | 1043 |
| 655 | Ga0495603_0047986 | 3300046455 | Bacteria | 2542 |
| 656 | Ga0495590_0045296 | 3300046457 | Bacteria | 1534 |
| 657 | Ga0495629_0041068 | 3300046459 | Bacteria | 3255 |
| 658 | Ga0495638_0000309 | 3300046460 | Bacteria | 62979 |
| 659 | Ga0495638_0027113 | 3300046460 | Bacteria | 3710 |
| 660 | Ga0495638_0054620 | 3300046460 | Bacteria | 2482 |
| 661 | Ga0495651_0038320 | 3300046462 | Bacteria | 3733 |
| 662 | Ga0495651_0140125 | 3300046462 | Bacteria | 1755 |
| 663 | Ga0495605_0000064 | 3300046474 | Bacteria | 140769 |
| 664 | Ga0495605_0008993 | 3300046474 | Bacteria | 5623 |
| 665 | Ga0495605_0030832 | 3300046474 | Bacteria | 2744 |
| 666 | Ga0495639_0006269 | 3300046475 | Bacteria | 5107 |
| 667 | Ga0495585_0019126 | 3300046492 | Bacteria | 3952 |
| 668 | Ga0495585_0042031 | 3300046492 | Bacteria | 2562 |
| 669 | Ga0495585_0044724 | 3300046492 | Bacteria | 2473 |
| 670 | Ga0495596_0001018 | 3300046500 | Bacteria | 16652 |
| 671 | Ga0495596_0009401 | 3300046500 | Bacteria | 4300 |
| 672 | Ga0495596_0047033 | 3300046500 | Bacteria | 1693 |
| 673 | Ga0495607_0003479 | 3300046501 | Bacteria | 12055 |
| 674 | Ga0495607_0022992 | 3300046501 | Bacteria | 3907 |
| 675 | Ga0495607_0031078 | 3300046501 | Bacteria | 3272 |
| 676 | Ga0495607_0036604 | 3300046501 | Bacteria | 2955 |
| 677 | Ga0495583_0000678 | 3300046506 | Bacteria | 44207 |
| 678 | Ga0495583_0003999 | 3300046506 | Bacteria | 10872 |
| 679 | Ga0495583_0027690 | 3300046506 | Bacteria | 2794 |
| 680 | Ga0495606_0000757 | 3300046507 | Bacteria | 49718 |
| 681 | Ga0495606_0003931 | 3300046507 | Bacteria | 15287 |
| 682 | Ga0495606_0040817 | 3300046507 | Bacteria | 3116 |
| 683 | Ga0495606_0107991 | 3300046507 | Bacteria | 1683 |
| 684 | Ga0495606_0124361 | 3300046507 | Bacteria | 1540 |
| 685 | Ga0495606_0136980 | 3300046507 | Bacteria | 1449 |
| 686 | Ga0495606_0180825 | 3300046507 | Bacteria | 1216 |
| 687 | Ga0495610_0000961 | 3300046512 | Bacteria | 26635 |
| 688 | Ga0495610_0003067 | 3300046512 | Bacteria | 13344 |
| 689 | Ga0495610_0011758 | 3300046512 | Bacteria | 5317 |
| 690 | Ga0495610_0033175 | 3300046512 | Bacteria | 2672 |
| 691 | Ga0495610_0091024 | 3300046512 | Bacteria | 1383 |
| 692 | Ga0495616_0000431 | 3300046513 | Bacteria | 32080 |
| 693 | Ga0495616_0005704 | 3300046513 | Bacteria | 7627 |
| 694 | Ga0495616_0082792 | 3300046513 | Bacteria | 1532 |
| 695 | Ga0495631_0000183 | 3300046518 | Bacteria | 42831 |
| 696 | Ga0495631_0051645 | 3300046518 | Bacteria | 1796 |
| 697 | Ga0495631_0059923 | 3300046518 | Bacteria | 1652 |
| 698 | Ga0495632_0000026 | 3300046519 | Bacteria | 176367 |
| 699 | Ga0495632_0000087 | 3300046519 | Bacteria | 94939 |
| 700 | Ga0495632_0008503 | 3300046519 | Bacteria | 6290 |
| 701 | Ga0495632_0041601 | 3300046519 | Bacteria | 2308 |
| 702 | Ga0495632_0071098 | 3300046519 | Bacteria | 1672 |
| 703 | Ga0495637_0008603 | 3300046520 | Bacteria | 5009 |
| 704 | Ga0495643_0000119 | 3300046522 | Bacteria | 127740 |
| 705 | Ga0495643_0000362 | 3300046522 | Bacteria | 61748 |
| 706 | Ga0495643_0025280 | 3300046522 | Bacteria | 3361 |
| 707 | Ga0495643_0074717 | 3300046522 | Bacteria | 1774 |
| 708 | Ga0495643_0082820 | 3300046522 | Bacteria | 1666 |
| 709 | Ga0495643_0140273 | 3300046522 | Bacteria | 1206 |
| 710 | Ga0495644_0033365 | 3300046523 | Bacteria | 1945 |
| 711 | Ga0495648_0000379 | 3300046524 | Bacteria | 48793 |
| 712 | Ga0495648_0058279 | 3300046524 | Bacteria | 2310 |
| 713 | Ga0495648_0121545 | 3300046524 | Bacteria | 1403 |
| 714 | Ga0495663_0030447 | 3300046525 | Bacteria | 1599 |
| 715 | Ga0495642_0000272 | 3300046528 | Bacteria | 29189 |
| 716 | Ga0495642_0000329 | 3300046528 | Bacteria | 25780 |
| 717 | Ga0495642_0006986 | 3300046528 | Bacteria | 4330 |
| 718 | Ga0495654_0000635 | 3300046530 | Bacteria | 27690 |
| 719 | Ga0495654_0000834 | 3300046530 | Bacteria | 23400 |
| 720 | Ga0495654_0001196 | 3300046530 | Bacteria | 18462 |
| 721 | Ga0495654_0008383 | 3300046530 | Bacteria | 5714 |
| 722 | Ga0495654_0091582 | 3300046530 | Bacteria | 1410 |
| 723 | Ga0495654_0095774 | 3300046530 | Bacteria | 1372 |
| 724 | Ga0495609_0005705 | 3300046538 | Bacteria | 6481 |
| 725 | Ga0495609_0008483 | 3300046538 | Bacteria | 5031 |
| 726 | Ga0495609_0065444 | 3300046538 | Bacteria | 1602 |
| 727 | Ga0495621_0043681 | 3300046539 | Bacteria | 1581 |
| 728 | Ga0495597_0000810 | 3300046542 | Bacteria | 24703 |
| 729 | Ga0495597_0009034 | 3300046542 | Bacteria | 4954 |
| 730 | Ga0495633_0045394 | 3300046558 | Bacteria | 2080 |
| 731 | Ga0495633_0048332 | 3300046558 | Bacteria | 2009 |
| 732 | Ga0495656_0079511 | 3300046615 | Bacteria | 1476 |
| 733 | Ga0495656_0130193 | 3300046615 | Bacteria | 1197 |
| 734 | Ga0495668_0000653 | 3300046616 | Bacteria | 41611 |
| 735 | Ga0495668_0004368 | 3300046616 | Bacteria | 10085 |
| 736 | Ga0495668_0024888 | 3300046616 | Bacteria | 3403 |
| 737 | Ga0495668_0038038 | 3300046616 | Bacteria | 2690 |
| 738 | Ga0495611_0005329 | 3300046648 | Bacteria | 5503 |
| 739 | Ga0495611_0012246 | 3300046648 | Bacteria | 3646 |
| 740 | Ga0495611_0022356 | 3300046648 | Bacteria | 2736 |
| 741 | Ga0495611_0063739 | 3300046648 | Bacteria | 1678 |
| 742 | Ga0495625_0000737 | 3300046660 | Bacteria | 45851 |
| 743 | Ga0495625_0004660 | 3300046660 | Bacteria | 12873 |
| 744 | Ga0495625_0070031 | 3300046660 | Bacteria | 2463 |
| 745 | Ga0495625_0072202 | 3300046660 | Bacteria | 2421 |
| 746 | Ga0495625_0077687 | 3300046660 | Bacteria | 2319 |
| 747 | Ga0495625_0133578 | 3300046660 | Bacteria | 1679 |
| 748 | Ga0495661_0003566 | 3300046665 | Bacteria | 11456 |
| 749 | Ga0495588_0009825 | 3300046674 | Bacteria | 4435 |
| 750 | Ga0495588_0043986 | 3300046674 | Bacteria | 2286 |
| 751 | Ga0495657_0017333 | 3300046675 | Bacteria | 5230 |
| 752 | Ga0495647_0044983 | 3300046681 | Bacteria | 1695 |
| 753 | Ga0495647_0060424 | 3300046681 | Bacteria | 1494 |
| 754 | Ga0495669_0010531 | 3300046684 | Bacteria | 3909 |
| 755 | Ga0495669_0013899 | 3300046684 | Bacteria | 3436 |
| 756 | Ga0495670_0008641 | 3300046691 | Bacteria | 5012 |
| 757 | Ga0495670_0045289 | 3300046691 | Bacteria | 2197 |
| 758 | Ga0495671_0000059 | 3300046692 | Bacteria | 107979 |
| 759 | Ga0495671_0000595 | 3300046692 | Bacteria | 26668 |
| 760 | Ga0495671_0011584 | 3300046692 | Bacteria | 4845 |
| 761 | Ga0495671_0094705 | 3300046692 | Bacteria | 1461 |
| 762 | Ga0495649_0016768 | 3300046694 | Bacteria | 4148 |
| 763 | Ga0495589_0018524 | 3300046794 | Bacteria | 3568 |
| 764 | Ga0495660_0003265 | 3300046810 | Bacteria | 10065 |
| 765 | Ga0495660_0057942 | 3300046810 | Bacteria | 2088 |
| 766 | Ga0495672_0000113 | 3300047320 | Bacteria | 129189 |
| 767 | Ga0495672_0038540 | 3300047320 | Bacteria | 2914 |
| 768 | Ga0495672_0047015 | 3300047320 | Bacteria | 2570 |
| 769 | Ga0495683_0006509 | 3300047323 | Bacteria | 6380 |
| 770 | Ga0495687_033205 | 3300047443 | Bacteria | 2344 |
| 771 | Ga0495677_0002243 | 3300047445 | Bacteria | 7641 |
| 772 | Ga0495679_007931 | 3300047446 | Bacteria | 4370 |
| 773 | Ga0495673_0000096 | 3300047469 | Bacteria | 182792 |
| 774 | Ga0495681_0000272 | 3300047470 | Bacteria | 41251 |
| 775 | Ga0495681_0008827 | 3300047470 | Bacteria | 6270 |
| 776 | Ga0495681_0057144 | 3300047470 | Bacteria | 1813 |
| 777 | Ga0495686_0000852 | 3300047472 | Bacteria | 39191 |
| 778 | Ga0495686_0008302 | 3300047472 | Bacteria | 7637 |
| 779 | Ga0495686_0054266 | 3300047472 | Bacteria | 2510 |
| 780 | Ga0495686_0069440 | 3300047472 | Bacteria | 2172 |
| 781 | Ga0495686_0135797 | 3300047472 | Bacteria | 1455 |
| 782 | Ga0495602_0006635 | 3300048088 | Bacteria | 12133 |
| 783 | Ga0495615_0008053 | 3300048090 | Bacteria | 2023 |
| 784 | Ga0495615_0022726 | 3300048090 | Bacteria | 1429 |
| 785 | Ga0495626_0000981 | 3300048091 | Bacteria | 24550 |
| 786 | Ga0495626_0029472 | 3300048091 | Bacteria | 2656 |
| 787 | Ga0496100_0017092 | 3300048903 | Bacteria | 4275 |
| 788 | Ga0496101_0002273 | 3300048904 | Bacteria | 11732 |
| 789 | Ga0496102_0000068 | 3300048905 | Bacteria | 156306 |
| 790 | Ga0496102_0012098 | 3300048905 | Bacteria | 7456 |
| 791 | Ga0496102_0026743 | 3300048905 | Bacteria | 5150 |
| 792 | Ga0496102_0161824 | 3300048905 | Bacteria | 2105 |
| 793 | Ga0496103_0021085 | 3300048906 | Bacteria | 3920 |
| 794 | Ga0496103_0068404 | 3300048906 | Bacteria | 2219 |
| 795 | Ga0496104_0107663 | 3300048907 | Bacteria | 2671 |
| 796 | Ga0496104_0174149 | 3300048907 | Bacteria | 2062 |
| 797 | Ga0496105_0002064 | 3300048908 | Bacteria | 14517 |
| 798 | Ga0496105_0066482 | 3300048908 | Bacteria | 2976 |
| 799 | Ga0496105_0075935 | 3300048908 | Bacteria | 2775 |
| 800 | Ga0496105_0375101 | 3300048908 | Bacteria | 1133 |
| 801 | Ga0496106_0000760 | 3300048909 | Bacteria | 23283 |
| 802 | Ga0496106_0029059 | 3300048909 | Bacteria | 4119 |
| 803 | Ga0496106_0092990 | 3300048909 | Bacteria | 2330 |
| 804 | Ga0496108_0016373 | 3300048911 | Bacteria | 6046 |
| 805 | Ga0496108_0031554 | 3300048911 | Bacteria | 4396 |
| 806 | Ga0496108_0108699 | 3300048911 | Bacteria | 2369 |
| 807 | Ga0496109_0031417 | 3300048912 | Bacteria | 4765 |
| 808 | Ga0496110_0025530 | 3300048913 | Bacteria | 5050 |
| 809 | Ga0496110_0055640 | 3300048913 | Bacteria | 3481 |
| 810 | Ga0496110_0153655 | 3300048913 | Bacteria | 2084 |
| 811 | Ga0496111_0109142 | 3300048914 | Bacteria | 2037 |
| 812 | Ga0496111_0120184 | 3300048914 | Bacteria | 1941 |
| 813 | Ga0496111_0205149 | 3300048914 | Bacteria | 1465 |
| 814 | Ga0496112_0020004 | 3300048915 | Bacteria | 6337 |
| 815 | Ga0496112_0037355 | 3300048915 | Bacteria | 4740 |
| 816 | Ga0496112_0042517 | 3300048915 | Bacteria | 4445 |
| 817 | Ga0496112_0532469 | 3300048915 | Bacteria | 1109 |
| 818 | Ga0496113_0009595 | 3300048916 | Bacteria | 6353 |
| 819 | Ga0496113_0065709 | 3300048916 | Bacteria | 2746 |
| 820 | Ga0496113_0142115 | 3300048916 | Bacteria | 1889 |
| 821 | Ga0496113_0261590 | 3300048916 | Bacteria | 1382 |
| 822 | Ga0496116_0005016 | 3300048919 | Bacteria | 12469 |
| 823 | Ga0496116_0019875 | 3300048919 | Bacteria | 5123 |
| 824 | Ga0496116_0021816 | 3300048919 | Bacteria | 4817 |
| 825 | Ga0496116_0032549 | 3300048919 | Bacteria | 3714 |
| 826 | Ga0496116_0062493 | 3300048919 | Bacteria | 2404 |
| 827 | Ga0496117_0000052 | 3300048920 | Bacteria | 280463 |
| 828 | Ga0496117_0000926 | 3300048920 | Bacteria | 44886 |
| 829 | Ga0496117_0012513 | 3300048920 | Bacteria | 7470 |
| 830 | Ga0496117_0014590 | 3300048920 | Bacteria | 6760 |
| 831 | Ga0496117_0017184 | 3300048920 | Bacteria | 6054 |
| 832 | Ga0496117_0053048 | 3300048920 | Bacteria | 2851 |
| 833 | Ga0496118_0000792 | 3300048921 | Bacteria | 50632 |
| 834 | Ga0496118_0001977 | 3300048921 | Bacteria | 29110 |
| 835 | Ga0496118_0015866 | 3300048921 | Bacteria | 6945 |
| 836 | Ga0496118_0078765 | 3300048921 | Bacteria | 2330 |
| 837 | Ga0496118_0146709 | 3300048921 | Bacteria | 1484 |
| 838 | Ga0496118_0162080 | 3300048921 | Bacteria | 1381 |
| 839 | Ga0496119_0028246 | 3300048922 | Bacteria | 3832 |
| 840 | Ga0496119_0041996 | 3300048922 | Bacteria | 2904 |
| 841 | Ga0496119_0090052 | 3300048922 | Bacteria | 1746 |
| 842 | Ga0496120_0000019 | 3300048923 | Bacteria | 260115 |
| 843 | Ga0496121_0000003 | 3300048924 | Bacteria | 1191431 |
| 844 | Ga0496121_0001731 | 3300048924 | Bacteria | 35624 |
| 845 | Ga0496121_0002950 | 3300048924 | Bacteria | 24830 |
| 846 | Ga0496121_0003041 | 3300048924 | Bacteria | 24337 |
| 847 | Ga0496121_0004490 | 3300048924 | Bacteria | 18711 |
| 848 | Ga0496121_0007187 | 3300048924 | Bacteria | 13486 |
| 849 | Ga0496121_0016496 | 3300048924 | Bacteria | 7622 |
| 850 | Ga0496121_0022327 | 3300048924 | Bacteria | 6148 |
| 851 | Ga0496121_0042776 | 3300048924 | Bacteria | 3934 |
| 852 | Ga0496121_0046025 | 3300048924 | Bacteria | 3740 |
| 853 | Ga0496121_0064361 | 3300048924 | Bacteria | 2990 |
| 854 | Ga0496121_0071722 | 3300048924 | Bacteria | 2784 |
| 855 | Ga0496121_0074626 | 3300048924 | Bacteria | 2712 |
| 856 | Ga0496121_0206123 | 3300048924 | Bacteria | 1397 |
| 857 | Ga0496121_0245275 | 3300048924 | Bacteria | 1246 |
| 858 | Ga0496122_0000042 | 3300048925 | Bacteria | 280482 |
| 859 | Ga0496122_0000053 | 3300048925 | Bacteria | 260120 |
| 860 | Ga0496122_0000080 | 3300048925 | Bacteria | 212397 |
| 861 | Ga0496122_0003537 | 3300048925 | Bacteria | 20432 |
| 862 | Ga0496122_0014660 | 3300048925 | Bacteria | 7559 |
| 863 | Ga0496122_0015740 | 3300048925 | Bacteria | 7209 |
| 864 | Ga0496122_0054120 | 3300048925 | Bacteria | 3017 |
| 865 | Ga0496122_0097767 | 3300048925 | Bacteria | 1974 |
| 866 | Ga0496122_0101472 | 3300048925 | Bacteria | 1922 |
| 867 | Ga0496122_0108059 | 3300048925 | Bacteria | 1836 |
| 868 | Ga0496122_0111801 | 3300048925 | Bacteria | 1790 |
| 869 | Ga0496123_0000030 | 3300048926 | Bacteria | 291764 |
| 870 | Ga0496123_0000038 | 3300048926 | Bacteria | 260120 |
| 871 | Ga0496123_0000072 | 3300048926 | Bacteria | 198524 |
| 872 | Ga0496123_0014925 | 3300048926 | Bacteria | 6404 |
| 873 | Ga0496123_0020288 | 3300048926 | Bacteria | 5204 |
| 874 | Ga0496123_0035113 | 3300048926 | Bacteria | 3579 |
| 875 | Ga0496123_0086803 | 3300048926 | Bacteria | 1874 |
| 876 | Ga0496123_0097916 | 3300048926 | Bacteria | 1717 |
| 877 | Ga0496124_0000139 | 3300048927 | Bacteria | 149873 |
| 878 | Ga0496124_0005584 | 3300048927 | Bacteria | 14078 |
| 879 | Ga0496124_0021455 | 3300048927 | Bacteria | 5950 |
| 880 | Ga0496124_0022392 | 3300048927 | Bacteria | 5793 |
| 881 | Ga0496124_0042429 | 3300048927 | Bacteria | 3918 |
| 882 | Ga0496124_0063069 | 3300048927 | Bacteria | 3098 |
| 883 | Ga0496124_0095898 | 3300048927 | Bacteria | 2410 |
| 884 | Ga0496124_0104468 | 3300048927 | Bacteria | 2291 |
| 885 | Ga0496124_0182178 | 3300048927 | Bacteria | 1615 |
| 886 | Ga0496124_0182364 | 3300048927 | Bacteria | 1614 |
| 887 | Ga0496125_0000170 | 3300048928 | Bacteria | 145369 |
| 888 | Ga0496125_0005886 | 3300048928 | Bacteria | 13444 |
| 889 | Ga0496125_0008875 | 3300048928 | Bacteria | 10442 |
| 890 | Ga0496125_0016390 | 3300048928 | Bacteria | 7119 |
| 891 | Ga0496125_0017649 | 3300048928 | Bacteria | 6795 |
| 892 | Ga0496125_0034692 | 3300048928 | Bacteria | 4441 |
| 893 | Ga0496125_0061916 | 3300048928 | Bacteria | 2997 |
| 894 | Ga0496125_0079083 | 3300048928 | Bacteria | 2524 |
| 895 | Ga0496125_0100689 | 3300048928 | Bacteria | 2129 |
| 896 | Ga0496125_0135504 | 3300048928 | Bacteria | 1723 |
| 897 | Ga0496126_0067226 | 3300048929 | Bacteria | 3202 |
| 898 | Ga0496126_0106212 | 3300048929 | Bacteria | 2451 |
| 899 | Ga0495678_000111 | 3300049459 | Bacteria | 97182 |
| 900 | Ga0495678_000126 | 3300049459 | Bacteria | 89779 |
| 901 | Ga0495678_000290 | 3300049459 | Bacteria | 55357 |
| 902 | Ga0495678_055692 | 3300049459 | Bacteria | 1508 |
| 903 | Ga0495682_0001716 | 3300049460 | Bacteria | 11106 |
| 904 | Ga0501031_0006749 | 3300049568 | Bacteria | 7485 |
| 905 | Ga0501032_0005683 | 3300049569 | Bacteria | 9240 |
| 906 | Ga0501032_0010167 | 3300049569 | Bacteria | 6791 |
| 907 | Ga0501033_0053265 | 3300049570 | Bacteria | 2996 |
| 908 | Ga0501034_0000105 | 3300049571 | Bacteria | 154973 |
| 909 | Ga0501034_0001513 | 3300049571 | Bacteria | 30544 |
| 910 | Ga0501034_0123456 | 3300049571 | Bacteria | 2575 |
| 911 | Ga0501034_0177521 | 3300049571 | Bacteria | 2095 |
| 912 | Ga0501034_0185791 | 3300049571 | Bacteria | 2042 |
| 913 | Ga0501034_0199710 | 3300049571 | Bacteria | 1958 |
| 914 | Ga0501034_0470051 | 3300049571 | Bacteria | 1173 |
| 915 | Ga0501036_0008378 | 3300049572 | Bacteria | 8474 |
| 916 | Ga0501036_0011841 | 3300049572 | Bacteria | 7231 |
| 917 | Ga0501036_0221525 | 3300049572 | Bacteria | 1589 |
| 918 | Ga0501037_0021070 | 3300049573 | Bacteria | 4816 |
| 919 | Ga0501037_0033550 | 3300049573 | Bacteria | 3791 |
| 920 | Ga0501037_0059227 | 3300049573 | Bacteria | 2794 |
| 921 | Ga0501037_0078992 | 3300049573 | Bacteria | 2388 |
| 922 | Ga0501037_0085660 | 3300049573 | Bacteria | 2281 |
| 923 | Ga0501037_0099157 | 3300049573 | Bacteria | 2104 |
| 924 | Ga0501037_0111961 | 3300049573 | Bacteria | 1966 |
| 925 | Ga0501037_0160482 | 3300049573 | Bacteria | 1603 |
| 926 | Ga0501038_0003528 | 3300049574 | Bacteria | 14565 |
| 927 | Ga0501038_0010312 | 3300049574 | Bacteria | 8545 |
| 928 | Ga0501038_0055230 | 3300049574 | Bacteria | 3413 |
| 929 | Ga0501038_0105139 | 3300049574 | Bacteria | 2345 |
| 930 | Ga0501038_0124171 | 3300049574 | Bacteria | 2126 |
| 931 | Ga0501039_0008209 | 3300049575 | Bacteria | 7959 |
| 932 | Ga0501039_0503212 | 3300049575 | Bacteria | 951 |
| 933 | Ga0501040_0037608 | 3300049576 | Bacteria | 3289 |
| 934 | Ga0501042_0379976 | 3300049578 | Bacteria | 1023 |
| 935 | Ga0501043_0002038 | 3300049579 | Bacteria | 17235 |
| 936 | Ga0501043_0009792 | 3300049579 | Bacteria | 7511 |
| 937 | Ga0501043_0098853 | 3300049579 | Bacteria | 2294 |
| 938 | Ga0501043_0161920 | 3300049579 | Bacteria | 1748 |
| 939 | Ga0501046_0007317 | 3300049580 | Bacteria | 9712 |
| 940 | Ga0501046_0010238 | 3300049580 | Bacteria | 8069 |
| 941 | Ga0501046_0164448 | 3300049580 | Bacteria | 1667 |
| 942 | Ga0501047_0000636 | 3300049581 | Bacteria | 36882 |
| 943 | Ga0501047_0003275 | 3300049581 | Bacteria | 15331 |
| 944 | Ga0501047_0003943 | 3300049581 | Bacteria | 13944 |
| 945 | Ga0501047_0004452 | 3300049581 | Bacteria | 13191 |
| 946 | Ga0501047_0010184 | 3300049581 | Bacteria | 8889 |
| 947 | Ga0501047_0077275 | 3300049581 | Bacteria | 3203 |
| 948 | Ga0501047_0113730 | 3300049581 | Bacteria | 2589 |
| 949 | Ga0501047_0152253 | 3300049581 | Bacteria | 2188 |
| 950 | Ga0501047_0205619 | 3300049581 | Bacteria | 1828 |
| 951 | Ga0501047_0454971 | 3300049581 | Bacteria | 1109 |
| 952 | Ga0501048_0084400 | 3300049582 | Bacteria | 2240 |
| 953 | Ga0501048_0149576 | 3300049582 | Bacteria | 1651 |
| 954 | Ga0501048_0160637 | 3300049582 | Bacteria | 1590 |
| 955 | Ga0501067_0009015 | 3300049583 | Bacteria | 5530 |
| 956 | Ga0501067_0114938 | 3300049583 | Bacteria | 1496 |
| 957 | Ga0501067_0139287 | 3300049583 | Bacteria | 1351 |
| 958 | Ga0501067_0154803 | 3300049583 | Bacteria | 1277 |
| 959 | Ga0501067_0228012 | 3300049583 | Bacteria | 1037 |
| 960 | Ga0501069_0026990 | 3300049585 | Bacteria | 3146 |
| 961 | Ga0501069_0090943 | 3300049585 | Bacteria | 1726 |
| 962 | Ga0501070_0000311 | 3300049586 | Bacteria | 44330 |
| 963 | Ga0501070_0007856 | 3300049586 | Bacteria | 9040 |
| 964 | Ga0501070_0033376 | 3300049586 | Bacteria | 4307 |
| 965 | Ga0501070_0073931 | 3300049586 | Bacteria | 2821 |
| 966 | Ga0501071_0026775 | 3300049587 | Bacteria | 4050 |
| 967 | Ga0501072_0244843 | 3300049588 | Bacteria | 1428 |
| 968 | Ga0501073_0012242 | 3300049589 | Bacteria | 6261 |
| 969 | Ga0501073_0013127 | 3300049589 | Bacteria | 6039 |
| 970 | Ga0501073_0089428 | 3300049589 | Bacteria | 2140 |
| 971 | Ga0501073_0205731 | 3300049589 | Bacteria | 1360 |
| 972 | Ga0501074_0001303 | 3300049590 | Bacteria | 16547 |
| 973 | Ga0501074_0025338 | 3300049590 | Bacteria | 4308 |
| 974 | Ga0501074_0279110 | 3300049590 | Bacteria | 1188 |
| 975 | Ga0501076_0167009 | 3300049592 | Bacteria | 1794 |
| 976 | Ga0501079_0094471 | 3300049741 | Bacteria | 2317 |
| 977 | Ga0501080_0002966 | 3300049742 | Bacteria | 14930 |
| 978 | Ga0501080_0007885 | 3300049742 | Bacteria | 9639 |
| 979 | Ga0501080_0056028 | 3300049742 | Bacteria | 3671 |
| 980 | Ga0501080_0132140 | 3300049742 | Bacteria | 2311 |
| 981 | Ga0501083_0000239 | 3300049744 | Bacteria | 35330 |
| 982 | Ga0501083_0001893 | 3300049744 | Bacteria | 14369 |
| 983 | Ga0501083_0005890 | 3300049744 | Bacteria | 8673 |
| 984 | Ga0501083_0190527 | 3300049744 | Bacteria | 1338 |
| 985 | Ga0501280_003283 | 3300049776 | Bacteria | 2512 |
| 986 | Ga0501035_0000800 | 3300049822 | Bacteria | 33514 |
| 987 | Ga0501035_0008949 | 3300049822 | Bacteria | 9316 |
| 988 | Ga0501035_0014906 | 3300049822 | Bacteria | 7172 |
| 989 | Ga0501035_0018416 | 3300049822 | Bacteria | 6435 |
| 990 | Ga0501035_0034708 | 3300049822 | Bacteria | 4581 |
| 991 | Ga0501035_0105050 | 3300049822 | Bacteria | 2476 |
| 992 | Ga0501044_0020553 | 3300049823 | Bacteria | 7049 |
| 993 | Ga0501044_0029070 | 3300049823 | Bacteria | 5829 |
| 994 | Ga0501044_0075097 | 3300049823 | Bacteria | 3432 |
| 995 | Ga0501044_0113668 | 3300049823 | Bacteria | 2714 |
| 996 | Ga0501044_0116094 | 3300049823 | Bacteria | 2682 |
| 997 | Ga0501044_0180307 | 3300049823 | Bacteria | 2079 |
| 998 | Ga0501044_0291298 | 3300049823 | Bacteria | 1564 |
| 999 | Ga0501044_0321580 | 3300049823 | Bacteria | 1471 |
| 1000 | Ga0501044_0413739 | 3300049823 | Bacteria | 1259 |
| 1001 | nmdc:mga03683_7456_c1 | 3300050489 | Bacteria | 3798 |
| 1002 | nmdc:mga03n38_985_c1 | 3300050490 | Bacteria | 7777 |
| 1003 | nmdc:mga00v17_346_c2 | 3300050491 | Bacteria | 15851 |
| 1004 | nmdc:mga00v17_55_c1 | 3300050491 | Bacteria | 72029 |
| 1005 | nmdc:mga0yw44_257267_c1 | 3300050492 | Bacteria | 1163 |
| 1006 | nmdc:mga0yw44_959_c1 | 3300050492 | Bacteria | 10341 |
| 1007 | nmdc:mga0k408_2026_c1 | 3300050493 | Bacteria | 10850 |
| 1008 | nmdc:mga06z11_80023_c1 | 3300050494 | Bacteria | 1751 |
| 1009 | nmdc:mga07m45_18218_c1 | 3300050496 | Bacteria | 3786 |
| 1010 | nmdc:mga0qj67_10964_c1 | 3300050509 | Bacteria | 6783 |
| 1011 | nmdc:mga0qj67_288810_c1 | 3300050509 | Bacteria | 1329 |
| 1012 | nmdc:mga0qj67_51303_c1 | 3300050509 | Bacteria | 3262 |
| 1013 | nmdc:mga06r32_13010_c1 | 3300050510 | Bacteria | 7529 |
| 1014 | nmdc:mga0n895_82117_c1 | 3300050512 | Bacteria | 3212 |
| 1015 | nmdc:mga0sz30_12942_c1 | 3300050516 | Bacteria | 3256 |
| 1016 | nmdc:mga0sz30_18084_c1 | 3300050516 | Bacteria | 2816 |
| 1017 | nmdc:mga0sz30_32_c1 | 3300050516 | Bacteria | 54057 |
| 1018 | Ga0500583_0003360 | 3300053092 | Bacteria | 5023 |
| 1019 | Ga0500557_011818 | 3300053105 | Bacteria | 2241 |
| 1020 | Ga0500572_002418 | 3300053111 | Bacteria | 4497 |
| 1021 | Ga0500593_000006 | 3300053117 | Bacteria | 88644 |
| 1022 | Ga0500594_0004768 | 3300053118 | Bacteria | 2995 |
| 1023 | Ga0500618_000337 | 3300053125 | Bacteria | 33703 |
| 1024 | Ga0500618_000717 | 3300053125 | Bacteria | 19091 |
| 1025 | Ga0500618_005905 | 3300053125 | Bacteria | 3660 |
| 1026 | Ga0500618_009856 | 3300053125 | Bacteria | 2590 |
| 1027 | Ga0500655_016915 | 3300053133 | Bacteria | 1345 |
| 1028 | Ga0500658_0012637 | 3300053134 | Bacteria | 3117 |
| 1029 | Ga0500559_0001871 | 3300053136 | Bacteria | 11458 |
| 1030 | Ga0500559_0002424 | 3300053136 | Bacteria | 9652 |
| 1031 | Ga0500561_0001332 | 3300053137 | Bacteria | 4016 |
| 1032 | Ga0500568_0000005 | 3300053139 | Bacteria | 614296 |
| 1033 | Ga0500568_0001296 | 3300053139 | Bacteria | 16418 |
| 1034 | Ga0500568_0015213 | 3300053139 | Bacteria | 3449 |
| 1035 | Ga0500568_0023471 | 3300053139 | Bacteria | 2623 |
| 1036 | Ga0500590_033078 | 3300053148 | Bacteria | 2681 |
| 1037 | Ga0500604_0004171 | 3300053151 | Bacteria | 3850 |
| 1038 | Ga0500604_0004488 | 3300053151 | Bacteria | 3703 |
| 1039 | Ga0500616_0000677 | 3300053153 | Bacteria | 39945 |
| 1040 | Ga0500616_0000980 | 3300053153 | Bacteria | 30834 |
| 1041 | Ga0500616_0049618 | 3300053153 | Bacteria | 2219 |
| 1042 | Ga0500622_0000780 | 3300053156 | Bacteria | 27667 |
| 1043 | Ga0500622_0027811 | 3300053156 | Bacteria | 2980 |
| 1044 | Ga0500622_0098291 | 3300053156 | Bacteria | 1445 |
| 1045 | Ga0500636_0000245 | 3300053177 | Bacteria | 29922 |
| 1046 | Ga0500636_0085413 | 3300053177 | Bacteria | 1813 |
| 1047 | Ga0501084_0000322 | 3300054114 | Bacteria | 36608 |
| 1048 | Ga0501084_0038339 | 3300054114 | Bacteria | 4006 |
| 1049 | Ga0501084_0266924 | 3300054114 | Bacteria | 1445 |
| 1050 | Ga0590071_011978 | 3300059421 | Bacteria | 2033 |
| 1051 | Ga0501082_0019565 | 3300060353 | Bacteria | 5839 |
| 1052 | Ga0501082_0028071 | 3300060353 | Bacteria | 4848 |
| 1053 | Ga0501082_0185140 | 3300060353 | Bacteria | 1812 |
| 1054 | Ga0501082_0253340 | 3300060353 | Bacteria | 1531 |
| 1055 | Ga0466962_0135295 | 3300061719 | Bacteria | 1192 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300049569 | Ga0501032_0010167 | Ga0501032_0010167_5964_6770 | 267 |
| 2 | 3300049575 | Ga0501039_0503212 | Ga0501039_0503212_131_937 | 267 |
| 3 | 3300049578 | Ga0501042_0379976 | Ga0501042_0379976_15_827 | 270 |
| 4 | 3300049581 | Ga0501047_0454971 | Ga0501047_0454971_252_1094 | 273 |
| 5 | 3300048919 | Ga0496116_0062493 | Ga0496116_0062493_1531_2391 | 276 |
| 6 | 3300049581 | Ga0501047_0003943 | Ga0501047_0003943_13092_13934 | 279 |
| 7 | 3300046660 | Ga0495625_0077687 | Ga0495625_0077687_30_887 | 283 |
| 8 | 3300049573 | Ga0501037_0085660 | Ga0501037_0085660_70_924 | 283 |
| 9 | 3300042007 | Ga0439449_0038752 | Ga0439449_0038752_892_1752 | 286 |
| 10 | 3300049573 | Ga0501037_0059227 | Ga0501037_0059227_710_1576 | 288 |
| 11 | 3300005335 | Ga0070666_10035138 | Ga0070666_100351383 | 309 |
| 12 | 3300013306 | Ga0163162_10403786 | Ga0163162_104037861 | 309 |
| 13 | 3300046452 | Ga0495617_004123 | Ga0495617_004123_1145_2152 | 311 |
| 14 | 3300046507 | Ga0495606_0000757 | Ga0495606_0000757_19108_20115 | 311 |
| 15 | 3300046520 | Ga0495637_0008603 | Ga0495637_0008603_1216_2223 | 311 |
| 16 | 3300046522 | Ga0495643_0000362 | Ga0495643_0000362_21554_22552 | 311 |
| 17 | 3300048091 | Ga0495626_0000981 | Ga0495626_0000981_20496_21494 | 311 |
| 18 | 3300046524 | Ga0495648_0058279 | Ga0495648_0058279_651_1658 | 312 |
| 19 | 3300046694 | Ga0495649_0016768 | Ga0495649_0016768_2242_3249 | 312 |
| 20 | 3300047469 | Ga0495673_0000096 | Ga0495673_0000096_63174_64181 | 312 |
| 21 | 3300048914 | Ga0496111_0120184 | Ga0496111_0120184_888_1895 | 312 |
| 22 | 3300053118 | Ga0500594_0004768 | Ga0500594_0004768_407_1414 | 312 |
| 23 | 3300009177 | Ga0105248_10119445 | Ga0105248_101194453 | 313 |
| 24 | 3300025961 | Ga0207712_10096928 | Ga0207712_100969283 | 313 |
| 25 | 3300044693 | Ga0466961_0044120 | Ga0466961_0044120_654_1649 | 313 |
| 26 | 3300045049 | Ga0466959_0089428 | Ga0466959_0089428_1149_2144 | 313 |
| 27 | 3300045976 | Ga0466967_0196632 | Ga0466967_0196632_376_1371 | 313 |
| 28 | 3300037471 | Ga0395905_0420516 | Ga0395905_0420516_81_1088 | 314 |
| 29 | 3300046660 | Ga0495625_0004660 | Ga0495625_0004660_1643_2650 | 314 |
| 30 | 3300049583 | Ga0501067_0114938 | Ga0501067_0114938_21_995 | 314 |
| 31 | 3300053111 | Ga0500572_002418 | Ga0500572_002418_3248_4249 | 314 |
| 32 | 3300053177 | Ga0500636_0085413 | Ga0500636_0085413_802_1803 | 314 |
| 33 | 3300005458 | Ga0070681_10024374 | Ga0070681_100243743 | 315 |
| 34 | 3300025912 | Ga0207707_10014148 | Ga0207707_100141484 | 315 |
| 35 | 3300031901 | Ga0307406_10022197 | Ga0307406_100221973 | 315 |
| 36 | 3300005329 | Ga0070683_100038909 | Ga0070683_1000389093 | 316 |
| 37 | 3300005435 | Ga0070714_100048057 | Ga0070714_1000480573 | 316 |
| 38 | 3300005530 | Ga0070679_100087266 | Ga0070679_1000872663 | 316 |
| 39 | 3300005535 | Ga0070684_100030837 | Ga0070684_1000308375 | 316 |
| 40 | 3300005563 | Ga0068855_100007019 | Ga0068855_1000070194 | 316 |
| 41 | 3300005564 | Ga0070664_100000477 | Ga0070664_10000047729 | 316 |
| 42 | 3300005577 | Ga0068857_100004249 | Ga0068857_10000424912 | 316 |
| 43 | 3300009093 | Ga0105240_10017115 | Ga0105240_100171155 | 316 |
| 44 | 3300009551 | Ga0105238_10009734 | Ga0105238_100097344 | 316 |
| 45 | 3300013100 | Ga0157373_10006166 | Ga0157373_100061664 | 316 |
| 46 | 3300013104 | Ga0157370_10032044 | Ga0157370_100320443 | 316 |
| 47 | 3300013105 | Ga0157369_10028777 | Ga0157369_100287774 | 316 |
| 48 | 3300013307 | Ga0157372_10011309 | Ga0157372_100113095 | 316 |
| 49 | 3300025909 | Ga0207705_10033838 | Ga0207705_100338384 | 316 |
| 50 | 3300025912 | Ga0207707_10259308 | Ga0207707_102593081 | 316 |
| 51 | 3300025913 | Ga0207695_10089322 | Ga0207695_100893222 | 316 |
| 52 | 3300025920 | Ga0207649_10009032 | Ga0207649_100090323 | 316 |
| 53 | 3300025924 | Ga0207694_10021429 | Ga0207694_100214293 | 316 |
| 54 | 3300025929 | Ga0207664_10043228 | Ga0207664_100432283 | 316 |
| 55 | 3300025932 | Ga0207690_10025978 | Ga0207690_100259783 | 316 |
| 56 | 3300025945 | Ga0207679_10033427 | Ga0207679_100334273 | 316 |
| 57 | 3300025949 | Ga0207667_10044605 | Ga0207667_100446053 | 316 |
| 58 | 3300025981 | Ga0207640_10049946 | Ga0207640_100499462 | 316 |
| 59 | 3300026041 | Ga0207639_10009223 | Ga0207639_100092235 | 316 |
| 60 | 3300026078 | Ga0207702_10021577 | Ga0207702_100215774 | 316 |
| 61 | 3300026116 | Ga0207674_10000379 | Ga0207674_1000037927 | 316 |
| 62 | 3300026142 | Ga0207698_10012640 | Ga0207698_100126402 | 316 |
| 63 | 3300046460 | Ga0495638_0027113 | Ga0495638_0027113_108_1115 | 316 |
| 64 | 3300046648 | Ga0495611_0022356 | Ga0495611_0022356_587_1573 | 316 |
| 65 | 3300049571 | Ga0501034_0000105 | Ga0501034_0000105_76213_77199 | 316 |
| 66 | 3300046452 | Ga0495617_000022 | Ga0495617_000022_109235_110221 | 317 |
| 67 | 3300046453 | Ga0495627_000222 | Ga0495627_000222_48566_49552 | 317 |
| 68 | 3300046455 | Ga0495603_0047986 | Ga0495603_0047986_1153_2139 | 317 |
| 69 | 3300046474 | Ga0495605_0000064 | Ga0495605_0000064_119377_120363 | 317 |
| 70 | 3300046492 | Ga0495585_0019126 | Ga0495585_0019126_1246_2232 | 317 |
| 71 | 3300046492 | Ga0495585_0042031 | Ga0495585_0042031_994_1980 | 317 |
| 72 | 3300046500 | Ga0495596_0009401 | Ga0495596_0009401_1747_2733 | 317 |
| 73 | 3300046500 | Ga0495596_0047033 | Ga0495596_0047033_89_1075 | 317 |
| 74 | 3300046501 | Ga0495607_0003479 | Ga0495607_0003479_3155_4141 | 317 |
| 75 | 3300046506 | Ga0495583_0000678 | Ga0495583_0000678_20582_21568 | 317 |
| 76 | 3300046506 | Ga0495583_0027690 | Ga0495583_0027690_1604_2590 | 317 |
| 77 | 3300046512 | Ga0495610_0003067 | Ga0495610_0003067_5316_6323 | 317 |
| 78 | 3300046513 | Ga0495616_0000431 | Ga0495616_0000431_17960_18946 | 317 |
| 79 | 3300046513 | Ga0495616_0005704 | Ga0495616_0005704_4448_5434 | 317 |
| 80 | 3300046518 | Ga0495631_0051645 | Ga0495631_0051645_353_1339 | 317 |
| 81 | 3300046518 | Ga0495631_0059923 | Ga0495631_0059923_29_1015 | 317 |
| 82 | 3300046519 | Ga0495632_0000026 | Ga0495632_0000026_87684_88670 | 317 |
| 83 | 3300046519 | Ga0495632_0000087 | Ga0495632_0000087_63458_64444 | 317 |
| 84 | 3300046522 | Ga0495643_0000119 | Ga0495643_0000119_107396_108403 | 317 |
| 85 | 3300046523 | Ga0495644_0033365 | Ga0495644_0033365_250_1236 | 317 |
| 86 | 3300046524 | Ga0495648_0000379 | Ga0495648_0000379_27413_28399 | 317 |
| 87 | 3300046525 | Ga0495663_0030447 | Ga0495663_0030447_534_1520 | 317 |
| 88 | 3300046528 | Ga0495642_0000272 | Ga0495642_0000272_18846_19832 | 317 |
| 89 | 3300046528 | Ga0495642_0000329 | Ga0495642_0000329_16077_17063 | 317 |
| 90 | 3300046528 | Ga0495642_0006986 | Ga0495642_0006986_1338_2324 | 317 |
| 91 | 3300046530 | Ga0495654_0001196 | Ga0495654_0001196_2797_3783 | 317 |
| 92 | 3300046530 | Ga0495654_0008383 | Ga0495654_0008383_2613_3599 | 317 |
| 93 | 3300046538 | Ga0495609_0008483 | Ga0495609_0008483_1953_2939 | 317 |
| 94 | 3300046538 | Ga0495609_0065444 | Ga0495609_0065444_303_1310 | 317 |
| 95 | 3300046542 | Ga0495597_0000810 | Ga0495597_0000810_19391_20398 | 317 |
| 96 | 3300046542 | Ga0495597_0009034 | Ga0495597_0009034_646_1632 | 317 |
| 97 | 3300046616 | Ga0495668_0000653 | Ga0495668_0000653_13194_14180 | 317 |
| 98 | 3300046648 | Ga0495611_0012246 | Ga0495611_0012246_2085_3071 | 317 |
| 99 | 3300046660 | Ga0495625_0133578 | Ga0495625_0133578_131_1117 | 317 |
| 100 | 3300046665 | Ga0495661_0003566 | Ga0495661_0003566_7897_8883 | 317 |
| 101 | 3300046674 | Ga0495588_0009825 | Ga0495588_0009825_3059_4045 | 317 |
| 102 | 3300046684 | Ga0495669_0010531 | Ga0495669_0010531_1788_2774 | 317 |
| 103 | 3300046684 | Ga0495669_0013899 | Ga0495669_0013899_2247_3233 | 317 |
| 104 | 3300046691 | Ga0495670_0008641 | Ga0495670_0008641_2591_3577 | 317 |
| 105 | 3300046692 | Ga0495671_0000059 | Ga0495671_0000059_56255_57241 | 317 |
| 106 | 3300046692 | Ga0495671_0000595 | Ga0495671_0000595_14375_15361 | 317 |
| 107 | 3300046692 | Ga0495671_0011584 | Ga0495671_0011584_2259_3245 | 317 |
| 108 | 3300046794 | Ga0495589_0018524 | Ga0495589_0018524_19_1005 | 317 |
| 109 | 3300046810 | Ga0495660_0003265 | Ga0495660_0003265_2002_2988 | 317 |
| 110 | 3300046810 | Ga0495660_0057942 | Ga0495660_0057942_692_1678 | 317 |
| 111 | 3300047320 | Ga0495672_0000113 | Ga0495672_0000113_40727_41734 | 317 |
| 112 | 3300047323 | Ga0495683_0006509 | Ga0495683_0006509_4487_5473 | 317 |
| 113 | 3300047445 | Ga0495677_0002243 | Ga0495677_0002243_2318_3304 | 317 |
| 114 | 3300047446 | Ga0495679_007931 | Ga0495679_007931_943_1929 | 317 |
| 115 | 3300047470 | Ga0495681_0000272 | Ga0495681_0000272_37777_38763 | 317 |
| 116 | 3300048091 | Ga0495626_0029472 | Ga0495626_0029472_1627_2613 | 317 |
| 117 | 3300048905 | Ga0496102_0000068 | Ga0496102_0000068_52437_53423 | 317 |
| 118 | 3300048924 | Ga0496121_0206123 | Ga0496121_0206123_210_1196 | 317 |
| 119 | 3300049459 | Ga0495678_000111 | Ga0495678_000111_58078_59085 | 317 |
| 120 | 3300049459 | Ga0495678_000126 | Ga0495678_000126_74917_75903 | 317 |
| 121 | 3300049459 | Ga0495678_000290 | Ga0495678_000290_8280_9266 | 317 |
| 122 | 3300049460 | Ga0495682_0001716 | Ga0495682_0001716_4456_5442 | 317 |
| 123 | 3300037471 | Ga0395905_0001192 | Ga0395905_0001192_30067_31065 | 319 |
| 124 | 3300048088 | Ga0495602_0006635 | Ga0495602_0006635_3905_4891 | 319 |
| 125 | 3300009177 | Ga0105248_10307717 | Ga0105248_103077172 | 320 |
| 126 | 3300048922 | Ga0496119_0090052 | Ga0496119_0090052_545_1534 | 320 |
| 127 | 3300048924 | Ga0496121_0046025 | Ga0496121_0046025_2130_3119 | 320 |
| 128 | 3300048928 | Ga0496125_0005886 | Ga0496125_0005886_3048_4037 | 320 |
| 129 | 3300005841 | Ga0068863_100162433 | Ga0068863_1001624332 | 321 |
| 130 | 3300005842 | Ga0068858_100002701 | Ga0068858_10000270110 | 321 |
| 131 | 3300014325 | Ga0163163_10103767 | Ga0163163_101037672 | 321 |
| 132 | 3300026035 | Ga0207703_10004984 | Ga0207703_1000498410 | 321 |
| 133 | 3300026088 | Ga0207641_10176543 | Ga0207641_101765432 | 321 |
| 134 | 3300048905 | Ga0496102_0026743 | Ga0496102_0026743_1246_2250 | 321 |
| 135 | 3300048909 | Ga0496106_0092990 | Ga0496106_0092990_981_1985 | 321 |
| 136 | 3300048924 | Ga0496121_0003041 | Ga0496121_0003041_22105_23109 | 321 |
| 137 | 3300048929 | Ga0496126_0106212 | Ga0496126_0106212_82_1086 | 321 |
| 138 | iso_pu_bacteria | 2842733646 | 2842738598 | 321 |
| 139 | iso_pu_bacteria | 2885192300 | 2885194295 | 321 |
| 140 | iso_pu_bacteria | 2899924645 | 2899929798 | 321 |
| 141 | iso_pu_bacteria | 2928044640 | 2928050030 | 321 |
| 142 | iso_pu_bacteria | 2928051484 | 2928054611 | 321 |
| 143 | 3300046459 | Ga0495629_0041068 | Ga0495629_0041068_519_1550 | 322 |
| 144 | 3300046681 | Ga0495647_0044983 | Ga0495647_0044983_295_1326 | 322 |
| 145 | 3300003354 | JGI25160J50197_1006336 | JGI25160J50197_10063363 | 323 |
| 146 | 3300003790 | Ga0055528_1003280 | Ga0055528_10032802 | 323 |
| 147 | 3300005355 | Ga0070671_100029091 | Ga0070671_1000290914 | 323 |
| 148 | 3300005367 | Ga0070667_100113050 | Ga0070667_1001130502 | 323 |
| 149 | 3300025258 | Ga0209129_1009869 | Ga0209129_10098693 | 323 |
| 150 | 3300025273 | Ga0209673_1001992 | Ga0209673_10019929 | 323 |
| 151 | 3300025294 | Ga0209025_1004200 | Ga0209025_10042003 | 323 |
| 152 | 3300025302 | Ga0207426_1001540 | Ga0207426_10015407 | 323 |
| 153 | 3300025931 | Ga0207644_10013039 | Ga0207644_100130392 | 323 |
| 154 | 3300025986 | Ga0207658_10191576 | Ga0207658_101915761 | 323 |
| 155 | 3300037312 | Ga0395899_0023290 | Ga0395899_0023290_3518_4495 | 323 |
| 156 | 3300037418 | Ga0395900_0075570 | Ga0395900_0075570_2170_3147 | 323 |
| 157 | 3300037466 | Ga0395898_0020217 | Ga0395898_0020217_1087_2064 | 323 |
| 158 | 3300038443 | Ga0395901_0442911 | Ga0395901_0442911_146_1123 | 323 |
| 159 | 3300038443 | Ga0395901_0442946 | Ga0395901_0442946_207_1184 | 323 |
| 160 | 3300046674 | Ga0495588_0043986 | Ga0495588_0043986_101_1075 | 323 |
| 161 | 3300048927 | Ga0496124_0095898 | Ga0496124_0095898_1387_2388 | 323 |
| 162 | 3300050509 | nmdc:mga0qj67_288810_c1 | nmdc:mga0qj67_288810_c1_215_1192 | 323 |
| 163 | iso_pu_bacteria | 2887375801 | 2887379975 | 323 |
| 164 | 3300005355 | Ga0070671_100004730 | Ga0070671_10000473010 | 324 |
| 165 | 3300005367 | Ga0070667_100008497 | Ga0070667_1000084978 | 324 |
| 166 | 3300005617 | Ga0068859_100001222 | Ga0068859_1000012225 | 324 |
| 167 | 3300005843 | Ga0068860_100139263 | Ga0068860_1001392633 | 324 |
| 168 | 3300006844 | Ga0075428_100394322 | Ga0075428_1003943222 | 324 |
| 169 | 3300006846 | Ga0075430_100013283 | Ga0075430_1000132836 | 324 |
| 170 | 3300006847 | Ga0075431_100008297 | Ga0075431_1000082973 | 324 |
| 171 | 3300006880 | Ga0075429_100052920 | Ga0075429_1000529202 | 324 |
| 172 | 3300006931 | Ga0097620_100001222 | Ga0097620_10000122221 | 324 |
| 173 | 3300007265 | Ga0099794_10001158 | Ga0099794_100011587 | 324 |
| 174 | 3300009101 | Ga0105247_10000248 | Ga0105247_1000024825 | 324 |
| 175 | 3300009553 | Ga0105249_10004888 | Ga0105249_1000488811 | 324 |
| 176 | 3300014968 | Ga0157379_10004041 | Ga0157379_100040418 | 324 |
| 177 | 3300025900 | Ga0207710_10000333 | Ga0207710_1000033319 | 324 |
| 178 | 3300025931 | Ga0207644_10003506 | Ga0207644_100035067 | 324 |
| 179 | 3300025986 | Ga0207658_10002111 | Ga0207658_100021117 | 324 |
| 180 | 3300027671 | Ga0209588_1002399 | Ga0209588_10023993 | 324 |
| 181 | 3300032005 | Ga0307411_10015733 | Ga0307411_100157334 | 324 |
| 182 | 3300037466 | Ga0395898_0022748 | Ga0395898_0022748_2475_3458 | 324 |
| 183 | 3300049568 | Ga0501031_0006749 | Ga0501031_0006749_5207_6196 | 324 |
| 184 | 3300049572 | Ga0501036_0008378 | Ga0501036_0008378_4959_5948 | 324 |
| 185 | 3300049574 | Ga0501038_0010312 | Ga0501038_0010312_3761_4750 | 324 |
| 186 | 3300049579 | Ga0501043_0009792 | Ga0501043_0009792_5355_6344 | 324 |
| 187 | 3300049581 | Ga0501047_0003275 | Ga0501047_0003275_6241_7230 | 324 |
| 188 | 3300049822 | Ga0501035_0018416 | Ga0501035_0018416_2431_3420 | 324 |
| 189 | 3300049823 | Ga0501044_0020553 | Ga0501044_0020553_3358_4347 | 324 |
| 190 | 3300050509 | nmdc:mga0qj67_10964_c1 | nmdc:mga0qj67_10964_c1_5164_6141 | 324 |
| 191 | 3300050510 | nmdc:mga06r32_13010_c1 | nmdc:mga06r32_13010_c1_3223_4200 | 324 |
| 192 | iso_pu_bacteria | 2885305155 | 2885306900 | 324 |
| 193 | iso_pu_bacteria | 2885326080 | 2885327918 | 324 |
| 194 | iso_pu_bacteria | 2885334103 | 2885335457 | 324 |
| 195 | iso_pu_bacteria | 2904541872 | 2904549200 | 324 |
| 196 | iso_pu_bacteria | 2929160207 | 2929160830 | 324 |
| 197 | 3300005336 | Ga0070680_100019667 | Ga0070680_1000196675 | 325 |
| 198 | 3300005458 | Ga0070681_10051581 | Ga0070681_100515813 | 325 |
| 199 | 3300005530 | Ga0070679_100041890 | Ga0070679_1000418906 | 325 |
| 200 | 3300005530 | Ga0070679_100321496 | Ga0070679_1003214962 | 325 |
| 201 | 3300007265 | Ga0099794_10054135 | Ga0099794_100541352 | 325 |
| 202 | 3300025912 | Ga0207707_10136521 | Ga0207707_101365213 | 325 |
| 203 | 3300025913 | Ga0207695_10118060 | Ga0207695_101180603 | 325 |
| 204 | 3300025917 | Ga0207660_10204946 | Ga0207660_102049462 | 325 |
| 205 | 3300025921 | Ga0207652_10059508 | Ga0207652_100595081 | 325 |
| 206 | 3300025921 | Ga0207652_10391359 | Ga0207652_103913591 | 325 |
| 207 | 3300026121 | Ga0207683_10360889 | Ga0207683_103608891 | 325 |
| 208 | 3300031239 | Ga0265328_10091898 | Ga0265328_100918981 | 325 |
| 209 | 3300031250 | Ga0265331_10007443 | Ga0265331_100074433 | 325 |
| 210 | 3300031251 | Ga0265327_10000083 | Ga0265327_10000083140 | 325 |
| 211 | 3300032004 | Ga0307414_10284064 | Ga0307414_102840641 | 325 |
| 212 | 3300032005 | Ga0307411_10269961 | Ga0307411_102699612 | 325 |
| 213 | 3300037418 | Ga0395900_0394358 | Ga0395900_0394358_248_1231 | 325 |
| 214 | 3300039447 | Ga0436361_0004189 | Ga0436361_0004189_4198_5235 | 325 |
| 215 | 3300041411 | Ga0439466_0011166 | Ga0439466_0011166_2206_3186 | 325 |
| 216 | 3300041413 | Ga0439465_0006254 | Ga0439465_0006254_184_1164 | 325 |
| 217 | 3300042007 | Ga0439449_0005817 | Ga0439449_0005817_677_1657 | 325 |
| 218 | 3300042010 | Ga0439452_005324 | Ga0439452_005324_2327_3307 | 325 |
| 219 | 3300042014 | Ga0439457_008408 | Ga0439457_008408_1043_2023 | 325 |
| 220 | 3300042015 | Ga0439462_0039767 | Ga0439462_0039767_165_1145 | 325 |
| 221 | 3300048920 | Ga0496117_0017184 | Ga0496117_0017184_3855_4892 | 325 |
| 222 | iso_pu_bacteria | 2739367756 | 2739793384 | 325 |
| 223 | iso_pu_bacteria | 2842747753 | 2842750036 | 325 |
| 224 | iso_pu_bacteria | 2869162929 | 2869163394 | 325 |
| 225 | iso_pu_bacteria | 2895511927 | 2895518571 | 325 |
| 226 | 3300003784 | Ga0055534_1001811 | Ga0055534_10018115 | 326 |
| 227 | 3300003792 | Ga0055540_1005410 | Ga0055540_10054102 | 326 |
| 228 | 3300003794 | Ga0055531_10003153 | Ga0055531_100031539 | 326 |
| 229 | 3300005327 | Ga0070658_10034330 | Ga0070658_100343303 | 326 |
| 230 | 3300005329 | Ga0070683_100023540 | Ga0070683_1000235403 | 326 |
| 231 | 3300005334 | Ga0068869_100135223 | Ga0068869_1001352232 | 326 |
| 232 | 3300005336 | Ga0070680_100097355 | Ga0070680_1000973551 | 326 |
| 233 | 3300005344 | Ga0070661_100128804 | Ga0070661_1001288042 | 326 |
| 234 | 3300005347 | Ga0070668_100132243 | Ga0070668_1001322431 | 326 |
| 235 | 3300005353 | Ga0070669_100225018 | Ga0070669_1002250181 | 326 |
| 236 | 3300005535 | Ga0070684_100011755 | Ga0070684_1000117555 | 326 |
| 237 | 3300005563 | Ga0068855_100531508 | Ga0068855_1005315081 | 326 |
| 238 | 3300005577 | Ga0068857_100047477 | Ga0068857_1000474773 | 326 |
| 239 | 3300005616 | Ga0068852_100379177 | Ga0068852_1003791772 | 326 |
| 240 | 3300005617 | Ga0068859_100048247 | Ga0068859_1000482473 | 326 |
| 241 | 3300005618 | Ga0068864_100135764 | Ga0068864_1001357642 | 326 |
| 242 | 3300005842 | Ga0068858_100291860 | Ga0068858_1002918602 | 326 |
| 243 | 3300005843 | Ga0068860_100047094 | Ga0068860_1000470943 | 326 |
| 244 | 3300006931 | Ga0097620_100048249 | Ga0097620_1000482493 | 326 |
| 245 | 3300013307 | Ga0157372_10083943 | Ga0157372_100839434 | 326 |
| 246 | 3300014325 | Ga0163163_10037715 | Ga0163163_100377152 | 326 |
| 247 | 3300021361 | Ga0213872_10000154 | Ga0213872_1000015434 | 326 |
| 248 | 3300025284 | Ga0209130_1003722 | Ga0209130_10037224 | 326 |
| 249 | 3300025291 | Ga0209675_1000981 | Ga0209675_10009815 | 326 |
| 250 | 3300025292 | Ga0209676_1010510 | Ga0209676_10105101 | 326 |
| 251 | 3300025298 | Ga0209050_1010907 | Ga0209050_10109072 | 326 |
| 252 | 3300025303 | Ga0209051_1000025 | Ga0209051_1000025372 | 326 |
| 253 | 3300025303 | Ga0209051_1048586 | Ga0209051_10485861 | 326 |
| 254 | 3300025304 | Ga0209257_1000039 | Ga0209257_1000039236 | 326 |
| 255 | 3300025304 | Ga0209257_1003715 | Ga0209257_100371511 | 326 |
| 256 | 3300025901 | Ga0207688_10185509 | Ga0207688_101855092 | 326 |
| 257 | 3300025920 | Ga0207649_10143812 | Ga0207649_101438122 | 326 |
| 258 | 3300025923 | Ga0207681_10270633 | Ga0207681_102706331 | 326 |
| 259 | 3300025932 | Ga0207690_10147463 | Ga0207690_101474632 | 326 |
| 260 | 3300025938 | Ga0207704_10151506 | Ga0207704_101515062 | 326 |
| 261 | 3300025945 | Ga0207679_10036372 | Ga0207679_100363722 | 326 |
| 262 | 3300026088 | Ga0207641_10344561 | Ga0207641_103445611 | 326 |
| 263 | 3300026095 | Ga0207676_10092593 | Ga0207676_100925933 | 326 |
| 264 | 3300026116 | Ga0207674_10024476 | Ga0207674_100244766 | 326 |
| 265 | 3300026142 | Ga0207698_10212521 | Ga0207698_102125212 | 326 |
| 266 | 3300027671 | Ga0209588_1020191 | Ga0209588_10201912 | 326 |
| 267 | 3300028381 | Ga0268264_10034697 | Ga0268264_100346974 | 326 |
| 268 | 3300031901 | Ga0307406_10013167 | Ga0307406_100131672 | 326 |
| 269 | 3300031995 | Ga0307409_100183640 | Ga0307409_1001836402 | 326 |
| 270 | 3300037312 | Ga0395899_0025702 | Ga0395899_0025702_2601_3584 | 326 |
| 271 | 3300037418 | Ga0395900_0074477 | Ga0395900_0074477_1513_2496 | 326 |
| 272 | 3300037418 | Ga0395900_0145690 | Ga0395900_0145690_346_1329 | 326 |
| 273 | 3300037466 | Ga0395898_0030101 | Ga0395898_0030101_1973_2956 | 326 |
| 274 | 3300037471 | Ga0395905_0122288 | Ga0395905_0122288_1165_2151 | 326 |
| 275 | 3300039447 | Ga0436361_0530495 | Ga0436361_0530495_64123_65145 | 326 |
| 276 | 3300045976 | Ga0466967_0254682 | Ga0466967_0254682_380_1363 | 326 |
| 277 | 3300046475 | Ga0495639_0006269 | Ga0495639_0006269_3585_4592 | 326 |
| 278 | 3300046522 | Ga0495643_0082820 | Ga0495643_0082820_351_1334 | 326 |
| 279 | 3300048911 | Ga0496108_0016373 | Ga0496108_0016373_329_1351 | 326 |
| 280 | 3300048914 | Ga0496111_0205149 | Ga0496111_0205149_430_1419 | 326 |
| 281 | 3300048915 | Ga0496112_0020004 | Ga0496112_0020004_1038_2027 | 326 |
| 282 | 3300048915 | Ga0496112_0037355 | Ga0496112_0037355_2984_4006 | 326 |
| 283 | 3300048916 | Ga0496113_0009595 | Ga0496113_0009595_1233_2222 | 326 |
| 284 | 3300048916 | Ga0496113_0261590 | Ga0496113_0261590_82_1104 | 326 |
| 285 | 3300049571 | Ga0501034_0123456 | Ga0501034_0123456_1433_2416 | 326 |
| 286 | 3300049571 | Ga0501034_0177521 | Ga0501034_0177521_412_1395 | 326 |
| 287 | 3300049571 | Ga0501034_0199710 | Ga0501034_0199710_922_1905 | 326 |
| 288 | 3300049571 | Ga0501034_0470051 | Ga0501034_0470051_78_1061 | 326 |
| 289 | 3300049573 | Ga0501037_0033550 | Ga0501037_0033550_683_1666 | 326 |
| 290 | 3300049573 | Ga0501037_0160482 | Ga0501037_0160482_69_1052 | 326 |
| 291 | 3300049579 | Ga0501043_0002038 | Ga0501043_0002038_8779_9762 | 326 |
| 292 | 3300049579 | Ga0501043_0098853 | Ga0501043_0098853_64_1047 | 326 |
| 293 | 3300049580 | Ga0501046_0007317 | Ga0501046_0007317_5136_6119 | 326 |
| 294 | 3300049580 | Ga0501046_0164448 | Ga0501046_0164448_143_1126 | 326 |
| 295 | 3300049581 | Ga0501047_0000636 | Ga0501047_0000636_27794_28777 | 326 |
| 296 | 3300049581 | Ga0501047_0152253 | Ga0501047_0152253_1086_2069 | 326 |
| 297 | 3300049582 | Ga0501048_0149576 | Ga0501048_0149576_156_1139 | 326 |
| 298 | 3300049582 | Ga0501048_0160637 | Ga0501048_0160637_31_1014 | 326 |
| 299 | 3300049583 | Ga0501067_0009015 | Ga0501067_0009015_2307_3329 | 326 |
| 300 | 3300049583 | Ga0501067_0154803 | Ga0501067_0154803_26_1009 | 326 |
| 301 | 3300049583 | Ga0501067_0228012 | Ga0501067_0228012_29_1012 | 326 |
| 302 | 3300049586 | Ga0501070_0073931 | Ga0501070_0073931_990_1973 | 326 |
| 303 | 3300049589 | Ga0501073_0089428 | Ga0501073_0089428_135_1118 | 326 |
| 304 | 3300049589 | Ga0501073_0205731 | Ga0501073_0205731_35_1018 | 326 |
| 305 | 3300049742 | Ga0501080_0056028 | Ga0501080_0056028_1363_2346 | 326 |
| 306 | 3300049744 | Ga0501083_0001893 | Ga0501083_0001893_3229_4212 | 326 |
| 307 | 3300049744 | Ga0501083_0005890 | Ga0501083_0005890_1099_2082 | 326 |
| 308 | 3300049822 | Ga0501035_0000800 | Ga0501035_0000800_4218_5213 | 326 |
| 309 | 3300049823 | Ga0501044_0075097 | Ga0501044_0075097_479_1462 | 326 |
| 310 | 3300050516 | nmdc:mga0sz30_18084_c1 | nmdc:mga0sz30_18084_c1_675_1682 | 326 |
| 311 | 3300054114 | Ga0501084_0038339 | Ga0501084_0038339_1111_2094 | 326 |
| 312 | 3300054114 | Ga0501084_0266924 | Ga0501084_0266924_181_1164 | 326 |
| 313 | 3300060353 | Ga0501082_0028071 | Ga0501082_0028071_1878_2861 | 326 |
| 314 | iso_pu_bacteria | 2738543013 | 2739251582 | 326 |
| 315 | 3300001904 | JGI24736J21556_1001796 | JGI24736J21556_10017966 | 327 |
| 316 | 3300001915 | JGI24741J21665_1000582 | JGI24741J21665_10005824 | 327 |
| 317 | 3300001979 | JGI24740J21852_10002373 | JGI24740J21852_100023739 | 327 |
| 318 | 3300005327 | Ga0070658_10046534 | Ga0070658_100465344 | 327 |
| 319 | 3300005329 | Ga0070683_100023206 | Ga0070683_1000232066 | 327 |
| 320 | 3300005336 | Ga0070680_100004729 | Ga0070680_10000472911 | 327 |
| 321 | 3300005336 | Ga0070680_100019004 | Ga0070680_1000190046 | 327 |
| 322 | 3300005336 | Ga0070680_100046207 | Ga0070680_1000462072 | 327 |
| 323 | 3300005337 | Ga0070682_100049310 | Ga0070682_1000493102 | 327 |
| 324 | 3300005337 | Ga0070682_100085439 | Ga0070682_1000854392 | 327 |
| 325 | 3300005337 | Ga0070682_100113963 | Ga0070682_1001139632 | 327 |
| 326 | 3300005339 | Ga0070660_100035735 | Ga0070660_1000357355 | 327 |
| 327 | 3300005339 | Ga0070660_100250026 | Ga0070660_1002500262 | 327 |
| 328 | 3300005341 | Ga0070691_10000346 | Ga0070691_1000034610 | 327 |
| 329 | 3300005344 | Ga0070661_100011899 | Ga0070661_1000118997 | 327 |
| 330 | 3300005344 | Ga0070661_100032241 | Ga0070661_1000322415 | 327 |
| 331 | 3300005345 | Ga0070692_10006692 | Ga0070692_100066926 | 327 |
| 332 | 3300005345 | Ga0070692_10012767 | Ga0070692_100127674 | 327 |
| 333 | 3300005455 | Ga0070663_100096368 | Ga0070663_1000963682 | 327 |
| 334 | 3300005458 | Ga0070681_10000944 | Ga0070681_1000094416 | 327 |
| 335 | 3300005458 | Ga0070681_10042102 | Ga0070681_100421022 | 327 |
| 336 | 3300005458 | Ga0070681_10077426 | Ga0070681_100774262 | 327 |
| 337 | 3300005458 | Ga0070681_10079325 | Ga0070681_100793252 | 327 |
| 338 | 3300005468 | Ga0070707_100291758 | Ga0070707_1002917581 | 327 |
| 339 | 3300005530 | Ga0070679_100001195 | Ga0070679_10000119513 | 327 |
| 340 | 3300005530 | Ga0070679_100041528 | Ga0070679_1000415282 | 327 |
| 341 | 3300005530 | Ga0070679_100080762 | Ga0070679_1000807622 | 327 |
| 342 | 3300005530 | Ga0070679_100259093 | Ga0070679_1002590932 | 327 |
| 343 | 3300005535 | Ga0070684_100033388 | Ga0070684_1000333884 | 327 |
| 344 | 3300005539 | Ga0068853_100060825 | Ga0068853_1000608252 | 327 |
| 345 | 3300005539 | Ga0068853_100325541 | Ga0068853_1003255412 | 327 |
| 346 | 3300005546 | Ga0070696_100021029 | Ga0070696_1000210292 | 327 |
| 347 | 3300005563 | Ga0068855_100086230 | Ga0068855_1000862305 | 327 |
| 348 | 3300005564 | Ga0070664_100020672 | Ga0070664_1000206724 | 327 |
| 349 | 3300005564 | Ga0070664_100047232 | Ga0070664_1000472322 | 327 |
| 350 | 3300005577 | Ga0068857_100035167 | Ga0068857_1000351674 | 327 |
| 351 | 3300005577 | Ga0068857_100084204 | Ga0068857_1000842042 | 327 |
| 352 | 3300005577 | Ga0068857_100191711 | Ga0068857_1001917112 | 327 |
| 353 | 3300005578 | Ga0068854_100035067 | Ga0068854_1000350672 | 327 |
| 354 | 3300005614 | Ga0068856_100025937 | Ga0068856_1000259375 | 327 |
| 355 | 3300005614 | Ga0068856_100064087 | Ga0068856_1000640875 | 327 |
| 356 | 3300005614 | Ga0068856_100465197 | Ga0068856_1004651972 | 327 |
| 357 | 3300005616 | Ga0068852_100037601 | Ga0068852_1000376015 | 327 |
| 358 | 3300005842 | Ga0068858_100014485 | Ga0068858_1000144857 | 327 |
| 359 | 3300009093 | Ga0105240_10389256 | Ga0105240_103892562 | 327 |
| 360 | 3300009551 | Ga0105238_10508408 | Ga0105238_105084082 | 327 |
| 361 | 3300009553 | Ga0105249_10021341 | Ga0105249_100213414 | 327 |
| 362 | 3300013102 | Ga0157371_10021219 | Ga0157371_100212192 | 327 |
| 363 | 3300013104 | Ga0157370_10059372 | Ga0157370_100593722 | 327 |
| 364 | 3300013105 | Ga0157369_10041336 | Ga0157369_100413362 | 327 |
| 365 | 3300013105 | Ga0157369_10081484 | Ga0157369_100814843 | 327 |
| 366 | 3300013307 | Ga0157372_10007498 | Ga0157372_100074988 | 327 |
| 367 | 3300013307 | Ga0157372_10086408 | Ga0157372_100864082 | 327 |
| 368 | 3300014325 | Ga0163163_10023142 | Ga0163163_100231424 | 327 |
| 369 | 3300020070 | Ga0206356_11279593 | Ga0206356_112795938 | 327 |
| 370 | 3300020077 | Ga0206351_10870896 | Ga0206351_108708962 | 327 |
| 371 | 3300020080 | Ga0206350_10446903 | Ga0206350_104469032 | 327 |
| 372 | 3300020081 | Ga0206354_10899802 | Ga0206354_108998027 | 327 |
| 373 | 3300020082 | Ga0206353_11006691 | Ga0206353_110066912 | 327 |
| 374 | 3300020082 | Ga0206353_11673663 | Ga0206353_116736632 | 327 |
| 375 | 3300020082 | Ga0206353_12066740 | Ga0206353_120667402 | 327 |
| 376 | 3300020610 | Ga0154015_1215416 | Ga0154015_12154167 | 327 |
| 377 | 3300021361 | Ga0213872_10001077 | Ga0213872_1000107715 | 327 |
| 378 | 3300021384 | Ga0213876_10093465 | Ga0213876_100934651 | 327 |
| 379 | 3300025904 | Ga0207647_10000677 | Ga0207647_100006776 | 327 |
| 380 | 3300025904 | Ga0207647_10001610 | Ga0207647_100016108 | 327 |
| 381 | 3300025904 | Ga0207647_10023607 | Ga0207647_100236074 | 327 |
| 382 | 3300025909 | Ga0207705_10001829 | Ga0207705_100018298 | 327 |
| 383 | 3300025909 | Ga0207705_10002514 | Ga0207705_100025148 | 327 |
| 384 | 3300025909 | Ga0207705_10004985 | Ga0207705_100049857 | 327 |
| 385 | 3300025909 | Ga0207705_10016011 | Ga0207705_100160116 | 327 |
| 386 | 3300025912 | Ga0207707_10001419 | Ga0207707_1000141915 | 327 |
| 387 | 3300025912 | Ga0207707_10003100 | Ga0207707_1000310010 | 327 |
| 388 | 3300025912 | Ga0207707_10032224 | Ga0207707_100322242 | 327 |
| 389 | 3300025912 | Ga0207707_10082705 | Ga0207707_100827053 | 327 |
| 390 | 3300025913 | Ga0207695_10004738 | Ga0207695_1000473812 | 327 |
| 391 | 3300025913 | Ga0207695_10016841 | Ga0207695_100168416 | 327 |
| 392 | 3300025913 | Ga0207695_10020794 | Ga0207695_100207948 | 327 |
| 393 | 3300025917 | Ga0207660_10001517 | Ga0207660_1000151715 | 327 |
| 394 | 3300025917 | Ga0207660_10007012 | Ga0207660_100070125 | 327 |
| 395 | 3300025917 | Ga0207660_10015836 | Ga0207660_100158366 | 327 |
| 396 | 3300025917 | Ga0207660_10018280 | Ga0207660_100182806 | 327 |
| 397 | 3300025917 | Ga0207660_10043401 | Ga0207660_100434012 | 327 |
| 398 | 3300025919 | Ga0207657_10008479 | Ga0207657_100084797 | 327 |
| 399 | 3300025919 | Ga0207657_10008724 | Ga0207657_100087246 | 327 |
| 400 | 3300025919 | Ga0207657_10018265 | Ga0207657_100182656 | 327 |
| 401 | 3300025919 | Ga0207657_10024698 | Ga0207657_100246986 | 327 |
| 402 | 3300025920 | Ga0207649_10002686 | Ga0207649_100026868 | 327 |
| 403 | 3300025920 | Ga0207649_10010440 | Ga0207649_100104404 | 327 |
| 404 | 3300025920 | Ga0207649_10022348 | Ga0207649_100223482 | 327 |
| 405 | 3300025921 | Ga0207652_10000022 | Ga0207652_10000022130 | 327 |
| 406 | 3300025921 | Ga0207652_10003362 | Ga0207652_100033628 | 327 |
| 407 | 3300025921 | Ga0207652_10005539 | Ga0207652_1000553914 | 327 |
| 408 | 3300025924 | Ga0207694_10097465 | Ga0207694_100974652 | 327 |
| 409 | 3300025932 | Ga0207690_10000913 | Ga0207690_100009138 | 327 |
| 410 | 3300025944 | Ga0207661_10004890 | Ga0207661_100048906 | 327 |
| 411 | 3300025944 | Ga0207661_10224154 | Ga0207661_102241542 | 327 |
| 412 | 3300025945 | Ga0207679_10057463 | Ga0207679_100574633 | 327 |
| 413 | 3300025945 | Ga0207679_10062086 | Ga0207679_100620864 | 327 |
| 414 | 3300025945 | Ga0207679_10177404 | Ga0207679_101774043 | 327 |
| 415 | 3300025949 | Ga0207667_10008048 | Ga0207667_100080482 | 327 |
| 416 | 3300025949 | Ga0207667_10008565 | Ga0207667_100085659 | 327 |
| 417 | 3300025949 | Ga0207667_10010015 | Ga0207667_1001001512 | 327 |
| 418 | 3300025949 | Ga0207667_10024202 | Ga0207667_100242022 | 327 |
| 419 | 3300025981 | Ga0207640_10002697 | Ga0207640_100026977 | 327 |
| 420 | 3300025981 | Ga0207640_10007005 | Ga0207640_100070055 | 327 |
| 421 | 3300025981 | Ga0207640_10174289 | Ga0207640_101742892 | 327 |
| 422 | 3300026035 | Ga0207703_10010204 | Ga0207703_100102047 | 327 |
| 423 | 3300026041 | Ga0207639_10005288 | Ga0207639_1000528812 | 327 |
| 424 | 3300026041 | Ga0207639_10018414 | Ga0207639_100184142 | 327 |
| 425 | 3300026041 | Ga0207639_10028040 | Ga0207639_100280402 | 327 |
| 426 | 3300026041 | Ga0207639_10207337 | Ga0207639_102073372 | 327 |
| 427 | 3300026067 | Ga0207678_10004139 | Ga0207678_1000413912 | 327 |
| 428 | 3300026067 | Ga0207678_10005965 | Ga0207678_100059659 | 327 |
| 429 | 3300026067 | Ga0207678_10016535 | Ga0207678_100165356 | 327 |
| 430 | 3300026067 | Ga0207678_10024028 | Ga0207678_100240285 | 327 |
| 431 | 3300026078 | Ga0207702_10003761 | Ga0207702_1000376111 | 327 |
| 432 | 3300026116 | Ga0207674_10001397 | Ga0207674_1000139727 | 327 |
| 433 | 3300026116 | Ga0207674_10016247 | Ga0207674_100162476 | 327 |
| 434 | 3300026116 | Ga0207674_10209486 | Ga0207674_102094862 | 327 |
| 435 | 3300026142 | Ga0207698_10001610 | Ga0207698_100016106 | 327 |
| 436 | 3300026142 | Ga0207698_10005754 | Ga0207698_100057549 | 327 |
| 437 | 3300026142 | Ga0207698_10098851 | Ga0207698_100988513 | 327 |
| 438 | 3300028563 | Ga0265319_1007401 | Ga0265319_10074014 | 327 |
| 439 | 3300028577 | Ga0265318_10002906 | Ga0265318_100029065 | 327 |
| 440 | 3300031824 | Ga0307413_10037912 | Ga0307413_100379122 | 327 |
| 441 | 3300031903 | Ga0307407_10014441 | Ga0307407_100144412 | 327 |
| 442 | 3300032002 | Ga0307416_100027749 | Ga0307416_1000277493 | 327 |
| 443 | 3300032004 | Ga0307414_10222628 | Ga0307414_102226281 | 327 |
| 444 | 3300037312 | Ga0395899_0000644 | Ga0395899_0000644_19469_20455 | 327 |
| 445 | 3300037312 | Ga0395899_0000662 | Ga0395899_0000662_12181_13167 | 327 |
| 446 | 3300037312 | Ga0395899_0239167 | Ga0395899_0239167_127_1113 | 327 |
| 447 | 3300037418 | Ga0395900_0118560 | Ga0395900_0118560_1119_2105 | 327 |
| 448 | 3300037418 | Ga0395900_0154710 | Ga0395900_0154710_1330_2319 | 327 |
| 449 | 3300037418 | Ga0395900_0158821 | Ga0395900_0158821_237_1241 | 327 |
| 450 | 3300037466 | Ga0395898_0025292 | Ga0395898_0025292_4772_5761 | 327 |
| 451 | 3300037471 | Ga0395905_0248862 | Ga0395905_0248862_76_1062 | 327 |
| 452 | 3300039437 | Ga0436365_0471224 | Ga0436365_0471224_358_1344 | 327 |
| 453 | 3300039447 | Ga0436361_0197147 | Ga0436361_0197147_62354_63367 | 327 |
| 454 | 3300042004 | Ga0439445_0012513 | Ga0439445_0012513_846_1832 | 327 |
| 455 | 3300042115 | Ga0450911_000141 | Ga0450911_000141_4163_5149 | 327 |
| 456 | 3300044673 | Ga0453683_0000198 | Ga0453683_0000198_61889_62881 | 327 |
| 457 | 3300044901 | Ga0466960_0070385 | Ga0466960_0070385_211_1197 | 327 |
| 458 | 3300046474 | Ga0495605_0030832 | Ga0495605_0030832_476_1462 | 327 |
| 459 | 3300046500 | Ga0495596_0001018 | Ga0495596_0001018_12189_13175 | 327 |
| 460 | 3300046615 | Ga0495656_0079511 | Ga0495656_0079511_31_1020 | 327 |
| 461 | 3300046615 | Ga0495656_0130193 | Ga0495656_0130193_69_1070 | 327 |
| 462 | 3300046616 | Ga0495668_0024888 | Ga0495668_0024888_1955_2941 | 327 |
| 463 | 3300047320 | Ga0495672_0038540 | Ga0495672_0038540_1266_2252 | 327 |
| 464 | 3300048090 | Ga0495615_0022726 | Ga0495615_0022726_131_1120 | 327 |
| 465 | 3300048924 | Ga0496121_0001731 | Ga0496121_0001731_24301_25287 | 327 |
| 466 | 3300048928 | Ga0496125_0008875 | Ga0496125_0008875_936_1922 | 327 |
| 467 | 3300048928 | Ga0496125_0016390 | Ga0496125_0016390_3527_4513 | 327 |
| 468 | 3300048928 | Ga0496125_0017649 | Ga0496125_0017649_3212_4198 | 327 |
| 469 | 3300049569 | Ga0501032_0005683 | Ga0501032_0005683_1379_2428 | 327 |
| 470 | 3300049571 | Ga0501034_0001513 | Ga0501034_0001513_9177_10226 | 327 |
| 471 | 3300049572 | Ga0501036_0011841 | Ga0501036_0011841_3108_4157 | 327 |
| 472 | 3300049573 | Ga0501037_0021070 | Ga0501037_0021070_3681_4670 | 327 |
| 473 | 3300049573 | Ga0501037_0099157 | Ga0501037_0099157_545_1594 | 327 |
| 474 | 3300049573 | Ga0501037_0111961 | Ga0501037_0111961_510_1499 | 327 |
| 475 | 3300049574 | Ga0501038_0003528 | Ga0501038_0003528_10602_11651 | 327 |
| 476 | 3300049574 | Ga0501038_0124171 | Ga0501038_0124171_373_1362 | 327 |
| 477 | 3300049575 | Ga0501039_0008209 | Ga0501039_0008209_154_1203 | 327 |
| 478 | 3300049580 | Ga0501046_0010238 | Ga0501046_0010238_1931_2980 | 327 |
| 479 | 3300049581 | Ga0501047_0004452 | Ga0501047_0004452_9489_10538 | 327 |
| 480 | 3300049581 | Ga0501047_0010184 | Ga0501047_0010184_1594_2583 | 327 |
| 481 | 3300049581 | Ga0501047_0077275 | Ga0501047_0077275_101_1090 | 327 |
| 482 | 3300049585 | Ga0501069_0026990 | Ga0501069_0026990_1362_2351 | 327 |
| 483 | 3300049585 | Ga0501069_0090943 | Ga0501069_0090943_356_1345 | 327 |
| 484 | 3300049586 | Ga0501070_0000311 | Ga0501070_0000311_8215_9204 | 327 |
| 485 | 3300049586 | Ga0501070_0007856 | Ga0501070_0007856_981_1970 | 327 |
| 486 | 3300049586 | Ga0501070_0033376 | Ga0501070_0033376_216_1205 | 327 |
| 487 | 3300049587 | Ga0501071_0026775 | Ga0501071_0026775_905_1894 | 327 |
| 488 | 3300049589 | Ga0501073_0012242 | Ga0501073_0012242_2204_3253 | 327 |
| 489 | 3300049589 | Ga0501073_0013127 | Ga0501073_0013127_345_1334 | 327 |
| 490 | 3300049590 | Ga0501074_0001303 | Ga0501074_0001303_2630_3619 | 327 |
| 491 | 3300049590 | Ga0501074_0025338 | Ga0501074_0025338_2670_3659 | 327 |
| 492 | 3300049741 | Ga0501079_0094471 | Ga0501079_0094471_18_1007 | 327 |
| 493 | 3300049742 | Ga0501080_0002966 | Ga0501080_0002966_8615_9604 | 327 |
| 494 | 3300049742 | Ga0501080_0007885 | Ga0501080_0007885_7349_8398 | 327 |
| 495 | 3300049744 | Ga0501083_0190527 | Ga0501083_0190527_235_1266 | 327 |
| 496 | 3300049822 | Ga0501035_0008949 | Ga0501035_0008949_112_1101 | 327 |
| 497 | 3300049822 | Ga0501035_0014906 | Ga0501035_0014906_3769_4758 | 327 |
| 498 | 3300049822 | Ga0501035_0034708 | Ga0501035_0034708_224_1213 | 327 |
| 499 | 3300049823 | Ga0501044_0029070 | Ga0501044_0029070_1825_2874 | 327 |
| 500 | 3300049823 | Ga0501044_0113668 | Ga0501044_0113668_889_1878 | 327 |
| 501 | 3300049823 | Ga0501044_0116094 | Ga0501044_0116094_1480_2469 | 327 |
| 502 | 3300049823 | Ga0501044_0180307 | Ga0501044_0180307_867_1856 | 327 |
| 503 | 3300060353 | Ga0501082_0019565 | Ga0501082_0019565_1672_2721 | 327 |
| 504 | iso_pu_bacteria | 2510917026 | 2511171483 | 327 |
| 505 | iso_pu_bacteria | 2558860983 | 2561468075 | 327 |
| 506 | iso_pu_bacteria | 2582581304 | 2585257667 | 327 |
| 507 | iso_pu_bacteria | 2585427594 | 2585845185 | 327 |
| 508 | iso_pu_bacteria | 2599185236 | 2599722495 | 327 |
| 509 | iso_pu_bacteria | 2738541293 | 2738800597 | 327 |
| 510 | iso_pu_bacteria | 2835188231 | 2835190205 | 327 |
| 511 | iso_pu_bacteria | 2838736955 | 2838737487 | 327 |
| 512 | iso_pu_bacteria | 2841840854 | 2841842144 | 327 |
| 513 | iso_pu_bacteria | 2842140634 | 2842141923 | 327 |
| 514 | iso_pu_bacteria | 2854896431 | 2854900357 | 327 |
| 515 | iso_pu_bacteria | 2854916844 | 2854920189 | 327 |
| 516 | iso_pu_bacteria | 639633007 | 639786329 | 327 |
| 517 | iso_pu_bacteria | 8055431914 | 8055432145 | 327 |
| 518 | 3300003187 | JGI25151J46595_10032082 | JGI25151J46595_100320822 | 328 |
| 519 | 3300003759 | Ga0055525_1000036 | Ga0055525_100003640 | 328 |
| 520 | 3300005441 | Ga0070700_100176122 | Ga0070700_1001761221 | 328 |
| 521 | 3300005445 | Ga0070708_100000241 | Ga0070708_10000024119 | 328 |
| 522 | 3300005445 | Ga0070708_100004969 | Ga0070708_1000049694 | 328 |
| 523 | 3300005456 | Ga0070678_100047817 | Ga0070678_1000478173 | 328 |
| 524 | 3300005468 | Ga0070707_100132667 | Ga0070707_1001326672 | 328 |
| 525 | 3300005518 | Ga0070699_100029109 | Ga0070699_1000291095 | 328 |
| 526 | 3300005543 | Ga0070672_100077333 | Ga0070672_1000773332 | 328 |
| 527 | 3300005548 | Ga0070665_100025227 | Ga0070665_1000252272 | 328 |
| 528 | 3300005563 | Ga0068855_100016173 | Ga0068855_1000161734 | 328 |
| 529 | 3300005563 | Ga0068855_100210331 | Ga0068855_1002103312 | 328 |
| 530 | 3300005618 | Ga0068864_100067294 | Ga0068864_1000672942 | 328 |
| 531 | 3300006178 | Ga0075367_10058543 | Ga0075367_100585432 | 328 |
| 532 | 3300006846 | Ga0075430_100047465 | Ga0075430_1000474652 | 328 |
| 533 | 3300007265 | Ga0099794_10041302 | Ga0099794_100413022 | 328 |
| 534 | 3300009011 | Ga0105251_10029058 | Ga0105251_100290581 | 328 |
| 535 | 3300009147 | Ga0114129_10117336 | Ga0114129_101173365 | 328 |
| 536 | 3300009177 | Ga0105248_10053339 | Ga0105248_100533392 | 328 |
| 537 | 3300009177 | Ga0105248_10310526 | Ga0105248_103105262 | 328 |
| 538 | 3300009553 | Ga0105249_10093171 | Ga0105249_100931711 | 328 |
| 539 | 3300013306 | Ga0163162_10056641 | Ga0163162_100566412 | 328 |
| 540 | 3300015683 | Ga0183362_10019 | Ga0183362_1001914 | 328 |
| 541 | 3300017792 | Ga0163161_10186179 | Ga0163161_101861792 | 328 |
| 542 | 3300021361 | Ga0213872_10000073 | Ga0213872_1000007367 | 328 |
| 543 | 3300025230 | Ga0209563_100014 | Ga0209563_100014423 | 328 |
| 544 | 3300025294 | Ga0209025_1000359 | Ga0209025_100035965 | 328 |
| 545 | 3300025917 | Ga0207660_10205888 | Ga0207660_102058882 | 328 |
| 546 | 3300025932 | Ga0207690_10195532 | Ga0207690_101955322 | 328 |
| 547 | 3300025949 | Ga0207667_10010275 | Ga0207667_100102755 | 328 |
| 548 | 3300025949 | Ga0207667_10159902 | Ga0207667_101599022 | 328 |
| 549 | 3300025960 | Ga0207651_10100285 | Ga0207651_101002852 | 328 |
| 550 | 3300026075 | Ga0207708_10090026 | Ga0207708_100900262 | 328 |
| 551 | 3300026121 | Ga0207683_10014618 | Ga0207683_100146186 | 328 |
| 552 | 3300026121 | Ga0207683_10021474 | Ga0207683_100214742 | 328 |
| 553 | 3300028379 | Ga0268266_10059413 | Ga0268266_100594133 | 328 |
| 554 | 3300028794 | Ga0307515_10000651 | Ga0307515_1000065128 | 328 |
| 555 | 3300030521 | Ga0307511_10000077 | Ga0307511_1000007745 | 328 |
| 556 | 3300031249 | Ga0265339_10000691 | Ga0265339_100006915 | 328 |
| 557 | 3300031344 | Ga0265316_10001019 | Ga0265316_100010192 | 328 |
| 558 | 3300031548 | Ga0307408_100355402 | Ga0307408_1003554021 | 328 |
| 559 | 3300031711 | Ga0265314_10000003 | Ga0265314_10000003213 | 328 |
| 560 | 3300031901 | Ga0307406_10226006 | Ga0307406_102260062 | 328 |
| 561 | 3300032002 | Ga0307416_100273224 | Ga0307416_1002732242 | 328 |
| 562 | 3300036647 | Ga0316582_0165885 | Ga0316582_0165885_321_1310 | 328 |
| 563 | 3300039447 | Ga0436361_0736070 | Ga0436361_0736070_20991_22007 | 328 |
| 564 | 3300046454 | Ga0495592_0300675 | Ga0495592_0300675_20_1015 | 328 |
| 565 | 3300046462 | Ga0495651_0038320 | Ga0495651_0038320_2210_3205 | 328 |
| 566 | 3300048905 | Ga0496102_0161824 | Ga0496102_0161824_595_1653 | 328 |
| 567 | 3300048906 | Ga0496103_0068404 | Ga0496103_0068404_247_1305 | 328 |
| 568 | 3300048907 | Ga0496104_0174149 | Ga0496104_0174149_448_1506 | 328 |
| 569 | 3300048908 | Ga0496105_0066482 | Ga0496105_0066482_632_1690 | 328 |
| 570 | 3300048911 | Ga0496108_0108699 | Ga0496108_0108699_450_1508 | 328 |
| 571 | 3300048913 | Ga0496110_0055640 | Ga0496110_0055640_1596_2591 | 328 |
| 572 | 3300048914 | Ga0496111_0109142 | Ga0496111_0109142_682_1677 | 328 |
| 573 | 3300048916 | Ga0496113_0142115 | Ga0496113_0142115_450_1508 | 328 |
| 574 | 3300048922 | Ga0496119_0041996 | Ga0496119_0041996_1392_2450 | 328 |
| 575 | 3300048925 | Ga0496122_0054120 | Ga0496122_0054120_1454_2512 | 328 |
| 576 | 3300048928 | Ga0496125_0061916 | Ga0496125_0061916_1289_2347 | 328 |
| 577 | 3300049570 | Ga0501033_0053265 | Ga0501033_0053265_93_1082 | 328 |
| 578 | 3300049823 | Ga0501044_0321580 | Ga0501044_0321580_129_1118 | 328 |
| 579 | 3300050496 | nmdc:mga07m45_18218_c1 | nmdc:mga07m45_18218_c1_1068_2087 | 328 |
| 580 | 3300050509 | nmdc:mga0qj67_51303_c1 | nmdc:mga0qj67_51303_c1_86_1123 | 328 |
| 581 | iso_pu_bacteria | 2510461069 | 2510842552 | 328 |
| 582 | iso_pu_bacteria | 2510917022 | 2511136687 | 328 |
| 583 | iso_pu_bacteria | 2524023209 | 2524462067 | 328 |
| 584 | iso_pu_bacteria | 2582581307 | 2585274156 | 328 |
| 585 | iso_pu_bacteria | 2582581308 | 2585280436 | 328 |
| 586 | iso_pu_bacteria | 2582581315 | 2585322709 | 328 |
| 587 | iso_pu_bacteria | 2582581316 | 2585330826 | 328 |
| 588 | iso_pu_bacteria | 2585427527 | 2585532664 | 328 |
| 589 | iso_pu_bacteria | 2585427530 | 2585554320 | 328 |
| 590 | iso_pu_bacteria | 2585427531 | 2585560605 | 328 |
| 591 | iso_pu_bacteria | 2585427608 | 2585898816 | 328 |
| 592 | iso_pu_bacteria | 2585427609 | 2585903597 | 328 |
| 593 | iso_pu_bacteria | 2585428125 | 2587981283 | 328 |
| 594 | iso_pu_bacteria | 2615840626 | 2616307265 | 328 |
| 595 | iso_pu_bacteria | 2617270742 | 2617383487 | 328 |
| 596 | iso_pu_bacteria | 2643221558 | 2643813149 | 328 |
| 597 | iso_pu_bacteria | 2667528174 | 2671112062 | 328 |
| 598 | iso_pu_bacteria | 2738541317 | 2738944382 | 328 |
| 599 | iso_pu_bacteria | 2775507266 | 2778175882 | 328 |
| 600 | iso_pu_bacteria | 2818991453 | 2819639833 | 328 |
| 601 | iso_pu_bacteria | 2838029111 | 2838033001 | 328 |
| 602 | iso_pu_bacteria | 2842298080 | 2842298566 | 328 |
| 603 | iso_pu_bacteria | 2842357229 | 2842362418 | 328 |
| 604 | iso_pu_bacteria | 2842475841 | 2842479734 | 328 |
| 605 | iso_pu_bacteria | 2842482326 | 2842483524 | 328 |
| 606 | iso_pu_bacteria | 2842502639 | 2842506910 | 328 |
| 607 | iso_pu_bacteria | 2842509118 | 2842510594 | 328 |
| 608 | iso_pu_bacteria | 2852387548 | 2852391045 | 328 |
| 609 | iso_pu_bacteria | 2894772417 | 2894772567 | 328 |
| 610 | iso_pu_bacteria | 2913308742 | 2913309001 | 328 |
| 611 | iso_pu_bacteria | 2919408235 | 2919410546 | 328 |
| 612 | iso_pu_bacteria | 2929138655 | 2929141292 | 328 |
| 613 | iso_pu_bacteria | 3005416602 | 3005418618 | 328 |
| 614 | iso_pu_bacteria | 8005314921 | 8005318490 | 328 |
| 615 | iso_pu_bacteria | 8005682033 | 8005682335 | 328 |
| 616 | iso_pu_bacteria | 8056875544 | 8056876070 | 328 |
| 617 | iso_pu_bacteria | 8057575449 | 8057577532 | 328 |
| 618 | 3300005329 | Ga0070683_100121335 | Ga0070683_1001213352 | 329 |
| 619 | 3300005336 | Ga0070680_100293576 | Ga0070680_1002935762 | 329 |
| 620 | 3300005338 | Ga0068868_100193279 | Ga0068868_1001932791 | 329 |
| 621 | 3300005353 | Ga0070669_100036844 | Ga0070669_1000368442 | 329 |
| 622 | 3300005435 | Ga0070714_100049230 | Ga0070714_1000492304 | 329 |
| 623 | 3300005535 | Ga0070684_100073917 | Ga0070684_1000739173 | 329 |
| 624 | 3300006038 | Ga0075365_10203020 | Ga0075365_102030202 | 329 |
| 625 | 3300006847 | Ga0075431_100157557 | Ga0075431_1001575573 | 329 |
| 626 | 3300006871 | Ga0075434_100286532 | Ga0075434_1002865322 | 329 |
| 627 | 3300007265 | Ga0099794_10012174 | Ga0099794_100121743 | 329 |
| 628 | 3300009177 | Ga0105248_10000043 | Ga0105248_1000004358 | 329 |
| 629 | 3300014325 | Ga0163163_10016430 | Ga0163163_100164305 | 329 |
| 630 | 3300014497 | Ga0182008_10001809 | Ga0182008_1000180911 | 329 |
| 631 | 3300021361 | Ga0213872_10000017 | Ga0213872_10000017164 | 329 |
| 632 | 3300025246 | Ga0209646_1000097 | Ga0209646_1000097154 | 329 |
| 633 | 3300025909 | Ga0207705_10066289 | Ga0207705_100662893 | 329 |
| 634 | 3300025923 | Ga0207681_10001417 | Ga0207681_100014172 | 329 |
| 635 | 3300026023 | Ga0207677_10164895 | Ga0207677_101648951 | 329 |
| 636 | 3300028558 | Ga0265326_10013540 | Ga0265326_100135402 | 329 |
| 637 | 3300028563 | Ga0265319_1012116 | Ga0265319_10121163 | 329 |
| 638 | 3300028573 | Ga0265334_10003454 | Ga0265334_100034543 | 329 |
| 639 | 3300028577 | Ga0265318_10001215 | Ga0265318_100012156 | 329 |
| 640 | 3300028800 | Ga0265338_10005969 | Ga0265338_1000596913 | 329 |
| 641 | 3300030521 | Ga0307511_10000851 | Ga0307511_1000085122 | 329 |
| 642 | 3300031238 | Ga0265332_10001462 | Ga0265332_100014623 | 329 |
| 643 | 3300031240 | Ga0265320_10002610 | Ga0265320_100026103 | 329 |
| 644 | 3300031241 | Ga0265325_10005974 | Ga0265325_100059743 | 329 |
| 645 | 3300031242 | Ga0265329_10001757 | Ga0265329_100017572 | 329 |
| 646 | 3300031249 | Ga0265339_10013975 | Ga0265339_100139753 | 329 |
| 647 | 3300031251 | Ga0265327_10023427 | Ga0265327_100234274 | 329 |
| 648 | 3300031344 | Ga0265316_10009140 | Ga0265316_100091403 | 329 |
| 649 | 3300031595 | Ga0265313_10006665 | Ga0265313_100066658 | 329 |
| 650 | 3300031711 | Ga0265314_10006556 | Ga0265314_100065565 | 329 |
| 651 | 3300031712 | Ga0265342_10002161 | Ga0265342_1000216117 | 329 |
| 652 | 3300031824 | Ga0307413_10008271 | Ga0307413_100082713 | 329 |
| 653 | 3300031995 | Ga0307409_100219575 | Ga0307409_1002195752 | 329 |
| 654 | 3300036401 | Ga0373937_0381280 | Ga0373937_0381280_288_1280 | 329 |
| 655 | 3300037418 | Ga0395900_0258829 | Ga0395900_0258829_480_1472 | 329 |
| 656 | 3300037471 | Ga0395905_0000126 | Ga0395905_0000126_50233_51240 | 329 |
| 657 | 3300037471 | Ga0395905_0078544 | Ga0395905_0078544_1359_2351 | 329 |
| 658 | 3300037471 | Ga0395905_0086219 | Ga0395905_0086219_1230_2225 | 329 |
| 659 | 3300038443 | Ga0395901_0065755 | Ga0395901_0065755_1615_2607 | 329 |
| 660 | 3300039447 | Ga0436361_0472104 | Ga0436361_0472104_2979_3971 | 329 |
| 661 | 3300039447 | Ga0436361_1101954 | Ga0436361_1101954_31407_32414 | 329 |
| 662 | 3300045051 | Ga0451576_0192238 | Ga0451576_0192238_660_1673 | 329 |
| 663 | 3300046530 | Ga0495654_0095774 | Ga0495654_0095774_27_1028 | 329 |
| 664 | 3300046681 | Ga0495647_0060424 | Ga0495647_0060424_390_1394 | 329 |
| 665 | 3300048913 | Ga0496110_0153655 | Ga0496110_0153655_582_1574 | 329 |
| 666 | 3300048925 | Ga0496122_0000080 | Ga0496122_0000080_177926_178927 | 329 |
| 667 | 3300048926 | Ga0496123_0000072 | Ga0496123_0000072_33459_34460 | 329 |
| 668 | 3300049572 | Ga0501036_0221525 | Ga0501036_0221525_190_1185 | 329 |
| 669 | 3300049574 | Ga0501038_0055230 | Ga0501038_0055230_361_1356 | 329 |
| 670 | 3300049576 | Ga0501040_0037608 | Ga0501040_0037608_1074_2075 | 329 |
| 671 | 3300049581 | Ga0501047_0113730 | Ga0501047_0113730_1574_2572 | 329 |
| 672 | 3300049582 | Ga0501048_0084400 | Ga0501048_0084400_300_1295 | 329 |
| 673 | 3300049588 | Ga0501072_0244843 | Ga0501072_0244843_418_1416 | 329 |
| 674 | 3300049590 | Ga0501074_0279110 | Ga0501074_0279110_81_1094 | 329 |
| 675 | 3300049592 | Ga0501076_0167009 | Ga0501076_0167009_350_1351 | 329 |
| 676 | 3300049744 | Ga0501083_0000239 | Ga0501083_0000239_26638_27636 | 329 |
| 677 | 3300050492 | nmdc:mga0yw44_257267_c1 | nmdc:mga0yw44_257267_c1_137_1129 | 329 |
| 678 | 3300050512 | nmdc:mga0n895_82117_c1 | nmdc:mga0n895_82117_c1_2000_2992 | 329 |
| 679 | 3300050516 | nmdc:mga0sz30_12942_c1 | nmdc:mga0sz30_12942_c1_2106_3098 | 329 |
| 680 | 3300053092 | Ga0500583_0003360 | Ga0500583_0003360_2072_3064 | 329 |
| 681 | 3300053133 | Ga0500655_016915 | Ga0500655_016915_74_1066 | 329 |
| 682 | 3300053136 | Ga0500559_0001871 | Ga0500559_0001871_5062_6075 | 329 |
| 683 | 3300053139 | Ga0500568_0000005 | Ga0500568_0000005_397999_398997 | 329 |
| 684 | 3300053151 | Ga0500604_0004171 | Ga0500604_0004171_701_1693 | 329 |
| 685 | 3300053156 | Ga0500622_0098291 | Ga0500622_0098291_71_1084 | 329 |
| 686 | 3300054114 | Ga0501084_0000322 | Ga0501084_0000322_27931_28929 | 329 |
| 687 | 3300060353 | Ga0501082_0185140 | Ga0501082_0185140_778_1779 | 329 |
| 688 | iso_pu_bacteria | 2509276021 | 2509389978 | 329 |
| 689 | iso_pu_bacteria | 2509276033 | 2509447787 | 329 |
| 690 | iso_pu_bacteria | 2510065019 | 2510134699 | 329 |
| 691 | iso_pu_bacteria | 2510461076 | 2510896050 | 329 |
| 692 | iso_pu_bacteria | 2510917030 | 2511200459 | 329 |
| 693 | iso_pu_bacteria | 2513237084 | 2513573249 | 329 |
| 694 | iso_pu_bacteria | 2513237085 | 2513578500 | 329 |
| 695 | iso_pu_bacteria | 2513237088 | 2513599098 | 329 |
| 696 | iso_pu_bacteria | 2513237093 | 2513631462 | 329 |
| 697 | iso_pu_bacteria | 2513237103 | 2513710605 | 329 |
| 698 | iso_pu_bacteria | 2513237144 | 2513908315 | 329 |
| 699 | iso_pu_bacteria | 2513237146 | 2513926825 | 329 |
| 700 | iso_pu_bacteria | 2513237162 | 2514023412 | 329 |
| 701 | iso_pu_bacteria | 2515075009 | 2515113790 | 329 |
| 702 | iso_pu_bacteria | 2515154113 | 2515634654 | 329 |
| 703 | iso_pu_bacteria | 2515154114 | 2515645302 | 329 |
| 704 | iso_pu_bacteria | 2515154116 | 2515660892 | 329 |
| 705 | iso_pu_bacteria | 2515154134 | 2515743512 | 329 |
| 706 | iso_pu_bacteria | 2516653077 | 2517037401 | 329 |
| 707 | iso_pu_bacteria | 2517093000 | 2517096500 | 329 |
| 708 | iso_pu_bacteria | 2517287029 | 2517410597 | 329 |
| 709 | iso_pu_bacteria | 2519899620 | 2520378007 | 329 |
| 710 | iso_pu_bacteria | 2529292951 | 2530646817 | 329 |
| 711 | iso_pu_bacteria | 2534681796 | 2535519568 | 329 |
| 712 | iso_pu_bacteria | 2537561587 | 2537876440 | 329 |
| 713 | iso_pu_bacteria | 2554235003 | 2554245231 | 329 |
| 714 | iso_pu_bacteria | 2558860242 | 2559296939 | 329 |
| 715 | iso_pu_bacteria | 2582581298 | 2585224935 | 329 |
| 716 | iso_pu_bacteria | 2582581299 | 2585227659 | 329 |
| 717 | iso_pu_bacteria | 2585427528 | 2585541155 | 329 |
| 718 | iso_pu_bacteria | 2585427529 | 2585547491 | 329 |
| 719 | iso_pu_bacteria | 2585427593 | 2585839918 | 329 |
| 720 | iso_pu_bacteria | 2585427633 | 2585997027 | 329 |
| 721 | iso_pu_bacteria | 2585427634 | 2586001628 | 329 |
| 722 | iso_pu_bacteria | 2599185170 | 2599420682 | 329 |
| 723 | iso_pu_bacteria | 2599185210 | 2599604629 | 329 |
| 724 | iso_pu_bacteria | 2600254933 | 2600373763 | 329 |
| 725 | iso_pu_bacteria | 2615840624 | 2616295421 | 329 |
| 726 | iso_pu_bacteria | 2643221599 | 2644006267 | 329 |
| 727 | iso_pu_bacteria | 2643221634 | 2644191523 | 329 |
| 728 | iso_pu_bacteria | 2643221643 | 2644241723 | 329 |
| 729 | iso_pu_bacteria | 2643221653 | 2644299122 | 329 |
| 730 | iso_pu_bacteria | 2643221693 | 2644521181 | 329 |
| 731 | iso_pu_bacteria | 2643221719 | 2644657350 | 329 |
| 732 | iso_pu_bacteria | 2718217882 | 2719182469 | 329 |
| 733 | iso_pu_bacteria | 2718217927 | 2719387128 | 329 |
| 734 | iso_pu_bacteria | 2718217997 | 2719666772 | 329 |
| 735 | iso_pu_bacteria | 2718218009 | 2719733188 | 329 |
| 736 | iso_pu_bacteria | 2718218199 | 2720493192 | 329 |
| 737 | iso_pu_bacteria | 2718218232 | 2720614669 | 329 |
| 738 | iso_pu_bacteria | 2718218233 | 2720621442 | 329 |
| 739 | iso_pu_bacteria | 2718218235 | 2720632770 | 329 |
| 740 | iso_pu_bacteria | 2718218269 | 2720776494 | 329 |
| 741 | iso_pu_bacteria | 2718218363 | 2721148582 | 329 |
| 742 | iso_pu_bacteria | 2718218365 | 2721159968 | 329 |
| 743 | iso_pu_bacteria | 2718218366 | 2721165396 | 329 |
| 744 | iso_pu_bacteria | 2718218423 | 2721400763 | 329 |
| 745 | iso_pu_bacteria | 2721755514 | 2722841566 | 329 |
| 746 | iso_pu_bacteria | 2721755556 | 2723028082 | 329 |
| 747 | iso_pu_bacteria | 2721755684 | 2723561713 | 329 |
| 748 | iso_pu_bacteria | 2721755685 | 2723568342 | 329 |
| 749 | iso_pu_bacteria | 2721755809 | 2724039576 | 329 |
| 750 | iso_pu_bacteria | 2721755810 | 2724045944 | 329 |
| 751 | iso_pu_bacteria | 2721755819 | 2724091101 | 329 |
| 752 | iso_pu_bacteria | 2721755822 | 2724105607 | 329 |
| 753 | iso_pu_bacteria | 2721755823 | 2724111434 | 329 |
| 754 | iso_pu_bacteria | 2724679232 | 2725947686 | 329 |
| 755 | iso_pu_bacteria | 2728369352 | 2730109018 | 329 |
| 756 | iso_pu_bacteria | 2728369365 | 2730165704 | 329 |
| 757 | iso_pu_bacteria | 2728369397 | 2730299600 | 329 |
| 758 | iso_pu_bacteria | 2738541333 | 2739035707 | 329 |
| 759 | iso_pu_bacteria | 2765235942 | 2766065468 | 329 |
| 760 | iso_pu_bacteria | 2775507049 | 2776914440 | 329 |
| 761 | iso_pu_bacteria | 2791355256 | 2793293779 | 329 |
| 762 | iso_pu_bacteria | 2791355259 | 2793313195 | 329 |
| 763 | iso_pu_bacteria | 2791355260 | 2793319856 | 329 |
| 764 | iso_pu_bacteria | 2791355261 | 2793328140 | 329 |
| 765 | iso_pu_bacteria | 2791355262 | 2793333236 | 329 |
| 766 | iso_pu_bacteria | 2791355263 | 2793343817 | 329 |
| 767 | iso_pu_bacteria | 2791355264 | 2793347239 | 329 |
| 768 | iso_pu_bacteria | 2791355265 | 2793356624 | 329 |
| 769 | iso_pu_bacteria | 2791355266 | 2793362917 | 329 |
| 770 | iso_pu_bacteria | 2791355267 | 2793370057 | 329 |
| 771 | iso_pu_bacteria | 2802429605 | 2805930707 | 329 |
| 772 | iso_pu_bacteria | 2802429606 | 2805934180 | 329 |
| 773 | iso_pu_bacteria | 2802429633 | 2806044694 | 329 |
| 774 | iso_pu_bacteria | 2802429634 | 2806052894 | 329 |
| 775 | iso_pu_bacteria | 2802429635 | 2806059194 | 329 |
| 776 | iso_pu_bacteria | 2802429636 | 2806068143 | 329 |
| 777 | iso_pu_bacteria | 2802429637 | 2806074263 | 329 |
| 778 | iso_pu_bacteria | 2808606387 | 2808987455 | 329 |
| 779 | iso_pu_bacteria | 2818991272 | 2819243694 | 329 |
| 780 | iso_pu_bacteria | 2818991439 | 2819557227 | 329 |
| 781 | iso_pu_bacteria | 2818991461 | 2819685548 | 329 |
| 782 | iso_pu_bacteria | 2821123053 | 2821126036 | 329 |
| 783 | iso_pu_bacteria | 2838016132 | 2838018969 | 329 |
| 784 | iso_pu_bacteria | 2838022645 | 2838024431 | 329 |
| 785 | iso_pu_bacteria | 2838035591 | 2838040644 | 329 |
| 786 | iso_pu_bacteria | 2838048938 | 2838051315 | 329 |
| 787 | iso_pu_bacteria | 2838061910 | 2838063707 | 329 |
| 788 | iso_pu_bacteria | 2838068647 | 2838074278 | 329 |
| 789 | iso_pu_bacteria | 2838661181 | 2838664968 | 329 |
| 790 | iso_pu_bacteria | 2838680041 | 2838685097 | 329 |
| 791 | iso_pu_bacteria | 2838694306 | 2838699066 | 329 |
| 792 | iso_pu_bacteria | 2838707686 | 2838712547 | 329 |
| 793 | iso_pu_bacteria | 2841859092 | 2841861712 | 329 |
| 794 | iso_pu_bacteria | 2841864319 | 2841868319 | 329 |
| 795 | iso_pu_bacteria | 2842077413 | 2842082024 | 329 |
| 796 | iso_pu_bacteria | 2842110456 | 2842113583 | 329 |
| 797 | iso_pu_bacteria | 2842118031 | 2842122946 | 329 |
| 798 | iso_pu_bacteria | 2842198810 | 2842199974 | 329 |
| 799 | iso_pu_bacteria | 2842205361 | 2842208166 | 329 |
| 800 | iso_pu_bacteria | 2842237096 | 2842242151 | 329 |
| 801 | iso_pu_bacteria | 2842264693 | 2842266475 | 329 |
| 802 | iso_pu_bacteria | 2842278818 | 2842281825 | 329 |
| 803 | iso_pu_bacteria | 2842291075 | 2842296024 | 329 |
| 804 | iso_pu_bacteria | 2842311132 | 2842316168 | 329 |
| 805 | iso_pu_bacteria | 2842341865 | 2842344859 | 329 |
| 806 | iso_pu_bacteria | 2842370503 | 2842377164 | 329 |
| 807 | iso_pu_bacteria | 2842377471 | 2842382423 | 329 |
| 808 | iso_pu_bacteria | 2842384541 | 2842389824 | 329 |
| 809 | iso_pu_bacteria | 2842395702 | 2842398666 | 329 |
| 810 | iso_pu_bacteria | 2842422224 | 2842427902 | 329 |
| 811 | iso_pu_bacteria | 2842428310 | 2842429794 | 329 |
| 812 | iso_pu_bacteria | 2842434925 | 2842436546 | 329 |
| 813 | iso_pu_bacteria | 2842441272 | 2842444249 | 329 |
| 814 | iso_pu_bacteria | 2842447887 | 2842450890 | 329 |
| 815 | iso_pu_bacteria | 2842462802 | 2842464215 | 329 |
| 816 | iso_pu_bacteria | 2842469257 | 2842470875 | 329 |
| 817 | iso_pu_bacteria | 2842515876 | 2842518022 | 329 |
| 818 | iso_pu_bacteria | 2857516855 | 2857519050 | 329 |
| 819 | iso_pu_bacteria | 2857531043 | 2857532598 | 329 |
| 820 | iso_pu_bacteria | 2899792073 | 2899792800 | 329 |
| 821 | iso_pu_bacteria | 2899803654 | 2899806550 | 329 |
| 822 | iso_pu_bacteria | 2899845264 | 2899845463 | 329 |
| 823 | iso_pu_bacteria | 2919100787 | 2919104413 | 329 |
| 824 | iso_pu_bacteria | 2919171160 | 2919173273 | 329 |
| 825 | iso_pu_bacteria | 2926760298 | 2926763902 | 329 |
| 826 | iso_pu_bacteria | 2933011516 | 2933013651 | 329 |
| 827 | iso_pu_bacteria | 2933016740 | 2933023328 | 329 |
| 828 | iso_pu_bacteria | 2933586486 | 2933589127 | 329 |
| 829 | iso_pu_bacteria | 2935894831 | 2935899872 | 329 |
| 830 | iso_pu_bacteria | 2936367885 | 2936375011 | 329 |
| 831 | iso_pu_bacteria | 2936375103 | 2936380702 | 329 |
| 832 | iso_pu_bacteria | 2936381700 | 2936382128 | 329 |
| 833 | iso_pu_bacteria | 2979089926 | 2979091000 | 329 |
| 834 | iso_pu_bacteria | 2979095461 | 2979096526 | 329 |
| 835 | iso_pu_bacteria | 2979100975 | 2979102259 | 329 |
| 836 | iso_pu_bacteria | 2984509177 | 2984509793 | 329 |
| 837 | iso_pu_bacteria | 2984518228 | 2984519510 | 329 |
| 838 | iso_pu_bacteria | 2984537506 | 2984538131 | 329 |
| 839 | iso_pu_bacteria | 2984601300 | 2984604883 | 329 |
| 840 | iso_pu_bacteria | 2989776772 | 2989779694 | 329 |
| 841 | iso_pu_bacteria | 2996893221 | 2996895903 | 329 |
| 842 | iso_pu_bacteria | 3005445848 | 3005449130 | 329 |
| 843 | iso_pu_bacteria | 3005452660 | 3005455411 | 329 |
| 844 | iso_pu_bacteria | 639633055 | 639649864 | 329 |
| 845 | iso_pu_bacteria | 650716007 | 650843360 | 329 |
| 846 | iso_pu_bacteria | 8005246636 | 8005249689 | 329 |
| 847 | iso_pu_bacteria | 8005275841 | 8005281855 | 329 |
| 848 | iso_pu_bacteria | 8005282627 | 8005288849 | 329 |
| 849 | iso_pu_bacteria | 8005289223 | 8005294432 | 329 |
| 850 | iso_pu_bacteria | 8005301065 | 8005306815 | 329 |
| 851 | iso_pu_bacteria | 8005376324 | 8005378334 | 329 |
| 852 | iso_pu_bacteria | 8005382845 | 8005383979 | 329 |
| 853 | iso_pu_bacteria | 8005395548 | 8005401306 | 329 |
| 854 | iso_pu_bacteria | 8005430974 | 8005434261 | 329 |
| 855 | iso_pu_bacteria | 8005497431 | 8005501520 | 329 |
| 856 | iso_pu_bacteria | 8005542996 | 8005547266 | 329 |
| 857 | iso_pu_bacteria | 8005570704 | 8005575080 | 329 |
| 858 | iso_pu_bacteria | 8005619151 | 8005622881 | 329 |
| 859 | iso_pu_bacteria | 8005668836 | 8005672941 | 329 |
| 860 | iso_pu_bacteria | 8005688590 | 8005693488 | 329 |
| 861 | iso_pu_bacteria | 8005695170 | 8005700709 | 329 |
| 862 | iso_pu_bacteria | 8018127388 | 8018133752 | 329 |
| 863 | iso_pu_bacteria | 8018150411 | 8018153301 | 329 |
| 864 | iso_pu_bacteria | 8018176218 | 8018178599 | 329 |
| 865 | iso_pu_bacteria | 8024479707 | 8024481641 | 329 |
| 866 | iso_pu_bacteria | 8024486573 | 8024487871 | 329 |
| 867 | iso_pu_bacteria | 8046767195 | 8046772038 | 329 |
| 868 | iso_pu_bacteria | 8056375014 | 8056381445 | 329 |
| 869 | iso_pu_bacteria | 8056382006 | 8056386888 | 329 |
| 870 | 3300005434 | Ga0070709_10035983 | Ga0070709_100359832 | 330 |
| 871 | 3300005434 | Ga0070709_10109793 | Ga0070709_101097932 | 330 |
| 872 | 3300005435 | Ga0070714_100034690 | Ga0070714_1000346902 | 330 |
| 873 | 3300005436 | Ga0070713_100019647 | Ga0070713_1000196473 | 330 |
| 874 | 3300005530 | Ga0070679_100034303 | Ga0070679_1000343033 | 330 |
| 875 | 3300005842 | Ga0068858_100268723 | Ga0068858_1002687231 | 330 |
| 876 | 3300009176 | Ga0105242_10451008 | Ga0105242_104510081 | 330 |
| 877 | 3300009545 | Ga0105237_10004792 | Ga0105237_1000479214 | 330 |
| 878 | 3300014326 | Ga0157380_10106070 | Ga0157380_101060702 | 330 |
| 879 | 3300025906 | Ga0207699_10019657 | Ga0207699_100196573 | 330 |
| 880 | 3300025906 | Ga0207699_10097873 | Ga0207699_100978732 | 330 |
| 881 | 3300025914 | Ga0207671_10011955 | Ga0207671_100119555 | 330 |
| 882 | 3300025914 | Ga0207671_10171881 | Ga0207671_101718812 | 330 |
| 883 | 3300025921 | Ga0207652_10023709 | Ga0207652_100237093 | 330 |
| 884 | 3300025928 | Ga0207700_10005150 | Ga0207700_100051504 | 330 |
| 885 | 3300025929 | Ga0207664_10145881 | Ga0207664_101458811 | 330 |
| 886 | 3300028563 | Ga0265319_1000349 | Ga0265319_10003496 | 330 |
| 887 | 3300028794 | Ga0307515_10001447 | Ga0307515_100014478 | 330 |
| 888 | 3300031240 | Ga0265320_10008784 | Ga0265320_100087845 | 330 |
| 889 | 3300031250 | Ga0265331_10102430 | Ga0265331_101024301 | 330 |
| 890 | 3300031251 | Ga0265327_10111898 | Ga0265327_101118982 | 330 |
| 891 | 3300031456 | Ga0307513_10029600 | Ga0307513_100296002 | 330 |
| 892 | 3300031649 | Ga0307514_10001548 | Ga0307514_1000154816 | 330 |
| 893 | 3300033179 | Ga0307507_10023456 | Ga0307507_100234563 | 330 |
| 894 | 3300033179 | Ga0307507_10121353 | Ga0307507_101213532 | 330 |
| 895 | 3300038443 | Ga0395901_0097650 | Ga0395901_0097650_751_1746 | 330 |
| 896 | 3300046530 | Ga0495654_0000834 | Ga0495654_0000834_16165_17172 | 330 |
| 897 | 3300046539 | Ga0495621_0043681 | Ga0495621_0043681_48_1049 | 330 |
| 898 | 3300048908 | Ga0496105_0075935 | Ga0496105_0075935_807_1922 | 330 |
| 899 | 3300048924 | Ga0496121_0245275 | Ga0496121_0245275_117_1145 | 330 |
| 900 | 3300049571 | Ga0501034_0185791 | Ga0501034_0185791_867_1868 | 330 |
| 901 | 3300049822 | Ga0501035_0105050 | Ga0501035_0105050_1405_2397 | 330 |
| 902 | 3300053139 | Ga0500568_0015213 | Ga0500568_0015213_1752_2807 | 330 |
| 903 | iso_pu_bacteria | 2929206907 | 2929212133 | 330 |
| 904 | 3300002773 | JGI25152J39213_1014814 | JGI25152J39213_10148142 | 331 |
| 905 | 3300002774 | JGI25150J39212_1000144 | JGI25150J39212_100014439 | 331 |
| 906 | 3300003187 | JGI25151J46595_10000031 | JGI25151J46595_1000003117 | 331 |
| 907 | 3300005336 | Ga0070680_100116211 | Ga0070680_1001162112 | 331 |
| 908 | 3300005436 | Ga0070713_100002078 | Ga0070713_1000020785 | 331 |
| 909 | 3300005439 | Ga0070711_100168028 | Ga0070711_1001680281 | 331 |
| 910 | 3300005457 | Ga0070662_100015877 | Ga0070662_1000158772 | 331 |
| 911 | 3300005548 | Ga0070665_100080487 | Ga0070665_1000804872 | 331 |
| 912 | 3300005563 | Ga0068855_100067798 | Ga0068855_1000677984 | 331 |
| 913 | 3300005564 | Ga0070664_100024731 | Ga0070664_1000247313 | 331 |
| 914 | 3300005578 | Ga0068854_100160848 | Ga0068854_1001608482 | 331 |
| 915 | 3300006028 | Ga0070717_10051681 | Ga0070717_100516812 | 331 |
| 916 | 3300006175 | Ga0070712_100006701 | Ga0070712_1000067017 | 331 |
| 917 | 3300009765 | Ga0123341_1000014 | Ga0123341_100001428 | 331 |
| 918 | 3300013307 | Ga0157372_10045183 | Ga0157372_100451833 | 331 |
| 919 | 3300014497 | Ga0182008_10010338 | Ga0182008_100103386 | 331 |
| 920 | 3300015262 | Ga0182007_10003916 | Ga0182007_100039164 | 331 |
| 921 | 3300025245 | Ga0207425_1000058 | Ga0207425_100005862 | 331 |
| 922 | 3300025258 | Ga0209129_1000107 | Ga0209129_100010762 | 331 |
| 923 | 3300025294 | Ga0209025_1000083 | Ga0209025_100008362 | 331 |
| 924 | 3300025297 | Ga0209758_1000090 | Ga0209758_1000090201 | 331 |
| 925 | 3300025297 | Ga0209758_1000839 | Ga0209758_100083930 | 331 |
| 926 | 3300025299 | Ga0209256_1028614 | Ga0209256_10286142 | 331 |
| 927 | 3300025915 | Ga0207693_10020804 | Ga0207693_100208041 | 331 |
| 928 | 3300025920 | Ga0207649_10029373 | Ga0207649_100293733 | 331 |
| 929 | 3300025921 | Ga0207652_10325159 | Ga0207652_103251592 | 331 |
| 930 | 3300025928 | Ga0207700_10001779 | Ga0207700_100017793 | 331 |
| 931 | 3300025933 | Ga0207706_10023167 | Ga0207706_100231672 | 331 |
| 932 | 3300026041 | Ga0207639_10100476 | Ga0207639_101004762 | 331 |
| 933 | 3300026116 | Ga0207674_10099047 | Ga0207674_100990473 | 331 |
| 934 | 3300028379 | Ga0268266_10092961 | Ga0268266_100929612 | 331 |
| 935 | 3300031731 | Ga0307405_10005651 | Ga0307405_100056513 | 331 |
| 936 | 3300031911 | Ga0307412_10001366 | Ga0307412_1000136617 | 331 |
| 937 | 3300031911 | Ga0307412_10090045 | Ga0307412_100900452 | 331 |
| 938 | 3300032005 | Ga0307411_10360205 | Ga0307411_103602051 | 331 |
| 939 | 3300037471 | Ga0395905_0005488 | Ga0395905_0005488_9948_10952 | 331 |
| 940 | 3300046512 | Ga0495610_0000961 | Ga0495610_0000961_23964_24959 | 331 |
| 941 | 3300046512 | Ga0495610_0091024 | Ga0495610_0091024_103_1098 | 331 |
| 942 | 3300046519 | Ga0495632_0008503 | Ga0495632_0008503_1859_2854 | 331 |
| 943 | 3300046519 | Ga0495632_0041601 | Ga0495632_0041601_1275_2270 | 331 |
| 944 | 3300046530 | Ga0495654_0000635 | Ga0495654_0000635_14765_15760 | 331 |
| 945 | 3300046692 | Ga0495671_0094705 | Ga0495671_0094705_15_1010 | 331 |
| 946 | 3300047472 | Ga0495686_0054266 | Ga0495686_0054266_1119_2114 | 331 |
| 947 | 3300048903 | Ga0496100_0017092 | Ga0496100_0017092_2856_3884 | 331 |
| 948 | 3300048904 | Ga0496101_0002273 | Ga0496101_0002273_9126_10154 | 331 |
| 949 | 3300048905 | Ga0496102_0012098 | Ga0496102_0012098_5983_7011 | 331 |
| 950 | 3300048906 | Ga0496103_0021085 | Ga0496103_0021085_2347_3375 | 331 |
| 951 | 3300048908 | Ga0496105_0002064 | Ga0496105_0002064_4285_5313 | 331 |
| 952 | 3300048909 | Ga0496106_0029059 | Ga0496106_0029059_507_1535 | 331 |
| 953 | 3300048919 | Ga0496116_0005016 | Ga0496116_0005016_10205_11200 | 331 |
| 954 | 3300048919 | Ga0496116_0019875 | Ga0496116_0019875_2552_3547 | 331 |
| 955 | 3300048919 | Ga0496116_0021816 | Ga0496116_0021816_2959_3954 | 331 |
| 956 | 3300048920 | Ga0496117_0012513 | Ga0496117_0012513_1155_2150 | 331 |
| 957 | 3300048920 | Ga0496117_0014590 | Ga0496117_0014590_1222_2217 | 331 |
| 958 | 3300048921 | Ga0496118_0015866 | Ga0496118_0015866_2628_3623 | 331 |
| 959 | 3300048921 | Ga0496118_0146709 | Ga0496118_0146709_253_1248 | 331 |
| 960 | 3300048924 | Ga0496121_0002950 | Ga0496121_0002950_22594_23589 | 331 |
| 961 | 3300048924 | Ga0496121_0004490 | Ga0496121_0004490_16386_17381 | 331 |
| 962 | 3300048925 | Ga0496122_0003537 | Ga0496122_0003537_1954_2949 | 331 |
| 963 | 3300048925 | Ga0496122_0014660 | Ga0496122_0014660_1238_2233 | 331 |
| 964 | 3300048925 | Ga0496122_0097767 | Ga0496122_0097767_909_1904 | 331 |
| 965 | 3300048925 | Ga0496122_0108059 | Ga0496122_0108059_693_1688 | 331 |
| 966 | 3300048925 | Ga0496122_0111801 | Ga0496122_0111801_401_1396 | 331 |
| 967 | 3300048926 | Ga0496123_0014925 | Ga0496123_0014925_4681_5676 | 331 |
| 968 | 3300048926 | Ga0496123_0020288 | Ga0496123_0020288_1254_2249 | 331 |
| 969 | 3300048927 | Ga0496124_0005584 | Ga0496124_0005584_11218_12213 | 331 |
| 970 | 3300048927 | Ga0496124_0021455 | Ga0496124_0021455_4882_5877 | 331 |
| 971 | 3300048927 | Ga0496124_0022392 | Ga0496124_0022392_2548_3543 | 331 |
| 972 | 3300048927 | Ga0496124_0104468 | Ga0496124_0104468_1049_2044 | 331 |
| 973 | 3300048928 | Ga0496125_0034692 | Ga0496125_0034692_1596_2591 | 331 |
| 974 | 3300048928 | Ga0496125_0100689 | Ga0496125_0100689_440_1435 | 331 |
| 975 | 3300053117 | Ga0500593_000006 | Ga0500593_000006_85874_86965 | 331 |
| 976 | 3300053125 | Ga0500618_000337 | Ga0500618_000337_13812_14807 | 331 |
| 977 | 3300053125 | Ga0500618_005905 | Ga0500618_005905_840_1835 | 331 |
| 978 | 3300053153 | Ga0500616_0000677 | Ga0500616_0000677_18668_19669 | 331 |
| 979 | 3300059421 | Ga0590071_011978 | Ga0590071_011978_394_1413 | 331 |
| 980 | iso_pu_bacteria | 8005658619 | 8005658673 | 331 |
| 981 | 3300001979 | JGI24740J21852_10003345 | JGI24740J21852_100033457 | 332 |
| 982 | 3300002704 | JGI25155J39150_1000007 | JGI25155J39150_1000007134 | 332 |
| 983 | 3300002705 | JGI25156J39149_1000066 | JGI25156J39149_100006631 | 332 |
| 984 | 3300002737 | JGI25162J39368_1000488 | JGI25162J39368_100048823 | 332 |
| 985 | 3300002737 | JGI25162J39368_1001297 | JGI25162J39368_100129714 | 332 |
| 986 | 3300002738 | JGI25154J39366_1000035 | JGI25154J39366_100003549 | 332 |
| 987 | 3300002741 | JGI25157J39369_1000036 | JGI25157J39369_100003633 | 332 |
| 988 | 3300002987 | JGI25159J45721_1000463 | JGI25159J45721_100046321 | 332 |
| 989 | 3300003214 | JGI25165J46597_1000676 | JGI25165J46597_100067613 | 332 |
| 990 | 3300003214 | JGI25165J46597_1001184 | JGI25165J46597_100118410 | 332 |
| 991 | 3300003354 | JGI25160J50197_1000100 | JGI25160J50197_100010042 | 332 |
| 992 | 3300003374 | JGI25161J50226_1000072 | JGI25161J50226_100007249 | 332 |
| 993 | 3300003752 | Ga0055539_1002732 | Ga0055539_10027324 | 332 |
| 994 | 3300004625 | Ga0055543_1000078 | Ga0055543_100007849 | 332 |
| 995 | 3300005262 | Ga0065165_1000623 | Ga0065165_100062326 | 332 |
| 996 | 3300005548 | Ga0070665_100055026 | Ga0070665_1000550267 | 332 |
| 997 | 3300006038 | Ga0075365_10001634 | Ga0075365_100016343 | 332 |
| 998 | 3300006195 | Ga0075366_10041272 | Ga0075366_100412722 | 332 |
| 999 | 3300006353 | Ga0075370_10027065 | Ga0075370_100270651 | 332 |
| 1000 | 3300006946 | Ga0079104_1000015 | Ga0079104_1000015292 | 332 |
| 1001 | 3300009093 | Ga0105240_10000019 | Ga0105240_10000019317 | 332 |
| 1002 | 3300009177 | Ga0105248_10194685 | Ga0105248_101946853 | 332 |
| 1003 | 3300009545 | Ga0105237_10000734 | Ga0105237_1000073434 | 332 |
| 1004 | 3300010375 | Ga0105239_10000574 | Ga0105239_1000057434 | 332 |
| 1005 | 3300013104 | Ga0157370_10000131 | Ga0157370_1000013177 | 332 |
| 1006 | 3300014325 | Ga0163163_10169354 | Ga0163163_101693542 | 332 |
| 1007 | 3300014497 | Ga0182008_10017006 | Ga0182008_100170065 | 332 |
| 1008 | 3300015262 | Ga0182007_10035634 | Ga0182007_100356343 | 332 |
| 1009 | 3300015265 | Ga0182005_1003936 | Ga0182005_10039363 | 332 |
| 1010 | 3300025206 | Ga0209435_100005 | Ga0209435_100005286 | 332 |
| 1011 | 3300025207 | Ga0209760_101522 | Ga0209760_1015222 | 332 |
| 1012 | 3300025233 | Ga0209437_100058 | Ga0209437_100058292 | 332 |
| 1013 | 3300025233 | Ga0209437_100313 | Ga0209437_10031341 | 332 |
| 1014 | 3300025233 | Ga0209437_104360 | Ga0209437_1043603 | 332 |
| 1015 | 3300025246 | Ga0209646_1000011 | Ga0209646_1000011286 | 332 |
| 1016 | 3300025250 | Ga0209026_1000008 | Ga0209026_1000008286 | 332 |
| 1017 | 3300025253 | Ga0209677_100475 | Ga0209677_1004755 | 332 |
| 1018 | 3300025256 | Ga0209759_1000004 | Ga0209759_1000004286 | 332 |
| 1019 | 3300025261 | Ga0209233_1000157 | Ga0209233_1000157133 | 332 |
| 1020 | 3300025261 | Ga0209233_1000354 | Ga0209233_100035432 | 332 |
| 1021 | 3300025261 | Ga0209233_1000380 | Ga0209233_100038010 | 332 |
| 1022 | 3300025284 | Ga0209130_1000083 | Ga0209130_100008340 | 332 |
| 1023 | 3300025297 | Ga0209758_1015048 | Ga0209758_10150483 | 332 |
| 1024 | 3300025302 | Ga0207426_1000173 | Ga0207426_100017340 | 332 |
| 1025 | 3300025913 | Ga0207695_10000049 | Ga0207695_10000049320 | 332 |
| 1026 | 3300025914 | Ga0207671_10000423 | Ga0207671_1000042317 | 332 |
| 1027 | 3300025941 | Ga0207711_10123572 | Ga0207711_101235722 | 332 |
| 1028 | 3300027111 | Ga0209281_1000068 | Ga0209281_100006898 | 332 |
| 1029 | 3300027312 | Ga0209371_1005272 | Ga0209371_10052723 | 332 |
| 1030 | 3300028379 | Ga0268266_10000103 | Ga0268266_10000103145 | 332 |
| 1031 | 3300028379 | Ga0268266_10068412 | Ga0268266_100684122 | 332 |
| 1032 | 3300030500 | Ga0268256_1002352 | Ga0268256_10023527 | 332 |
| 1033 | 3300031824 | Ga0307413_10046628 | Ga0307413_100466282 | 332 |
| 1034 | 3300031852 | Ga0307410_10294034 | Ga0307410_102940341 | 332 |
| 1035 | 3300032002 | Ga0307416_100122995 | Ga0307416_1001229954 | 332 |
| 1036 | 3300035088 | Ga0373940_0017126 | Ga0373940_0017126_71_1252 | 332 |
| 1037 | 3300037471 | Ga0395905_0000741 | Ga0395905_0000741_5301_6314 | 332 |
| 1038 | 3300037471 | Ga0395905_0023045 | Ga0395905_0023045_4135_5133 | 332 |
| 1039 | 3300046507 | Ga0495606_0124361 | Ga0495606_0124361_246_1244 | 332 |
| 1040 | 3300048907 | Ga0496104_0107663 | Ga0496104_0107663_985_2148 | 332 |
| 1041 | 3300048908 | Ga0496105_0375101 | Ga0496105_0375101_70_1068 | 332 |
| 1042 | 3300048911 | Ga0496108_0031554 | Ga0496108_0031554_1957_3120 | 332 |
| 1043 | 3300048912 | Ga0496109_0031417 | Ga0496109_0031417_192_1355 | 332 |
| 1044 | 3300048913 | Ga0496110_0025530 | Ga0496110_0025530_2970_4133 | 332 |
| 1045 | 3300048915 | Ga0496112_0042517 | Ga0496112_0042517_1566_2729 | 332 |
| 1046 | 3300048920 | Ga0496117_0000926 | Ga0496117_0000926_24829_25827 | 332 |
| 1047 | 3300048921 | Ga0496118_0001977 | Ga0496118_0001977_7671_8669 | 332 |
| 1048 | 3300048922 | Ga0496119_0028246 | Ga0496119_0028246_2334_3332 | 332 |
| 1049 | 3300048925 | Ga0496122_0015740 | Ga0496122_0015740_2813_3811 | 332 |
| 1050 | 3300048926 | Ga0496123_0035113 | Ga0496123_0035113_736_1734 | 332 |
| 1051 | 3300048927 | Ga0496124_0042429 | Ga0496124_0042429_2062_3060 | 332 |
| 1052 | 3300049823 | Ga0501044_0291298 | Ga0501044_0291298_87_1085 | 332 |
| 1053 | 3300050492 | nmdc:mga0yw44_959_c1 | nmdc:mga0yw44_959_c1_8770_9777 | 332 |
| 1054 | 3300053136 | Ga0500559_0002424 | Ga0500559_0002424_670_1668 | 332 |
| 1055 | 3300061719 | Ga0466962_0135295 | Ga0466962_0135295_101_1099 | 332 |
| 1056 | iso_pu_bacteria | 2506783011 | 2506865889 | 332 |
| 1057 | iso_pu_bacteria | 2773857933 | 2774905340 | 332 |
| 1058 | 3300002773 | JGI25152J39213_1004590 | JGI25152J39213_10045903 | 333 |
| 1059 | 3300002987 | JGI25159J45721_1001920 | JGI25159J45721_10019205 | 333 |
| 1060 | 3300003187 | JGI25151J46595_10001277 | JGI25151J46595_1000127711 | 333 |
| 1061 | 3300003215 | JGI25153J46596_10004998 | JGI25153J46596_100049982 | 333 |
| 1062 | 3300003354 | JGI25160J50197_1001130 | JGI25160J50197_100113011 | 333 |
| 1063 | 3300003374 | JGI25161J50226_1000104 | JGI25161J50226_100010465 | 333 |
| 1064 | 3300003374 | JGI25161J50226_1000396 | JGI25161J50226_100039615 | 333 |
| 1065 | 3300003771 | Ga0055526_1001414 | Ga0055526_10014145 | 333 |
| 1066 | 3300003771 | Ga0055526_1012623 | Ga0055526_10126231 | 333 |
| 1067 | 3300003771 | Ga0055526_1023211 | Ga0055526_10232112 | 333 |
| 1068 | 3300003771 | Ga0055526_1024203 | Ga0055526_10242032 | 333 |
| 1069 | 3300003775 | Ga0055524_1008292 | Ga0055524_10082924 | 333 |
| 1070 | 3300003775 | Ga0055524_1015401 | Ga0055524_10154012 | 333 |
| 1071 | 3300003781 | Ga0055536_1005370 | Ga0055536_10053702 | 333 |
| 1072 | 3300003790 | Ga0055528_1000695 | Ga0055528_10006955 | 333 |
| 1073 | 3300003790 | Ga0055528_1001150 | Ga0055528_10011508 | 333 |
| 1074 | 3300003790 | Ga0055528_1008246 | Ga0055528_10082462 | 333 |
| 1075 | 3300003790 | Ga0055528_1011300 | Ga0055528_10113002 | 333 |
| 1076 | 3300003791 | Ga0055530_10022910 | Ga0055530_100229101 | 333 |
| 1077 | 3300003792 | Ga0055540_1000752 | Ga0055540_10007522 | 333 |
| 1078 | 3300003792 | Ga0055540_1004512 | Ga0055540_10045127 | 333 |
| 1079 | 3300003792 | Ga0055540_1007583 | Ga0055540_10075832 | 333 |
| 1080 | 3300003792 | Ga0055540_1012146 | Ga0055540_10121462 | 333 |
| 1081 | 3300003794 | Ga0055531_10003943 | Ga0055531_1000394311 | 333 |
| 1082 | 3300003856 | Ga0058692_1002399 | Ga0058692_10023995 | 333 |
| 1083 | 3300004625 | Ga0055543_1000280 | Ga0055543_100028011 | 333 |
| 1084 | 3300005262 | Ga0065165_1002557 | Ga0065165_10025577 | 333 |
| 1085 | 3300005262 | Ga0065165_1026404 | Ga0065165_10264042 | 333 |
| 1086 | 3300005327 | Ga0070658_10000253 | Ga0070658_1000025316 | 333 |
| 1087 | 3300005353 | Ga0070669_100211508 | Ga0070669_1002115082 | 333 |
| 1088 | 3300005353 | Ga0070669_100212799 | Ga0070669_1002127991 | 333 |
| 1089 | 3300005548 | Ga0070665_100018720 | Ga0070665_1000187207 | 333 |
| 1090 | 3300005548 | Ga0070665_100288661 | Ga0070665_1002886611 | 333 |
| 1091 | 3300005548 | Ga0070665_100360853 | Ga0070665_1003608531 | 333 |
| 1092 | 3300006038 | Ga0075365_10019376 | Ga0075365_100193762 | 333 |
| 1093 | 3300006042 | Ga0075368_10044867 | Ga0075368_100448671 | 333 |
| 1094 | 3300006048 | Ga0075363_100000517 | Ga0075363_10000051710 | 333 |
| 1095 | 3300006048 | Ga0075363_100141446 | Ga0075363_1001414462 | 333 |
| 1096 | 3300006177 | Ga0075362_10006339 | Ga0075362_100063392 | 333 |
| 1097 | 3300006177 | Ga0075362_10049176 | Ga0075362_100491762 | 333 |
| 1098 | 3300006178 | Ga0075367_10000817 | Ga0075367_100008175 | 333 |
| 1099 | 3300006178 | Ga0075367_10001171 | Ga0075367_100011713 | 333 |
| 1100 | 3300006186 | Ga0075369_10013607 | Ga0075369_100136072 | 333 |
| 1101 | 3300006186 | Ga0075369_10021040 | Ga0075369_100210401 | 333 |
| 1102 | 3300006195 | Ga0075366_10003864 | Ga0075366_100038644 | 333 |
| 1103 | 3300006195 | Ga0075366_10014213 | Ga0075366_100142132 | 333 |
| 1104 | 3300006353 | Ga0075370_10007174 | Ga0075370_100071745 | 333 |
| 1105 | 3300006353 | Ga0075370_10075881 | Ga0075370_100758811 | 333 |
| 1106 | 3300009148 | Ga0105243_10009086 | Ga0105243_100090863 | 333 |
| 1107 | 3300011119 | Ga0105246_10063299 | Ga0105246_100632992 | 333 |
| 1108 | 3300013100 | Ga0157373_10175927 | Ga0157373_101759272 | 333 |
| 1109 | 3300013102 | Ga0157371_10000002 | Ga0157371_10000002108 | 333 |
| 1110 | 3300013104 | Ga0157370_10000246 | Ga0157370_1000024660 | 333 |
| 1111 | 3300025208 | Ga0209436_100023 | Ga0209436_10002388 | 333 |
| 1112 | 3300025208 | Ga0209436_100027 | Ga0209436_10002730 | 333 |
| 1113 | 3300025245 | Ga0207425_1001260 | Ga0207425_10012602 | 333 |
| 1114 | 3300025258 | Ga0209129_1000080 | Ga0209129_100008010 | 333 |
| 1115 | 3300025258 | Ga0209129_1000605 | Ga0209129_10006054 | 333 |
| 1116 | 3300025258 | Ga0209129_1000714 | Ga0209129_100071413 | 333 |
| 1117 | 3300025258 | Ga0209129_1006349 | Ga0209129_10063492 | 333 |
| 1118 | 3300025273 | Ga0209673_1000060 | Ga0209673_100006072 | 333 |
| 1119 | 3300025273 | Ga0209673_1000233 | Ga0209673_100023340 | 333 |
| 1120 | 3300025273 | Ga0209673_1000781 | Ga0209673_100078133 | 333 |
| 1121 | 3300025273 | Ga0209673_1001374 | Ga0209673_100137421 | 333 |
| 1122 | 3300025273 | Ga0209673_1005142 | Ga0209673_10051427 | 333 |
| 1123 | 3300025284 | Ga0209130_1000173 | Ga0209130_100017384 | 333 |
| 1124 | 3300025294 | Ga0209025_1000255 | Ga0209025_100025539 | 333 |
| 1125 | 3300025294 | Ga0209025_1000350 | Ga0209025_100035053 | 333 |
| 1126 | 3300025294 | Ga0209025_1000749 | Ga0209025_100074946 | 333 |
| 1127 | 3300025294 | Ga0209025_1009200 | Ga0209025_10092008 | 333 |
| 1128 | 3300025294 | Ga0209025_1010819 | Ga0209025_10108196 | 333 |
| 1129 | 3300025294 | Ga0209025_1041452 | Ga0209025_10414522 | 333 |
| 1130 | 3300025295 | Ga0209564_1000116 | Ga0209564_100011672 | 333 |
| 1131 | 3300025295 | Ga0209564_1000125 | Ga0209564_1000125126 | 333 |
| 1132 | 3300025295 | Ga0209564_1001273 | Ga0209564_100127321 | 333 |
| 1133 | 3300025295 | Ga0209564_1011141 | Ga0209564_10111413 | 333 |
| 1134 | 3300025297 | Ga0209758_1000928 | Ga0209758_10009283 | 333 |
| 1135 | 3300025297 | Ga0209758_1001034 | Ga0209758_100103434 | 333 |
| 1136 | 3300025297 | Ga0209758_1001969 | Ga0209758_100196911 | 333 |
| 1137 | 3300025297 | Ga0209758_1003215 | Ga0209758_100321510 | 333 |
| 1138 | 3300025297 | Ga0209758_1015938 | Ga0209758_10159382 | 333 |
| 1139 | 3300025297 | Ga0209758_1037329 | Ga0209758_10373292 | 333 |
| 1140 | 3300025298 | Ga0209050_1003361 | Ga0209050_100336112 | 333 |
| 1141 | 3300025298 | Ga0209050_1005007 | Ga0209050_10050072 | 333 |
| 1142 | 3300025299 | Ga0209256_1000302 | Ga0209256_100030230 | 333 |
| 1143 | 3300025299 | Ga0209256_1001684 | Ga0209256_100168410 | 333 |
| 1144 | 3300025299 | Ga0209256_1001904 | Ga0209256_100190416 | 333 |
| 1145 | 3300025299 | Ga0209256_1006695 | Ga0209256_10066952 | 333 |
| 1146 | 3300025302 | Ga0207426_1000047 | Ga0207426_100004784 | 333 |
| 1147 | 3300025302 | Ga0207426_1000276 | Ga0207426_100027637 | 333 |
| 1148 | 3300025303 | Ga0209051_1000217 | Ga0209051_100021770 | 333 |
| 1149 | 3300025303 | Ga0209051_1001815 | Ga0209051_10018152 | 333 |
| 1150 | 3300025303 | Ga0209051_1003071 | Ga0209051_10030714 | 333 |
| 1151 | 3300025303 | Ga0209051_1017149 | Ga0209051_10171492 | 333 |
| 1152 | 3300025304 | Ga0209257_1002359 | Ga0209257_10023598 | 333 |
| 1153 | 3300025304 | Ga0209257_1003258 | Ga0209257_100325812 | 333 |
| 1154 | 3300025919 | Ga0207657_10094172 | Ga0207657_100941721 | 333 |
| 1155 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003756 | 333 |
| 1156 | 3300027312 | Ga0209371_1001970 | Ga0209371_10019708 | 333 |
| 1157 | 3300027866 | Ga0209813_10002642 | Ga0209813_100026424 | 333 |
| 1158 | 3300028379 | Ga0268266_10018839 | Ga0268266_100188394 | 333 |
| 1159 | 3300028379 | Ga0268266_10215456 | Ga0268266_102154561 | 333 |
| 1160 | 3300028794 | Ga0307515_10000386 | Ga0307515_1000038663 | 333 |
| 1161 | 3300028794 | Ga0307515_10086697 | Ga0307515_100866972 | 333 |
| 1162 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004294 | 333 |
| 1163 | 3300030500 | Ga0268256_1001045 | Ga0268256_10010457 | 333 |
| 1164 | 3300031456 | Ga0307513_10022270 | Ga0307513_100222703 | 333 |
| 1165 | 3300031649 | Ga0307514_10089318 | Ga0307514_100893182 | 333 |
| 1166 | 3300041413 | Ga0439465_0010269 | Ga0439465_0010269_1313_2314 | 333 |
| 1167 | 3300041413 | Ga0439465_0010635 | Ga0439465_0010635_1193_2194 | 333 |
| 1168 | 3300041413 | Ga0439465_0039107 | Ga0439465_0039107_40_1041 | 333 |
| 1169 | 3300041492 | Ga0451835_0532047 | Ga0451835_0532047_22_1023 | 333 |
| 1170 | 3300041497 | Ga0451840_01892 | Ga0451840_01892_169_1170 | 333 |
| 1171 | 3300041502 | Ga0451846_65077 | Ga0451846_65077_388_1389 | 333 |
| 1172 | 3300041510 | Ga0451854_08073 | Ga0451854_08073_534_1535 | 333 |
| 1173 | 3300041907 | Ga0452268_51778 | Ga0452268_51778_243_1244 | 333 |
| 1174 | 3300044672 | Ga0466982_0210788 | Ga0466982_0210788_81_1082 | 333 |
| 1175 | 3300046452 | Ga0495617_026952 | Ga0495617_026952_537_1538 | 333 |
| 1176 | 3300046460 | Ga0495638_0000309 | Ga0495638_0000309_16753_17754 | 333 |
| 1177 | 3300046462 | Ga0495651_0140125 | Ga0495651_0140125_395_1396 | 333 |
| 1178 | 3300046474 | Ga0495605_0008993 | Ga0495605_0008993_4218_5219 | 333 |
| 1179 | 3300046492 | Ga0495585_0044724 | Ga0495585_0044724_1000_2001 | 333 |
| 1180 | 3300046501 | Ga0495607_0022992 | Ga0495607_0022992_2443_3444 | 333 |
| 1181 | 3300046501 | Ga0495607_0031078 | Ga0495607_0031078_1944_2951 | 333 |
| 1182 | 3300046506 | Ga0495583_0003999 | Ga0495583_0003999_1919_2920 | 333 |
| 1183 | 3300046507 | Ga0495606_0003931 | Ga0495606_0003931_7521_8522 | 333 |
| 1184 | 3300046507 | Ga0495606_0107991 | Ga0495606_0107991_561_1562 | 333 |
| 1185 | 3300046507 | Ga0495606_0136980 | Ga0495606_0136980_356_1357 | 333 |
| 1186 | 3300046507 | Ga0495606_0180825 | Ga0495606_0180825_14_1015 | 333 |
| 1187 | 3300046512 | Ga0495610_0033175 | Ga0495610_0033175_529_1530 | 333 |
| 1188 | 3300046518 | Ga0495631_0000183 | Ga0495631_0000183_41305_42306 | 333 |
| 1189 | 3300046522 | Ga0495643_0074717 | Ga0495643_0074717_597_1598 | 333 |
| 1190 | 3300046522 | Ga0495643_0140273 | Ga0495643_0140273_17_1018 | 333 |
| 1191 | 3300046524 | Ga0495648_0121545 | Ga0495648_0121545_321_1322 | 333 |
| 1192 | 3300046530 | Ga0495654_0091582 | Ga0495654_0091582_273_1274 | 333 |
| 1193 | 3300046538 | Ga0495609_0005705 | Ga0495609_0005705_1146_2147 | 333 |
| 1194 | 3300046558 | Ga0495633_0048332 | Ga0495633_0048332_725_1726 | 333 |
| 1195 | 3300046616 | Ga0495668_0004368 | Ga0495668_0004368_6898_7899 | 333 |
| 1196 | 3300046648 | Ga0495611_0005329 | Ga0495611_0005329_410_1411 | 333 |
| 1197 | 3300046660 | Ga0495625_0000737 | Ga0495625_0000737_461_1462 | 333 |
| 1198 | 3300046660 | Ga0495625_0072202 | Ga0495625_0072202_124_1125 | 333 |
| 1199 | 3300046675 | Ga0495657_0017333 | Ga0495657_0017333_284_1285 | 333 |
| 1200 | 3300046691 | Ga0495670_0045289 | Ga0495670_0045289_1184_2185 | 333 |
| 1201 | 3300047320 | Ga0495672_0047015 | Ga0495672_0047015_1160_2161 | 333 |
| 1202 | 3300047470 | Ga0495681_0008827 | Ga0495681_0008827_4081_5082 | 333 |
| 1203 | 3300047470 | Ga0495681_0057144 | Ga0495681_0057144_425_1426 | 333 |
| 1204 | 3300047472 | Ga0495686_0008302 | Ga0495686_0008302_6129_7130 | 333 |
| 1205 | 3300047472 | Ga0495686_0069440 | Ga0495686_0069440_191_1192 | 333 |
| 1206 | 3300047472 | Ga0495686_0135797 | Ga0495686_0135797_376_1377 | 333 |
| 1207 | 3300048909 | Ga0496106_0000760 | Ga0496106_0000760_21873_22874 | 333 |
| 1208 | 3300048915 | Ga0496112_0532469 | Ga0496112_0532469_33_1034 | 333 |
| 1209 | 3300048916 | Ga0496113_0065709 | Ga0496113_0065709_689_1690 | 333 |
| 1210 | 3300048919 | Ga0496116_0032549 | Ga0496116_0032549_297_1298 | 333 |
| 1211 | 3300048920 | Ga0496117_0000052 | Ga0496117_0000052_40529_41530 | 333 |
| 1212 | 3300048921 | Ga0496118_0000792 | Ga0496118_0000792_9103_10104 | 333 |
| 1213 | 3300048921 | Ga0496118_0078765 | Ga0496118_0078765_283_1284 | 333 |
| 1214 | 3300048923 | Ga0496120_0000019 | Ga0496120_0000019_40529_41530 | 333 |
| 1215 | 3300048924 | Ga0496121_0007187 | Ga0496121_0007187_10141_11142 | 333 |
| 1216 | 3300048924 | Ga0496121_0016496 | Ga0496121_0016496_6563_7564 | 333 |
| 1217 | 3300048924 | Ga0496121_0022327 | Ga0496121_0022327_5110_6117 | 333 |
| 1218 | 3300048924 | Ga0496121_0042776 | Ga0496121_0042776_303_1304 | 333 |
| 1219 | 3300048924 | Ga0496121_0064361 | Ga0496121_0064361_729_1730 | 333 |
| 1220 | 3300048924 | Ga0496121_0071722 | Ga0496121_0071722_1041_2042 | 333 |
| 1221 | 3300048924 | Ga0496121_0074626 | Ga0496121_0074626_1119_2126 | 333 |
| 1222 | 3300048925 | Ga0496122_0000042 | Ga0496122_0000042_56778_57779 | 333 |
| 1223 | 3300048925 | Ga0496122_0000053 | Ga0496122_0000053_40529_41530 | 333 |
| 1224 | 3300048925 | Ga0496122_0101472 | Ga0496122_0101472_488_1489 | 333 |
| 1225 | 3300048926 | Ga0496123_0000030 | Ga0496123_0000030_233981_234982 | 333 |
| 1226 | 3300048926 | Ga0496123_0000038 | Ga0496123_0000038_40529_41530 | 333 |
| 1227 | 3300048926 | Ga0496123_0097916 | Ga0496123_0097916_334_1335 | 333 |
| 1228 | 3300048927 | Ga0496124_0000139 | Ga0496124_0000139_46470_47471 | 333 |
| 1229 | 3300048927 | Ga0496124_0063069 | Ga0496124_0063069_509_1513 | 333 |
| 1230 | 3300048927 | Ga0496124_0182178 | Ga0496124_0182178_178_1179 | 333 |
| 1231 | 3300048927 | Ga0496124_0182364 | Ga0496124_0182364_474_1481 | 333 |
| 1232 | 3300048928 | Ga0496125_0079083 | Ga0496125_0079083_1266_2267 | 333 |
| 1233 | 3300048928 | Ga0496125_0135504 | Ga0496125_0135504_20_1021 | 333 |
| 1234 | 3300048929 | Ga0496126_0067226 | Ga0496126_0067226_1211_2212 | 333 |
| 1235 | 3300049459 | Ga0495678_055692 | Ga0495678_055692_86_1087 | 333 |
| 1236 | 3300049573 | Ga0501037_0078992 | Ga0501037_0078992_55_1056 | 333 |
| 1237 | 3300049574 | Ga0501038_0105139 | Ga0501038_0105139_397_1398 | 333 |
| 1238 | 3300049579 | Ga0501043_0161920 | Ga0501043_0161920_97_1098 | 333 |
| 1239 | 3300049581 | Ga0501047_0205619 | Ga0501047_0205619_359_1360 | 333 |
| 1240 | 3300049583 | Ga0501067_0139287 | Ga0501067_0139287_20_1021 | 333 |
| 1241 | 3300049742 | Ga0501080_0132140 | Ga0501080_0132140_72_1073 | 333 |
| 1242 | 3300049776 | Ga0501280_003283 | Ga0501280_003283_1264_2265 | 333 |
| 1243 | 3300049823 | Ga0501044_0413739 | Ga0501044_0413739_126_1127 | 333 |
| 1244 | 3300050489 | nmdc:mga03683_7456_c1 | nmdc:mga03683_7456_c1_515_1516 | 333 |
| 1245 | 3300050490 | nmdc:mga03n38_985_c1 | nmdc:mga03n38_985_c1_2458_3459 | 333 |
| 1246 | 3300050491 | nmdc:mga00v17_55_c1 | nmdc:mga00v17_55_c1_60270_61271 | 333 |
| 1247 | 3300050493 | nmdc:mga0k408_2026_c1 | nmdc:mga0k408_2026_c1_4670_5671 | 333 |
| 1248 | 3300050494 | nmdc:mga06z11_80023_c1 | nmdc:mga06z11_80023_c1_500_1501 | 333 |
| 1249 | 3300050516 | nmdc:mga0sz30_32_c1 | nmdc:mga0sz30_32_c1_31562_32563 | 333 |
| 1250 | 3300053105 | Ga0500557_011818 | Ga0500557_011818_495_1496 | 333 |
| 1251 | 3300053125 | Ga0500618_000717 | Ga0500618_000717_8869_9876 | 333 |
| 1252 | 3300053125 | Ga0500618_009856 | Ga0500618_009856_338_1345 | 333 |
| 1253 | 3300053134 | Ga0500658_0012637 | Ga0500658_0012637_518_1519 | 333 |
| 1254 | 3300053137 | Ga0500561_0001332 | Ga0500561_0001332_44_1045 | 333 |
| 1255 | 3300053139 | Ga0500568_0001296 | Ga0500568_0001296_454_1455 | 333 |
| 1256 | 3300053139 | Ga0500568_0023471 | Ga0500568_0023471_1132_2133 | 333 |
| 1257 | 3300053148 | Ga0500590_033078 | Ga0500590_033078_1208_2224 | 333 |
| 1258 | 3300053151 | Ga0500604_0004488 | Ga0500604_0004488_496_1497 | 333 |
| 1259 | 3300053153 | Ga0500616_0000980 | Ga0500616_0000980_11958_12959 | 333 |
| 1260 | 3300053156 | Ga0500622_0000780 | Ga0500622_0000780_10855_11856 | 333 |
| 1261 | 3300053156 | Ga0500622_0027811 | Ga0500622_0027811_1280_2281 | 333 |
| 1262 | 3300053177 | Ga0500636_0000245 | Ga0500636_0000245_6710_7711 | 333 |
| 1263 | 3300060353 | Ga0501082_0253340 | Ga0501082_0253340_59_1060 | 333 |
| 1264 | iso_pu_bacteria | 2563366752 | 2563930621 | 333 |
| 1265 | 3300003322 | rootL2_10026958 | rootL2_1002695812 | 334 |
| 1266 | 3300044656 | Ga0466969_0000373 | Ga0466969_0000373_21389_22411 | 334 |
| 1267 | 3300046457 | Ga0495590_0045296 | Ga0495590_0045296_452_1498 | 334 |
| 1268 | iso_pu_bacteria | 2615840698 | 2616554808 | 334 |
| 1269 | iso_pu_bacteria | 2818991448 | 2819609734 | 334 |
| 1270 | iso_pu_bacteria | 8005484373 | 8005488629 | 334 |
| 1271 | iso_pu_bacteria | 8005645114 | 8005649096 | 334 |
| 1272 | 3300005617 | Ga0068859_100000421 | Ga0068859_10000042113 | 335 |
| 1273 | 3300005844 | Ga0068862_100000433 | Ga0068862_10000043329 | 335 |
| 1274 | 3300006931 | Ga0097620_100000421 | Ga0097620_10000042113 | 335 |
| 1275 | 3300013100 | Ga0157373_10109717 | Ga0157373_101097172 | 335 |
| 1276 | 3300013104 | Ga0157370_10036865 | Ga0157370_100368654 | 335 |
| 1277 | 3300025941 | Ga0207711_10000049 | Ga0207711_1000004944 | 335 |
| 1278 | 3300025961 | Ga0207712_10010624 | Ga0207712_100106244 | 335 |
| 1279 | 3300028380 | Ga0268265_10000422 | Ga0268265_1000042224 | 335 |
| 1280 | 3300044684 | Ga0466966_0005580 | Ga0466966_0005580_1588_2718 | 335 |
| 1281 | 3300045049 | Ga0466959_0030345 | Ga0466959_0030345_801_1931 | 335 |
| 1282 | 3300048920 | Ga0496117_0053048 | Ga0496117_0053048_276_1289 | 335 |
| 1283 | 3300048921 | Ga0496118_0162080 | Ga0496118_0162080_276_1289 | 335 |
| 1284 | 3300048924 | Ga0496121_0000003 | Ga0496121_0000003_909054_910067 | 335 |
| 1285 | 3300048926 | Ga0496123_0086803 | Ga0496123_0086803_309_1322 | 335 |
| 1286 | 3300048928 | Ga0496125_0000170 | Ga0496125_0000170_123747_124760 | 335 |
| 1287 | iso_pu_bacteria | 2508501039 | 2508671141 | 335 |
| 1288 | iso_pu_bacteria | 2675902999 | 2676203372 | 335 |
| 1289 | iso_pu_bacteria | 2687453737 | 2689964227 | 335 |
| 1290 | iso_pu_bacteria | 2773857921 | 2774847948 | 335 |
| 1291 | 3300046460 | Ga0495638_0054620 | Ga0495638_0054620_552_1613 | 336 |
| 1292 | 3300050491 | nmdc:mga00v17_346_c2 | nmdc:mga00v17_346_c2_2767_3828 | 336 |
| 1293 | 3300032004 | Ga0307414_10155932 | Ga0307414_101559322 | 337 |
| 1294 | 3300047472 | Ga0495686_0000852 | Ga0495686_0000852_6201_7373 | 337 |
| 1295 | 2010549000 | RicEn_C5165 | RicEn_92080 | 338 |
| 1296 | 3300003215 | JGI25153J46596_10004925 | JGI25153J46596_100049257 | 338 |
| 1297 | 3300006844 | Ga0075428_100241623 | Ga0075428_1002416231 | 338 |
| 1298 | 3300009766 | Ga0123342_1017304 | Ga0123342_10173045 | 338 |
| 1299 | 3300025303 | Ga0209051_1028197 | Ga0209051_10281972 | 338 |
| 1300 | 3300041413 | Ga0439465_0029736 | Ga0439465_0029736_650_1708 | 338 |
| 1301 | 3300041496 | Ga0451839_0268071 | Ga0451839_0268071_239_1297 | 338 |
| 1302 | 3300041503 | Ga0451847_0036653 | Ga0451847_0036653_442_1500 | 338 |
| 1303 | 3300041505 | Ga0451849_0249873 | Ga0451849_0249873_11_1069 | 338 |
| 1304 | 3300042007 | Ga0439449_0025227 | Ga0439449_0025227_1078_2136 | 338 |
| 1305 | 3300046501 | Ga0495607_0036604 | Ga0495607_0036604_448_1506 | 338 |
| 1306 | 3300046507 | Ga0495606_0040817 | Ga0495606_0040817_390_1448 | 338 |
| 1307 | 3300046512 | Ga0495610_0011758 | Ga0495610_0011758_197_1255 | 338 |
| 1308 | 3300046513 | Ga0495616_0082792 | Ga0495616_0082792_413_1471 | 338 |
| 1309 | 3300046519 | Ga0495632_0071098 | Ga0495632_0071098_593_1651 | 338 |
| 1310 | 3300046522 | Ga0495643_0025280 | Ga0495643_0025280_1598_2656 | 338 |
| 1311 | 3300046558 | Ga0495633_0045394 | Ga0495633_0045394_125_1231 | 338 |
| 1312 | 3300046616 | Ga0495668_0038038 | Ga0495668_0038038_1362_2420 | 338 |
| 1313 | 3300046648 | Ga0495611_0063739 | Ga0495611_0063739_563_1621 | 338 |
| 1314 | 3300046660 | Ga0495625_0070031 | Ga0495625_0070031_98_1156 | 338 |
| 1315 | 3300047443 | Ga0495687_033205 | Ga0495687_033205_338_1396 | 338 |
| 1316 | 3300048090 | Ga0495615_0008053 | Ga0495615_0008053_87_1193 | 338 |
| 1317 | 3300053153 | Ga0500616_0049618 | Ga0500616_0049618_455_1513 | 338 |
| 1318 | iso_pu_bacteria | 2510917028 | 2511187180 | 338 |
| 1319 | iso_pu_bacteria | 2513237138 | 2513867563 | 338 |
| 1320 | iso_pu_bacteria | 2582581294 | 2585204886 | 338 |
| 1321 | iso_pu_bacteria | 2585427526 | 2585529611 | 338 |
| 1322 | iso_pu_bacteria | 2585427590 | 2585823664 | 338 |
| 1323 | iso_pu_bacteria | 2838042994 | 2838046388 | 338 |
| 1324 | iso_pu_bacteria | 2838668709 | 2838671289 | 338 |
| 1325 | iso_pu_bacteria | 2838686498 | 2838691465 | 338 |
| 1326 | iso_pu_bacteria | 2838701080 | 2838703530 | 338 |
| 1327 | iso_pu_bacteria | 2838729681 | 2838733424 | 338 |
| 1328 | iso_pu_bacteria | 2838742623 | 2838746004 | 338 |
| 1329 | iso_pu_bacteria | 2841851746 | 2841853716 | 338 |
| 1330 | iso_pu_bacteria | 2842146304 | 2842149468 | 338 |
| 1331 | iso_pu_bacteria | 2842156927 | 2842162277 | 338 |
| 1332 | iso_pu_bacteria | 2842163707 | 2842169833 | 338 |
| 1333 | iso_pu_bacteria | 2842180545 | 2842185203 | 338 |
| 1334 | iso_pu_bacteria | 2842192696 | 2842197764 | 338 |
| 1335 | iso_pu_bacteria | 2842217011 | 2842220220 | 338 |
| 1336 | iso_pu_bacteria | 2842229732 | 2842233690 | 338 |
| 1337 | iso_pu_bacteria | 2842243621 | 2842247734 | 338 |
| 1338 | iso_pu_bacteria | 2842250916 | 2842253894 | 338 |
| 1339 | iso_pu_bacteria | 2842257432 | 2842261998 | 338 |
| 1340 | iso_pu_bacteria | 2842271015 | 2842275939 | 338 |
| 1341 | iso_pu_bacteria | 2842285085 | 2842288928 | 338 |
| 1342 | iso_pu_bacteria | 2842304105 | 2842308077 | 338 |
| 1343 | iso_pu_bacteria | 2842363717 | 2842369362 | 338 |
| 1344 | iso_pu_bacteria | 2842402390 | 2842406405 | 338 |
| 1345 | iso_pu_bacteria | 2842409023 | 2842413168 | 338 |
| 1346 | iso_pu_bacteria | 2842415677 | 2842419811 | 338 |
| 1347 | iso_pu_bacteria | 2842489311 | 2842493123 | 338 |
| 1348 | iso_pu_bacteria | 2842495871 | 2842499307 | 338 |
| 1349 | iso_pu_bacteria | 2844454524 | 2844457639 | 338 |
| 1350 | iso_pu_bacteria | 2923556063 | 2923558913 | 338 |
| 1351 | iso_pu_bacteria | 2933570622 | 2933574526 | 338 |
| 1352 | iso_pu_bacteria | 2935901341 | 2935907042 | 338 |
| 1353 | iso_pu_bacteria | 2996887358 | 2996890123 | 338 |
| 1354 | iso_pu_bacteria | 8005258706 | 8005262156 | 338 |
| 1355 | iso_pu_bacteria | 8005307578 | 8005310815 | 338 |
| 1356 | iso_pu_bacteria | 8005321885 | 8005324650 | 338 |
| 1357 | iso_pu_bacteria | 8005460587 | 8005464477 | 338 |
| 1358 | iso_pu_bacteria | 8005556819 | 8005558525 | 338 |
| 1359 | iso_pu_bacteria | 8005563573 | 8005566631 | 338 |
| 1360 | iso_pu_bacteria | 8005626139 | 8005631818 | 338 |
| 1361 | iso_pu_bacteria | 8018163183 | 8018170075 | 338 |
| 1362 | iso_pu_bacteria | 8023680758 | 8023687696 | 338 |
| 1363 | iso_pu_bacteria | 8024501048 | 8024506092 | 338 |
| 1364 | iso_pu_bacteria | 8057874678 | 8057876678 | 338 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.8933 | 7 | 334 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.8928 | 3 | 334 |
| 4us5-assembly1.cif.gz_A | crystal structure of apo-msno8 | 0.8892 | 7 | 334 |
| 4us5-assembly2.cif.gz_D | crystal structure of apo-msno8 | 0.8849 | 3 | 334 |
| 4us5-assembly2.cif.gz_C | crystal structure of apo-msno8 | 0.8804 | 7 | 334 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9809 | 5 | 330 | 3.20.20.30 |
| af_P0ADV5_3_330_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9721 | 5 | 330 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9586 | 1 | 331 | 3.20.20.30 |
| af_Q2FXV3_1_329_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.9529 | 1 | 331 | 3.20.20.30 |
| af_Q2G151_1_332_3.20.20.30 | Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain | 0.8899 | 7 | 330 | 3.20.20.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A6I4KRK4-F1-model_v4 | deleted | 0.9916 | 8 | 104 |
|
| AF-A0A534XP08-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9883 | 8 | 100 |
GO:0005829
GO:0016705 |
| AF-A0A4R6FAV2-F1-model_v4 | Luciferase family oxidoreductase group 1 | 0.9877 | 7 | 331 |
GO:0005829
GO:0016705 |
| AF-A0A7Y6WWL1-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9858 | 7 | 330 |
GO:0005829
GO:0016705 |
| AF-A0A5B0DWW8-F1-model_v4 | LLM class flavin-dependent oxidoreductase | 0.9851 | 7 | 330 |
GO:0005829
GO:0016705 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar