F493364

General Info

Members Datasets Scaffolds Average Seq Length
1364 719 1055 332

Family's Representative Sequence

Representative Sequence 3300035088|Ga0373940_0017126|Ga0373940_0017126_71_1252
Length 393
Sequence MRVRWAGRGHAELFHRPAGYRTMSMIPAQPDSGPDRRVPLSVLDLAPIVQGGDAADAFRRSLDLAQHAERWGYRRFWLAEHHGLPGIASAATAVVIGHVAGGTSTIRVGAGGVMLPNHAPLVIAEQFGTLASLFPGRIDLGLGRAPGSDQLTARALRRSPLAADTFADDVVELMDYFRPPHPRQLVRAVPGAGLDVPVWILGSSLFGAQLAADLGLPYAFASHFAPAALDEALELYRARFKPSAQLDRPYVMLGVNLFAAESDDEGRRLFTSLQQAFVNLRRGHPGPLPPPVDGFVERLHPGDRRLLDEMLSCSVVGSPATVERGLEAFVARTGADELMLASQIYDHGARLRSYELAAGTSGPRQQPIEPSVDIDGSPFQGTATLGGNRLANS

Samples

Sample ID Description Type Environment
1 2010549000 Rice roots microbial communities from plants at IRRI, Los Banos, Philippines - endophytes Metagenome Endosphere
2 2506783011 Frankia datiscae Dg1 Isolate Nodule
3 2508501039 Frankia saprophytica CN3 Isolate Nodule
4 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
5 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
6 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
7 2510461069 Rhizobium sp. PDO1-076 Isolate Rhizosphere
8 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
9 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
10 2510917026 Rhizobium sp. CF80 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
14 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
15 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
16 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
17 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
18 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
19 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
20 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
21 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
22 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
23 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
24 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
25 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
26 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
27 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
28 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
29 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
30 2519899620 Rhizobium sp. Pop5 Isolate Nodule
31 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
32 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
33 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
34 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
35 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
36 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
37 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
38 2563366752 Paenibacillus pini JCM 16418 Isolate Rhizosphere
39 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
40 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
41 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
42 2582581304 Rhizobium sp. YR519 Isolate Rhizosphere
43 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
44 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
45 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
46 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
47 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
48 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
49 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
50 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
51 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
52 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
53 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
54 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
55 2585427594 Rhizobium sp. YR528 Isolate Rhizosphere
56 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
57 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
58 2585427633 Neorhizobium galegae bv. officinalis HAMBI 1141 Isolate Nodule
59 2585427634 Neorhizobium galegae bv. orientalis HAMBI 540 Isolate Nodule
60 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
61 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
62 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
63 2599185236 Rhizobium sp. NFR07 Isolate Rhizoplane
64 2600254933 Rhizobium sp. NFR12 Isolate Rhizoplane
65 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
66 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
67 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
68 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
69 2643221558 Rhizobium sp. Root149 Isolate Unclassified
70 2643221599 Rhizobium sp. Root708 Isolate Unclassified
71 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
72 2643221643 Rhizobium sp. Root1220 Isolate Unclassified
73 2643221653 Rhizobium sp. Root1240 Isolate Unclassified
74 2643221693 Rhizobium sp. Root491 Isolate Unclassified
75 2643221719 Rhizobium sp. Root274 Isolate Unclassified
76 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
77 2675902999 Frankia asymbiotica NRRL B-16386 Isolate Nodule
78 2687453737 Frankia sp. BMG5.36 Isolate Nodule
79 2718217882 Rhizobium sp. N741 Isolate Nodule
80 2718217927 Rhizobium sp. N324 Isolate Nodule
81 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
82 2718218009 Rhizobium sp. N561 Isolate Nodule
83 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
84 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
85 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
86 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
87 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
88 2718218363 Rhizobium sp. N113 Isolate Nodule
89 2718218365 Rhizobium sp. N731 Isolate Nodule
90 2718218366 Rhizobium sp. N621 Isolate Nodule
91 2718218423 Rhizobium sp. N941 Isolate Nodule
92 2721755514 Rhizobium sp. N6212 Isolate Nodule
93 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
94 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
95 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
96 2721755809 Rhizobium sp. N541 Isolate Nodule
97 2721755810 Rhizobium sp. N871 Isolate Nodule
98 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
99 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
100 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
101 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
102 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
103 2728369365 Rhizobium sp. N1341 Isolate Nodule
104 2728369397 Rhizobium sp. N1314 Isolate Nodule
105 2738541293 Rhizobium sp. GV031 Isolate Unclassified
106 2738541317 Rhizobium halophytocola DSM 21600 Isolate Unclassified
107 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
108 2738543013 Variovorax sp. BT01 Isolate Unclassified
109 2739367756 Asticcacaulis sp. CF398 Isolate Unclassified
110 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
111 2773857921 Frankia asymbiotica NRRL B-16386 Isolate Nodule
112 2773857933 Frankia sp. BMG5.30 Isolate Nodule
113 2775507049 Rhizobium sp. ACO-34A Isolate Unclassified
114 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
115 2791355256 Rhizobium sp. M10 Isolate Nodule
116 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
117 2791355260 Rhizobium sp. L9 Isolate Nodule
118 2791355261 Rhizobium sp. J15 Isolate Nodule
119 2791355262 Rhizobium sp. M1 Isolate Nodule
120 2791355263 Rhizobium chutanense C5 Isolate Nodule
121 2791355264 Rhizobium sp. S9 Isolate Nodule
122 2791355265 Rhizobium sp. H4 Isolate Nodule
123 2791355266 Rhizobium sp. L43 Isolate Nodule
124 2791355267 Rhizobium sp. L18 Isolate Nodule
125 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
126 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
127 2802429633 Rhizobium anhuiense J3 Isolate Nodule
128 2802429634 Rhizobium anhuiense S10 Isolate Nodule
129 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
130 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
131 2802429637 Rhizobium anhuiense C15 Isolate Nodule
132 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
133 2818991272 Rhizobium sp. SLBN-4 Isolate Unclassified
134 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
135 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
136 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
137 2818991461 Neorhizobium alkalisoli 1225 Isolate Unclassified
138 2821123053 Rhizobium cellulosilyticum 1193 Isolate Unclassified
139 2835188231 Isoptericola variabilis JZ7 Isolate Unclassified
140 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
141 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
142 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
143 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
144 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
145 2838048938 Rhizobium pisi 27/80 Isolate Nodule
146 2838061910 Rhizobium phaseoli L15 Isolate Nodule
147 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
148 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
149 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
150 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
151 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
152 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
153 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
154 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
155 2838729681 Rhizobium leguminosarum SEMIA 445 Isolate Nodule
156 2838736955 Rhizobium cellulosilyticum SEMIA 448 Isolate Nodule
157 2838742623 Rhizobium leguminosarum SEMIA 449 Isolate Nodule
158 2841840854 Rhizobium cellulosilyticum SEMIA 444 Isolate Nodule
159 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
160 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
161 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
162 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
163 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
164 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
165 2842140634 Rhizobium cellulosilyticum SEMIA 452 Isolate Nodule
166 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
167 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
168 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
169 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
170 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
171 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
172 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
173 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
174 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
175 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
176 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
177 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
178 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
179 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
180 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
181 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
182 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
183 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
184 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
185 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
186 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
187 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
188 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
189 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
190 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
191 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
192 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
193 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
194 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
195 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
196 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
197 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
198 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
199 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
200 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
201 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
202 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
203 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
204 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
205 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
206 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
207 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
208 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
209 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
210 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
211 2842733646 Variovorax sp. R-72446 Isolate Unclassified
212 2842747753 Variovorax sp. R-72060 Isolate Unclassified
213 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
214 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
215 2854896431 Neorhizobium alkalisoli DSM 21826 Isolate Unclassified
216 2854916844 Neorhizobium huautlense DSM 21817 Isolate Unclassified
217 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
218 2857531043 Neorhizobium sp. R-72160 Isolate Unclassified
219 2869162929 Mesorhizobium sanjuanii BSA136 Isolate Nodule
220 2885192300 Variovorax sp. MHTC-1 Isolate Rhizosphere
221 2885305155 Mesorhizobium sp. M1E.F.Ca.ET.045.02.1.1 Isolate Nodule
222 2885326080 Mesorhizobium sp. M1E.F.Ca.ET.041.01.1.1 Isolate Nodule
223 2885334103 Mesorhizobium sp. M1E.F.Ca.ET.063.01.1.1 Isolate Nodule
224 2887375801 Parapusillimonas sp. SGNA-6 Isolate Rhizosphere
225 2894772417 Roseomonas oryzicola KCTC 22478 Isolate Rhizosphere
226 2895511927 Pseudoxanthomonas sp. SGD-5-1 Isolate Rhizosphere
227 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
228 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
229 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
230 2899924645 Variovorax sp. 369 Isolate Unclassified
231 2904541872 Variovorax sp. 1615 Isolate Rhizosphere
232 2913308742 Rhizobium halophytocola DSM 21600 Isolate Unclassified
233 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
234 2919171160 Neorhizobium sp. 2083 Isolate Unclassified
235 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
236 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
237 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
238 2928044640 Variovorax sp. 1128 Isolate Unclassified
239 2928051484 Variovorax sp. 1133 Isolate Unclassified
240 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
241 2929160207 Variovorax sp. R-72349 Hybrid assembly Isolate Unclassified
242 2929206907 Paenibacillus sp. R-74146 Hybrid assembly Isolate Unclassified
243 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
244 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
245 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
246 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
247 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
248 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
249 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
250 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
251 2936381700 Rhizobium chutanense C16 Isolate Unclassified
252 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
253 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
254 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
255 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
256 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
257 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
258 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
259 2989776772 Rhizobium glycinendophyticum CL12 Isolate Unclassified
260 2996887358 Rhizobium sp. R711 Isolate Nodule
261 2996893221 Rhizobium sp. R635 Isolate Nodule
262 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
263 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
264 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
265 3300001904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 Metagenome Rhizosphere
266 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
267 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
268 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
269 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
270 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
271 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
272 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
273 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
274 3300002774 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA Metagenome Endosphere
275 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
276 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
277 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
278 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
279 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
280 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
281 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
282 3300003752 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 Metagenome Endosphere
283 3300003759 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 Metagenome Endosphere
284 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
285 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
286 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
287 3300003784 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 Metagenome Endosphere
288 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
289 3300003791 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 Metagenome Endosphere
290 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
291 3300003794 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 Metagenome Endosphere
292 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
293 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
294 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
295 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
296 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
297 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
298 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
299 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
300 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
301 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
302 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
303 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
304 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
305 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
306 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
307 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
308 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
309 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
310 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
311 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
312 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
313 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
314 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
315 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
316 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
317 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
318 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
319 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
320 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
321 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
322 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
323 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
324 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
325 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
326 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
327 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
328 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
329 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
330 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
331 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
332 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
333 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
334 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
335 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
336 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
337 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
338 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
339 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
340 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
341 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
342 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
343 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
344 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
345 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
346 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
347 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
348 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
349 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
350 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
351 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
352 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
353 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
354 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
355 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
356 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
357 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
358 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
359 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
360 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
361 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
362 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
363 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
364 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
365 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
366 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
367 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
368 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
369 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
370 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
371 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
372 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
373 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
374 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
375 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
376 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
377 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
378 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
379 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
380 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
381 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
382 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
383 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
384 3300015683 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_F04 Metagenome Rhizosphere
385 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
386 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
387 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
388 3300020080 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
389 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
390 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
391 3300020610 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
392 3300021361 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 Metagenome Rhizosphere
393 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
394 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
395 3300025207 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
396 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
397 3300025230 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
398 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
399 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
400 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
401 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
402 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
403 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
404 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
405 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
406 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
407 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
408 3300025291 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mLB_r2 (SPAdes) (version 3) Metagenome Endosphere
409 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
410 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
411 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
412 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
413 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
414 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
415 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
416 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
417 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
418 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
419 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
420 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
421 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
422 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
423 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
424 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
425 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
426 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
427 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
428 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
429 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
430 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
431 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
432 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
433 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
434 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
435 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
436 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
437 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
438 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
439 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
440 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
441 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
442 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
443 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
444 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
445 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
446 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
447 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
448 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
449 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
450 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
451 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
452 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
453 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
454 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
455 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
456 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
457 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
458 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
459 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
460 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
461 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
462 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
463 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
464 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
465 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
466 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
467 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
468 3300028577 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG Metagenome Rhizosphere
469 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
470 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
471 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
472 3300030521 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 13_EM Metagenome Unclassified
473 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
474 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
475 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
476 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
477 3300031242 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-27 metaG Metagenome Rhizosphere
478 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
479 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
480 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
481 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
482 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
483 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
484 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
485 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
486 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
487 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
488 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
489 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
490 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
491 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
492 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
493 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
494 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
495 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
496 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
497 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
498 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
499 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
500 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
501 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
502 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
503 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
504 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
505 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
506 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
507 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
508 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
509 3300041411 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0409DE14Z080117_6708 Metagenome Rhizosphere
510 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
511 3300041492 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG Metagenome Unclassified
512 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
513 3300041497 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT Metatranscriptome Unclassified
514 3300041502 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaT Metatranscriptome Unclassified
515 3300041503 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_8 MetaG Metagenome Unclassified
516 3300041505 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_9 MetaG Metagenome Unclassified
517 3300041510 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaT Metatranscriptome Unclassified
518 3300041907 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaT_extra_run Metatranscriptome Unclassified
519 3300042004 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612WE14Z082817_5619 Metagenome Rhizosphere
520 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
521 3300042010 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z080117_5431 Metagenome Rhizosphere
522 3300042014 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216WE14Z070717_5275 Metagenome Rhizosphere
523 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
524 3300042115 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_080116_2642 Metagenome Rhizosphere
525 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
526 3300044672 Roots microbial communities from millet plant in semiarid region near Thies, Senegal - COA3E Metagenome Unclassified
527 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
528 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
529 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
530 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
531 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
532 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
533 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
534 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
535 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
536 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
537 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
538 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
539 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
540 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
541 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
542 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
543 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
544 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
545 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
546 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
547 3300046506 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 rhizosphere Metagenome Rhizosphere
548 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
549 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
550 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
551 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
552 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
553 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
554 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
555 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
556 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
557 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
558 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
559 3300046530 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co1_10_5 rhizosphere Metagenome Rhizosphere
560 3300046538 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co1_12_7 rhizosphere Metagenome Rhizosphere
561 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
562 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
563 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
564 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
565 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
566 3300046648 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 rhizosphere Metagenome Rhizosphere
567 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
568 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
569 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
570 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
571 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
572 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
573 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
574 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
575 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
576 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
577 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
578 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
579 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
580 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
581 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
582 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
583 3300047469 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co3_31_39 rhizosphere Metagenome Rhizosphere
584 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
585 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
586 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
587 3300048090 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co1_10_3 rhizosphere Metagenome Rhizosphere
588 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
589 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
590 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
591 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
592 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
593 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
594 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
595 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
596 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
597 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
598 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
599 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
600 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
601 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
602 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
603 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
604 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
605 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
606 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
607 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
608 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
609 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
610 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
611 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
612 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
613 3300049459 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 rhizosphere Metagenome Rhizosphere
614 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
615 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
616 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
617 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
618 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
619 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
620 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
621 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
622 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
623 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
624 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
625 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
626 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
627 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
628 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
629 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
630 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
631 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
632 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
633 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
634 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
635 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
636 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
637 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
638 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
639 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
640 3300049776 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H24_A_5_drought Metagenome Rhizosphere
641 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
642 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
643 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
644 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
645 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
646 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
647 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
648 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
649 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
650 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
651 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
652 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
653 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
654 3300053092 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co3_15_40 endosphere Metagenome Endosphere
655 3300053105 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 endosphere Metagenome Endosphere
656 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
657 3300053117 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 endosphere Metagenome Endosphere
658 3300053118 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 endosphere Metagenome Endosphere
659 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
660 3300053133 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 endosphere Metagenome Endosphere
661 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
662 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
663 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
664 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
665 3300053148 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 endosphere Metagenome Endosphere
666 3300053151 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 endosphere Metagenome Endosphere
667 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
668 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
669 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
670 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
671 3300059421 Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 Metagenome Rhizosphere
672 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
673 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
674 639633007 Azoarcus olearius BH72 Isolate Unclassified
675 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
676 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
677 8005246636 Rhizobium wuzhouense W44 Isolate Rhizosphere
678 8005258706 Rhizobium sp. R693 Isolate Nodule
679 8005275841 Rhizobium sp. N4311 Isolate Nodule
680 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
681 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
682 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
683 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
684 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
685 8005321885 Rhizobium sp. R72 Isolate Nodule
686 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
687 8005382845 Rhizobium sp. R634 Isolate Nodule
688 8005395548 Rhizobium sp. R339 Isolate Nodule
689 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
690 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
691 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
692 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
693 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
694 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
695 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
696 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
697 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
698 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
699 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
700 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
701 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
702 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
703 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
704 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
705 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
706 8018150411 Rhizobium straminoryzae SM12 Isolate Rhizosphere
707 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
708 8018176218 Rhizobium sp. N122 Isolate Nodule
709 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
710 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
711 8024486573 Rhizobium tubonense CCBAU 85046 Isolate Nodule
712 8024501048 Rhizobium sp. H4 Isolate Nodule
713 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
714 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
715 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
716 8056382006 Rhizobium croatiense 13T Isolate Nodule
717 8056875544 Rhizobium halophilum TRM95001 Isolate Rhizosphere
718 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
719 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 76.47
Metatranscriptomes 0.88
Isolates 22.65

Biome Distribution

Category Percentage (%)
Aerial Root 0.29
Bulb 0
Endosphere 13.56
Nodule 14.66
Rhizoplane 2.93
Rhizosphere 56.09
Stem 0
Stem Tuber 0
Unclassified 12.46

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 RicEn_C5165 2010549000 Bacteria 1417
2 JGI24736J21556_1001796 3300001904 Bacteria 3852
3 JGI24741J21665_1000582 3300001915 Bacteria 11068
4 JGI24740J21852_10002373 3300001979 Bacteria 8560
5 JGI24740J21852_10003345 3300001979 Bacteria 7067
6 JGI25155J39150_1000007 3300002704 Bacteria 238857
7 JGI25156J39149_1000066 3300002705 Bacteria 82816
8 JGI25162J39368_1000488 3300002737 Bacteria 30289
9 JGI25162J39368_1001297 3300002737 Bacteria 14115
10 JGI25154J39366_1000035 3300002738 Bacteria 172224
11 JGI25157J39369_1000036 3300002741 Bacteria 133671
12 JGI25152J39213_1004590 3300002773 Bacteria 4302
13 JGI25152J39213_1014814 3300002773 Bacteria 1563
14 JGI25150J39212_1000144 3300002774 Bacteria 40186
15 JGI25159J45721_1000463 3300002987 Bacteria 18770
16 JGI25159J45721_1001920 3300002987 Bacteria 8309
17 JGI25151J46595_10000031 3300003187 Bacteria 197865
18 JGI25151J46595_10001277 3300003187 Bacteria 17761
19 JGI25151J46595_10032082 3300003187 Bacteria 2041
20 JGI25165J46597_1000676 3300003214 Bacteria 27457
21 JGI25165J46597_1001184 3300003214 Bacteria 15921
22 JGI25153J46596_10004925 3300003215 Bacteria 7096
23 JGI25153J46596_10004998 3300003215 Bacteria 7037
24 rootL2_10026958 3300003322 Bacteria 10783
25 JGI25160J50197_1000100 3300003354 Bacteria 86646
26 JGI25160J50197_1001130 3300003354 Bacteria 13639
27 JGI25160J50197_1006336 3300003354 Bacteria 4805
28 JGI25161J50226_1000072 3300003374 Bacteria 86646
29 JGI25161J50226_1000104 3300003374 Bacteria 67942
30 JGI25161J50226_1000396 3300003374 Bacteria 21728
31 Ga0055539_1002732 3300003752 Bacteria 2605
32 Ga0055525_1000036 3300003759 Bacteria 298878
33 Ga0055526_1001414 3300003771 Bacteria 17081
34 Ga0055526_1012623 3300003771 Bacteria 3664
35 Ga0055526_1023211 3300003771 Bacteria 2078
36 Ga0055526_1024203 3300003771 Bacteria 1996
37 Ga0055524_1008292 3300003775 Bacteria 4327
38 Ga0055524_1015401 3300003775 Bacteria 2790
39 Ga0055536_1005370 3300003781 Bacteria 6283
40 Ga0055534_1001811 3300003784 Bacteria 8005
41 Ga0055528_1000695 3300003790 Bacteria 23949
42 Ga0055528_1001150 3300003790 Bacteria 17214
43 Ga0055528_1003280 3300003790 Bacteria 8231
44 Ga0055528_1008246 3300003790 Bacteria 4499
45 Ga0055528_1011300 3300003790 Bacteria 3559
46 Ga0055530_10022910 3300003791 Bacteria 1807
47 Ga0055540_1000752 3300003792 Bacteria 21989
48 Ga0055540_1004512 3300003792 Bacteria 6237
49 Ga0055540_1005410 3300003792 Bacteria 5379
50 Ga0055540_1007583 3300003792 Bacteria 4061
51 Ga0055540_1012146 3300003792 Bacteria 2724
52 Ga0055531_10003153 3300003794 Bacteria 10605
53 Ga0055531_10003943 3300003794 Bacteria 9215
54 Ga0058692_1002399 3300003856 Bacteria 6287
55 Ga0055543_1000078 3300004625 Bacteria 85340
56 Ga0055543_1000280 3300004625 Bacteria 37509
57 Ga0065165_1000623 3300005262 Bacteria 51455
58 Ga0065165_1002557 3300005262 Bacteria 15059
59 Ga0065165_1026404 3300005262 Bacteria 1911
60 Ga0070658_10000253 3300005327 Bacteria 46941
61 Ga0070658_10034330 3300005327 Bacteria 4081
62 Ga0070658_10046534 3300005327 Bacteria 3510
63 Ga0070683_100023206 3300005329 Bacteria 5548
64 Ga0070683_100023540 3300005329 Bacteria 5509
65 Ga0070683_100038909 3300005329 Bacteria 4363
66 Ga0070683_100121335 3300005329 Bacteria 2469
67 Ga0068869_100135223 3300005334 Bacteria 1899
68 Ga0070666_10035138 3300005335 Bacteria 3323
69 Ga0070680_100004729 3300005336 Bacteria 10247
70 Ga0070680_100019004 3300005336 Bacteria 5439
71 Ga0070680_100019667 3300005336 Bacteria 5355
72 Ga0070680_100046207 3300005336 Bacteria 3541
73 Ga0070680_100097355 3300005336 Bacteria 2440
74 Ga0070680_100116211 3300005336 Bacteria 2230
75 Ga0070680_100293576 3300005336 Bacteria 1378
76 Ga0070682_100049310 3300005337 Bacteria 2625
77 Ga0070682_100085439 3300005337 Bacteria 2053
78 Ga0070682_100113963 3300005337 Bacteria 1806
79 Ga0068868_100193279 3300005338 Bacteria 1693
80 Ga0070660_100035735 3300005339 Bacteria 3761
81 Ga0070660_100250026 3300005339 Bacteria 1445
82 Ga0070691_10000346 3300005341 Bacteria 16494
83 Ga0070661_100011899 3300005344 Bacteria 6073
84 Ga0070661_100032241 3300005344 Bacteria 3792
85 Ga0070661_100128804 3300005344 Bacteria 1900
86 Ga0070692_10006692 3300005345 Bacteria 5022
87 Ga0070692_10012767 3300005345 Bacteria 3900
88 Ga0070668_100132243 3300005347 Bacteria 2004
89 Ga0070669_100036844 3300005353 Bacteria 3546
90 Ga0070669_100211508 3300005353 Bacteria 1530
91 Ga0070669_100212799 3300005353 Bacteria 1526
92 Ga0070669_100225018 3300005353 Bacteria 1485
93 Ga0070671_100004730 3300005355 Bacteria 10811
94 Ga0070671_100029091 3300005355 Bacteria 4555
95 Ga0070667_100008497 3300005367 Bacteria 8513
96 Ga0070667_100113050 3300005367 Bacteria 2356
97 Ga0070709_10035983 3300005434 Bacteria 3012
98 Ga0070709_10109793 3300005434 Bacteria 1852
99 Ga0070714_100034690 3300005435 Bacteria 4226
100 Ga0070714_100048057 3300005435 Bacteria 3628
101 Ga0070714_100049230 3300005435 Bacteria 3587
102 Ga0070713_100002078 3300005436 Bacteria 12941
103 Ga0070713_100019647 3300005436 Bacteria 5165
104 Ga0070711_100168028 3300005439 Bacteria 1669
105 Ga0070700_100176122 3300005441 Bacteria 1485
106 Ga0070708_100000241 3300005445 Bacteria 40642
107 Ga0070708_100004969 3300005445 Bacteria 10506
108 Ga0070663_100096368 3300005455 Bacteria 2200
109 Ga0070678_100047817 3300005456 Bacteria 3076
110 Ga0070662_100015877 3300005457 Bacteria 5051
111 Ga0070681_10000944 3300005458 Bacteria 24477
112 Ga0070681_10024374 3300005458 Bacteria 6091
113 Ga0070681_10042102 3300005458 Bacteria 4577
114 Ga0070681_10051581 3300005458 Bacteria 4103
115 Ga0070681_10077426 3300005458 Bacteria 3283
116 Ga0070681_10079325 3300005458 Bacteria 3239
117 Ga0070707_100132667 3300005468 Bacteria 2423
118 Ga0070707_100291758 3300005468 Bacteria 1585
119 Ga0070699_100029109 3300005518 Bacteria 4763
120 Ga0070679_100001195 3300005530 Bacteria 22809
121 Ga0070679_100034303 3300005530 Bacteria 5029
122 Ga0070679_100041528 3300005530 Bacteria 4577
123 Ga0070679_100041890 3300005530 Bacteria 4559
124 Ga0070679_100080762 3300005530 Bacteria 3241
125 Ga0070679_100087266 3300005530 Bacteria 3107
126 Ga0070679_100259093 3300005530 Bacteria 1694
127 Ga0070679_100321496 3300005530 Bacteria 1497
128 Ga0070684_100011755 3300005535 Bacteria 6983
129 Ga0070684_100030837 3300005535 Bacteria 4560
130 Ga0070684_100033388 3300005535 Bacteria 4393
131 Ga0070684_100073917 3300005535 Bacteria 3004
132 Ga0068853_100060825 3300005539 Bacteria 3264
133 Ga0068853_100325541 3300005539 Bacteria 1425
134 Ga0070672_100077333 3300005543 Bacteria 2661
135 Ga0070696_100021029 3300005546 Bacteria 4422
136 Ga0070665_100018720 3300005548 Bacteria 6943
137 Ga0070665_100025227 3300005548 Bacteria 5989
138 Ga0070665_100055026 3300005548 Bacteria 3991
139 Ga0070665_100080487 3300005548 Bacteria 3263
140 Ga0070665_100288661 3300005548 Bacteria 1643
141 Ga0070665_100360853 3300005548 Bacteria 1459
142 Ga0068855_100007019 3300005563 Bacteria 13668
143 Ga0068855_100016173 3300005563 Bacteria 8970
144 Ga0068855_100067798 3300005563 Bacteria 4155
145 Ga0068855_100086230 3300005563 Bacteria 3631
146 Ga0068855_100210331 3300005563 Bacteria 2186
147 Ga0068855_100531508 3300005563 Bacteria 1275
148 Ga0070664_100000477 3300005564 Bacteria 30247
149 Ga0070664_100020672 3300005564 Bacteria 5422
150 Ga0070664_100024731 3300005564 Bacteria 4971
151 Ga0070664_100047232 3300005564 Bacteria 3637
152 Ga0068857_100004249 3300005577 Bacteria 12073
153 Ga0068857_100035167 3300005577 Bacteria 4435
154 Ga0068857_100047477 3300005577 Bacteria 3813
155 Ga0068857_100084204 3300005577 Bacteria 2841
156 Ga0068857_100191711 3300005577 Bacteria 1862
157 Ga0068854_100035067 3300005578 Bacteria 3510
158 Ga0068854_100160848 3300005578 Bacteria 1739
159 Ga0068856_100025937 3300005614 Bacteria 5715
160 Ga0068856_100064087 3300005614 Bacteria 3631
161 Ga0068856_100465197 3300005614 Bacteria 1285
162 Ga0068852_100037601 3300005616 Bacteria 4060
163 Ga0068852_100379177 3300005616 Bacteria 1387
164 Ga0068859_100000421 3300005617 Bacteria 42369
165 Ga0068859_100001222 3300005617 Bacteria 26208
166 Ga0068859_100048247 3300005617 Bacteria 4278
167 Ga0068864_100067294 3300005618 Bacteria 3111
168 Ga0068864_100135764 3300005618 Bacteria 2215
169 Ga0068863_100162433 3300005841 Bacteria 2140
170 Ga0068858_100002701 3300005842 Bacteria 17882
171 Ga0068858_100014485 3300005842 Bacteria 7430
172 Ga0068858_100268723 3300005842 Bacteria 1622
173 Ga0068858_100291860 3300005842 Bacteria 1555
174 Ga0068860_100047094 3300005843 Bacteria 4110
175 Ga0068860_100139263 3300005843 Bacteria 2331
176 Ga0068862_100000433 3300005844 Bacteria 45464
177 Ga0070717_10051681 3300006028 Bacteria 3384
178 Ga0075365_10001634 3300006038 Bacteria 10333
179 Ga0075365_10019376 3300006038 Bacteria 4199
180 Ga0075365_10203020 3300006038 Bacteria 1389
181 Ga0075368_10044867 3300006042 Bacteria 1745
182 Ga0075363_100000517 3300006048 Bacteria 12410
183 Ga0075363_100141446 3300006048 Bacteria 1355
184 Ga0070712_100006701 3300006175 Bacteria 7161
185 Ga0075362_10006339 3300006177 Bacteria 4406
186 Ga0075362_10049176 3300006177 Bacteria 1883
187 Ga0075367_10000817 3300006178 Bacteria 12303
188 Ga0075367_10001171 3300006178 Bacteria 10976
189 Ga0075367_10058543 3300006178 Bacteria 2293
190 Ga0075369_10013607 3300006186 Bacteria 3235
191 Ga0075369_10021040 3300006186 Bacteria 2676
192 Ga0075366_10003864 3300006195 Bacteria 7981
193 Ga0075366_10014213 3300006195 Bacteria 4545
194 Ga0075366_10041272 3300006195 Bacteria 2732
195 Ga0075370_10007174 3300006353 Bacteria 5661
196 Ga0075370_10027065 3300006353 Bacteria 3180
197 Ga0075370_10075881 3300006353 Bacteria 1927
198 Ga0075428_100241623 3300006844 Bacteria 1948
199 Ga0075428_100394322 3300006844 Bacteria 1484
200 Ga0075430_100013283 3300006846 Bacteria 7020
201 Ga0075430_100047465 3300006846 Bacteria 3627
202 Ga0075431_100008297 3300006847 Bacteria 10388
203 Ga0075431_100157557 3300006847 Bacteria 2336
204 Ga0075434_100286532 3300006871 Bacteria 1667
205 Ga0075429_100052920 3300006880 Bacteria 3532
206 Ga0097620_100000421 3300006931 Bacteria 42369
207 Ga0097620_100001222 3300006931 Bacteria 26208
208 Ga0097620_100048249 3300006931 Bacteria 4278
209 Ga0079104_1000015 3300006946 Bacteria 321803
210 Ga0099794_10001158 3300007265 Bacteria 9054
211 Ga0099794_10012174 3300007265 Bacteria 3702
212 Ga0099794_10041302 3300007265 Bacteria 2196
213 Ga0099794_10054135 3300007265 Bacteria 1936
214 Ga0105251_10029058 3300009011 Bacteria 2788
215 Ga0105240_10000019 3300009093 Bacteria 406211
216 Ga0105240_10017115 3300009093 Bacteria 9787
217 Ga0105240_10389256 3300009093 Bacteria 1573
218 Ga0105247_10000248 3300009101 Bacteria 50108
219 Ga0114129_10117336 3300009147 Bacteria 3667
220 Ga0105243_10009086 3300009148 Bacteria 7594
221 Ga0105242_10451008 3300009176 Bacteria 1212
222 Ga0105248_10000043 3300009177 Bacteria 167170
223 Ga0105248_10053339 3300009177 Bacteria 4537
224 Ga0105248_10119445 3300009177 Bacteria 2973
225 Ga0105248_10194685 3300009177 Bacteria 2284
226 Ga0105248_10307717 3300009177 Bacteria 1784
227 Ga0105248_10310526 3300009177 Bacteria 1776
228 Ga0105237_10000734 3300009545 Bacteria 45223
229 Ga0105237_10004792 3300009545 Bacteria 15543
230 Ga0105238_10009734 3300009551 Bacteria 9625
231 Ga0105238_10508408 3300009551 Bacteria 1206
232 Ga0105249_10004888 3300009553 Bacteria 11562
233 Ga0105249_10021341 3300009553 Bacteria 5798
234 Ga0105249_10093171 3300009553 Bacteria 2821
235 Ga0123341_1000014 3300009765 Bacteria 91980
236 Ga0123342_1017304 3300009766 Bacteria 6025
237 Ga0105239_10000574 3300010375 Bacteria 52563
238 Ga0105246_10063299 3300011119 Bacteria 2579
239 Ga0157373_10006166 3300013100 Bacteria 8958
240 Ga0157373_10109717 3300013100 Bacteria 1940
241 Ga0157373_10175927 3300013100 Bacteria 1506
242 Ga0157371_10000002 3300013102 Bacteria 665040
243 Ga0157371_10021219 3300013102 Bacteria 4771
244 Ga0157370_10000131 3300013104 Bacteria 89805
245 Ga0157370_10000246 3300013104 Bacteria 69424
246 Ga0157370_10032044 3300013104 Bacteria 5136
247 Ga0157370_10036865 3300013104 Bacteria 4743
248 Ga0157370_10059372 3300013104 Bacteria 3634
249 Ga0157369_10028777 3300013105 Bacteria 6145
250 Ga0157369_10041336 3300013105 Bacteria 5032
251 Ga0157369_10081484 3300013105 Bacteria 3463
252 Ga0163162_10056641 3300013306 Bacteria 3947
253 Ga0163162_10403786 3300013306 Bacteria 1499
254 Ga0157372_10007498 3300013307 Bacteria 11602
255 Ga0157372_10011309 3300013307 Bacteria 9494
256 Ga0157372_10045183 3300013307 Bacteria 4884
257 Ga0157372_10083943 3300013307 Bacteria 3608
258 Ga0157372_10086408 3300013307 Bacteria 3558
259 Ga0163163_10016430 3300014325 Bacteria 6879
260 Ga0163163_10023142 3300014325 Bacteria 5894
261 Ga0163163_10037715 3300014325 Bacteria 4703
262 Ga0163163_10103767 3300014325 Bacteria 2868
263 Ga0163163_10169354 3300014325 Bacteria 2230
264 Ga0157380_10106070 3300014326 Bacteria 2350
265 Ga0182008_10001809 3300014497 Bacteria 13962
266 Ga0182008_10010338 3300014497 Bacteria 4996
267 Ga0182008_10017006 3300014497 Bacteria 3773
268 Ga0157379_10004041 3300014968 Bacteria 12507
269 Ga0182007_10003916 3300015262 Bacteria 6902
270 Ga0182007_10035634 3300015262 Bacteria 1677
271 Ga0182005_1003936 3300015265 Bacteria 4902
272 Ga0183362_10019 3300015683 Bacteria 17730
273 Ga0163161_10186179 3300017792 Bacteria 1594
274 Ga0206356_11279593 3300020070 Bacteria 5893
275 Ga0206351_10870896 3300020077 Bacteria 1868
276 Ga0206350_10446903 3300020080 Bacteria 2097
277 Ga0206354_10899802 3300020081 Bacteria 5894
278 Ga0206353_11006691 3300020082 Bacteria 2640
279 Ga0206353_11673663 3300020082 Bacteria 3698
280 Ga0206353_12066740 3300020082 Bacteria 4773
281 Ga0154015_1215416 3300020610 Bacteria 6226
282 Ga0213872_10000017 3300021361 Bacteria 178787
283 Ga0213872_10000073 3300021361 Bacteria 91302
284 Ga0213872_10000154 3300021361 Bacteria 63158
285 Ga0213872_10001077 3300021361 Bacteria 18803
286 Ga0213876_10093465 3300021384 Bacteria 1593
287 Ga0209435_100005 3300025206 Bacteria 573745
288 Ga0209760_101522 3300025207 Bacteria 2405
289 Ga0209436_100023 3300025208 Bacteria 96401
290 Ga0209436_100027 3300025208 Bacteria 87534
291 Ga0209563_100014 3300025230 Bacteria 940582
292 Ga0209437_100058 3300025233 Bacteria 357279
293 Ga0209437_100313 3300025233 Bacteria 64057
294 Ga0209437_104360 3300025233 Bacteria 2502
295 Ga0207425_1000058 3300025245 Bacteria 149214
296 Ga0207425_1001260 3300025245 Bacteria 11068
297 Ga0209646_1000011 3300025246 Bacteria 573745
298 Ga0209646_1000097 3300025246 Bacteria 181432
299 Ga0209026_1000008 3300025250 Bacteria 573745
300 Ga0209677_100475 3300025253 Bacteria 22964
301 Ga0209759_1000004 3300025256 Bacteria 573745
302 Ga0209129_1000080 3300025258 Bacteria 186416
303 Ga0209129_1000107 3300025258 Bacteria 154705
304 Ga0209129_1000605 3300025258 Bacteria 24282
305 Ga0209129_1000714 3300025258 Bacteria 21436
306 Ga0209129_1006349 3300025258 Bacteria 3853
307 Ga0209129_1009869 3300025258 Bacteria 2453
308 Ga0209233_1000157 3300025261 Bacteria 164269
309 Ga0209233_1000354 3300025261 Bacteria 42911
310 Ga0209233_1000380 3300025261 Bacteria 38801
311 Ga0209673_1000060 3300025273 Bacteria 263602
312 Ga0209673_1000233 3300025273 Bacteria 108504
313 Ga0209673_1000781 3300025273 Bacteria 42606
314 Ga0209673_1001374 3300025273 Bacteria 23942
315 Ga0209673_1001992 3300025273 Bacteria 15810
316 Ga0209673_1005142 3300025273 Bacteria 6693
317 Ga0209130_1000083 3300025284 Bacteria 162582
318 Ga0209130_1000173 3300025284 Bacteria 92248
319 Ga0209130_1003722 3300025284 Bacteria 6248
320 Ga0209675_1000981 3300025291 Bacteria 18059
321 Ga0209676_1010510 3300025292 Bacteria 3843
322 Ga0209025_1000083 3300025294 Bacteria 265556
323 Ga0209025_1000255 3300025294 Bacteria 125764
324 Ga0209025_1000350 3300025294 Bacteria 99649
325 Ga0209025_1000359 3300025294 Bacteria 97475
326 Ga0209025_1000749 3300025294 Bacteria 54530
327 Ga0209025_1004200 3300025294 Bacteria 12708
328 Ga0209025_1009200 3300025294 Bacteria 6936
329 Ga0209025_1010819 3300025294 Bacteria 6121
330 Ga0209025_1041452 3300025294 Bacteria 1972
331 Ga0209564_1000116 3300025295 Bacteria 207889
332 Ga0209564_1000125 3300025295 Bacteria 201709
333 Ga0209564_1001273 3300025295 Bacteria 27736
334 Ga0209564_1011141 3300025295 Bacteria 4059
335 Ga0209758_1000090 3300025297 Bacteria 246564
336 Ga0209758_1000839 3300025297 Bacteria 42882
337 Ga0209758_1000928 3300025297 Bacteria 39646
338 Ga0209758_1001034 3300025297 Bacteria 36440
339 Ga0209758_1001969 3300025297 Bacteria 22184
340 Ga0209758_1003215 3300025297 Bacteria 15224
341 Ga0209758_1015048 3300025297 Bacteria 4043
342 Ga0209758_1015938 3300025297 Bacteria 3853
343 Ga0209758_1037329 3300025297 Bacteria 1880
344 Ga0209050_1003361 3300025298 Bacteria 11915
345 Ga0209050_1005007 3300025298 Bacteria 8609
346 Ga0209050_1010907 3300025298 Bacteria 4398
347 Ga0209256_1000302 3300025299 Bacteria 86634
348 Ga0209256_1001684 3300025299 Bacteria 21424
349 Ga0209256_1001904 3300025299 Bacteria 19087
350 Ga0209256_1006695 3300025299 Bacteria 5984
351 Ga0209256_1028614 3300025299 Bacteria 1569
352 Ga0207426_1000047 3300025302 Bacteria 417011
353 Ga0207426_1000173 3300025302 Bacteria 162697
354 Ga0207426_1000276 3300025302 Bacteria 106148
355 Ga0207426_1001540 3300025302 Bacteria 18739
356 Ga0209051_1000025 3300025303 Bacteria 415397
357 Ga0209051_1000217 3300025303 Bacteria 97218
358 Ga0209051_1001815 3300025303 Bacteria 16899
359 Ga0209051_1003071 3300025303 Bacteria 11278
360 Ga0209051_1017149 3300025303 Bacteria 3246
361 Ga0209051_1028197 3300025303 Bacteria 2222
362 Ga0209051_1048586 3300025303 Bacteria 1437
363 Ga0209257_1000039 3300025304 Bacteria 591694
364 Ga0209257_1002359 3300025304 Bacteria 18962
365 Ga0209257_1003258 3300025304 Bacteria 14215
366 Ga0209257_1003715 3300025304 Bacteria 12680
367 Ga0207710_10000333 3300025900 Bacteria 35381
368 Ga0207688_10185509 3300025901 Bacteria 1242
369 Ga0207647_10000677 3300025904 Bacteria 26730
370 Ga0207647_10001610 3300025904 Bacteria 17365
371 Ga0207647_10023607 3300025904 Bacteria 4066
372 Ga0207699_10019657 3300025906 Bacteria 3607
373 Ga0207699_10097873 3300025906 Bacteria 1855
374 Ga0207705_10001829 3300025909 Bacteria 16749
375 Ga0207705_10002514 3300025909 Bacteria 14134
376 Ga0207705_10004985 3300025909 Bacteria 9962
377 Ga0207705_10016011 3300025909 Bacteria 5381
378 Ga0207705_10033838 3300025909 Bacteria 3652
379 Ga0207705_10066289 3300025909 Bacteria 2611
380 Ga0207707_10001419 3300025912 Bacteria 22162
381 Ga0207707_10003100 3300025912 Bacteria 14752
382 Ga0207707_10014148 3300025912 Bacteria 6952
383 Ga0207707_10032224 3300025912 Bacteria 4587
384 Ga0207707_10082705 3300025912 Bacteria 2803
385 Ga0207707_10136521 3300025912 Bacteria 2144
386 Ga0207707_10259308 3300025912 Bacteria 1509
387 Ga0207695_10000049 3300025913 Bacteria 406233
388 Ga0207695_10004738 3300025913 Bacteria 18411
389 Ga0207695_10016841 3300025913 Bacteria 8533
390 Ga0207695_10020794 3300025913 Bacteria 7507
391 Ga0207695_10089322 3300025913 Bacteria 3099
392 Ga0207695_10118060 3300025913 Bacteria 2624
393 Ga0207671_10000423 3300025914 Bacteria 58526
394 Ga0207671_10011955 3300025914 Bacteria 7017
395 Ga0207671_10171881 3300025914 Bacteria 1683
396 Ga0207693_10020804 3300025915 Bacteria 5218
397 Ga0207660_10001517 3300025917 Bacteria 15597
398 Ga0207660_10007012 3300025917 Bacteria 7298
399 Ga0207660_10015836 3300025917 Bacteria 4984
400 Ga0207660_10018280 3300025917 Bacteria 4669
401 Ga0207660_10043401 3300025917 Bacteria 3160
402 Ga0207660_10204946 3300025917 Bacteria 1542
403 Ga0207660_10205888 3300025917 Bacteria 1538
404 Ga0207657_10008479 3300025919 Bacteria 10427
405 Ga0207657_10008724 3300025919 Bacteria 10261
406 Ga0207657_10018265 3300025919 Bacteria 6705
407 Ga0207657_10024698 3300025919 Bacteria 5557
408 Ga0207657_10094172 3300025919 Bacteria 2494
409 Ga0207649_10002686 3300025920 Bacteria 9858
410 Ga0207649_10009032 3300025920 Bacteria 5444
411 Ga0207649_10010440 3300025920 Bacteria 5102
412 Ga0207649_10022348 3300025920 Bacteria 3653
413 Ga0207649_10029373 3300025920 Bacteria 3246
414 Ga0207649_10143812 3300025920 Bacteria 1635
415 Ga0207652_10000022 3300025921 Bacteria 158642
416 Ga0207652_10003362 3300025921 Bacteria 13211
417 Ga0207652_10005539 3300025921 Bacteria 10237
418 Ga0207652_10023709 3300025921 Bacteria 5086
419 Ga0207652_10059508 3300025921 Bacteria 3293
420 Ga0207652_10325159 3300025921 Bacteria 1388
421 Ga0207652_10391359 3300025921 Bacteria 1254
422 Ga0207681_10001417 3300025923 Bacteria 15465
423 Ga0207681_10270633 3300025923 Bacteria 1333
424 Ga0207694_10021429 3300025924 Bacteria 4897
425 Ga0207694_10097465 3300025924 Bacteria 2326
426 Ga0207700_10001779 3300025928 Bacteria 12230
427 Ga0207700_10005150 3300025928 Bacteria 7778
428 Ga0207664_10043228 3300025929 Bacteria 3523
429 Ga0207664_10145881 3300025929 Bacteria 2007
430 Ga0207644_10003506 3300025931 Bacteria 10154
431 Ga0207644_10013039 3300025931 Bacteria 5532
432 Ga0207690_10000913 3300025932 Bacteria 18868
433 Ga0207690_10025978 3300025932 Bacteria 3685
434 Ga0207690_10147463 3300025932 Bacteria 1741
435 Ga0207690_10195532 3300025932 Bacteria 1532
436 Ga0207706_10023167 3300025933 Bacteria 5578
437 Ga0207704_10151506 3300025938 Bacteria 1637
438 Ga0207711_10000049 3300025941 Bacteria 147090
439 Ga0207711_10123572 3300025941 Bacteria 2313
440 Ga0207661_10004890 3300025944 Bacteria 9390
441 Ga0207661_10224154 3300025944 Bacteria 1662
442 Ga0207679_10033427 3300025945 Bacteria 3618
443 Ga0207679_10036372 3300025945 Bacteria 3492
444 Ga0207679_10057463 3300025945 Bacteria 2878
445 Ga0207679_10062086 3300025945 Bacteria 2783
446 Ga0207679_10177404 3300025945 Bacteria 1759
447 Ga0207667_10008048 3300025949 Bacteria 12572
448 Ga0207667_10008565 3300025949 Bacteria 12139
449 Ga0207667_10010015 3300025949 Bacteria 11118
450 Ga0207667_10010275 3300025949 Bacteria 10956
451 Ga0207667_10024202 3300025949 Bacteria 6672
452 Ga0207667_10044605 3300025949 Bacteria 4697
453 Ga0207667_10159902 3300025949 Bacteria 2317
454 Ga0207651_10100285 3300025960 Bacteria 2147
455 Ga0207712_10010624 3300025961 Bacteria 5845
456 Ga0207712_10096928 3300025961 Bacteria 2184
457 Ga0207640_10002697 3300025981 Bacteria 9505
458 Ga0207640_10007005 3300025981 Bacteria 6205
459 Ga0207640_10049946 3300025981 Bacteria 2711
460 Ga0207640_10174289 3300025981 Bacteria 1606
461 Ga0207658_10002111 3300025986 Bacteria 14799
462 Ga0207658_10191576 3300025986 Bacteria 1700
463 Ga0207677_10164895 3300026023 Bacteria 1726
464 Ga0207703_10004984 3300026035 Bacteria 10776
465 Ga0207703_10010204 3300026035 Bacteria 7362
466 Ga0207639_10005288 3300026041 Bacteria 8715
467 Ga0207639_10009223 3300026041 Bacteria 6802
468 Ga0207639_10018414 3300026041 Bacteria 4961
469 Ga0207639_10028040 3300026041 Bacteria 4107
470 Ga0207639_10100476 3300026041 Bacteria 2337
471 Ga0207639_10207337 3300026041 Bacteria 1685
472 Ga0207678_10004139 3300026067 Bacteria 13034
473 Ga0207678_10005965 3300026067 Bacteria 10848
474 Ga0207678_10016535 3300026067 Bacteria 6479
475 Ga0207678_10024028 3300026067 Bacteria 5326
476 Ga0207708_10090026 3300026075 Bacteria 2365
477 Ga0207702_10003761 3300026078 Bacteria 13704
478 Ga0207702_10021577 3300026078 Bacteria 5332
479 Ga0207641_10176543 3300026088 Bacteria 1953
480 Ga0207641_10344561 3300026088 Bacteria 1419
481 Ga0207676_10092593 3300026095 Bacteria 2486
482 Ga0207674_10000379 3300026116 Bacteria 57925
483 Ga0207674_10001397 3300026116 Bacteria 31130
484 Ga0207674_10016247 3300026116 Bacteria 8152
485 Ga0207674_10024476 3300026116 Bacteria 6452
486 Ga0207674_10099047 3300026116 Bacteria 2898
487 Ga0207674_10209486 3300026116 Bacteria 1898
488 Ga0207683_10014618 3300026121 Bacteria 6685
489 Ga0207683_10021474 3300026121 Bacteria 5528
490 Ga0207683_10360889 3300026121 Bacteria 1334
491 Ga0207698_10001610 3300026142 Bacteria 13138
492 Ga0207698_10005754 3300026142 Bacteria 7692
493 Ga0207698_10012640 3300026142 Bacteria 5533
494 Ga0207698_10098851 3300026142 Bacteria 2412
495 Ga0207698_10212521 3300026142 Bacteria 1741
496 Ga0209281_1000068 3300027111 Bacteria 280238
497 Ga0209371_1000003 3300027312 Bacteria 1122971
498 Ga0209371_1001970 3300027312 Bacteria 12422
499 Ga0209371_1005272 3300027312 Bacteria 5209
500 Ga0209588_1002399 3300027671 Bacteria 5073
501 Ga0209588_1020191 3300027671 Bacteria 2086
502 Ga0209813_10002642 3300027866 Bacteria 4120
503 Ga0268266_10000103 3300028379 Bacteria 179736
504 Ga0268266_10018839 3300028379 Bacteria 5883
505 Ga0268266_10059413 3300028379 Bacteria 3294
506 Ga0268266_10068412 3300028379 Bacteria 3075
507 Ga0268266_10092961 3300028379 Bacteria 2647
508 Ga0268266_10215456 3300028379 Bacteria 1763
509 Ga0268265_10000422 3300028380 Bacteria 45478
510 Ga0268264_10034697 3300028381 Bacteria 4151
511 Ga0265326_10013540 3300028558 Bacteria 2384
512 Ga0265319_1000349 3300028563 Bacteria 33705
513 Ga0265319_1007401 3300028563 Bacteria 4943
514 Ga0265319_1012116 3300028563 Bacteria 3497
515 Ga0265334_10003454 3300028573 Bacteria 7185
516 Ga0265318_10001215 3300028577 Bacteria 15658
517 Ga0265318_10002906 3300028577 Bacteria 8905
518 Ga0307515_10000386 3300028794 Bacteria 107196
519 Ga0307515_10000651 3300028794 Bacteria 80257
520 Ga0307515_10001447 3300028794 Bacteria 53309
521 Ga0307515_10086697 3300028794 Bacteria 3987
522 Ga0265338_10005969 3300028800 Bacteria 15663
523 Ga0268256_1000004 3300030500 Bacteria 1122967
524 Ga0268256_1001045 3300030500 Bacteria 18558
525 Ga0268256_1002352 3300030500 Bacteria 9744
526 Ga0307511_10000077 3300030521 Bacteria 82357
527 Ga0307511_10000851 3300030521 Bacteria 32500
528 Ga0265332_10001462 3300031238 Bacteria 13214
529 Ga0265328_10091898 3300031239 Bacteria 1121
530 Ga0265320_10002610 3300031240 Bacteria 12509
531 Ga0265320_10008784 3300031240 Bacteria 6150
532 Ga0265325_10005974 3300031241 Bacteria 7453
533 Ga0265329_10001757 3300031242 Bacteria 10315
534 Ga0265339_10000691 3300031249 Bacteria 26070
535 Ga0265339_10013975 3300031249 Bacteria 4855
536 Ga0265331_10007443 3300031250 Bacteria 6332
537 Ga0265331_10102430 3300031250 Bacteria 1317
538 Ga0265327_10000083 3300031251 Bacteria 204923
539 Ga0265327_10023427 3300031251 Bacteria 3656
540 Ga0265327_10111898 3300031251 Bacteria 1303
541 Ga0265316_10001019 3300031344 Bacteria 30433
542 Ga0265316_10009140 3300031344 Bacteria 9129
543 Ga0307513_10022270 3300031456 Bacteria 7454
544 Ga0307513_10029600 3300031456 Bacteria 6238
545 Ga0307408_100355402 3300031548 Bacteria 1245
546 Ga0265313_10006665 3300031595 Bacteria 8097
547 Ga0307514_10001548 3300031649 Bacteria 27327
548 Ga0307514_10089318 3300031649 Bacteria 2251
549 Ga0265314_10000003 3300031711 Bacteria 1653386
550 Ga0265314_10006556 3300031711 Bacteria 10266
551 Ga0265342_10002161 3300031712 Bacteria 17328
552 Ga0307405_10005651 3300031731 Bacteria 6059
553 Ga0307413_10008271 3300031824 Bacteria 4899
554 Ga0307413_10037912 3300031824 Bacteria 2788
555 Ga0307413_10046628 3300031824 Bacteria 2579
556 Ga0307410_10294034 3300031852 Bacteria 1279
557 Ga0307406_10013167 3300031901 Bacteria 4733
558 Ga0307406_10022197 3300031901 Bacteria 3763
559 Ga0307406_10226006 3300031901 Bacteria 1394
560 Ga0307407_10014441 3300031903 Bacteria 3868
561 Ga0307412_10001366 3300031911 Bacteria 13566
562 Ga0307412_10090045 3300031911 Bacteria 2144
563 Ga0307409_100183640 3300031995 Bacteria 1854
564 Ga0307409_100219575 3300031995 Bacteria 1715
565 Ga0307416_100027749 3300032002 Bacteria 4198
566 Ga0307416_100122995 3300032002 Bacteria 2318
567 Ga0307416_100273224 3300032002 Bacteria 1661
568 Ga0307414_10155932 3300032004 Bacteria 1807
569 Ga0307414_10222628 3300032004 Bacteria 1550
570 Ga0307414_10284064 3300032004 Bacteria 1392
571 Ga0307411_10015733 3300032005 Bacteria 4260
572 Ga0307411_10269961 3300032005 Bacteria 1348
573 Ga0307411_10360205 3300032005 Bacteria 1189
574 Ga0307507_10023456 3300033179 Bacteria 6773
575 Ga0307507_10121353 3300033179 Bacteria 2089
576 Ga0373940_0017126 3300035088 Bacteria 1804
577 Ga0373937_0381280 3300036401 Bacteria 1337
578 Ga0316582_0165885 3300036647 Bacteria 1497
579 Ga0395899_0000644 3300037312 Bacteria 35945
580 Ga0395899_0000662 3300037312 Bacteria 35000
581 Ga0395899_0023290 3300037312 Bacteria 4693
582 Ga0395899_0025702 3300037312 Bacteria 4445
583 Ga0395899_0239167 3300037312 Bacteria 1250
584 Ga0395900_0074477 3300037418 Bacteria 3490
585 Ga0395900_0075570 3300037418 Bacteria 3463
586 Ga0395900_0118560 3300037418 Bacteria 2716
587 Ga0395900_0145690 3300037418 Bacteria 2422
588 Ga0395900_0154710 3300037418 Bacteria 2342
589 Ga0395900_0158821 3300037418 Bacteria 2307
590 Ga0395900_0258829 3300037418 Bacteria 1739
591 Ga0395900_0394358 3300037418 Bacteria 1350
592 Ga0395898_0020217 3300037466 Bacteria 6763
593 Ga0395898_0022748 3300037466 Bacteria 6344
594 Ga0395898_0025292 3300037466 Bacteria 5984
595 Ga0395898_0030101 3300037466 Bacteria 5434
596 Ga0395905_0000126 3300037471 Bacteria 126035
597 Ga0395905_0000741 3300037471 Bacteria 42960
598 Ga0395905_0001192 3300037471 Bacteria 32515
599 Ga0395905_0005488 3300037471 Bacteria 12939
600 Ga0395905_0023045 3300037471 Bacteria 5886
601 Ga0395905_0078544 3300037471 Bacteria 3093
602 Ga0395905_0086219 3300037471 Bacteria 2943
603 Ga0395905_0122288 3300037471 Bacteria 2447
604 Ga0395905_0248862 3300037471 Bacteria 1660
605 Ga0395905_0420516 3300037471 Bacteria 1232
606 Ga0395901_0065755 3300038443 Bacteria 3776
607 Ga0395901_0097650 3300038443 Bacteria 3080
608 Ga0395901_0442911 3300038443 Bacteria 1329
609 Ga0395901_0442946 3300038443 Bacteria 1329
610 Ga0436365_0471224 3300039437 Bacteria 4505
611 Ga0436361_0004189 3300039447 Bacteria 6648
612 Ga0436361_0197147 3300039447 Bacteria 66813
613 Ga0436361_0472104 3300039447 Bacteria 4396
614 Ga0436361_0530495 3300039447 Bacteria 101563
615 Ga0436361_0736070 3300039447 Bacteria 84726
616 Ga0436361_1101954 3300039447 Bacteria 36014
617 Ga0439466_0011166 3300041411 Bacteria 3325
618 Ga0439465_0006254 3300041413 Bacteria 3783
619 Ga0439465_0010269 3300041413 Bacteria 2944
620 Ga0439465_0010635 3300041413 Bacteria 2887
621 Ga0439465_0029736 3300041413 Bacteria 1736
622 Ga0439465_0039107 3300041413 Bacteria 1530
623 Ga0451835_0532047 3300041492 Bacteria 1180
624 Ga0451839_0268071 3300041496 Bacteria 3058
625 Ga0451840_01892 3300041497 Bacteria 1188
626 Ga0451846_65077 3300041502 Bacteria 1987
627 Ga0451847_0036653 3300041503 Bacteria 1733
628 Ga0451849_0249873 3300041505 Bacteria 2624
629 Ga0451854_08073 3300041510 Bacteria 1548
630 Ga0452268_51778 3300041907 Bacteria 1256
631 Ga0439445_0012513 3300042004 Bacteria 2041
632 Ga0439449_0005817 3300042007 Bacteria 4716
633 Ga0439449_0025227 3300042007 Bacteria 2222
634 Ga0439449_0038752 3300042007 Bacteria 1772
635 Ga0439452_005324 3300042010 Bacteria 4151
636 Ga0439457_008408 3300042014 Bacteria 2436
637 Ga0439462_0039767 3300042015 Bacteria 1254
638 Ga0450911_000141 3300042115 Bacteria 29229
639 Ga0466969_0000373 3300044656 Bacteria 24574
640 Ga0466982_0210788 3300044672 Bacteria 1159
641 Ga0453683_0000198 3300044673 Bacteria 81903
642 Ga0466966_0005580 3300044684 Bacteria 8274
643 Ga0466961_0044120 3300044693 Bacteria 2853
644 Ga0466960_0070385 3300044901 Bacteria 1740
645 Ga0466959_0030345 3300045049 Bacteria 4003
646 Ga0466959_0089428 3300045049 Bacteria 2212
647 Ga0451576_0192238 3300045051 Bacteria 2132
648 Ga0466967_0196632 3300045976 Bacteria 1908
649 Ga0466967_0254682 3300045976 Bacteria 1678
650 Ga0495617_000022 3300046452 Bacteria 185975
651 Ga0495617_004123 3300046452 Bacteria 5325
652 Ga0495617_026952 3300046452 Bacteria 1935
653 Ga0495627_000222 3300046453 Bacteria 61109
654 Ga0495592_0300675 3300046454 Bacteria 1043
655 Ga0495603_0047986 3300046455 Bacteria 2542
656 Ga0495590_0045296 3300046457 Bacteria 1534
657 Ga0495629_0041068 3300046459 Bacteria 3255
658 Ga0495638_0000309 3300046460 Bacteria 62979
659 Ga0495638_0027113 3300046460 Bacteria 3710
660 Ga0495638_0054620 3300046460 Bacteria 2482
661 Ga0495651_0038320 3300046462 Bacteria 3733
662 Ga0495651_0140125 3300046462 Bacteria 1755
663 Ga0495605_0000064 3300046474 Bacteria 140769
664 Ga0495605_0008993 3300046474 Bacteria 5623
665 Ga0495605_0030832 3300046474 Bacteria 2744
666 Ga0495639_0006269 3300046475 Bacteria 5107
667 Ga0495585_0019126 3300046492 Bacteria 3952
668 Ga0495585_0042031 3300046492 Bacteria 2562
669 Ga0495585_0044724 3300046492 Bacteria 2473
670 Ga0495596_0001018 3300046500 Bacteria 16652
671 Ga0495596_0009401 3300046500 Bacteria 4300
672 Ga0495596_0047033 3300046500 Bacteria 1693
673 Ga0495607_0003479 3300046501 Bacteria 12055
674 Ga0495607_0022992 3300046501 Bacteria 3907
675 Ga0495607_0031078 3300046501 Bacteria 3272
676 Ga0495607_0036604 3300046501 Bacteria 2955
677 Ga0495583_0000678 3300046506 Bacteria 44207
678 Ga0495583_0003999 3300046506 Bacteria 10872
679 Ga0495583_0027690 3300046506 Bacteria 2794
680 Ga0495606_0000757 3300046507 Bacteria 49718
681 Ga0495606_0003931 3300046507 Bacteria 15287
682 Ga0495606_0040817 3300046507 Bacteria 3116
683 Ga0495606_0107991 3300046507 Bacteria 1683
684 Ga0495606_0124361 3300046507 Bacteria 1540
685 Ga0495606_0136980 3300046507 Bacteria 1449
686 Ga0495606_0180825 3300046507 Bacteria 1216
687 Ga0495610_0000961 3300046512 Bacteria 26635
688 Ga0495610_0003067 3300046512 Bacteria 13344
689 Ga0495610_0011758 3300046512 Bacteria 5317
690 Ga0495610_0033175 3300046512 Bacteria 2672
691 Ga0495610_0091024 3300046512 Bacteria 1383
692 Ga0495616_0000431 3300046513 Bacteria 32080
693 Ga0495616_0005704 3300046513 Bacteria 7627
694 Ga0495616_0082792 3300046513 Bacteria 1532
695 Ga0495631_0000183 3300046518 Bacteria 42831
696 Ga0495631_0051645 3300046518 Bacteria 1796
697 Ga0495631_0059923 3300046518 Bacteria 1652
698 Ga0495632_0000026 3300046519 Bacteria 176367
699 Ga0495632_0000087 3300046519 Bacteria 94939
700 Ga0495632_0008503 3300046519 Bacteria 6290
701 Ga0495632_0041601 3300046519 Bacteria 2308
702 Ga0495632_0071098 3300046519 Bacteria 1672
703 Ga0495637_0008603 3300046520 Bacteria 5009
704 Ga0495643_0000119 3300046522 Bacteria 127740
705 Ga0495643_0000362 3300046522 Bacteria 61748
706 Ga0495643_0025280 3300046522 Bacteria 3361
707 Ga0495643_0074717 3300046522 Bacteria 1774
708 Ga0495643_0082820 3300046522 Bacteria 1666
709 Ga0495643_0140273 3300046522 Bacteria 1206
710 Ga0495644_0033365 3300046523 Bacteria 1945
711 Ga0495648_0000379 3300046524 Bacteria 48793
712 Ga0495648_0058279 3300046524 Bacteria 2310
713 Ga0495648_0121545 3300046524 Bacteria 1403
714 Ga0495663_0030447 3300046525 Bacteria 1599
715 Ga0495642_0000272 3300046528 Bacteria 29189
716 Ga0495642_0000329 3300046528 Bacteria 25780
717 Ga0495642_0006986 3300046528 Bacteria 4330
718 Ga0495654_0000635 3300046530 Bacteria 27690
719 Ga0495654_0000834 3300046530 Bacteria 23400
720 Ga0495654_0001196 3300046530 Bacteria 18462
721 Ga0495654_0008383 3300046530 Bacteria 5714
722 Ga0495654_0091582 3300046530 Bacteria 1410
723 Ga0495654_0095774 3300046530 Bacteria 1372
724 Ga0495609_0005705 3300046538 Bacteria 6481
725 Ga0495609_0008483 3300046538 Bacteria 5031
726 Ga0495609_0065444 3300046538 Bacteria 1602
727 Ga0495621_0043681 3300046539 Bacteria 1581
728 Ga0495597_0000810 3300046542 Bacteria 24703
729 Ga0495597_0009034 3300046542 Bacteria 4954
730 Ga0495633_0045394 3300046558 Bacteria 2080
731 Ga0495633_0048332 3300046558 Bacteria 2009
732 Ga0495656_0079511 3300046615 Bacteria 1476
733 Ga0495656_0130193 3300046615 Bacteria 1197
734 Ga0495668_0000653 3300046616 Bacteria 41611
735 Ga0495668_0004368 3300046616 Bacteria 10085
736 Ga0495668_0024888 3300046616 Bacteria 3403
737 Ga0495668_0038038 3300046616 Bacteria 2690
738 Ga0495611_0005329 3300046648 Bacteria 5503
739 Ga0495611_0012246 3300046648 Bacteria 3646
740 Ga0495611_0022356 3300046648 Bacteria 2736
741 Ga0495611_0063739 3300046648 Bacteria 1678
742 Ga0495625_0000737 3300046660 Bacteria 45851
743 Ga0495625_0004660 3300046660 Bacteria 12873
744 Ga0495625_0070031 3300046660 Bacteria 2463
745 Ga0495625_0072202 3300046660 Bacteria 2421
746 Ga0495625_0077687 3300046660 Bacteria 2319
747 Ga0495625_0133578 3300046660 Bacteria 1679
748 Ga0495661_0003566 3300046665 Bacteria 11456
749 Ga0495588_0009825 3300046674 Bacteria 4435
750 Ga0495588_0043986 3300046674 Bacteria 2286
751 Ga0495657_0017333 3300046675 Bacteria 5230
752 Ga0495647_0044983 3300046681 Bacteria 1695
753 Ga0495647_0060424 3300046681 Bacteria 1494
754 Ga0495669_0010531 3300046684 Bacteria 3909
755 Ga0495669_0013899 3300046684 Bacteria 3436
756 Ga0495670_0008641 3300046691 Bacteria 5012
757 Ga0495670_0045289 3300046691 Bacteria 2197
758 Ga0495671_0000059 3300046692 Bacteria 107979
759 Ga0495671_0000595 3300046692 Bacteria 26668
760 Ga0495671_0011584 3300046692 Bacteria 4845
761 Ga0495671_0094705 3300046692 Bacteria 1461
762 Ga0495649_0016768 3300046694 Bacteria 4148
763 Ga0495589_0018524 3300046794 Bacteria 3568
764 Ga0495660_0003265 3300046810 Bacteria 10065
765 Ga0495660_0057942 3300046810 Bacteria 2088
766 Ga0495672_0000113 3300047320 Bacteria 129189
767 Ga0495672_0038540 3300047320 Bacteria 2914
768 Ga0495672_0047015 3300047320 Bacteria 2570
769 Ga0495683_0006509 3300047323 Bacteria 6380
770 Ga0495687_033205 3300047443 Bacteria 2344
771 Ga0495677_0002243 3300047445 Bacteria 7641
772 Ga0495679_007931 3300047446 Bacteria 4370
773 Ga0495673_0000096 3300047469 Bacteria 182792
774 Ga0495681_0000272 3300047470 Bacteria 41251
775 Ga0495681_0008827 3300047470 Bacteria 6270
776 Ga0495681_0057144 3300047470 Bacteria 1813
777 Ga0495686_0000852 3300047472 Bacteria 39191
778 Ga0495686_0008302 3300047472 Bacteria 7637
779 Ga0495686_0054266 3300047472 Bacteria 2510
780 Ga0495686_0069440 3300047472 Bacteria 2172
781 Ga0495686_0135797 3300047472 Bacteria 1455
782 Ga0495602_0006635 3300048088 Bacteria 12133
783 Ga0495615_0008053 3300048090 Bacteria 2023
784 Ga0495615_0022726 3300048090 Bacteria 1429
785 Ga0495626_0000981 3300048091 Bacteria 24550
786 Ga0495626_0029472 3300048091 Bacteria 2656
787 Ga0496100_0017092 3300048903 Bacteria 4275
788 Ga0496101_0002273 3300048904 Bacteria 11732
789 Ga0496102_0000068 3300048905 Bacteria 156306
790 Ga0496102_0012098 3300048905 Bacteria 7456
791 Ga0496102_0026743 3300048905 Bacteria 5150
792 Ga0496102_0161824 3300048905 Bacteria 2105
793 Ga0496103_0021085 3300048906 Bacteria 3920
794 Ga0496103_0068404 3300048906 Bacteria 2219
795 Ga0496104_0107663 3300048907 Bacteria 2671
796 Ga0496104_0174149 3300048907 Bacteria 2062
797 Ga0496105_0002064 3300048908 Bacteria 14517
798 Ga0496105_0066482 3300048908 Bacteria 2976
799 Ga0496105_0075935 3300048908 Bacteria 2775
800 Ga0496105_0375101 3300048908 Bacteria 1133
801 Ga0496106_0000760 3300048909 Bacteria 23283
802 Ga0496106_0029059 3300048909 Bacteria 4119
803 Ga0496106_0092990 3300048909 Bacteria 2330
804 Ga0496108_0016373 3300048911 Bacteria 6046
805 Ga0496108_0031554 3300048911 Bacteria 4396
806 Ga0496108_0108699 3300048911 Bacteria 2369
807 Ga0496109_0031417 3300048912 Bacteria 4765
808 Ga0496110_0025530 3300048913 Bacteria 5050
809 Ga0496110_0055640 3300048913 Bacteria 3481
810 Ga0496110_0153655 3300048913 Bacteria 2084
811 Ga0496111_0109142 3300048914 Bacteria 2037
812 Ga0496111_0120184 3300048914 Bacteria 1941
813 Ga0496111_0205149 3300048914 Bacteria 1465
814 Ga0496112_0020004 3300048915 Bacteria 6337
815 Ga0496112_0037355 3300048915 Bacteria 4740
816 Ga0496112_0042517 3300048915 Bacteria 4445
817 Ga0496112_0532469 3300048915 Bacteria 1109
818 Ga0496113_0009595 3300048916 Bacteria 6353
819 Ga0496113_0065709 3300048916 Bacteria 2746
820 Ga0496113_0142115 3300048916 Bacteria 1889
821 Ga0496113_0261590 3300048916 Bacteria 1382
822 Ga0496116_0005016 3300048919 Bacteria 12469
823 Ga0496116_0019875 3300048919 Bacteria 5123
824 Ga0496116_0021816 3300048919 Bacteria 4817
825 Ga0496116_0032549 3300048919 Bacteria 3714
826 Ga0496116_0062493 3300048919 Bacteria 2404
827 Ga0496117_0000052 3300048920 Bacteria 280463
828 Ga0496117_0000926 3300048920 Bacteria 44886
829 Ga0496117_0012513 3300048920 Bacteria 7470
830 Ga0496117_0014590 3300048920 Bacteria 6760
831 Ga0496117_0017184 3300048920 Bacteria 6054
832 Ga0496117_0053048 3300048920 Bacteria 2851
833 Ga0496118_0000792 3300048921 Bacteria 50632
834 Ga0496118_0001977 3300048921 Bacteria 29110
835 Ga0496118_0015866 3300048921 Bacteria 6945
836 Ga0496118_0078765 3300048921 Bacteria 2330
837 Ga0496118_0146709 3300048921 Bacteria 1484
838 Ga0496118_0162080 3300048921 Bacteria 1381
839 Ga0496119_0028246 3300048922 Bacteria 3832
840 Ga0496119_0041996 3300048922 Bacteria 2904
841 Ga0496119_0090052 3300048922 Bacteria 1746
842 Ga0496120_0000019 3300048923 Bacteria 260115
843 Ga0496121_0000003 3300048924 Bacteria 1191431
844 Ga0496121_0001731 3300048924 Bacteria 35624
845 Ga0496121_0002950 3300048924 Bacteria 24830
846 Ga0496121_0003041 3300048924 Bacteria 24337
847 Ga0496121_0004490 3300048924 Bacteria 18711
848 Ga0496121_0007187 3300048924 Bacteria 13486
849 Ga0496121_0016496 3300048924 Bacteria 7622
850 Ga0496121_0022327 3300048924 Bacteria 6148
851 Ga0496121_0042776 3300048924 Bacteria 3934
852 Ga0496121_0046025 3300048924 Bacteria 3740
853 Ga0496121_0064361 3300048924 Bacteria 2990
854 Ga0496121_0071722 3300048924 Bacteria 2784
855 Ga0496121_0074626 3300048924 Bacteria 2712
856 Ga0496121_0206123 3300048924 Bacteria 1397
857 Ga0496121_0245275 3300048924 Bacteria 1246
858 Ga0496122_0000042 3300048925 Bacteria 280482
859 Ga0496122_0000053 3300048925 Bacteria 260120
860 Ga0496122_0000080 3300048925 Bacteria 212397
861 Ga0496122_0003537 3300048925 Bacteria 20432
862 Ga0496122_0014660 3300048925 Bacteria 7559
863 Ga0496122_0015740 3300048925 Bacteria 7209
864 Ga0496122_0054120 3300048925 Bacteria 3017
865 Ga0496122_0097767 3300048925 Bacteria 1974
866 Ga0496122_0101472 3300048925 Bacteria 1922
867 Ga0496122_0108059 3300048925 Bacteria 1836
868 Ga0496122_0111801 3300048925 Bacteria 1790
869 Ga0496123_0000030 3300048926 Bacteria 291764
870 Ga0496123_0000038 3300048926 Bacteria 260120
871 Ga0496123_0000072 3300048926 Bacteria 198524
872 Ga0496123_0014925 3300048926 Bacteria 6404
873 Ga0496123_0020288 3300048926 Bacteria 5204
874 Ga0496123_0035113 3300048926 Bacteria 3579
875 Ga0496123_0086803 3300048926 Bacteria 1874
876 Ga0496123_0097916 3300048926 Bacteria 1717
877 Ga0496124_0000139 3300048927 Bacteria 149873
878 Ga0496124_0005584 3300048927 Bacteria 14078
879 Ga0496124_0021455 3300048927 Bacteria 5950
880 Ga0496124_0022392 3300048927 Bacteria 5793
881 Ga0496124_0042429 3300048927 Bacteria 3918
882 Ga0496124_0063069 3300048927 Bacteria 3098
883 Ga0496124_0095898 3300048927 Bacteria 2410
884 Ga0496124_0104468 3300048927 Bacteria 2291
885 Ga0496124_0182178 3300048927 Bacteria 1615
886 Ga0496124_0182364 3300048927 Bacteria 1614
887 Ga0496125_0000170 3300048928 Bacteria 145369
888 Ga0496125_0005886 3300048928 Bacteria 13444
889 Ga0496125_0008875 3300048928 Bacteria 10442
890 Ga0496125_0016390 3300048928 Bacteria 7119
891 Ga0496125_0017649 3300048928 Bacteria 6795
892 Ga0496125_0034692 3300048928 Bacteria 4441
893 Ga0496125_0061916 3300048928 Bacteria 2997
894 Ga0496125_0079083 3300048928 Bacteria 2524
895 Ga0496125_0100689 3300048928 Bacteria 2129
896 Ga0496125_0135504 3300048928 Bacteria 1723
897 Ga0496126_0067226 3300048929 Bacteria 3202
898 Ga0496126_0106212 3300048929 Bacteria 2451
899 Ga0495678_000111 3300049459 Bacteria 97182
900 Ga0495678_000126 3300049459 Bacteria 89779
901 Ga0495678_000290 3300049459 Bacteria 55357
902 Ga0495678_055692 3300049459 Bacteria 1508
903 Ga0495682_0001716 3300049460 Bacteria 11106
904 Ga0501031_0006749 3300049568 Bacteria 7485
905 Ga0501032_0005683 3300049569 Bacteria 9240
906 Ga0501032_0010167 3300049569 Bacteria 6791
907 Ga0501033_0053265 3300049570 Bacteria 2996
908 Ga0501034_0000105 3300049571 Bacteria 154973
909 Ga0501034_0001513 3300049571 Bacteria 30544
910 Ga0501034_0123456 3300049571 Bacteria 2575
911 Ga0501034_0177521 3300049571 Bacteria 2095
912 Ga0501034_0185791 3300049571 Bacteria 2042
913 Ga0501034_0199710 3300049571 Bacteria 1958
914 Ga0501034_0470051 3300049571 Bacteria 1173
915 Ga0501036_0008378 3300049572 Bacteria 8474
916 Ga0501036_0011841 3300049572 Bacteria 7231
917 Ga0501036_0221525 3300049572 Bacteria 1589
918 Ga0501037_0021070 3300049573 Bacteria 4816
919 Ga0501037_0033550 3300049573 Bacteria 3791
920 Ga0501037_0059227 3300049573 Bacteria 2794
921 Ga0501037_0078992 3300049573 Bacteria 2388
922 Ga0501037_0085660 3300049573 Bacteria 2281
923 Ga0501037_0099157 3300049573 Bacteria 2104
924 Ga0501037_0111961 3300049573 Bacteria 1966
925 Ga0501037_0160482 3300049573 Bacteria 1603
926 Ga0501038_0003528 3300049574 Bacteria 14565
927 Ga0501038_0010312 3300049574 Bacteria 8545
928 Ga0501038_0055230 3300049574 Bacteria 3413
929 Ga0501038_0105139 3300049574 Bacteria 2345
930 Ga0501038_0124171 3300049574 Bacteria 2126
931 Ga0501039_0008209 3300049575 Bacteria 7959
932 Ga0501039_0503212 3300049575 Bacteria 951
933 Ga0501040_0037608 3300049576 Bacteria 3289
934 Ga0501042_0379976 3300049578 Bacteria 1023
935 Ga0501043_0002038 3300049579 Bacteria 17235
936 Ga0501043_0009792 3300049579 Bacteria 7511
937 Ga0501043_0098853 3300049579 Bacteria 2294
938 Ga0501043_0161920 3300049579 Bacteria 1748
939 Ga0501046_0007317 3300049580 Bacteria 9712
940 Ga0501046_0010238 3300049580 Bacteria 8069
941 Ga0501046_0164448 3300049580 Bacteria 1667
942 Ga0501047_0000636 3300049581 Bacteria 36882
943 Ga0501047_0003275 3300049581 Bacteria 15331
944 Ga0501047_0003943 3300049581 Bacteria 13944
945 Ga0501047_0004452 3300049581 Bacteria 13191
946 Ga0501047_0010184 3300049581 Bacteria 8889
947 Ga0501047_0077275 3300049581 Bacteria 3203
948 Ga0501047_0113730 3300049581 Bacteria 2589
949 Ga0501047_0152253 3300049581 Bacteria 2188
950 Ga0501047_0205619 3300049581 Bacteria 1828
951 Ga0501047_0454971 3300049581 Bacteria 1109
952 Ga0501048_0084400 3300049582 Bacteria 2240
953 Ga0501048_0149576 3300049582 Bacteria 1651
954 Ga0501048_0160637 3300049582 Bacteria 1590
955 Ga0501067_0009015 3300049583 Bacteria 5530
956 Ga0501067_0114938 3300049583 Bacteria 1496
957 Ga0501067_0139287 3300049583 Bacteria 1351
958 Ga0501067_0154803 3300049583 Bacteria 1277
959 Ga0501067_0228012 3300049583 Bacteria 1037
960 Ga0501069_0026990 3300049585 Bacteria 3146
961 Ga0501069_0090943 3300049585 Bacteria 1726
962 Ga0501070_0000311 3300049586 Bacteria 44330
963 Ga0501070_0007856 3300049586 Bacteria 9040
964 Ga0501070_0033376 3300049586 Bacteria 4307
965 Ga0501070_0073931 3300049586 Bacteria 2821
966 Ga0501071_0026775 3300049587 Bacteria 4050
967 Ga0501072_0244843 3300049588 Bacteria 1428
968 Ga0501073_0012242 3300049589 Bacteria 6261
969 Ga0501073_0013127 3300049589 Bacteria 6039
970 Ga0501073_0089428 3300049589 Bacteria 2140
971 Ga0501073_0205731 3300049589 Bacteria 1360
972 Ga0501074_0001303 3300049590 Bacteria 16547
973 Ga0501074_0025338 3300049590 Bacteria 4308
974 Ga0501074_0279110 3300049590 Bacteria 1188
975 Ga0501076_0167009 3300049592 Bacteria 1794
976 Ga0501079_0094471 3300049741 Bacteria 2317
977 Ga0501080_0002966 3300049742 Bacteria 14930
978 Ga0501080_0007885 3300049742 Bacteria 9639
979 Ga0501080_0056028 3300049742 Bacteria 3671
980 Ga0501080_0132140 3300049742 Bacteria 2311
981 Ga0501083_0000239 3300049744 Bacteria 35330
982 Ga0501083_0001893 3300049744 Bacteria 14369
983 Ga0501083_0005890 3300049744 Bacteria 8673
984 Ga0501083_0190527 3300049744 Bacteria 1338
985 Ga0501280_003283 3300049776 Bacteria 2512
986 Ga0501035_0000800 3300049822 Bacteria 33514
987 Ga0501035_0008949 3300049822 Bacteria 9316
988 Ga0501035_0014906 3300049822 Bacteria 7172
989 Ga0501035_0018416 3300049822 Bacteria 6435
990 Ga0501035_0034708 3300049822 Bacteria 4581
991 Ga0501035_0105050 3300049822 Bacteria 2476
992 Ga0501044_0020553 3300049823 Bacteria 7049
993 Ga0501044_0029070 3300049823 Bacteria 5829
994 Ga0501044_0075097 3300049823 Bacteria 3432
995 Ga0501044_0113668 3300049823 Bacteria 2714
996 Ga0501044_0116094 3300049823 Bacteria 2682
997 Ga0501044_0180307 3300049823 Bacteria 2079
998 Ga0501044_0291298 3300049823 Bacteria 1564
999 Ga0501044_0321580 3300049823 Bacteria 1471
1000 Ga0501044_0413739 3300049823 Bacteria 1259
1001 nmdc:mga03683_7456_c1 3300050489 Bacteria 3798
1002 nmdc:mga03n38_985_c1 3300050490 Bacteria 7777
1003 nmdc:mga00v17_346_c2 3300050491 Bacteria 15851
1004 nmdc:mga00v17_55_c1 3300050491 Bacteria 72029
1005 nmdc:mga0yw44_257267_c1 3300050492 Bacteria 1163
1006 nmdc:mga0yw44_959_c1 3300050492 Bacteria 10341
1007 nmdc:mga0k408_2026_c1 3300050493 Bacteria 10850
1008 nmdc:mga06z11_80023_c1 3300050494 Bacteria 1751
1009 nmdc:mga07m45_18218_c1 3300050496 Bacteria 3786
1010 nmdc:mga0qj67_10964_c1 3300050509 Bacteria 6783
1011 nmdc:mga0qj67_288810_c1 3300050509 Bacteria 1329
1012 nmdc:mga0qj67_51303_c1 3300050509 Bacteria 3262
1013 nmdc:mga06r32_13010_c1 3300050510 Bacteria 7529
1014 nmdc:mga0n895_82117_c1 3300050512 Bacteria 3212
1015 nmdc:mga0sz30_12942_c1 3300050516 Bacteria 3256
1016 nmdc:mga0sz30_18084_c1 3300050516 Bacteria 2816
1017 nmdc:mga0sz30_32_c1 3300050516 Bacteria 54057
1018 Ga0500583_0003360 3300053092 Bacteria 5023
1019 Ga0500557_011818 3300053105 Bacteria 2241
1020 Ga0500572_002418 3300053111 Bacteria 4497
1021 Ga0500593_000006 3300053117 Bacteria 88644
1022 Ga0500594_0004768 3300053118 Bacteria 2995
1023 Ga0500618_000337 3300053125 Bacteria 33703
1024 Ga0500618_000717 3300053125 Bacteria 19091
1025 Ga0500618_005905 3300053125 Bacteria 3660
1026 Ga0500618_009856 3300053125 Bacteria 2590
1027 Ga0500655_016915 3300053133 Bacteria 1345
1028 Ga0500658_0012637 3300053134 Bacteria 3117
1029 Ga0500559_0001871 3300053136 Bacteria 11458
1030 Ga0500559_0002424 3300053136 Bacteria 9652
1031 Ga0500561_0001332 3300053137 Bacteria 4016
1032 Ga0500568_0000005 3300053139 Bacteria 614296
1033 Ga0500568_0001296 3300053139 Bacteria 16418
1034 Ga0500568_0015213 3300053139 Bacteria 3449
1035 Ga0500568_0023471 3300053139 Bacteria 2623
1036 Ga0500590_033078 3300053148 Bacteria 2681
1037 Ga0500604_0004171 3300053151 Bacteria 3850
1038 Ga0500604_0004488 3300053151 Bacteria 3703
1039 Ga0500616_0000677 3300053153 Bacteria 39945
1040 Ga0500616_0000980 3300053153 Bacteria 30834
1041 Ga0500616_0049618 3300053153 Bacteria 2219
1042 Ga0500622_0000780 3300053156 Bacteria 27667
1043 Ga0500622_0027811 3300053156 Bacteria 2980
1044 Ga0500622_0098291 3300053156 Bacteria 1445
1045 Ga0500636_0000245 3300053177 Bacteria 29922
1046 Ga0500636_0085413 3300053177 Bacteria 1813
1047 Ga0501084_0000322 3300054114 Bacteria 36608
1048 Ga0501084_0038339 3300054114 Bacteria 4006
1049 Ga0501084_0266924 3300054114 Bacteria 1445
1050 Ga0590071_011978 3300059421 Bacteria 2033
1051 Ga0501082_0019565 3300060353 Bacteria 5839
1052 Ga0501082_0028071 3300060353 Bacteria 4848
1053 Ga0501082_0185140 3300060353 Bacteria 1812
1054 Ga0501082_0253340 3300060353 Bacteria 1531
1055 Ga0466962_0135295 3300061719 Bacteria 1192

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300049569 Ga0501032_0010167 Ga0501032_0010167_5964_6770 267
2 3300049575 Ga0501039_0503212 Ga0501039_0503212_131_937 267
3 3300049578 Ga0501042_0379976 Ga0501042_0379976_15_827 270
4 3300049581 Ga0501047_0454971 Ga0501047_0454971_252_1094 273
5 3300048919 Ga0496116_0062493 Ga0496116_0062493_1531_2391 276
6 3300049581 Ga0501047_0003943 Ga0501047_0003943_13092_13934 279
7 3300046660 Ga0495625_0077687 Ga0495625_0077687_30_887 283
8 3300049573 Ga0501037_0085660 Ga0501037_0085660_70_924 283
9 3300042007 Ga0439449_0038752 Ga0439449_0038752_892_1752 286
10 3300049573 Ga0501037_0059227 Ga0501037_0059227_710_1576 288
11 3300005335 Ga0070666_10035138 Ga0070666_100351383 309
12 3300013306 Ga0163162_10403786 Ga0163162_104037861 309
13 3300046452 Ga0495617_004123 Ga0495617_004123_1145_2152 311
14 3300046507 Ga0495606_0000757 Ga0495606_0000757_19108_20115 311
15 3300046520 Ga0495637_0008603 Ga0495637_0008603_1216_2223 311
16 3300046522 Ga0495643_0000362 Ga0495643_0000362_21554_22552 311
17 3300048091 Ga0495626_0000981 Ga0495626_0000981_20496_21494 311
18 3300046524 Ga0495648_0058279 Ga0495648_0058279_651_1658 312
19 3300046694 Ga0495649_0016768 Ga0495649_0016768_2242_3249 312
20 3300047469 Ga0495673_0000096 Ga0495673_0000096_63174_64181 312
21 3300048914 Ga0496111_0120184 Ga0496111_0120184_888_1895 312
22 3300053118 Ga0500594_0004768 Ga0500594_0004768_407_1414 312
23 3300009177 Ga0105248_10119445 Ga0105248_101194453 313
24 3300025961 Ga0207712_10096928 Ga0207712_100969283 313
25 3300044693 Ga0466961_0044120 Ga0466961_0044120_654_1649 313
26 3300045049 Ga0466959_0089428 Ga0466959_0089428_1149_2144 313
27 3300045976 Ga0466967_0196632 Ga0466967_0196632_376_1371 313
28 3300037471 Ga0395905_0420516 Ga0395905_0420516_81_1088 314
29 3300046660 Ga0495625_0004660 Ga0495625_0004660_1643_2650 314
30 3300049583 Ga0501067_0114938 Ga0501067_0114938_21_995 314
31 3300053111 Ga0500572_002418 Ga0500572_002418_3248_4249 314
32 3300053177 Ga0500636_0085413 Ga0500636_0085413_802_1803 314
33 3300005458 Ga0070681_10024374 Ga0070681_100243743 315
34 3300025912 Ga0207707_10014148 Ga0207707_100141484 315
35 3300031901 Ga0307406_10022197 Ga0307406_100221973 315
36 3300005329 Ga0070683_100038909 Ga0070683_1000389093 316
37 3300005435 Ga0070714_100048057 Ga0070714_1000480573 316
38 3300005530 Ga0070679_100087266 Ga0070679_1000872663 316
39 3300005535 Ga0070684_100030837 Ga0070684_1000308375 316
40 3300005563 Ga0068855_100007019 Ga0068855_1000070194 316
41 3300005564 Ga0070664_100000477 Ga0070664_10000047729 316
42 3300005577 Ga0068857_100004249 Ga0068857_10000424912 316
43 3300009093 Ga0105240_10017115 Ga0105240_100171155 316
44 3300009551 Ga0105238_10009734 Ga0105238_100097344 316
45 3300013100 Ga0157373_10006166 Ga0157373_100061664 316
46 3300013104 Ga0157370_10032044 Ga0157370_100320443 316
47 3300013105 Ga0157369_10028777 Ga0157369_100287774 316
48 3300013307 Ga0157372_10011309 Ga0157372_100113095 316
49 3300025909 Ga0207705_10033838 Ga0207705_100338384 316
50 3300025912 Ga0207707_10259308 Ga0207707_102593081 316
51 3300025913 Ga0207695_10089322 Ga0207695_100893222 316
52 3300025920 Ga0207649_10009032 Ga0207649_100090323 316
53 3300025924 Ga0207694_10021429 Ga0207694_100214293 316
54 3300025929 Ga0207664_10043228 Ga0207664_100432283 316
55 3300025932 Ga0207690_10025978 Ga0207690_100259783 316
56 3300025945 Ga0207679_10033427 Ga0207679_100334273 316
57 3300025949 Ga0207667_10044605 Ga0207667_100446053 316
58 3300025981 Ga0207640_10049946 Ga0207640_100499462 316
59 3300026041 Ga0207639_10009223 Ga0207639_100092235 316
60 3300026078 Ga0207702_10021577 Ga0207702_100215774 316
61 3300026116 Ga0207674_10000379 Ga0207674_1000037927 316
62 3300026142 Ga0207698_10012640 Ga0207698_100126402 316
63 3300046460 Ga0495638_0027113 Ga0495638_0027113_108_1115 316
64 3300046648 Ga0495611_0022356 Ga0495611_0022356_587_1573 316
65 3300049571 Ga0501034_0000105 Ga0501034_0000105_76213_77199 316
66 3300046452 Ga0495617_000022 Ga0495617_000022_109235_110221 317
67 3300046453 Ga0495627_000222 Ga0495627_000222_48566_49552 317
68 3300046455 Ga0495603_0047986 Ga0495603_0047986_1153_2139 317
69 3300046474 Ga0495605_0000064 Ga0495605_0000064_119377_120363 317
70 3300046492 Ga0495585_0019126 Ga0495585_0019126_1246_2232 317
71 3300046492 Ga0495585_0042031 Ga0495585_0042031_994_1980 317
72 3300046500 Ga0495596_0009401 Ga0495596_0009401_1747_2733 317
73 3300046500 Ga0495596_0047033 Ga0495596_0047033_89_1075 317
74 3300046501 Ga0495607_0003479 Ga0495607_0003479_3155_4141 317
75 3300046506 Ga0495583_0000678 Ga0495583_0000678_20582_21568 317
76 3300046506 Ga0495583_0027690 Ga0495583_0027690_1604_2590 317
77 3300046512 Ga0495610_0003067 Ga0495610_0003067_5316_6323 317
78 3300046513 Ga0495616_0000431 Ga0495616_0000431_17960_18946 317
79 3300046513 Ga0495616_0005704 Ga0495616_0005704_4448_5434 317
80 3300046518 Ga0495631_0051645 Ga0495631_0051645_353_1339 317
81 3300046518 Ga0495631_0059923 Ga0495631_0059923_29_1015 317
82 3300046519 Ga0495632_0000026 Ga0495632_0000026_87684_88670 317
83 3300046519 Ga0495632_0000087 Ga0495632_0000087_63458_64444 317
84 3300046522 Ga0495643_0000119 Ga0495643_0000119_107396_108403 317
85 3300046523 Ga0495644_0033365 Ga0495644_0033365_250_1236 317
86 3300046524 Ga0495648_0000379 Ga0495648_0000379_27413_28399 317
87 3300046525 Ga0495663_0030447 Ga0495663_0030447_534_1520 317
88 3300046528 Ga0495642_0000272 Ga0495642_0000272_18846_19832 317
89 3300046528 Ga0495642_0000329 Ga0495642_0000329_16077_17063 317
90 3300046528 Ga0495642_0006986 Ga0495642_0006986_1338_2324 317
91 3300046530 Ga0495654_0001196 Ga0495654_0001196_2797_3783 317
92 3300046530 Ga0495654_0008383 Ga0495654_0008383_2613_3599 317
93 3300046538 Ga0495609_0008483 Ga0495609_0008483_1953_2939 317
94 3300046538 Ga0495609_0065444 Ga0495609_0065444_303_1310 317
95 3300046542 Ga0495597_0000810 Ga0495597_0000810_19391_20398 317
96 3300046542 Ga0495597_0009034 Ga0495597_0009034_646_1632 317
97 3300046616 Ga0495668_0000653 Ga0495668_0000653_13194_14180 317
98 3300046648 Ga0495611_0012246 Ga0495611_0012246_2085_3071 317
99 3300046660 Ga0495625_0133578 Ga0495625_0133578_131_1117 317
100 3300046665 Ga0495661_0003566 Ga0495661_0003566_7897_8883 317
101 3300046674 Ga0495588_0009825 Ga0495588_0009825_3059_4045 317
102 3300046684 Ga0495669_0010531 Ga0495669_0010531_1788_2774 317
103 3300046684 Ga0495669_0013899 Ga0495669_0013899_2247_3233 317
104 3300046691 Ga0495670_0008641 Ga0495670_0008641_2591_3577 317
105 3300046692 Ga0495671_0000059 Ga0495671_0000059_56255_57241 317
106 3300046692 Ga0495671_0000595 Ga0495671_0000595_14375_15361 317
107 3300046692 Ga0495671_0011584 Ga0495671_0011584_2259_3245 317
108 3300046794 Ga0495589_0018524 Ga0495589_0018524_19_1005 317
109 3300046810 Ga0495660_0003265 Ga0495660_0003265_2002_2988 317
110 3300046810 Ga0495660_0057942 Ga0495660_0057942_692_1678 317
111 3300047320 Ga0495672_0000113 Ga0495672_0000113_40727_41734 317
112 3300047323 Ga0495683_0006509 Ga0495683_0006509_4487_5473 317
113 3300047445 Ga0495677_0002243 Ga0495677_0002243_2318_3304 317
114 3300047446 Ga0495679_007931 Ga0495679_007931_943_1929 317
115 3300047470 Ga0495681_0000272 Ga0495681_0000272_37777_38763 317
116 3300048091 Ga0495626_0029472 Ga0495626_0029472_1627_2613 317
117 3300048905 Ga0496102_0000068 Ga0496102_0000068_52437_53423 317
118 3300048924 Ga0496121_0206123 Ga0496121_0206123_210_1196 317
119 3300049459 Ga0495678_000111 Ga0495678_000111_58078_59085 317
120 3300049459 Ga0495678_000126 Ga0495678_000126_74917_75903 317
121 3300049459 Ga0495678_000290 Ga0495678_000290_8280_9266 317
122 3300049460 Ga0495682_0001716 Ga0495682_0001716_4456_5442 317
123 3300037471 Ga0395905_0001192 Ga0395905_0001192_30067_31065 319
124 3300048088 Ga0495602_0006635 Ga0495602_0006635_3905_4891 319
125 3300009177 Ga0105248_10307717 Ga0105248_103077172 320
126 3300048922 Ga0496119_0090052 Ga0496119_0090052_545_1534 320
127 3300048924 Ga0496121_0046025 Ga0496121_0046025_2130_3119 320
128 3300048928 Ga0496125_0005886 Ga0496125_0005886_3048_4037 320
129 3300005841 Ga0068863_100162433 Ga0068863_1001624332 321
130 3300005842 Ga0068858_100002701 Ga0068858_10000270110 321
131 3300014325 Ga0163163_10103767 Ga0163163_101037672 321
132 3300026035 Ga0207703_10004984 Ga0207703_1000498410 321
133 3300026088 Ga0207641_10176543 Ga0207641_101765432 321
134 3300048905 Ga0496102_0026743 Ga0496102_0026743_1246_2250 321
135 3300048909 Ga0496106_0092990 Ga0496106_0092990_981_1985 321
136 3300048924 Ga0496121_0003041 Ga0496121_0003041_22105_23109 321
137 3300048929 Ga0496126_0106212 Ga0496126_0106212_82_1086 321
138 iso_pu_bacteria 2842733646 2842738598 321
139 iso_pu_bacteria 2885192300 2885194295 321
140 iso_pu_bacteria 2899924645 2899929798 321
141 iso_pu_bacteria 2928044640 2928050030 321
142 iso_pu_bacteria 2928051484 2928054611 321
143 3300046459 Ga0495629_0041068 Ga0495629_0041068_519_1550 322
144 3300046681 Ga0495647_0044983 Ga0495647_0044983_295_1326 322
145 3300003354 JGI25160J50197_1006336 JGI25160J50197_10063363 323
146 3300003790 Ga0055528_1003280 Ga0055528_10032802 323
147 3300005355 Ga0070671_100029091 Ga0070671_1000290914 323
148 3300005367 Ga0070667_100113050 Ga0070667_1001130502 323
149 3300025258 Ga0209129_1009869 Ga0209129_10098693 323
150 3300025273 Ga0209673_1001992 Ga0209673_10019929 323
151 3300025294 Ga0209025_1004200 Ga0209025_10042003 323
152 3300025302 Ga0207426_1001540 Ga0207426_10015407 323
153 3300025931 Ga0207644_10013039 Ga0207644_100130392 323
154 3300025986 Ga0207658_10191576 Ga0207658_101915761 323
155 3300037312 Ga0395899_0023290 Ga0395899_0023290_3518_4495 323
156 3300037418 Ga0395900_0075570 Ga0395900_0075570_2170_3147 323
157 3300037466 Ga0395898_0020217 Ga0395898_0020217_1087_2064 323
158 3300038443 Ga0395901_0442911 Ga0395901_0442911_146_1123 323
159 3300038443 Ga0395901_0442946 Ga0395901_0442946_207_1184 323
160 3300046674 Ga0495588_0043986 Ga0495588_0043986_101_1075 323
161 3300048927 Ga0496124_0095898 Ga0496124_0095898_1387_2388 323
162 3300050509 nmdc:mga0qj67_288810_c1 nmdc:mga0qj67_288810_c1_215_1192 323
163 iso_pu_bacteria 2887375801 2887379975 323
164 3300005355 Ga0070671_100004730 Ga0070671_10000473010 324
165 3300005367 Ga0070667_100008497 Ga0070667_1000084978 324
166 3300005617 Ga0068859_100001222 Ga0068859_1000012225 324
167 3300005843 Ga0068860_100139263 Ga0068860_1001392633 324
168 3300006844 Ga0075428_100394322 Ga0075428_1003943222 324
169 3300006846 Ga0075430_100013283 Ga0075430_1000132836 324
170 3300006847 Ga0075431_100008297 Ga0075431_1000082973 324
171 3300006880 Ga0075429_100052920 Ga0075429_1000529202 324
172 3300006931 Ga0097620_100001222 Ga0097620_10000122221 324
173 3300007265 Ga0099794_10001158 Ga0099794_100011587 324
174 3300009101 Ga0105247_10000248 Ga0105247_1000024825 324
175 3300009553 Ga0105249_10004888 Ga0105249_1000488811 324
176 3300014968 Ga0157379_10004041 Ga0157379_100040418 324
177 3300025900 Ga0207710_10000333 Ga0207710_1000033319 324
178 3300025931 Ga0207644_10003506 Ga0207644_100035067 324
179 3300025986 Ga0207658_10002111 Ga0207658_100021117 324
180 3300027671 Ga0209588_1002399 Ga0209588_10023993 324
181 3300032005 Ga0307411_10015733 Ga0307411_100157334 324
182 3300037466 Ga0395898_0022748 Ga0395898_0022748_2475_3458 324
183 3300049568 Ga0501031_0006749 Ga0501031_0006749_5207_6196 324
184 3300049572 Ga0501036_0008378 Ga0501036_0008378_4959_5948 324
185 3300049574 Ga0501038_0010312 Ga0501038_0010312_3761_4750 324
186 3300049579 Ga0501043_0009792 Ga0501043_0009792_5355_6344 324
187 3300049581 Ga0501047_0003275 Ga0501047_0003275_6241_7230 324
188 3300049822 Ga0501035_0018416 Ga0501035_0018416_2431_3420 324
189 3300049823 Ga0501044_0020553 Ga0501044_0020553_3358_4347 324
190 3300050509 nmdc:mga0qj67_10964_c1 nmdc:mga0qj67_10964_c1_5164_6141 324
191 3300050510 nmdc:mga06r32_13010_c1 nmdc:mga06r32_13010_c1_3223_4200 324
192 iso_pu_bacteria 2885305155 2885306900 324
193 iso_pu_bacteria 2885326080 2885327918 324
194 iso_pu_bacteria 2885334103 2885335457 324
195 iso_pu_bacteria 2904541872 2904549200 324
196 iso_pu_bacteria 2929160207 2929160830 324
197 3300005336 Ga0070680_100019667 Ga0070680_1000196675 325
198 3300005458 Ga0070681_10051581 Ga0070681_100515813 325
199 3300005530 Ga0070679_100041890 Ga0070679_1000418906 325
200 3300005530 Ga0070679_100321496 Ga0070679_1003214962 325
201 3300007265 Ga0099794_10054135 Ga0099794_100541352 325
202 3300025912 Ga0207707_10136521 Ga0207707_101365213 325
203 3300025913 Ga0207695_10118060 Ga0207695_101180603 325
204 3300025917 Ga0207660_10204946 Ga0207660_102049462 325
205 3300025921 Ga0207652_10059508 Ga0207652_100595081 325
206 3300025921 Ga0207652_10391359 Ga0207652_103913591 325
207 3300026121 Ga0207683_10360889 Ga0207683_103608891 325
208 3300031239 Ga0265328_10091898 Ga0265328_100918981 325
209 3300031250 Ga0265331_10007443 Ga0265331_100074433 325
210 3300031251 Ga0265327_10000083 Ga0265327_10000083140 325
211 3300032004 Ga0307414_10284064 Ga0307414_102840641 325
212 3300032005 Ga0307411_10269961 Ga0307411_102699612 325
213 3300037418 Ga0395900_0394358 Ga0395900_0394358_248_1231 325
214 3300039447 Ga0436361_0004189 Ga0436361_0004189_4198_5235 325
215 3300041411 Ga0439466_0011166 Ga0439466_0011166_2206_3186 325
216 3300041413 Ga0439465_0006254 Ga0439465_0006254_184_1164 325
217 3300042007 Ga0439449_0005817 Ga0439449_0005817_677_1657 325
218 3300042010 Ga0439452_005324 Ga0439452_005324_2327_3307 325
219 3300042014 Ga0439457_008408 Ga0439457_008408_1043_2023 325
220 3300042015 Ga0439462_0039767 Ga0439462_0039767_165_1145 325
221 3300048920 Ga0496117_0017184 Ga0496117_0017184_3855_4892 325
222 iso_pu_bacteria 2739367756 2739793384 325
223 iso_pu_bacteria 2842747753 2842750036 325
224 iso_pu_bacteria 2869162929 2869163394 325
225 iso_pu_bacteria 2895511927 2895518571 325
226 3300003784 Ga0055534_1001811 Ga0055534_10018115 326
227 3300003792 Ga0055540_1005410 Ga0055540_10054102 326
228 3300003794 Ga0055531_10003153 Ga0055531_100031539 326
229 3300005327 Ga0070658_10034330 Ga0070658_100343303 326
230 3300005329 Ga0070683_100023540 Ga0070683_1000235403 326
231 3300005334 Ga0068869_100135223 Ga0068869_1001352232 326
232 3300005336 Ga0070680_100097355 Ga0070680_1000973551 326
233 3300005344 Ga0070661_100128804 Ga0070661_1001288042 326
234 3300005347 Ga0070668_100132243 Ga0070668_1001322431 326
235 3300005353 Ga0070669_100225018 Ga0070669_1002250181 326
236 3300005535 Ga0070684_100011755 Ga0070684_1000117555 326
237 3300005563 Ga0068855_100531508 Ga0068855_1005315081 326
238 3300005577 Ga0068857_100047477 Ga0068857_1000474773 326
239 3300005616 Ga0068852_100379177 Ga0068852_1003791772 326
240 3300005617 Ga0068859_100048247 Ga0068859_1000482473 326
241 3300005618 Ga0068864_100135764 Ga0068864_1001357642 326
242 3300005842 Ga0068858_100291860 Ga0068858_1002918602 326
243 3300005843 Ga0068860_100047094 Ga0068860_1000470943 326
244 3300006931 Ga0097620_100048249 Ga0097620_1000482493 326
245 3300013307 Ga0157372_10083943 Ga0157372_100839434 326
246 3300014325 Ga0163163_10037715 Ga0163163_100377152 326
247 3300021361 Ga0213872_10000154 Ga0213872_1000015434 326
248 3300025284 Ga0209130_1003722 Ga0209130_10037224 326
249 3300025291 Ga0209675_1000981 Ga0209675_10009815 326
250 3300025292 Ga0209676_1010510 Ga0209676_10105101 326
251 3300025298 Ga0209050_1010907 Ga0209050_10109072 326
252 3300025303 Ga0209051_1000025 Ga0209051_1000025372 326
253 3300025303 Ga0209051_1048586 Ga0209051_10485861 326
254 3300025304 Ga0209257_1000039 Ga0209257_1000039236 326
255 3300025304 Ga0209257_1003715 Ga0209257_100371511 326
256 3300025901 Ga0207688_10185509 Ga0207688_101855092 326
257 3300025920 Ga0207649_10143812 Ga0207649_101438122 326
258 3300025923 Ga0207681_10270633 Ga0207681_102706331 326
259 3300025932 Ga0207690_10147463 Ga0207690_101474632 326
260 3300025938 Ga0207704_10151506 Ga0207704_101515062 326
261 3300025945 Ga0207679_10036372 Ga0207679_100363722 326
262 3300026088 Ga0207641_10344561 Ga0207641_103445611 326
263 3300026095 Ga0207676_10092593 Ga0207676_100925933 326
264 3300026116 Ga0207674_10024476 Ga0207674_100244766 326
265 3300026142 Ga0207698_10212521 Ga0207698_102125212 326
266 3300027671 Ga0209588_1020191 Ga0209588_10201912 326
267 3300028381 Ga0268264_10034697 Ga0268264_100346974 326
268 3300031901 Ga0307406_10013167 Ga0307406_100131672 326
269 3300031995 Ga0307409_100183640 Ga0307409_1001836402 326
270 3300037312 Ga0395899_0025702 Ga0395899_0025702_2601_3584 326
271 3300037418 Ga0395900_0074477 Ga0395900_0074477_1513_2496 326
272 3300037418 Ga0395900_0145690 Ga0395900_0145690_346_1329 326
273 3300037466 Ga0395898_0030101 Ga0395898_0030101_1973_2956 326
274 3300037471 Ga0395905_0122288 Ga0395905_0122288_1165_2151 326
275 3300039447 Ga0436361_0530495 Ga0436361_0530495_64123_65145 326
276 3300045976 Ga0466967_0254682 Ga0466967_0254682_380_1363 326
277 3300046475 Ga0495639_0006269 Ga0495639_0006269_3585_4592 326
278 3300046522 Ga0495643_0082820 Ga0495643_0082820_351_1334 326
279 3300048911 Ga0496108_0016373 Ga0496108_0016373_329_1351 326
280 3300048914 Ga0496111_0205149 Ga0496111_0205149_430_1419 326
281 3300048915 Ga0496112_0020004 Ga0496112_0020004_1038_2027 326
282 3300048915 Ga0496112_0037355 Ga0496112_0037355_2984_4006 326
283 3300048916 Ga0496113_0009595 Ga0496113_0009595_1233_2222 326
284 3300048916 Ga0496113_0261590 Ga0496113_0261590_82_1104 326
285 3300049571 Ga0501034_0123456 Ga0501034_0123456_1433_2416 326
286 3300049571 Ga0501034_0177521 Ga0501034_0177521_412_1395 326
287 3300049571 Ga0501034_0199710 Ga0501034_0199710_922_1905 326
288 3300049571 Ga0501034_0470051 Ga0501034_0470051_78_1061 326
289 3300049573 Ga0501037_0033550 Ga0501037_0033550_683_1666 326
290 3300049573 Ga0501037_0160482 Ga0501037_0160482_69_1052 326
291 3300049579 Ga0501043_0002038 Ga0501043_0002038_8779_9762 326
292 3300049579 Ga0501043_0098853 Ga0501043_0098853_64_1047 326
293 3300049580 Ga0501046_0007317 Ga0501046_0007317_5136_6119 326
294 3300049580 Ga0501046_0164448 Ga0501046_0164448_143_1126 326
295 3300049581 Ga0501047_0000636 Ga0501047_0000636_27794_28777 326
296 3300049581 Ga0501047_0152253 Ga0501047_0152253_1086_2069 326
297 3300049582 Ga0501048_0149576 Ga0501048_0149576_156_1139 326
298 3300049582 Ga0501048_0160637 Ga0501048_0160637_31_1014 326
299 3300049583 Ga0501067_0009015 Ga0501067_0009015_2307_3329 326
300 3300049583 Ga0501067_0154803 Ga0501067_0154803_26_1009 326
301 3300049583 Ga0501067_0228012 Ga0501067_0228012_29_1012 326
302 3300049586 Ga0501070_0073931 Ga0501070_0073931_990_1973 326
303 3300049589 Ga0501073_0089428 Ga0501073_0089428_135_1118 326
304 3300049589 Ga0501073_0205731 Ga0501073_0205731_35_1018 326
305 3300049742 Ga0501080_0056028 Ga0501080_0056028_1363_2346 326
306 3300049744 Ga0501083_0001893 Ga0501083_0001893_3229_4212 326
307 3300049744 Ga0501083_0005890 Ga0501083_0005890_1099_2082 326
308 3300049822 Ga0501035_0000800 Ga0501035_0000800_4218_5213 326
309 3300049823 Ga0501044_0075097 Ga0501044_0075097_479_1462 326
310 3300050516 nmdc:mga0sz30_18084_c1 nmdc:mga0sz30_18084_c1_675_1682 326
311 3300054114 Ga0501084_0038339 Ga0501084_0038339_1111_2094 326
312 3300054114 Ga0501084_0266924 Ga0501084_0266924_181_1164 326
313 3300060353 Ga0501082_0028071 Ga0501082_0028071_1878_2861 326
314 iso_pu_bacteria 2738543013 2739251582 326
315 3300001904 JGI24736J21556_1001796 JGI24736J21556_10017966 327
316 3300001915 JGI24741J21665_1000582 JGI24741J21665_10005824 327
317 3300001979 JGI24740J21852_10002373 JGI24740J21852_100023739 327
318 3300005327 Ga0070658_10046534 Ga0070658_100465344 327
319 3300005329 Ga0070683_100023206 Ga0070683_1000232066 327
320 3300005336 Ga0070680_100004729 Ga0070680_10000472911 327
321 3300005336 Ga0070680_100019004 Ga0070680_1000190046 327
322 3300005336 Ga0070680_100046207 Ga0070680_1000462072 327
323 3300005337 Ga0070682_100049310 Ga0070682_1000493102 327
324 3300005337 Ga0070682_100085439 Ga0070682_1000854392 327
325 3300005337 Ga0070682_100113963 Ga0070682_1001139632 327
326 3300005339 Ga0070660_100035735 Ga0070660_1000357355 327
327 3300005339 Ga0070660_100250026 Ga0070660_1002500262 327
328 3300005341 Ga0070691_10000346 Ga0070691_1000034610 327
329 3300005344 Ga0070661_100011899 Ga0070661_1000118997 327
330 3300005344 Ga0070661_100032241 Ga0070661_1000322415 327
331 3300005345 Ga0070692_10006692 Ga0070692_100066926 327
332 3300005345 Ga0070692_10012767 Ga0070692_100127674 327
333 3300005455 Ga0070663_100096368 Ga0070663_1000963682 327
334 3300005458 Ga0070681_10000944 Ga0070681_1000094416 327
335 3300005458 Ga0070681_10042102 Ga0070681_100421022 327
336 3300005458 Ga0070681_10077426 Ga0070681_100774262 327
337 3300005458 Ga0070681_10079325 Ga0070681_100793252 327
338 3300005468 Ga0070707_100291758 Ga0070707_1002917581 327
339 3300005530 Ga0070679_100001195 Ga0070679_10000119513 327
340 3300005530 Ga0070679_100041528 Ga0070679_1000415282 327
341 3300005530 Ga0070679_100080762 Ga0070679_1000807622 327
342 3300005530 Ga0070679_100259093 Ga0070679_1002590932 327
343 3300005535 Ga0070684_100033388 Ga0070684_1000333884 327
344 3300005539 Ga0068853_100060825 Ga0068853_1000608252 327
345 3300005539 Ga0068853_100325541 Ga0068853_1003255412 327
346 3300005546 Ga0070696_100021029 Ga0070696_1000210292 327
347 3300005563 Ga0068855_100086230 Ga0068855_1000862305 327
348 3300005564 Ga0070664_100020672 Ga0070664_1000206724 327
349 3300005564 Ga0070664_100047232 Ga0070664_1000472322 327
350 3300005577 Ga0068857_100035167 Ga0068857_1000351674 327
351 3300005577 Ga0068857_100084204 Ga0068857_1000842042 327
352 3300005577 Ga0068857_100191711 Ga0068857_1001917112 327
353 3300005578 Ga0068854_100035067 Ga0068854_1000350672 327
354 3300005614 Ga0068856_100025937 Ga0068856_1000259375 327
355 3300005614 Ga0068856_100064087 Ga0068856_1000640875 327
356 3300005614 Ga0068856_100465197 Ga0068856_1004651972 327
357 3300005616 Ga0068852_100037601 Ga0068852_1000376015 327
358 3300005842 Ga0068858_100014485 Ga0068858_1000144857 327
359 3300009093 Ga0105240_10389256 Ga0105240_103892562 327
360 3300009551 Ga0105238_10508408 Ga0105238_105084082 327
361 3300009553 Ga0105249_10021341 Ga0105249_100213414 327
362 3300013102 Ga0157371_10021219 Ga0157371_100212192 327
363 3300013104 Ga0157370_10059372 Ga0157370_100593722 327
364 3300013105 Ga0157369_10041336 Ga0157369_100413362 327
365 3300013105 Ga0157369_10081484 Ga0157369_100814843 327
366 3300013307 Ga0157372_10007498 Ga0157372_100074988 327
367 3300013307 Ga0157372_10086408 Ga0157372_100864082 327
368 3300014325 Ga0163163_10023142 Ga0163163_100231424 327
369 3300020070 Ga0206356_11279593 Ga0206356_112795938 327
370 3300020077 Ga0206351_10870896 Ga0206351_108708962 327
371 3300020080 Ga0206350_10446903 Ga0206350_104469032 327
372 3300020081 Ga0206354_10899802 Ga0206354_108998027 327
373 3300020082 Ga0206353_11006691 Ga0206353_110066912 327
374 3300020082 Ga0206353_11673663 Ga0206353_116736632 327
375 3300020082 Ga0206353_12066740 Ga0206353_120667402 327
376 3300020610 Ga0154015_1215416 Ga0154015_12154167 327
377 3300021361 Ga0213872_10001077 Ga0213872_1000107715 327
378 3300021384 Ga0213876_10093465 Ga0213876_100934651 327
379 3300025904 Ga0207647_10000677 Ga0207647_100006776 327
380 3300025904 Ga0207647_10001610 Ga0207647_100016108 327
381 3300025904 Ga0207647_10023607 Ga0207647_100236074 327
382 3300025909 Ga0207705_10001829 Ga0207705_100018298 327
383 3300025909 Ga0207705_10002514 Ga0207705_100025148 327
384 3300025909 Ga0207705_10004985 Ga0207705_100049857 327
385 3300025909 Ga0207705_10016011 Ga0207705_100160116 327
386 3300025912 Ga0207707_10001419 Ga0207707_1000141915 327
387 3300025912 Ga0207707_10003100 Ga0207707_1000310010 327
388 3300025912 Ga0207707_10032224 Ga0207707_100322242 327
389 3300025912 Ga0207707_10082705 Ga0207707_100827053 327
390 3300025913 Ga0207695_10004738 Ga0207695_1000473812 327
391 3300025913 Ga0207695_10016841 Ga0207695_100168416 327
392 3300025913 Ga0207695_10020794 Ga0207695_100207948 327
393 3300025917 Ga0207660_10001517 Ga0207660_1000151715 327
394 3300025917 Ga0207660_10007012 Ga0207660_100070125 327
395 3300025917 Ga0207660_10015836 Ga0207660_100158366 327
396 3300025917 Ga0207660_10018280 Ga0207660_100182806 327
397 3300025917 Ga0207660_10043401 Ga0207660_100434012 327
398 3300025919 Ga0207657_10008479 Ga0207657_100084797 327
399 3300025919 Ga0207657_10008724 Ga0207657_100087246 327
400 3300025919 Ga0207657_10018265 Ga0207657_100182656 327
401 3300025919 Ga0207657_10024698 Ga0207657_100246986 327
402 3300025920 Ga0207649_10002686 Ga0207649_100026868 327
403 3300025920 Ga0207649_10010440 Ga0207649_100104404 327
404 3300025920 Ga0207649_10022348 Ga0207649_100223482 327
405 3300025921 Ga0207652_10000022 Ga0207652_10000022130 327
406 3300025921 Ga0207652_10003362 Ga0207652_100033628 327
407 3300025921 Ga0207652_10005539 Ga0207652_1000553914 327
408 3300025924 Ga0207694_10097465 Ga0207694_100974652 327
409 3300025932 Ga0207690_10000913 Ga0207690_100009138 327
410 3300025944 Ga0207661_10004890 Ga0207661_100048906 327
411 3300025944 Ga0207661_10224154 Ga0207661_102241542 327
412 3300025945 Ga0207679_10057463 Ga0207679_100574633 327
413 3300025945 Ga0207679_10062086 Ga0207679_100620864 327
414 3300025945 Ga0207679_10177404 Ga0207679_101774043 327
415 3300025949 Ga0207667_10008048 Ga0207667_100080482 327
416 3300025949 Ga0207667_10008565 Ga0207667_100085659 327
417 3300025949 Ga0207667_10010015 Ga0207667_1001001512 327
418 3300025949 Ga0207667_10024202 Ga0207667_100242022 327
419 3300025981 Ga0207640_10002697 Ga0207640_100026977 327
420 3300025981 Ga0207640_10007005 Ga0207640_100070055 327
421 3300025981 Ga0207640_10174289 Ga0207640_101742892 327
422 3300026035 Ga0207703_10010204 Ga0207703_100102047 327
423 3300026041 Ga0207639_10005288 Ga0207639_1000528812 327
424 3300026041 Ga0207639_10018414 Ga0207639_100184142 327
425 3300026041 Ga0207639_10028040 Ga0207639_100280402 327
426 3300026041 Ga0207639_10207337 Ga0207639_102073372 327
427 3300026067 Ga0207678_10004139 Ga0207678_1000413912 327
428 3300026067 Ga0207678_10005965 Ga0207678_100059659 327
429 3300026067 Ga0207678_10016535 Ga0207678_100165356 327
430 3300026067 Ga0207678_10024028 Ga0207678_100240285 327
431 3300026078 Ga0207702_10003761 Ga0207702_1000376111 327
432 3300026116 Ga0207674_10001397 Ga0207674_1000139727 327
433 3300026116 Ga0207674_10016247 Ga0207674_100162476 327
434 3300026116 Ga0207674_10209486 Ga0207674_102094862 327
435 3300026142 Ga0207698_10001610 Ga0207698_100016106 327
436 3300026142 Ga0207698_10005754 Ga0207698_100057549 327
437 3300026142 Ga0207698_10098851 Ga0207698_100988513 327
438 3300028563 Ga0265319_1007401 Ga0265319_10074014 327
439 3300028577 Ga0265318_10002906 Ga0265318_100029065 327
440 3300031824 Ga0307413_10037912 Ga0307413_100379122 327
441 3300031903 Ga0307407_10014441 Ga0307407_100144412 327
442 3300032002 Ga0307416_100027749 Ga0307416_1000277493 327
443 3300032004 Ga0307414_10222628 Ga0307414_102226281 327
444 3300037312 Ga0395899_0000644 Ga0395899_0000644_19469_20455 327
445 3300037312 Ga0395899_0000662 Ga0395899_0000662_12181_13167 327
446 3300037312 Ga0395899_0239167 Ga0395899_0239167_127_1113 327
447 3300037418 Ga0395900_0118560 Ga0395900_0118560_1119_2105 327
448 3300037418 Ga0395900_0154710 Ga0395900_0154710_1330_2319 327
449 3300037418 Ga0395900_0158821 Ga0395900_0158821_237_1241 327
450 3300037466 Ga0395898_0025292 Ga0395898_0025292_4772_5761 327
451 3300037471 Ga0395905_0248862 Ga0395905_0248862_76_1062 327
452 3300039437 Ga0436365_0471224 Ga0436365_0471224_358_1344 327
453 3300039447 Ga0436361_0197147 Ga0436361_0197147_62354_63367 327
454 3300042004 Ga0439445_0012513 Ga0439445_0012513_846_1832 327
455 3300042115 Ga0450911_000141 Ga0450911_000141_4163_5149 327
456 3300044673 Ga0453683_0000198 Ga0453683_0000198_61889_62881 327
457 3300044901 Ga0466960_0070385 Ga0466960_0070385_211_1197 327
458 3300046474 Ga0495605_0030832 Ga0495605_0030832_476_1462 327
459 3300046500 Ga0495596_0001018 Ga0495596_0001018_12189_13175 327
460 3300046615 Ga0495656_0079511 Ga0495656_0079511_31_1020 327
461 3300046615 Ga0495656_0130193 Ga0495656_0130193_69_1070 327
462 3300046616 Ga0495668_0024888 Ga0495668_0024888_1955_2941 327
463 3300047320 Ga0495672_0038540 Ga0495672_0038540_1266_2252 327
464 3300048090 Ga0495615_0022726 Ga0495615_0022726_131_1120 327
465 3300048924 Ga0496121_0001731 Ga0496121_0001731_24301_25287 327
466 3300048928 Ga0496125_0008875 Ga0496125_0008875_936_1922 327
467 3300048928 Ga0496125_0016390 Ga0496125_0016390_3527_4513 327
468 3300048928 Ga0496125_0017649 Ga0496125_0017649_3212_4198 327
469 3300049569 Ga0501032_0005683 Ga0501032_0005683_1379_2428 327
470 3300049571 Ga0501034_0001513 Ga0501034_0001513_9177_10226 327
471 3300049572 Ga0501036_0011841 Ga0501036_0011841_3108_4157 327
472 3300049573 Ga0501037_0021070 Ga0501037_0021070_3681_4670 327
473 3300049573 Ga0501037_0099157 Ga0501037_0099157_545_1594 327
474 3300049573 Ga0501037_0111961 Ga0501037_0111961_510_1499 327
475 3300049574 Ga0501038_0003528 Ga0501038_0003528_10602_11651 327
476 3300049574 Ga0501038_0124171 Ga0501038_0124171_373_1362 327
477 3300049575 Ga0501039_0008209 Ga0501039_0008209_154_1203 327
478 3300049580 Ga0501046_0010238 Ga0501046_0010238_1931_2980 327
479 3300049581 Ga0501047_0004452 Ga0501047_0004452_9489_10538 327
480 3300049581 Ga0501047_0010184 Ga0501047_0010184_1594_2583 327
481 3300049581 Ga0501047_0077275 Ga0501047_0077275_101_1090 327
482 3300049585 Ga0501069_0026990 Ga0501069_0026990_1362_2351 327
483 3300049585 Ga0501069_0090943 Ga0501069_0090943_356_1345 327
484 3300049586 Ga0501070_0000311 Ga0501070_0000311_8215_9204 327
485 3300049586 Ga0501070_0007856 Ga0501070_0007856_981_1970 327
486 3300049586 Ga0501070_0033376 Ga0501070_0033376_216_1205 327
487 3300049587 Ga0501071_0026775 Ga0501071_0026775_905_1894 327
488 3300049589 Ga0501073_0012242 Ga0501073_0012242_2204_3253 327
489 3300049589 Ga0501073_0013127 Ga0501073_0013127_345_1334 327
490 3300049590 Ga0501074_0001303 Ga0501074_0001303_2630_3619 327
491 3300049590 Ga0501074_0025338 Ga0501074_0025338_2670_3659 327
492 3300049741 Ga0501079_0094471 Ga0501079_0094471_18_1007 327
493 3300049742 Ga0501080_0002966 Ga0501080_0002966_8615_9604 327
494 3300049742 Ga0501080_0007885 Ga0501080_0007885_7349_8398 327
495 3300049744 Ga0501083_0190527 Ga0501083_0190527_235_1266 327
496 3300049822 Ga0501035_0008949 Ga0501035_0008949_112_1101 327
497 3300049822 Ga0501035_0014906 Ga0501035_0014906_3769_4758 327
498 3300049822 Ga0501035_0034708 Ga0501035_0034708_224_1213 327
499 3300049823 Ga0501044_0029070 Ga0501044_0029070_1825_2874 327
500 3300049823 Ga0501044_0113668 Ga0501044_0113668_889_1878 327
501 3300049823 Ga0501044_0116094 Ga0501044_0116094_1480_2469 327
502 3300049823 Ga0501044_0180307 Ga0501044_0180307_867_1856 327
503 3300060353 Ga0501082_0019565 Ga0501082_0019565_1672_2721 327
504 iso_pu_bacteria 2510917026 2511171483 327
505 iso_pu_bacteria 2558860983 2561468075 327
506 iso_pu_bacteria 2582581304 2585257667 327
507 iso_pu_bacteria 2585427594 2585845185 327
508 iso_pu_bacteria 2599185236 2599722495 327
509 iso_pu_bacteria 2738541293 2738800597 327
510 iso_pu_bacteria 2835188231 2835190205 327
511 iso_pu_bacteria 2838736955 2838737487 327
512 iso_pu_bacteria 2841840854 2841842144 327
513 iso_pu_bacteria 2842140634 2842141923 327
514 iso_pu_bacteria 2854896431 2854900357 327
515 iso_pu_bacteria 2854916844 2854920189 327
516 iso_pu_bacteria 639633007 639786329 327
517 iso_pu_bacteria 8055431914 8055432145 327
518 3300003187 JGI25151J46595_10032082 JGI25151J46595_100320822 328
519 3300003759 Ga0055525_1000036 Ga0055525_100003640 328
520 3300005441 Ga0070700_100176122 Ga0070700_1001761221 328
521 3300005445 Ga0070708_100000241 Ga0070708_10000024119 328
522 3300005445 Ga0070708_100004969 Ga0070708_1000049694 328
523 3300005456 Ga0070678_100047817 Ga0070678_1000478173 328
524 3300005468 Ga0070707_100132667 Ga0070707_1001326672 328
525 3300005518 Ga0070699_100029109 Ga0070699_1000291095 328
526 3300005543 Ga0070672_100077333 Ga0070672_1000773332 328
527 3300005548 Ga0070665_100025227 Ga0070665_1000252272 328
528 3300005563 Ga0068855_100016173 Ga0068855_1000161734 328
529 3300005563 Ga0068855_100210331 Ga0068855_1002103312 328
530 3300005618 Ga0068864_100067294 Ga0068864_1000672942 328
531 3300006178 Ga0075367_10058543 Ga0075367_100585432 328
532 3300006846 Ga0075430_100047465 Ga0075430_1000474652 328
533 3300007265 Ga0099794_10041302 Ga0099794_100413022 328
534 3300009011 Ga0105251_10029058 Ga0105251_100290581 328
535 3300009147 Ga0114129_10117336 Ga0114129_101173365 328
536 3300009177 Ga0105248_10053339 Ga0105248_100533392 328
537 3300009177 Ga0105248_10310526 Ga0105248_103105262 328
538 3300009553 Ga0105249_10093171 Ga0105249_100931711 328
539 3300013306 Ga0163162_10056641 Ga0163162_100566412 328
540 3300015683 Ga0183362_10019 Ga0183362_1001914 328
541 3300017792 Ga0163161_10186179 Ga0163161_101861792 328
542 3300021361 Ga0213872_10000073 Ga0213872_1000007367 328
543 3300025230 Ga0209563_100014 Ga0209563_100014423 328
544 3300025294 Ga0209025_1000359 Ga0209025_100035965 328
545 3300025917 Ga0207660_10205888 Ga0207660_102058882 328
546 3300025932 Ga0207690_10195532 Ga0207690_101955322 328
547 3300025949 Ga0207667_10010275 Ga0207667_100102755 328
548 3300025949 Ga0207667_10159902 Ga0207667_101599022 328
549 3300025960 Ga0207651_10100285 Ga0207651_101002852 328
550 3300026075 Ga0207708_10090026 Ga0207708_100900262 328
551 3300026121 Ga0207683_10014618 Ga0207683_100146186 328
552 3300026121 Ga0207683_10021474 Ga0207683_100214742 328
553 3300028379 Ga0268266_10059413 Ga0268266_100594133 328
554 3300028794 Ga0307515_10000651 Ga0307515_1000065128 328
555 3300030521 Ga0307511_10000077 Ga0307511_1000007745 328
556 3300031249 Ga0265339_10000691 Ga0265339_100006915 328
557 3300031344 Ga0265316_10001019 Ga0265316_100010192 328
558 3300031548 Ga0307408_100355402 Ga0307408_1003554021 328
559 3300031711 Ga0265314_10000003 Ga0265314_10000003213 328
560 3300031901 Ga0307406_10226006 Ga0307406_102260062 328
561 3300032002 Ga0307416_100273224 Ga0307416_1002732242 328
562 3300036647 Ga0316582_0165885 Ga0316582_0165885_321_1310 328
563 3300039447 Ga0436361_0736070 Ga0436361_0736070_20991_22007 328
564 3300046454 Ga0495592_0300675 Ga0495592_0300675_20_1015 328
565 3300046462 Ga0495651_0038320 Ga0495651_0038320_2210_3205 328
566 3300048905 Ga0496102_0161824 Ga0496102_0161824_595_1653 328
567 3300048906 Ga0496103_0068404 Ga0496103_0068404_247_1305 328
568 3300048907 Ga0496104_0174149 Ga0496104_0174149_448_1506 328
569 3300048908 Ga0496105_0066482 Ga0496105_0066482_632_1690 328
570 3300048911 Ga0496108_0108699 Ga0496108_0108699_450_1508 328
571 3300048913 Ga0496110_0055640 Ga0496110_0055640_1596_2591 328
572 3300048914 Ga0496111_0109142 Ga0496111_0109142_682_1677 328
573 3300048916 Ga0496113_0142115 Ga0496113_0142115_450_1508 328
574 3300048922 Ga0496119_0041996 Ga0496119_0041996_1392_2450 328
575 3300048925 Ga0496122_0054120 Ga0496122_0054120_1454_2512 328
576 3300048928 Ga0496125_0061916 Ga0496125_0061916_1289_2347 328
577 3300049570 Ga0501033_0053265 Ga0501033_0053265_93_1082 328
578 3300049823 Ga0501044_0321580 Ga0501044_0321580_129_1118 328
579 3300050496 nmdc:mga07m45_18218_c1 nmdc:mga07m45_18218_c1_1068_2087 328
580 3300050509 nmdc:mga0qj67_51303_c1 nmdc:mga0qj67_51303_c1_86_1123 328
581 iso_pu_bacteria 2510461069 2510842552 328
582 iso_pu_bacteria 2510917022 2511136687 328
583 iso_pu_bacteria 2524023209 2524462067 328
584 iso_pu_bacteria 2582581307 2585274156 328
585 iso_pu_bacteria 2582581308 2585280436 328
586 iso_pu_bacteria 2582581315 2585322709 328
587 iso_pu_bacteria 2582581316 2585330826 328
588 iso_pu_bacteria 2585427527 2585532664 328
589 iso_pu_bacteria 2585427530 2585554320 328
590 iso_pu_bacteria 2585427531 2585560605 328
591 iso_pu_bacteria 2585427608 2585898816 328
592 iso_pu_bacteria 2585427609 2585903597 328
593 iso_pu_bacteria 2585428125 2587981283 328
594 iso_pu_bacteria 2615840626 2616307265 328
595 iso_pu_bacteria 2617270742 2617383487 328
596 iso_pu_bacteria 2643221558 2643813149 328
597 iso_pu_bacteria 2667528174 2671112062 328
598 iso_pu_bacteria 2738541317 2738944382 328
599 iso_pu_bacteria 2775507266 2778175882 328
600 iso_pu_bacteria 2818991453 2819639833 328
601 iso_pu_bacteria 2838029111 2838033001 328
602 iso_pu_bacteria 2842298080 2842298566 328
603 iso_pu_bacteria 2842357229 2842362418 328
604 iso_pu_bacteria 2842475841 2842479734 328
605 iso_pu_bacteria 2842482326 2842483524 328
606 iso_pu_bacteria 2842502639 2842506910 328
607 iso_pu_bacteria 2842509118 2842510594 328
608 iso_pu_bacteria 2852387548 2852391045 328
609 iso_pu_bacteria 2894772417 2894772567 328
610 iso_pu_bacteria 2913308742 2913309001 328
611 iso_pu_bacteria 2919408235 2919410546 328
612 iso_pu_bacteria 2929138655 2929141292 328
613 iso_pu_bacteria 3005416602 3005418618 328
614 iso_pu_bacteria 8005314921 8005318490 328
615 iso_pu_bacteria 8005682033 8005682335 328
616 iso_pu_bacteria 8056875544 8056876070 328
617 iso_pu_bacteria 8057575449 8057577532 328
618 3300005329 Ga0070683_100121335 Ga0070683_1001213352 329
619 3300005336 Ga0070680_100293576 Ga0070680_1002935762 329
620 3300005338 Ga0068868_100193279 Ga0068868_1001932791 329
621 3300005353 Ga0070669_100036844 Ga0070669_1000368442 329
622 3300005435 Ga0070714_100049230 Ga0070714_1000492304 329
623 3300005535 Ga0070684_100073917 Ga0070684_1000739173 329
624 3300006038 Ga0075365_10203020 Ga0075365_102030202 329
625 3300006847 Ga0075431_100157557 Ga0075431_1001575573 329
626 3300006871 Ga0075434_100286532 Ga0075434_1002865322 329
627 3300007265 Ga0099794_10012174 Ga0099794_100121743 329
628 3300009177 Ga0105248_10000043 Ga0105248_1000004358 329
629 3300014325 Ga0163163_10016430 Ga0163163_100164305 329
630 3300014497 Ga0182008_10001809 Ga0182008_1000180911 329
631 3300021361 Ga0213872_10000017 Ga0213872_10000017164 329
632 3300025246 Ga0209646_1000097 Ga0209646_1000097154 329
633 3300025909 Ga0207705_10066289 Ga0207705_100662893 329
634 3300025923 Ga0207681_10001417 Ga0207681_100014172 329
635 3300026023 Ga0207677_10164895 Ga0207677_101648951 329
636 3300028558 Ga0265326_10013540 Ga0265326_100135402 329
637 3300028563 Ga0265319_1012116 Ga0265319_10121163 329
638 3300028573 Ga0265334_10003454 Ga0265334_100034543 329
639 3300028577 Ga0265318_10001215 Ga0265318_100012156 329
640 3300028800 Ga0265338_10005969 Ga0265338_1000596913 329
641 3300030521 Ga0307511_10000851 Ga0307511_1000085122 329
642 3300031238 Ga0265332_10001462 Ga0265332_100014623 329
643 3300031240 Ga0265320_10002610 Ga0265320_100026103 329
644 3300031241 Ga0265325_10005974 Ga0265325_100059743 329
645 3300031242 Ga0265329_10001757 Ga0265329_100017572 329
646 3300031249 Ga0265339_10013975 Ga0265339_100139753 329
647 3300031251 Ga0265327_10023427 Ga0265327_100234274 329
648 3300031344 Ga0265316_10009140 Ga0265316_100091403 329
649 3300031595 Ga0265313_10006665 Ga0265313_100066658 329
650 3300031711 Ga0265314_10006556 Ga0265314_100065565 329
651 3300031712 Ga0265342_10002161 Ga0265342_1000216117 329
652 3300031824 Ga0307413_10008271 Ga0307413_100082713 329
653 3300031995 Ga0307409_100219575 Ga0307409_1002195752 329
654 3300036401 Ga0373937_0381280 Ga0373937_0381280_288_1280 329
655 3300037418 Ga0395900_0258829 Ga0395900_0258829_480_1472 329
656 3300037471 Ga0395905_0000126 Ga0395905_0000126_50233_51240 329
657 3300037471 Ga0395905_0078544 Ga0395905_0078544_1359_2351 329
658 3300037471 Ga0395905_0086219 Ga0395905_0086219_1230_2225 329
659 3300038443 Ga0395901_0065755 Ga0395901_0065755_1615_2607 329
660 3300039447 Ga0436361_0472104 Ga0436361_0472104_2979_3971 329
661 3300039447 Ga0436361_1101954 Ga0436361_1101954_31407_32414 329
662 3300045051 Ga0451576_0192238 Ga0451576_0192238_660_1673 329
663 3300046530 Ga0495654_0095774 Ga0495654_0095774_27_1028 329
664 3300046681 Ga0495647_0060424 Ga0495647_0060424_390_1394 329
665 3300048913 Ga0496110_0153655 Ga0496110_0153655_582_1574 329
666 3300048925 Ga0496122_0000080 Ga0496122_0000080_177926_178927 329
667 3300048926 Ga0496123_0000072 Ga0496123_0000072_33459_34460 329
668 3300049572 Ga0501036_0221525 Ga0501036_0221525_190_1185 329
669 3300049574 Ga0501038_0055230 Ga0501038_0055230_361_1356 329
670 3300049576 Ga0501040_0037608 Ga0501040_0037608_1074_2075 329
671 3300049581 Ga0501047_0113730 Ga0501047_0113730_1574_2572 329
672 3300049582 Ga0501048_0084400 Ga0501048_0084400_300_1295 329
673 3300049588 Ga0501072_0244843 Ga0501072_0244843_418_1416 329
674 3300049590 Ga0501074_0279110 Ga0501074_0279110_81_1094 329
675 3300049592 Ga0501076_0167009 Ga0501076_0167009_350_1351 329
676 3300049744 Ga0501083_0000239 Ga0501083_0000239_26638_27636 329
677 3300050492 nmdc:mga0yw44_257267_c1 nmdc:mga0yw44_257267_c1_137_1129 329
678 3300050512 nmdc:mga0n895_82117_c1 nmdc:mga0n895_82117_c1_2000_2992 329
679 3300050516 nmdc:mga0sz30_12942_c1 nmdc:mga0sz30_12942_c1_2106_3098 329
680 3300053092 Ga0500583_0003360 Ga0500583_0003360_2072_3064 329
681 3300053133 Ga0500655_016915 Ga0500655_016915_74_1066 329
682 3300053136 Ga0500559_0001871 Ga0500559_0001871_5062_6075 329
683 3300053139 Ga0500568_0000005 Ga0500568_0000005_397999_398997 329
684 3300053151 Ga0500604_0004171 Ga0500604_0004171_701_1693 329
685 3300053156 Ga0500622_0098291 Ga0500622_0098291_71_1084 329
686 3300054114 Ga0501084_0000322 Ga0501084_0000322_27931_28929 329
687 3300060353 Ga0501082_0185140 Ga0501082_0185140_778_1779 329
688 iso_pu_bacteria 2509276021 2509389978 329
689 iso_pu_bacteria 2509276033 2509447787 329
690 iso_pu_bacteria 2510065019 2510134699 329
691 iso_pu_bacteria 2510461076 2510896050 329
692 iso_pu_bacteria 2510917030 2511200459 329
693 iso_pu_bacteria 2513237084 2513573249 329
694 iso_pu_bacteria 2513237085 2513578500 329
695 iso_pu_bacteria 2513237088 2513599098 329
696 iso_pu_bacteria 2513237093 2513631462 329
697 iso_pu_bacteria 2513237103 2513710605 329
698 iso_pu_bacteria 2513237144 2513908315 329
699 iso_pu_bacteria 2513237146 2513926825 329
700 iso_pu_bacteria 2513237162 2514023412 329
701 iso_pu_bacteria 2515075009 2515113790 329
702 iso_pu_bacteria 2515154113 2515634654 329
703 iso_pu_bacteria 2515154114 2515645302 329
704 iso_pu_bacteria 2515154116 2515660892 329
705 iso_pu_bacteria 2515154134 2515743512 329
706 iso_pu_bacteria 2516653077 2517037401 329
707 iso_pu_bacteria 2517093000 2517096500 329
708 iso_pu_bacteria 2517287029 2517410597 329
709 iso_pu_bacteria 2519899620 2520378007 329
710 iso_pu_bacteria 2529292951 2530646817 329
711 iso_pu_bacteria 2534681796 2535519568 329
712 iso_pu_bacteria 2537561587 2537876440 329
713 iso_pu_bacteria 2554235003 2554245231 329
714 iso_pu_bacteria 2558860242 2559296939 329
715 iso_pu_bacteria 2582581298 2585224935 329
716 iso_pu_bacteria 2582581299 2585227659 329
717 iso_pu_bacteria 2585427528 2585541155 329
718 iso_pu_bacteria 2585427529 2585547491 329
719 iso_pu_bacteria 2585427593 2585839918 329
720 iso_pu_bacteria 2585427633 2585997027 329
721 iso_pu_bacteria 2585427634 2586001628 329
722 iso_pu_bacteria 2599185170 2599420682 329
723 iso_pu_bacteria 2599185210 2599604629 329
724 iso_pu_bacteria 2600254933 2600373763 329
725 iso_pu_bacteria 2615840624 2616295421 329
726 iso_pu_bacteria 2643221599 2644006267 329
727 iso_pu_bacteria 2643221634 2644191523 329
728 iso_pu_bacteria 2643221643 2644241723 329
729 iso_pu_bacteria 2643221653 2644299122 329
730 iso_pu_bacteria 2643221693 2644521181 329
731 iso_pu_bacteria 2643221719 2644657350 329
732 iso_pu_bacteria 2718217882 2719182469 329
733 iso_pu_bacteria 2718217927 2719387128 329
734 iso_pu_bacteria 2718217997 2719666772 329
735 iso_pu_bacteria 2718218009 2719733188 329
736 iso_pu_bacteria 2718218199 2720493192 329
737 iso_pu_bacteria 2718218232 2720614669 329
738 iso_pu_bacteria 2718218233 2720621442 329
739 iso_pu_bacteria 2718218235 2720632770 329
740 iso_pu_bacteria 2718218269 2720776494 329
741 iso_pu_bacteria 2718218363 2721148582 329
742 iso_pu_bacteria 2718218365 2721159968 329
743 iso_pu_bacteria 2718218366 2721165396 329
744 iso_pu_bacteria 2718218423 2721400763 329
745 iso_pu_bacteria 2721755514 2722841566 329
746 iso_pu_bacteria 2721755556 2723028082 329
747 iso_pu_bacteria 2721755684 2723561713 329
748 iso_pu_bacteria 2721755685 2723568342 329
749 iso_pu_bacteria 2721755809 2724039576 329
750 iso_pu_bacteria 2721755810 2724045944 329
751 iso_pu_bacteria 2721755819 2724091101 329
752 iso_pu_bacteria 2721755822 2724105607 329
753 iso_pu_bacteria 2721755823 2724111434 329
754 iso_pu_bacteria 2724679232 2725947686 329
755 iso_pu_bacteria 2728369352 2730109018 329
756 iso_pu_bacteria 2728369365 2730165704 329
757 iso_pu_bacteria 2728369397 2730299600 329
758 iso_pu_bacteria 2738541333 2739035707 329
759 iso_pu_bacteria 2765235942 2766065468 329
760 iso_pu_bacteria 2775507049 2776914440 329
761 iso_pu_bacteria 2791355256 2793293779 329
762 iso_pu_bacteria 2791355259 2793313195 329
763 iso_pu_bacteria 2791355260 2793319856 329
764 iso_pu_bacteria 2791355261 2793328140 329
765 iso_pu_bacteria 2791355262 2793333236 329
766 iso_pu_bacteria 2791355263 2793343817 329
767 iso_pu_bacteria 2791355264 2793347239 329
768 iso_pu_bacteria 2791355265 2793356624 329
769 iso_pu_bacteria 2791355266 2793362917 329
770 iso_pu_bacteria 2791355267 2793370057 329
771 iso_pu_bacteria 2802429605 2805930707 329
772 iso_pu_bacteria 2802429606 2805934180 329
773 iso_pu_bacteria 2802429633 2806044694 329
774 iso_pu_bacteria 2802429634 2806052894 329
775 iso_pu_bacteria 2802429635 2806059194 329
776 iso_pu_bacteria 2802429636 2806068143 329
777 iso_pu_bacteria 2802429637 2806074263 329
778 iso_pu_bacteria 2808606387 2808987455 329
779 iso_pu_bacteria 2818991272 2819243694 329
780 iso_pu_bacteria 2818991439 2819557227 329
781 iso_pu_bacteria 2818991461 2819685548 329
782 iso_pu_bacteria 2821123053 2821126036 329
783 iso_pu_bacteria 2838016132 2838018969 329
784 iso_pu_bacteria 2838022645 2838024431 329
785 iso_pu_bacteria 2838035591 2838040644 329
786 iso_pu_bacteria 2838048938 2838051315 329
787 iso_pu_bacteria 2838061910 2838063707 329
788 iso_pu_bacteria 2838068647 2838074278 329
789 iso_pu_bacteria 2838661181 2838664968 329
790 iso_pu_bacteria 2838680041 2838685097 329
791 iso_pu_bacteria 2838694306 2838699066 329
792 iso_pu_bacteria 2838707686 2838712547 329
793 iso_pu_bacteria 2841859092 2841861712 329
794 iso_pu_bacteria 2841864319 2841868319 329
795 iso_pu_bacteria 2842077413 2842082024 329
796 iso_pu_bacteria 2842110456 2842113583 329
797 iso_pu_bacteria 2842118031 2842122946 329
798 iso_pu_bacteria 2842198810 2842199974 329
799 iso_pu_bacteria 2842205361 2842208166 329
800 iso_pu_bacteria 2842237096 2842242151 329
801 iso_pu_bacteria 2842264693 2842266475 329
802 iso_pu_bacteria 2842278818 2842281825 329
803 iso_pu_bacteria 2842291075 2842296024 329
804 iso_pu_bacteria 2842311132 2842316168 329
805 iso_pu_bacteria 2842341865 2842344859 329
806 iso_pu_bacteria 2842370503 2842377164 329
807 iso_pu_bacteria 2842377471 2842382423 329
808 iso_pu_bacteria 2842384541 2842389824 329
809 iso_pu_bacteria 2842395702 2842398666 329
810 iso_pu_bacteria 2842422224 2842427902 329
811 iso_pu_bacteria 2842428310 2842429794 329
812 iso_pu_bacteria 2842434925 2842436546 329
813 iso_pu_bacteria 2842441272 2842444249 329
814 iso_pu_bacteria 2842447887 2842450890 329
815 iso_pu_bacteria 2842462802 2842464215 329
816 iso_pu_bacteria 2842469257 2842470875 329
817 iso_pu_bacteria 2842515876 2842518022 329
818 iso_pu_bacteria 2857516855 2857519050 329
819 iso_pu_bacteria 2857531043 2857532598 329
820 iso_pu_bacteria 2899792073 2899792800 329
821 iso_pu_bacteria 2899803654 2899806550 329
822 iso_pu_bacteria 2899845264 2899845463 329
823 iso_pu_bacteria 2919100787 2919104413 329
824 iso_pu_bacteria 2919171160 2919173273 329
825 iso_pu_bacteria 2926760298 2926763902 329
826 iso_pu_bacteria 2933011516 2933013651 329
827 iso_pu_bacteria 2933016740 2933023328 329
828 iso_pu_bacteria 2933586486 2933589127 329
829 iso_pu_bacteria 2935894831 2935899872 329
830 iso_pu_bacteria 2936367885 2936375011 329
831 iso_pu_bacteria 2936375103 2936380702 329
832 iso_pu_bacteria 2936381700 2936382128 329
833 iso_pu_bacteria 2979089926 2979091000 329
834 iso_pu_bacteria 2979095461 2979096526 329
835 iso_pu_bacteria 2979100975 2979102259 329
836 iso_pu_bacteria 2984509177 2984509793 329
837 iso_pu_bacteria 2984518228 2984519510 329
838 iso_pu_bacteria 2984537506 2984538131 329
839 iso_pu_bacteria 2984601300 2984604883 329
840 iso_pu_bacteria 2989776772 2989779694 329
841 iso_pu_bacteria 2996893221 2996895903 329
842 iso_pu_bacteria 3005445848 3005449130 329
843 iso_pu_bacteria 3005452660 3005455411 329
844 iso_pu_bacteria 639633055 639649864 329
845 iso_pu_bacteria 650716007 650843360 329
846 iso_pu_bacteria 8005246636 8005249689 329
847 iso_pu_bacteria 8005275841 8005281855 329
848 iso_pu_bacteria 8005282627 8005288849 329
849 iso_pu_bacteria 8005289223 8005294432 329
850 iso_pu_bacteria 8005301065 8005306815 329
851 iso_pu_bacteria 8005376324 8005378334 329
852 iso_pu_bacteria 8005382845 8005383979 329
853 iso_pu_bacteria 8005395548 8005401306 329
854 iso_pu_bacteria 8005430974 8005434261 329
855 iso_pu_bacteria 8005497431 8005501520 329
856 iso_pu_bacteria 8005542996 8005547266 329
857 iso_pu_bacteria 8005570704 8005575080 329
858 iso_pu_bacteria 8005619151 8005622881 329
859 iso_pu_bacteria 8005668836 8005672941 329
860 iso_pu_bacteria 8005688590 8005693488 329
861 iso_pu_bacteria 8005695170 8005700709 329
862 iso_pu_bacteria 8018127388 8018133752 329
863 iso_pu_bacteria 8018150411 8018153301 329
864 iso_pu_bacteria 8018176218 8018178599 329
865 iso_pu_bacteria 8024479707 8024481641 329
866 iso_pu_bacteria 8024486573 8024487871 329
867 iso_pu_bacteria 8046767195 8046772038 329
868 iso_pu_bacteria 8056375014 8056381445 329
869 iso_pu_bacteria 8056382006 8056386888 329
870 3300005434 Ga0070709_10035983 Ga0070709_100359832 330
871 3300005434 Ga0070709_10109793 Ga0070709_101097932 330
872 3300005435 Ga0070714_100034690 Ga0070714_1000346902 330
873 3300005436 Ga0070713_100019647 Ga0070713_1000196473 330
874 3300005530 Ga0070679_100034303 Ga0070679_1000343033 330
875 3300005842 Ga0068858_100268723 Ga0068858_1002687231 330
876 3300009176 Ga0105242_10451008 Ga0105242_104510081 330
877 3300009545 Ga0105237_10004792 Ga0105237_1000479214 330
878 3300014326 Ga0157380_10106070 Ga0157380_101060702 330
879 3300025906 Ga0207699_10019657 Ga0207699_100196573 330
880 3300025906 Ga0207699_10097873 Ga0207699_100978732 330
881 3300025914 Ga0207671_10011955 Ga0207671_100119555 330
882 3300025914 Ga0207671_10171881 Ga0207671_101718812 330
883 3300025921 Ga0207652_10023709 Ga0207652_100237093 330
884 3300025928 Ga0207700_10005150 Ga0207700_100051504 330
885 3300025929 Ga0207664_10145881 Ga0207664_101458811 330
886 3300028563 Ga0265319_1000349 Ga0265319_10003496 330
887 3300028794 Ga0307515_10001447 Ga0307515_100014478 330
888 3300031240 Ga0265320_10008784 Ga0265320_100087845 330
889 3300031250 Ga0265331_10102430 Ga0265331_101024301 330
890 3300031251 Ga0265327_10111898 Ga0265327_101118982 330
891 3300031456 Ga0307513_10029600 Ga0307513_100296002 330
892 3300031649 Ga0307514_10001548 Ga0307514_1000154816 330
893 3300033179 Ga0307507_10023456 Ga0307507_100234563 330
894 3300033179 Ga0307507_10121353 Ga0307507_101213532 330
895 3300038443 Ga0395901_0097650 Ga0395901_0097650_751_1746 330
896 3300046530 Ga0495654_0000834 Ga0495654_0000834_16165_17172 330
897 3300046539 Ga0495621_0043681 Ga0495621_0043681_48_1049 330
898 3300048908 Ga0496105_0075935 Ga0496105_0075935_807_1922 330
899 3300048924 Ga0496121_0245275 Ga0496121_0245275_117_1145 330
900 3300049571 Ga0501034_0185791 Ga0501034_0185791_867_1868 330
901 3300049822 Ga0501035_0105050 Ga0501035_0105050_1405_2397 330
902 3300053139 Ga0500568_0015213 Ga0500568_0015213_1752_2807 330
903 iso_pu_bacteria 2929206907 2929212133 330
904 3300002773 JGI25152J39213_1014814 JGI25152J39213_10148142 331
905 3300002774 JGI25150J39212_1000144 JGI25150J39212_100014439 331
906 3300003187 JGI25151J46595_10000031 JGI25151J46595_1000003117 331
907 3300005336 Ga0070680_100116211 Ga0070680_1001162112 331
908 3300005436 Ga0070713_100002078 Ga0070713_1000020785 331
909 3300005439 Ga0070711_100168028 Ga0070711_1001680281 331
910 3300005457 Ga0070662_100015877 Ga0070662_1000158772 331
911 3300005548 Ga0070665_100080487 Ga0070665_1000804872 331
912 3300005563 Ga0068855_100067798 Ga0068855_1000677984 331
913 3300005564 Ga0070664_100024731 Ga0070664_1000247313 331
914 3300005578 Ga0068854_100160848 Ga0068854_1001608482 331
915 3300006028 Ga0070717_10051681 Ga0070717_100516812 331
916 3300006175 Ga0070712_100006701 Ga0070712_1000067017 331
917 3300009765 Ga0123341_1000014 Ga0123341_100001428 331
918 3300013307 Ga0157372_10045183 Ga0157372_100451833 331
919 3300014497 Ga0182008_10010338 Ga0182008_100103386 331
920 3300015262 Ga0182007_10003916 Ga0182007_100039164 331
921 3300025245 Ga0207425_1000058 Ga0207425_100005862 331
922 3300025258 Ga0209129_1000107 Ga0209129_100010762 331
923 3300025294 Ga0209025_1000083 Ga0209025_100008362 331
924 3300025297 Ga0209758_1000090 Ga0209758_1000090201 331
925 3300025297 Ga0209758_1000839 Ga0209758_100083930 331
926 3300025299 Ga0209256_1028614 Ga0209256_10286142 331
927 3300025915 Ga0207693_10020804 Ga0207693_100208041 331
928 3300025920 Ga0207649_10029373 Ga0207649_100293733 331
929 3300025921 Ga0207652_10325159 Ga0207652_103251592 331
930 3300025928 Ga0207700_10001779 Ga0207700_100017793 331
931 3300025933 Ga0207706_10023167 Ga0207706_100231672 331
932 3300026041 Ga0207639_10100476 Ga0207639_101004762 331
933 3300026116 Ga0207674_10099047 Ga0207674_100990473 331
934 3300028379 Ga0268266_10092961 Ga0268266_100929612 331
935 3300031731 Ga0307405_10005651 Ga0307405_100056513 331
936 3300031911 Ga0307412_10001366 Ga0307412_1000136617 331
937 3300031911 Ga0307412_10090045 Ga0307412_100900452 331
938 3300032005 Ga0307411_10360205 Ga0307411_103602051 331
939 3300037471 Ga0395905_0005488 Ga0395905_0005488_9948_10952 331
940 3300046512 Ga0495610_0000961 Ga0495610_0000961_23964_24959 331
941 3300046512 Ga0495610_0091024 Ga0495610_0091024_103_1098 331
942 3300046519 Ga0495632_0008503 Ga0495632_0008503_1859_2854 331
943 3300046519 Ga0495632_0041601 Ga0495632_0041601_1275_2270 331
944 3300046530 Ga0495654_0000635 Ga0495654_0000635_14765_15760 331
945 3300046692 Ga0495671_0094705 Ga0495671_0094705_15_1010 331
946 3300047472 Ga0495686_0054266 Ga0495686_0054266_1119_2114 331
947 3300048903 Ga0496100_0017092 Ga0496100_0017092_2856_3884 331
948 3300048904 Ga0496101_0002273 Ga0496101_0002273_9126_10154 331
949 3300048905 Ga0496102_0012098 Ga0496102_0012098_5983_7011 331
950 3300048906 Ga0496103_0021085 Ga0496103_0021085_2347_3375 331
951 3300048908 Ga0496105_0002064 Ga0496105_0002064_4285_5313 331
952 3300048909 Ga0496106_0029059 Ga0496106_0029059_507_1535 331
953 3300048919 Ga0496116_0005016 Ga0496116_0005016_10205_11200 331
954 3300048919 Ga0496116_0019875 Ga0496116_0019875_2552_3547 331
955 3300048919 Ga0496116_0021816 Ga0496116_0021816_2959_3954 331
956 3300048920 Ga0496117_0012513 Ga0496117_0012513_1155_2150 331
957 3300048920 Ga0496117_0014590 Ga0496117_0014590_1222_2217 331
958 3300048921 Ga0496118_0015866 Ga0496118_0015866_2628_3623 331
959 3300048921 Ga0496118_0146709 Ga0496118_0146709_253_1248 331
960 3300048924 Ga0496121_0002950 Ga0496121_0002950_22594_23589 331
961 3300048924 Ga0496121_0004490 Ga0496121_0004490_16386_17381 331
962 3300048925 Ga0496122_0003537 Ga0496122_0003537_1954_2949 331
963 3300048925 Ga0496122_0014660 Ga0496122_0014660_1238_2233 331
964 3300048925 Ga0496122_0097767 Ga0496122_0097767_909_1904 331
965 3300048925 Ga0496122_0108059 Ga0496122_0108059_693_1688 331
966 3300048925 Ga0496122_0111801 Ga0496122_0111801_401_1396 331
967 3300048926 Ga0496123_0014925 Ga0496123_0014925_4681_5676 331
968 3300048926 Ga0496123_0020288 Ga0496123_0020288_1254_2249 331
969 3300048927 Ga0496124_0005584 Ga0496124_0005584_11218_12213 331
970 3300048927 Ga0496124_0021455 Ga0496124_0021455_4882_5877 331
971 3300048927 Ga0496124_0022392 Ga0496124_0022392_2548_3543 331
972 3300048927 Ga0496124_0104468 Ga0496124_0104468_1049_2044 331
973 3300048928 Ga0496125_0034692 Ga0496125_0034692_1596_2591 331
974 3300048928 Ga0496125_0100689 Ga0496125_0100689_440_1435 331
975 3300053117 Ga0500593_000006 Ga0500593_000006_85874_86965 331
976 3300053125 Ga0500618_000337 Ga0500618_000337_13812_14807 331
977 3300053125 Ga0500618_005905 Ga0500618_005905_840_1835 331
978 3300053153 Ga0500616_0000677 Ga0500616_0000677_18668_19669 331
979 3300059421 Ga0590071_011978 Ga0590071_011978_394_1413 331
980 iso_pu_bacteria 8005658619 8005658673 331
981 3300001979 JGI24740J21852_10003345 JGI24740J21852_100033457 332
982 3300002704 JGI25155J39150_1000007 JGI25155J39150_1000007134 332
983 3300002705 JGI25156J39149_1000066 JGI25156J39149_100006631 332
984 3300002737 JGI25162J39368_1000488 JGI25162J39368_100048823 332
985 3300002737 JGI25162J39368_1001297 JGI25162J39368_100129714 332
986 3300002738 JGI25154J39366_1000035 JGI25154J39366_100003549 332
987 3300002741 JGI25157J39369_1000036 JGI25157J39369_100003633 332
988 3300002987 JGI25159J45721_1000463 JGI25159J45721_100046321 332
989 3300003214 JGI25165J46597_1000676 JGI25165J46597_100067613 332
990 3300003214 JGI25165J46597_1001184 JGI25165J46597_100118410 332
991 3300003354 JGI25160J50197_1000100 JGI25160J50197_100010042 332
992 3300003374 JGI25161J50226_1000072 JGI25161J50226_100007249 332
993 3300003752 Ga0055539_1002732 Ga0055539_10027324 332
994 3300004625 Ga0055543_1000078 Ga0055543_100007849 332
995 3300005262 Ga0065165_1000623 Ga0065165_100062326 332
996 3300005548 Ga0070665_100055026 Ga0070665_1000550267 332
997 3300006038 Ga0075365_10001634 Ga0075365_100016343 332
998 3300006195 Ga0075366_10041272 Ga0075366_100412722 332
999 3300006353 Ga0075370_10027065 Ga0075370_100270651 332
1000 3300006946 Ga0079104_1000015 Ga0079104_1000015292 332
1001 3300009093 Ga0105240_10000019 Ga0105240_10000019317 332
1002 3300009177 Ga0105248_10194685 Ga0105248_101946853 332
1003 3300009545 Ga0105237_10000734 Ga0105237_1000073434 332
1004 3300010375 Ga0105239_10000574 Ga0105239_1000057434 332
1005 3300013104 Ga0157370_10000131 Ga0157370_1000013177 332
1006 3300014325 Ga0163163_10169354 Ga0163163_101693542 332
1007 3300014497 Ga0182008_10017006 Ga0182008_100170065 332
1008 3300015262 Ga0182007_10035634 Ga0182007_100356343 332
1009 3300015265 Ga0182005_1003936 Ga0182005_10039363 332
1010 3300025206 Ga0209435_100005 Ga0209435_100005286 332
1011 3300025207 Ga0209760_101522 Ga0209760_1015222 332
1012 3300025233 Ga0209437_100058 Ga0209437_100058292 332
1013 3300025233 Ga0209437_100313 Ga0209437_10031341 332
1014 3300025233 Ga0209437_104360 Ga0209437_1043603 332
1015 3300025246 Ga0209646_1000011 Ga0209646_1000011286 332
1016 3300025250 Ga0209026_1000008 Ga0209026_1000008286 332
1017 3300025253 Ga0209677_100475 Ga0209677_1004755 332
1018 3300025256 Ga0209759_1000004 Ga0209759_1000004286 332
1019 3300025261 Ga0209233_1000157 Ga0209233_1000157133 332
1020 3300025261 Ga0209233_1000354 Ga0209233_100035432 332
1021 3300025261 Ga0209233_1000380 Ga0209233_100038010 332
1022 3300025284 Ga0209130_1000083 Ga0209130_100008340 332
1023 3300025297 Ga0209758_1015048 Ga0209758_10150483 332
1024 3300025302 Ga0207426_1000173 Ga0207426_100017340 332
1025 3300025913 Ga0207695_10000049 Ga0207695_10000049320 332
1026 3300025914 Ga0207671_10000423 Ga0207671_1000042317 332
1027 3300025941 Ga0207711_10123572 Ga0207711_101235722 332
1028 3300027111 Ga0209281_1000068 Ga0209281_100006898 332
1029 3300027312 Ga0209371_1005272 Ga0209371_10052723 332
1030 3300028379 Ga0268266_10000103 Ga0268266_10000103145 332
1031 3300028379 Ga0268266_10068412 Ga0268266_100684122 332
1032 3300030500 Ga0268256_1002352 Ga0268256_10023527 332
1033 3300031824 Ga0307413_10046628 Ga0307413_100466282 332
1034 3300031852 Ga0307410_10294034 Ga0307410_102940341 332
1035 3300032002 Ga0307416_100122995 Ga0307416_1001229954 332
1036 3300035088 Ga0373940_0017126 Ga0373940_0017126_71_1252 332
1037 3300037471 Ga0395905_0000741 Ga0395905_0000741_5301_6314 332
1038 3300037471 Ga0395905_0023045 Ga0395905_0023045_4135_5133 332
1039 3300046507 Ga0495606_0124361 Ga0495606_0124361_246_1244 332
1040 3300048907 Ga0496104_0107663 Ga0496104_0107663_985_2148 332
1041 3300048908 Ga0496105_0375101 Ga0496105_0375101_70_1068 332
1042 3300048911 Ga0496108_0031554 Ga0496108_0031554_1957_3120 332
1043 3300048912 Ga0496109_0031417 Ga0496109_0031417_192_1355 332
1044 3300048913 Ga0496110_0025530 Ga0496110_0025530_2970_4133 332
1045 3300048915 Ga0496112_0042517 Ga0496112_0042517_1566_2729 332
1046 3300048920 Ga0496117_0000926 Ga0496117_0000926_24829_25827 332
1047 3300048921 Ga0496118_0001977 Ga0496118_0001977_7671_8669 332
1048 3300048922 Ga0496119_0028246 Ga0496119_0028246_2334_3332 332
1049 3300048925 Ga0496122_0015740 Ga0496122_0015740_2813_3811 332
1050 3300048926 Ga0496123_0035113 Ga0496123_0035113_736_1734 332
1051 3300048927 Ga0496124_0042429 Ga0496124_0042429_2062_3060 332
1052 3300049823 Ga0501044_0291298 Ga0501044_0291298_87_1085 332
1053 3300050492 nmdc:mga0yw44_959_c1 nmdc:mga0yw44_959_c1_8770_9777 332
1054 3300053136 Ga0500559_0002424 Ga0500559_0002424_670_1668 332
1055 3300061719 Ga0466962_0135295 Ga0466962_0135295_101_1099 332
1056 iso_pu_bacteria 2506783011 2506865889 332
1057 iso_pu_bacteria 2773857933 2774905340 332
1058 3300002773 JGI25152J39213_1004590 JGI25152J39213_10045903 333
1059 3300002987 JGI25159J45721_1001920 JGI25159J45721_10019205 333
1060 3300003187 JGI25151J46595_10001277 JGI25151J46595_1000127711 333
1061 3300003215 JGI25153J46596_10004998 JGI25153J46596_100049982 333
1062 3300003354 JGI25160J50197_1001130 JGI25160J50197_100113011 333
1063 3300003374 JGI25161J50226_1000104 JGI25161J50226_100010465 333
1064 3300003374 JGI25161J50226_1000396 JGI25161J50226_100039615 333
1065 3300003771 Ga0055526_1001414 Ga0055526_10014145 333
1066 3300003771 Ga0055526_1012623 Ga0055526_10126231 333
1067 3300003771 Ga0055526_1023211 Ga0055526_10232112 333
1068 3300003771 Ga0055526_1024203 Ga0055526_10242032 333
1069 3300003775 Ga0055524_1008292 Ga0055524_10082924 333
1070 3300003775 Ga0055524_1015401 Ga0055524_10154012 333
1071 3300003781 Ga0055536_1005370 Ga0055536_10053702 333
1072 3300003790 Ga0055528_1000695 Ga0055528_10006955 333
1073 3300003790 Ga0055528_1001150 Ga0055528_10011508 333
1074 3300003790 Ga0055528_1008246 Ga0055528_10082462 333
1075 3300003790 Ga0055528_1011300 Ga0055528_10113002 333
1076 3300003791 Ga0055530_10022910 Ga0055530_100229101 333
1077 3300003792 Ga0055540_1000752 Ga0055540_10007522 333
1078 3300003792 Ga0055540_1004512 Ga0055540_10045127 333
1079 3300003792 Ga0055540_1007583 Ga0055540_10075832 333
1080 3300003792 Ga0055540_1012146 Ga0055540_10121462 333
1081 3300003794 Ga0055531_10003943 Ga0055531_1000394311 333
1082 3300003856 Ga0058692_1002399 Ga0058692_10023995 333
1083 3300004625 Ga0055543_1000280 Ga0055543_100028011 333
1084 3300005262 Ga0065165_1002557 Ga0065165_10025577 333
1085 3300005262 Ga0065165_1026404 Ga0065165_10264042 333
1086 3300005327 Ga0070658_10000253 Ga0070658_1000025316 333
1087 3300005353 Ga0070669_100211508 Ga0070669_1002115082 333
1088 3300005353 Ga0070669_100212799 Ga0070669_1002127991 333
1089 3300005548 Ga0070665_100018720 Ga0070665_1000187207 333
1090 3300005548 Ga0070665_100288661 Ga0070665_1002886611 333
1091 3300005548 Ga0070665_100360853 Ga0070665_1003608531 333
1092 3300006038 Ga0075365_10019376 Ga0075365_100193762 333
1093 3300006042 Ga0075368_10044867 Ga0075368_100448671 333
1094 3300006048 Ga0075363_100000517 Ga0075363_10000051710 333
1095 3300006048 Ga0075363_100141446 Ga0075363_1001414462 333
1096 3300006177 Ga0075362_10006339 Ga0075362_100063392 333
1097 3300006177 Ga0075362_10049176 Ga0075362_100491762 333
1098 3300006178 Ga0075367_10000817 Ga0075367_100008175 333
1099 3300006178 Ga0075367_10001171 Ga0075367_100011713 333
1100 3300006186 Ga0075369_10013607 Ga0075369_100136072 333
1101 3300006186 Ga0075369_10021040 Ga0075369_100210401 333
1102 3300006195 Ga0075366_10003864 Ga0075366_100038644 333
1103 3300006195 Ga0075366_10014213 Ga0075366_100142132 333
1104 3300006353 Ga0075370_10007174 Ga0075370_100071745 333
1105 3300006353 Ga0075370_10075881 Ga0075370_100758811 333
1106 3300009148 Ga0105243_10009086 Ga0105243_100090863 333
1107 3300011119 Ga0105246_10063299 Ga0105246_100632992 333
1108 3300013100 Ga0157373_10175927 Ga0157373_101759272 333
1109 3300013102 Ga0157371_10000002 Ga0157371_10000002108 333
1110 3300013104 Ga0157370_10000246 Ga0157370_1000024660 333
1111 3300025208 Ga0209436_100023 Ga0209436_10002388 333
1112 3300025208 Ga0209436_100027 Ga0209436_10002730 333
1113 3300025245 Ga0207425_1001260 Ga0207425_10012602 333
1114 3300025258 Ga0209129_1000080 Ga0209129_100008010 333
1115 3300025258 Ga0209129_1000605 Ga0209129_10006054 333
1116 3300025258 Ga0209129_1000714 Ga0209129_100071413 333
1117 3300025258 Ga0209129_1006349 Ga0209129_10063492 333
1118 3300025273 Ga0209673_1000060 Ga0209673_100006072 333
1119 3300025273 Ga0209673_1000233 Ga0209673_100023340 333
1120 3300025273 Ga0209673_1000781 Ga0209673_100078133 333
1121 3300025273 Ga0209673_1001374 Ga0209673_100137421 333
1122 3300025273 Ga0209673_1005142 Ga0209673_10051427 333
1123 3300025284 Ga0209130_1000173 Ga0209130_100017384 333
1124 3300025294 Ga0209025_1000255 Ga0209025_100025539 333
1125 3300025294 Ga0209025_1000350 Ga0209025_100035053 333
1126 3300025294 Ga0209025_1000749 Ga0209025_100074946 333
1127 3300025294 Ga0209025_1009200 Ga0209025_10092008 333
1128 3300025294 Ga0209025_1010819 Ga0209025_10108196 333
1129 3300025294 Ga0209025_1041452 Ga0209025_10414522 333
1130 3300025295 Ga0209564_1000116 Ga0209564_100011672 333
1131 3300025295 Ga0209564_1000125 Ga0209564_1000125126 333
1132 3300025295 Ga0209564_1001273 Ga0209564_100127321 333
1133 3300025295 Ga0209564_1011141 Ga0209564_10111413 333
1134 3300025297 Ga0209758_1000928 Ga0209758_10009283 333
1135 3300025297 Ga0209758_1001034 Ga0209758_100103434 333
1136 3300025297 Ga0209758_1001969 Ga0209758_100196911 333
1137 3300025297 Ga0209758_1003215 Ga0209758_100321510 333
1138 3300025297 Ga0209758_1015938 Ga0209758_10159382 333
1139 3300025297 Ga0209758_1037329 Ga0209758_10373292 333
1140 3300025298 Ga0209050_1003361 Ga0209050_100336112 333
1141 3300025298 Ga0209050_1005007 Ga0209050_10050072 333
1142 3300025299 Ga0209256_1000302 Ga0209256_100030230 333
1143 3300025299 Ga0209256_1001684 Ga0209256_100168410 333
1144 3300025299 Ga0209256_1001904 Ga0209256_100190416 333
1145 3300025299 Ga0209256_1006695 Ga0209256_10066952 333
1146 3300025302 Ga0207426_1000047 Ga0207426_100004784 333
1147 3300025302 Ga0207426_1000276 Ga0207426_100027637 333
1148 3300025303 Ga0209051_1000217 Ga0209051_100021770 333
1149 3300025303 Ga0209051_1001815 Ga0209051_10018152 333
1150 3300025303 Ga0209051_1003071 Ga0209051_10030714 333
1151 3300025303 Ga0209051_1017149 Ga0209051_10171492 333
1152 3300025304 Ga0209257_1002359 Ga0209257_10023598 333
1153 3300025304 Ga0209257_1003258 Ga0209257_100325812 333
1154 3300025919 Ga0207657_10094172 Ga0207657_100941721 333
1155 3300027312 Ga0209371_1000003 Ga0209371_1000003756 333
1156 3300027312 Ga0209371_1001970 Ga0209371_10019708 333
1157 3300027866 Ga0209813_10002642 Ga0209813_100026424 333
1158 3300028379 Ga0268266_10018839 Ga0268266_100188394 333
1159 3300028379 Ga0268266_10215456 Ga0268266_102154561 333
1160 3300028794 Ga0307515_10000386 Ga0307515_1000038663 333
1161 3300028794 Ga0307515_10086697 Ga0307515_100866972 333
1162 3300030500 Ga0268256_1000004 Ga0268256_1000004294 333
1163 3300030500 Ga0268256_1001045 Ga0268256_10010457 333
1164 3300031456 Ga0307513_10022270 Ga0307513_100222703 333
1165 3300031649 Ga0307514_10089318 Ga0307514_100893182 333
1166 3300041413 Ga0439465_0010269 Ga0439465_0010269_1313_2314 333
1167 3300041413 Ga0439465_0010635 Ga0439465_0010635_1193_2194 333
1168 3300041413 Ga0439465_0039107 Ga0439465_0039107_40_1041 333
1169 3300041492 Ga0451835_0532047 Ga0451835_0532047_22_1023 333
1170 3300041497 Ga0451840_01892 Ga0451840_01892_169_1170 333
1171 3300041502 Ga0451846_65077 Ga0451846_65077_388_1389 333
1172 3300041510 Ga0451854_08073 Ga0451854_08073_534_1535 333
1173 3300041907 Ga0452268_51778 Ga0452268_51778_243_1244 333
1174 3300044672 Ga0466982_0210788 Ga0466982_0210788_81_1082 333
1175 3300046452 Ga0495617_026952 Ga0495617_026952_537_1538 333
1176 3300046460 Ga0495638_0000309 Ga0495638_0000309_16753_17754 333
1177 3300046462 Ga0495651_0140125 Ga0495651_0140125_395_1396 333
1178 3300046474 Ga0495605_0008993 Ga0495605_0008993_4218_5219 333
1179 3300046492 Ga0495585_0044724 Ga0495585_0044724_1000_2001 333
1180 3300046501 Ga0495607_0022992 Ga0495607_0022992_2443_3444 333
1181 3300046501 Ga0495607_0031078 Ga0495607_0031078_1944_2951 333
1182 3300046506 Ga0495583_0003999 Ga0495583_0003999_1919_2920 333
1183 3300046507 Ga0495606_0003931 Ga0495606_0003931_7521_8522 333
1184 3300046507 Ga0495606_0107991 Ga0495606_0107991_561_1562 333
1185 3300046507 Ga0495606_0136980 Ga0495606_0136980_356_1357 333
1186 3300046507 Ga0495606_0180825 Ga0495606_0180825_14_1015 333
1187 3300046512 Ga0495610_0033175 Ga0495610_0033175_529_1530 333
1188 3300046518 Ga0495631_0000183 Ga0495631_0000183_41305_42306 333
1189 3300046522 Ga0495643_0074717 Ga0495643_0074717_597_1598 333
1190 3300046522 Ga0495643_0140273 Ga0495643_0140273_17_1018 333
1191 3300046524 Ga0495648_0121545 Ga0495648_0121545_321_1322 333
1192 3300046530 Ga0495654_0091582 Ga0495654_0091582_273_1274 333
1193 3300046538 Ga0495609_0005705 Ga0495609_0005705_1146_2147 333
1194 3300046558 Ga0495633_0048332 Ga0495633_0048332_725_1726 333
1195 3300046616 Ga0495668_0004368 Ga0495668_0004368_6898_7899 333
1196 3300046648 Ga0495611_0005329 Ga0495611_0005329_410_1411 333
1197 3300046660 Ga0495625_0000737 Ga0495625_0000737_461_1462 333
1198 3300046660 Ga0495625_0072202 Ga0495625_0072202_124_1125 333
1199 3300046675 Ga0495657_0017333 Ga0495657_0017333_284_1285 333
1200 3300046691 Ga0495670_0045289 Ga0495670_0045289_1184_2185 333
1201 3300047320 Ga0495672_0047015 Ga0495672_0047015_1160_2161 333
1202 3300047470 Ga0495681_0008827 Ga0495681_0008827_4081_5082 333
1203 3300047470 Ga0495681_0057144 Ga0495681_0057144_425_1426 333
1204 3300047472 Ga0495686_0008302 Ga0495686_0008302_6129_7130 333
1205 3300047472 Ga0495686_0069440 Ga0495686_0069440_191_1192 333
1206 3300047472 Ga0495686_0135797 Ga0495686_0135797_376_1377 333
1207 3300048909 Ga0496106_0000760 Ga0496106_0000760_21873_22874 333
1208 3300048915 Ga0496112_0532469 Ga0496112_0532469_33_1034 333
1209 3300048916 Ga0496113_0065709 Ga0496113_0065709_689_1690 333
1210 3300048919 Ga0496116_0032549 Ga0496116_0032549_297_1298 333
1211 3300048920 Ga0496117_0000052 Ga0496117_0000052_40529_41530 333
1212 3300048921 Ga0496118_0000792 Ga0496118_0000792_9103_10104 333
1213 3300048921 Ga0496118_0078765 Ga0496118_0078765_283_1284 333
1214 3300048923 Ga0496120_0000019 Ga0496120_0000019_40529_41530 333
1215 3300048924 Ga0496121_0007187 Ga0496121_0007187_10141_11142 333
1216 3300048924 Ga0496121_0016496 Ga0496121_0016496_6563_7564 333
1217 3300048924 Ga0496121_0022327 Ga0496121_0022327_5110_6117 333
1218 3300048924 Ga0496121_0042776 Ga0496121_0042776_303_1304 333
1219 3300048924 Ga0496121_0064361 Ga0496121_0064361_729_1730 333
1220 3300048924 Ga0496121_0071722 Ga0496121_0071722_1041_2042 333
1221 3300048924 Ga0496121_0074626 Ga0496121_0074626_1119_2126 333
1222 3300048925 Ga0496122_0000042 Ga0496122_0000042_56778_57779 333
1223 3300048925 Ga0496122_0000053 Ga0496122_0000053_40529_41530 333
1224 3300048925 Ga0496122_0101472 Ga0496122_0101472_488_1489 333
1225 3300048926 Ga0496123_0000030 Ga0496123_0000030_233981_234982 333
1226 3300048926 Ga0496123_0000038 Ga0496123_0000038_40529_41530 333
1227 3300048926 Ga0496123_0097916 Ga0496123_0097916_334_1335 333
1228 3300048927 Ga0496124_0000139 Ga0496124_0000139_46470_47471 333
1229 3300048927 Ga0496124_0063069 Ga0496124_0063069_509_1513 333
1230 3300048927 Ga0496124_0182178 Ga0496124_0182178_178_1179 333
1231 3300048927 Ga0496124_0182364 Ga0496124_0182364_474_1481 333
1232 3300048928 Ga0496125_0079083 Ga0496125_0079083_1266_2267 333
1233 3300048928 Ga0496125_0135504 Ga0496125_0135504_20_1021 333
1234 3300048929 Ga0496126_0067226 Ga0496126_0067226_1211_2212 333
1235 3300049459 Ga0495678_055692 Ga0495678_055692_86_1087 333
1236 3300049573 Ga0501037_0078992 Ga0501037_0078992_55_1056 333
1237 3300049574 Ga0501038_0105139 Ga0501038_0105139_397_1398 333
1238 3300049579 Ga0501043_0161920 Ga0501043_0161920_97_1098 333
1239 3300049581 Ga0501047_0205619 Ga0501047_0205619_359_1360 333
1240 3300049583 Ga0501067_0139287 Ga0501067_0139287_20_1021 333
1241 3300049742 Ga0501080_0132140 Ga0501080_0132140_72_1073 333
1242 3300049776 Ga0501280_003283 Ga0501280_003283_1264_2265 333
1243 3300049823 Ga0501044_0413739 Ga0501044_0413739_126_1127 333
1244 3300050489 nmdc:mga03683_7456_c1 nmdc:mga03683_7456_c1_515_1516 333
1245 3300050490 nmdc:mga03n38_985_c1 nmdc:mga03n38_985_c1_2458_3459 333
1246 3300050491 nmdc:mga00v17_55_c1 nmdc:mga00v17_55_c1_60270_61271 333
1247 3300050493 nmdc:mga0k408_2026_c1 nmdc:mga0k408_2026_c1_4670_5671 333
1248 3300050494 nmdc:mga06z11_80023_c1 nmdc:mga06z11_80023_c1_500_1501 333
1249 3300050516 nmdc:mga0sz30_32_c1 nmdc:mga0sz30_32_c1_31562_32563 333
1250 3300053105 Ga0500557_011818 Ga0500557_011818_495_1496 333
1251 3300053125 Ga0500618_000717 Ga0500618_000717_8869_9876 333
1252 3300053125 Ga0500618_009856 Ga0500618_009856_338_1345 333
1253 3300053134 Ga0500658_0012637 Ga0500658_0012637_518_1519 333
1254 3300053137 Ga0500561_0001332 Ga0500561_0001332_44_1045 333
1255 3300053139 Ga0500568_0001296 Ga0500568_0001296_454_1455 333
1256 3300053139 Ga0500568_0023471 Ga0500568_0023471_1132_2133 333
1257 3300053148 Ga0500590_033078 Ga0500590_033078_1208_2224 333
1258 3300053151 Ga0500604_0004488 Ga0500604_0004488_496_1497 333
1259 3300053153 Ga0500616_0000980 Ga0500616_0000980_11958_12959 333
1260 3300053156 Ga0500622_0000780 Ga0500622_0000780_10855_11856 333
1261 3300053156 Ga0500622_0027811 Ga0500622_0027811_1280_2281 333
1262 3300053177 Ga0500636_0000245 Ga0500636_0000245_6710_7711 333
1263 3300060353 Ga0501082_0253340 Ga0501082_0253340_59_1060 333
1264 iso_pu_bacteria 2563366752 2563930621 333
1265 3300003322 rootL2_10026958 rootL2_1002695812 334
1266 3300044656 Ga0466969_0000373 Ga0466969_0000373_21389_22411 334
1267 3300046457 Ga0495590_0045296 Ga0495590_0045296_452_1498 334
1268 iso_pu_bacteria 2615840698 2616554808 334
1269 iso_pu_bacteria 2818991448 2819609734 334
1270 iso_pu_bacteria 8005484373 8005488629 334
1271 iso_pu_bacteria 8005645114 8005649096 334
1272 3300005617 Ga0068859_100000421 Ga0068859_10000042113 335
1273 3300005844 Ga0068862_100000433 Ga0068862_10000043329 335
1274 3300006931 Ga0097620_100000421 Ga0097620_10000042113 335
1275 3300013100 Ga0157373_10109717 Ga0157373_101097172 335
1276 3300013104 Ga0157370_10036865 Ga0157370_100368654 335
1277 3300025941 Ga0207711_10000049 Ga0207711_1000004944 335
1278 3300025961 Ga0207712_10010624 Ga0207712_100106244 335
1279 3300028380 Ga0268265_10000422 Ga0268265_1000042224 335
1280 3300044684 Ga0466966_0005580 Ga0466966_0005580_1588_2718 335
1281 3300045049 Ga0466959_0030345 Ga0466959_0030345_801_1931 335
1282 3300048920 Ga0496117_0053048 Ga0496117_0053048_276_1289 335
1283 3300048921 Ga0496118_0162080 Ga0496118_0162080_276_1289 335
1284 3300048924 Ga0496121_0000003 Ga0496121_0000003_909054_910067 335
1285 3300048926 Ga0496123_0086803 Ga0496123_0086803_309_1322 335
1286 3300048928 Ga0496125_0000170 Ga0496125_0000170_123747_124760 335
1287 iso_pu_bacteria 2508501039 2508671141 335
1288 iso_pu_bacteria 2675902999 2676203372 335
1289 iso_pu_bacteria 2687453737 2689964227 335
1290 iso_pu_bacteria 2773857921 2774847948 335
1291 3300046460 Ga0495638_0054620 Ga0495638_0054620_552_1613 336
1292 3300050491 nmdc:mga00v17_346_c2 nmdc:mga00v17_346_c2_2767_3828 336
1293 3300032004 Ga0307414_10155932 Ga0307414_101559322 337
1294 3300047472 Ga0495686_0000852 Ga0495686_0000852_6201_7373 337
1295 2010549000 RicEn_C5165 RicEn_92080 338
1296 3300003215 JGI25153J46596_10004925 JGI25153J46596_100049257 338
1297 3300006844 Ga0075428_100241623 Ga0075428_1002416231 338
1298 3300009766 Ga0123342_1017304 Ga0123342_10173045 338
1299 3300025303 Ga0209051_1028197 Ga0209051_10281972 338
1300 3300041413 Ga0439465_0029736 Ga0439465_0029736_650_1708 338
1301 3300041496 Ga0451839_0268071 Ga0451839_0268071_239_1297 338
1302 3300041503 Ga0451847_0036653 Ga0451847_0036653_442_1500 338
1303 3300041505 Ga0451849_0249873 Ga0451849_0249873_11_1069 338
1304 3300042007 Ga0439449_0025227 Ga0439449_0025227_1078_2136 338
1305 3300046501 Ga0495607_0036604 Ga0495607_0036604_448_1506 338
1306 3300046507 Ga0495606_0040817 Ga0495606_0040817_390_1448 338
1307 3300046512 Ga0495610_0011758 Ga0495610_0011758_197_1255 338
1308 3300046513 Ga0495616_0082792 Ga0495616_0082792_413_1471 338
1309 3300046519 Ga0495632_0071098 Ga0495632_0071098_593_1651 338
1310 3300046522 Ga0495643_0025280 Ga0495643_0025280_1598_2656 338
1311 3300046558 Ga0495633_0045394 Ga0495633_0045394_125_1231 338
1312 3300046616 Ga0495668_0038038 Ga0495668_0038038_1362_2420 338
1313 3300046648 Ga0495611_0063739 Ga0495611_0063739_563_1621 338
1314 3300046660 Ga0495625_0070031 Ga0495625_0070031_98_1156 338
1315 3300047443 Ga0495687_033205 Ga0495687_033205_338_1396 338
1316 3300048090 Ga0495615_0008053 Ga0495615_0008053_87_1193 338
1317 3300053153 Ga0500616_0049618 Ga0500616_0049618_455_1513 338
1318 iso_pu_bacteria 2510917028 2511187180 338
1319 iso_pu_bacteria 2513237138 2513867563 338
1320 iso_pu_bacteria 2582581294 2585204886 338
1321 iso_pu_bacteria 2585427526 2585529611 338
1322 iso_pu_bacteria 2585427590 2585823664 338
1323 iso_pu_bacteria 2838042994 2838046388 338
1324 iso_pu_bacteria 2838668709 2838671289 338
1325 iso_pu_bacteria 2838686498 2838691465 338
1326 iso_pu_bacteria 2838701080 2838703530 338
1327 iso_pu_bacteria 2838729681 2838733424 338
1328 iso_pu_bacteria 2838742623 2838746004 338
1329 iso_pu_bacteria 2841851746 2841853716 338
1330 iso_pu_bacteria 2842146304 2842149468 338
1331 iso_pu_bacteria 2842156927 2842162277 338
1332 iso_pu_bacteria 2842163707 2842169833 338
1333 iso_pu_bacteria 2842180545 2842185203 338
1334 iso_pu_bacteria 2842192696 2842197764 338
1335 iso_pu_bacteria 2842217011 2842220220 338
1336 iso_pu_bacteria 2842229732 2842233690 338
1337 iso_pu_bacteria 2842243621 2842247734 338
1338 iso_pu_bacteria 2842250916 2842253894 338
1339 iso_pu_bacteria 2842257432 2842261998 338
1340 iso_pu_bacteria 2842271015 2842275939 338
1341 iso_pu_bacteria 2842285085 2842288928 338
1342 iso_pu_bacteria 2842304105 2842308077 338
1343 iso_pu_bacteria 2842363717 2842369362 338
1344 iso_pu_bacteria 2842402390 2842406405 338
1345 iso_pu_bacteria 2842409023 2842413168 338
1346 iso_pu_bacteria 2842415677 2842419811 338
1347 iso_pu_bacteria 2842489311 2842493123 338
1348 iso_pu_bacteria 2842495871 2842499307 338
1349 iso_pu_bacteria 2844454524 2844457639 338
1350 iso_pu_bacteria 2923556063 2923558913 338
1351 iso_pu_bacteria 2933570622 2933574526 338
1352 iso_pu_bacteria 2935901341 2935907042 338
1353 iso_pu_bacteria 2996887358 2996890123 338
1354 iso_pu_bacteria 8005258706 8005262156 338
1355 iso_pu_bacteria 8005307578 8005310815 338
1356 iso_pu_bacteria 8005321885 8005324650 338
1357 iso_pu_bacteria 8005460587 8005464477 338
1358 iso_pu_bacteria 8005556819 8005558525 338
1359 iso_pu_bacteria 8005563573 8005566631 338
1360 iso_pu_bacteria 8005626139 8005631818 338
1361 iso_pu_bacteria 8018163183 8018170075 338
1362 iso_pu_bacteria 8023680758 8023687696 338
1363 iso_pu_bacteria 8024501048 8024506092 338
1364 iso_pu_bacteria 8057874678 8057876678 338

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00296

Bac_luciferase

Luciferase-like monooxygenase

38

337

0.78

Structural Annotation

Top 5 Hits

ID Description Score Start End
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8933 7 334
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8928 3 334
4us5-assembly1.cif.gz_A crystal structure of apo-msno8 0.8892 7 334
4us5-assembly2.cif.gz_D crystal structure of apo-msno8 0.8849 3 334
4us5-assembly2.cif.gz_C crystal structure of apo-msno8 0.8804 7 334
ID Description Score Start End Superfamily
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9809 5 330 3.20.20.30
af_P0ADV5_3_330_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9721 5 330 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9586 1 331 3.20.20.30
af_Q2FXV3_1_329_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.9529 1 331 3.20.20.30
af_Q2G151_1_332_3.20.20.30 Alpha Beta;Alpha-Beta Barrel;TIM Barrel;Luciferase-like domain 0.8899 7 330 3.20.20.30
ID Description Score Start End GO Terms
AF-A0A6I4KRK4-F1-model_v4 deleted 0.9916 8 104
AF-A0A534XP08-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9883 8 100 GO:0005829
GO:0016705
AF-A0A4R6FAV2-F1-model_v4 Luciferase family oxidoreductase group 1 0.9877 7 331 GO:0005829
GO:0016705
AF-A0A7Y6WWL1-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9858 7 330 GO:0005829
GO:0016705
AF-A0A5B0DWW8-F1-model_v4 LLM class flavin-dependent oxidoreductase 0.9851 7 330 GO:0005829
GO:0016705

Feature Viewer

pLDDT pTM Quality
91.75 0.91 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map