F493285
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1356 | 924 | 744 | 312 |
Family's Representative Sequence
| Representative Sequence | 3300013250|Ga0171462_1067|Ga0171462_10677 |
| Length | 343 |
| Sequence | MDEHFSHHQINFVNNENFGCYRYFSFLSFANIERGPGEEPMSNATAASTRAVQRDDLAAYGFLLPWLLGFLLLTLGPVAASFYLSLTDYSGLSAPNWVGIENYTRIATDDPRFITAMTVTFTFVLLSVPLKLLFALGVAVALNKGLTGLSFFRAVFYLPSLIGGSVAIAVLWRQVFAGDGLLNQALHTLFGYEGPSWIANPSTSLYTLVLLAVWQFGSSMIIFLAGLRQIPQDVYEAASIDGAQPVRQFFKITLPLLTPVIFFNAVIQTIDAFKAFTSAFVISDGTGGPIDSTLFYTLYLYQEAFTNFRFGYASALAWILVLIIAIFTALSFLSARYWVHYDD |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 2508501050 | Microvirga lupini Lut6 | Isolate | Nodule |
| 2 | 2508501114 | Microvirga lotononidis WSM3557 | Isolate | Nodule |
| 3 | 2508501122 | Ensifer yinggardensis WSM1721 | Isolate | Nodule |
| 4 | 2509276019 | Ensifer aridi TW10 | Isolate | Nodule |
| 5 | 2509276021 | Rhizobium leguminosarum bv. trifolii WSM597 | Isolate | Nodule |
| 6 | 2509276033 | Rhizobium leguminosarum bv. trifolii WSM2012 | Isolate | Nodule |
| 7 | 2510065019 | Rhizobium leguminosarum bv. trifolii WSM1689 | Isolate | Nodule |
| 8 | 2510065057 | Sinorhizobium meliloti WSM1022 | Isolate | Nodule |
| 9 | 2510461076 | Rhizobium leguminosarum bv. trifolii TA1 | Isolate | Nodule |
| 10 | 2510917022 | Rhizobium sp. AP16 | Isolate | Rhizosphere |
| 11 | 2510917028 | Rhizobium sp. CF122 | Isolate | Rhizosphere |
| 12 | 2510917030 | Rhizobium sp. CF142 | Isolate | Rhizosphere |
| 13 | 2511231027 | Phyllobacterium sp. YR531 | Isolate | Rhizosphere |
| 14 | 2511231052 | Sinorhizobium meliloti AK58 | Isolate | Nodule |
| 15 | 2512047086 | Sinorhizobium arboris LMG 14919 | Isolate | Nodule |
| 16 | 2512564039 | Paenibacillus mucilaginosus 3016 | Isolate | Rhizosphere |
| 17 | 2512875026 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 18 | 2513237084 | Rhizobium leguminosarum bv. viciae UPM1131 | Isolate | Nodule |
| 19 | 2513237085 | Rhizobium leguminosarum bv. viciae UPM1137 | Isolate | Nodule |
| 20 | 2513237086 | Sinorhizobium meliloti MVII-I | Isolate | Nodule |
| 21 | 2513237088 | Rhizobium mesoamericanum STM6155 | Isolate | Nodule |
| 22 | 2513237089 | Sinorhizobium medicae DI28 | Isolate | Nodule |
| 23 | 2513237091 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 24 | 2513237093 | Rhizobium leguminosarum bv. phaseoli FA23 | Isolate | Nodule |
| 25 | 2513237094 | Bradyrhizobium sp. WSM3983 | Isolate | Nodule |
| 26 | 2513237103 | Rhizobium leguminosarum bv. viciae VF39 | Isolate | Nodule |
| 27 | 2513237138 | Rhizobium favelukesii OR191 | Isolate | Nodule |
| 28 | 2513237140 | Sinorhizobium meliloti GVPV12 | Isolate | Nodule |
| 29 | 2513237143 | Sinorhizobium meliloti Mlalz-1 | Isolate | Nodule |
| 30 | 2513237144 | Rhizobium sullae WSM1592 | Isolate | Nodule |
| 31 | 2513237146 | Rhizobium mongolense USDA 1844 (Illumina) | Isolate | Nodule |
| 32 | 2513237156 | Sinorhizobium medicae WSM1369 | Isolate | Nodule |
| 33 | 2513237160 | Sinorhizobium medicae WSM244 | Isolate | Nodule |
| 34 | 2513237162 | Rhizobium ruizarguesonis GB30 | Isolate | Nodule |
| 35 | 2513237351 | Mesorhizobium alhagi CCNWXJ12-2 | Isolate | Nodule |
| 36 | 2515075009 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 37 | 2515154107 | Sinorhizobium meliloti 4H41 | Isolate | Nodule |
| 38 | 2515154113 | Rhizobium ruizarguesonis Vc2 | Isolate | Nodule |
| 39 | 2515154114 | Rhizobium ruizarguesonis Vh3 | Isolate | Nodule |
| 40 | 2515154116 | Rhizobium ruizarguesonis Ps8 | Isolate | Nodule |
| 41 | 2515154134 | Rhizobium gallicum bv. gallicum R602sp | Isolate | Nodule |
| 42 | 2515154155 | Actinopolymorpha alba DSM 45243 | Isolate | Rhizosphere |
| 43 | 2516143018 | Ensifer sp. BR816 | Isolate | Nodule |
| 44 | 2516653046 | Sinorhizobium meliloti BO21CC | Isolate | Nodule |
| 45 | 2516653077 | Rhizobium acaciae WSM1481 | Isolate | Nodule |
| 46 | 2516653085 | Rhizobium leguminosarum bv. phaseoli 4292 | Isolate | Nodule |
| 47 | 2517093000 | Rhizobium leguminosarum bv. trifolii SRDI943 | Isolate | Nodule |
| 48 | 2517287029 | Rhizobium leguminosarum bv. trifolii SRDI565 | Isolate | Nodule |
| 49 | 2517487022 | Sinorhizobium medicae WSM4191 | Isolate | Nodule |
| 50 | 2519899620 | Rhizobium sp. Pop5 | Isolate | Nodule |
| 51 | 2524023207 | Ensifer sp. USDA 6670 | Isolate | Nodule |
| 52 | 2524023209 | Rhizobium leucaenae USDA 9039 | Isolate | Nodule |
| 53 | 2529292951 | Rhizobium sp. CCGE 510 | Isolate | Nodule |
| 54 | 2534681796 | Rhizobium grahamii CCGE 502 | Isolate | Nodule |
| 55 | 2537561587 | Agrobacterium tumefaciens Cherry 2E-2-2 | Isolate | Rhizosphere |
| 56 | 2548877040 | Paenibacillus sonchi X19-5 | Isolate | Rhizosphere |
| 57 | 2551306084 | Sinorhizobium meliloti 5A14 | Isolate | Nodule |
| 58 | 2551306085 | Sinorhizobium meliloti AE608H | Isolate | Nodule |
| 59 | 2551306086 | Sinorhizobium meliloti AK11 | Isolate | Nodule |
| 60 | 2551306087 | Sinorhizobium meliloti A0643DD | Isolate | Nodule |
| 61 | 2551306089 | Sinorhizobium meliloti 1A42 | Isolate | Nodule |
| 62 | 2551306090 | Sinorhizobium meliloti A0641M | Isolate | Nodule |
| 63 | 2551306091 | Sinorhizobium meliloti C0431A | Isolate | Nodule |
| 64 | 2551306092 | Sinorhizobium meliloti AK75 | Isolate | Nodule |
| 65 | 2551306093 | Sinorhizobium meliloti C0438LL | Isolate | Nodule |
| 66 | 2554235003 | Agrobacterium tumefaciens WRT31 | Isolate | Rhizosphere |
| 67 | 2558860100 | Sinorhizobium sp. PC2 | Isolate | Nodule |
| 68 | 2558860242 | Agrobacterium fabacearum P4 | Isolate | Rhizosphere |
| 69 | 2558860983 | Allorhizobium undicola ATCC 700741 | Isolate | Rhizoplane |
| 70 | 2571042143 | Paenibacillus graminis RSA19 | Isolate | Unclassified |
| 71 | 2582581283 | Rhizobium sp. OK665 | Isolate | Rhizosphere |
| 72 | 2582581294 | Rhizobium sp. CF394 | Isolate | Rhizosphere |
| 73 | 2582581298 | Rhizobium alamii YR540 | Isolate | Rhizosphere |
| 74 | 2582581299 | Rhizobium leguminosarum OV483 | Isolate | Rhizosphere |
| 75 | 2582581307 | Rhizobium sp. YR060 | Isolate | Rhizosphere |
| 76 | 2582581308 | Rhizobium sp. OK494 | Isolate | Rhizosphere |
| 77 | 2582581315 | Agrobacterium rhizogenes YR147 | Isolate | Rhizosphere |
| 78 | 2582581316 | Agrobacterium rhizogenes OK036 | Isolate | Rhizosphere |
| 79 | 2582581867 | Rhizobium sp. OV201 | Isolate | Rhizosphere |
| 80 | 2585427526 | Rhizobium leguminosarum OV152 | Isolate | Rhizosphere |
| 81 | 2585427527 | Rhizobium lusitanum YR374 | Isolate | Rhizosphere |
| 82 | 2585427528 | Rhizobium leguminosarum CF307 | Isolate | Rhizosphere |
| 83 | 2585427529 | Rhizobium alamii YR584 | Isolate | Rhizosphere |
| 84 | 2585427530 | Rhizobium tropici YR635 | Isolate | Rhizosphere |
| 85 | 2585427531 | Agrobacterium rhizogenes YR530 | Isolate | Rhizosphere |
| 86 | 2585427590 | Rhizobium sp. CF048 | Isolate | Rhizosphere |
| 87 | 2585427593 | Rhizobium tropici CF286 | Isolate | Rhizosphere |
| 88 | 2585427608 | Agrobacterium rhizogenes OV677 | Isolate | Rhizosphere |
| 89 | 2585427609 | Agrobacterium rhizogenes CF263 | Isolate | Rhizosphere |
| 90 | 2585428059 | Paenibacillus chondroitinus OK414 | Isolate | Rhizosphere |
| 91 | 2585428125 | Agrobacterium rhizogenes CF262 | Isolate | Rhizosphere |
| 92 | 2585428157 | Microbacterium sp. CF335 | Isolate | Rhizosphere |
| 93 | 2593339198 | Paenibacillus sp. UNCCL117 | Isolate | Unclassified |
| 94 | 2599185170 | Rhizobium mongolense USDA 1844 (PacBio) | Isolate | Nodule |
| 95 | 2599185210 | Rhizobium sp. NFACC06-2 | Isolate | Rhizoplane |
| 96 | 2600255279 | Rhizobium sp. NFIX01 | Isolate | Rhizoplane |
| 97 | 2600255308 | Rhizobium sp. NFIX02 | Isolate | Rhizoplane |
| 98 | 2615840624 | Rhizobium aethiopicum HBR26 | Isolate | Nodule |
| 99 | 2615840626 | Rhizobium lusitanum P1-7 | Isolate | Nodule |
| 100 | 2615840698 | Rhizobium multihospitium HAMBI 2975 | Isolate | Nodule |
| 101 | 2617270742 | Rhizobium miluonense HAMBI 2971 | Isolate | Nodule |
| 102 | 2643221543 | Paenibacillus sp. Root52 | Isolate | Unclassified |
| 103 | 2643221557 | Ensifer sp. Root558 | Isolate | Unclassified |
| 104 | 2643221580 | Devosia sp. Root635 | Isolate | Unclassified |
| 105 | 2643221582 | Rhizobium sp. Root651 | Isolate | Unclassified |
| 106 | 2643221591 | Devosia sp. Root685 | Isolate | Unclassified |
| 107 | 2643221599 | Rhizobium sp. Root708 | Isolate | Unclassified |
| 108 | 2643221618 | Ensifer sp. Root231 | Isolate | Unclassified |
| 109 | 2643221626 | Ensifer sp. Root31 | Isolate | Unclassified |
| 110 | 2643221629 | Devosia sp. Root105 | Isolate | Unclassified |
| 111 | 2643221634 | Rhizobium sp. Root1203 | Isolate | Unclassified |
| 112 | 2643221655 | Ensifer sp. Root1252 | Isolate | Unclassified |
| 113 | 2643221659 | Ensifer sp. Root127 | Isolate | Unclassified |
| 114 | 2643221662 | Devosia sp. Root413D1 | Isolate | Unclassified |
| 115 | 2643221668 | Ensifer sp. Root423 | Isolate | Unclassified |
| 116 | 2643221674 | Devosia sp. Root436 | Isolate | Unclassified |
| 117 | 2643221676 | Paenibacillus sp. Root444D2 | Isolate | Unclassified |
| 118 | 2643221693 | Rhizobium sp. Root491 | Isolate | Unclassified |
| 119 | 2643221698 | Ensifer sp. Root142 | Isolate | Unclassified |
| 120 | 2643221712 | Ensifer sp. Root258 | Isolate | Unclassified |
| 121 | 2643221736 | Bosea sp. Root483D1 | Isolate | Unclassified |
| 122 | 2657244999 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 123 | 2667528174 | Rhizobium sp. NFR17 | Isolate | Rhizoplane |
| 124 | 2690316117 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 125 | 2718217882 | Rhizobium sp. N741 | Isolate | Nodule |
| 126 | 2718217927 | Rhizobium sp. N324 | Isolate | Nodule |
| 127 | 2718217997 | Rhizobium phaseoli sv. phaseoli R723 | Isolate | Nodule |
| 128 | 2718218009 | Rhizobium sp. N561 | Isolate | Nodule |
| 129 | 2718218199 | Rhizobium phaseoli sv. phaseoli N261 | Isolate | Nodule |
| 130 | 2718218232 | Rhizobium phaseoli sv. phaseoli N161 | Isolate | Nodule |
| 131 | 2718218233 | Rhizobium phaseoli sv. phaseoli R744 | Isolate | Nodule |
| 132 | 2718218235 | Rhizobium phaseoli sv. phaseoli R620 | Isolate | Nodule |
| 133 | 2718218269 | Rhizobium phaseoli sv. phaseoli N671 | Isolate | Nodule |
| 134 | 2718218363 | Rhizobium sp. N113 | Isolate | Nodule |
| 135 | 2718218365 | Rhizobium sp. N731 | Isolate | Nodule |
| 136 | 2718218366 | Rhizobium sp. N621 | Isolate | Nodule |
| 137 | 2718218423 | Rhizobium sp. N941 | Isolate | Nodule |
| 138 | 2721755514 | Rhizobium sp. N6212 | Isolate | Nodule |
| 139 | 2721755556 | Rhizobium phaseoli sv. phaseoli N931 | Isolate | Nodule |
| 140 | 2721755684 | Rhizobium phaseoli sv. phaseoli N841 | Isolate | Nodule |
| 141 | 2721755685 | Rhizobium phaseoli sv. phaseoli R611 | Isolate | Nodule |
| 142 | 2721755809 | Rhizobium sp. N541 | Isolate | Nodule |
| 143 | 2721755810 | Rhizobium sp. N871 | Isolate | Nodule |
| 144 | 2721755819 | Rhizobium phaseoli sv. phaseoli N771 | Isolate | Nodule |
| 145 | 2721755822 | Rhizobium phaseoli sv. phaseoli R650 | Isolate | Nodule |
| 146 | 2721755823 | Rhizobium phaseoli sv. phaseoli R630 | Isolate | Nodule |
| 147 | 2724679232 | Rhizobium leguminosarum Vaf12 | Isolate | Unclassified |
| 148 | 2728368933 | Paenibacillus jilunlii DSM 23019 | Isolate | Rhizosphere |
| 149 | 2728369352 | Rhizobium phaseoli sv. phaseoli N831 | Isolate | Nodule |
| 150 | 2728369365 | Rhizobium sp. N1341 | Isolate | Nodule |
| 151 | 2728369397 | Rhizobium sp. N1314 | Isolate | Nodule |
| 152 | 2738541333 | Rhizobium sophoriradicis CCBAU 03470 | Isolate | Unclassified |
| 153 | 2751185821 | Ensifer shofinae CCBAU 251167 | Isolate | Unclassified |
| 154 | 2757320392 | Phyllobacterium leguminum ORS 1419 | Isolate | Nodule |
| 155 | 2765235942 | Rhizobium sp. WYCCWR10014 | Isolate | Nodule |
| 156 | 2775506901 | Microvirga ossetica V5/3m | Isolate | Unclassified |
| 157 | 2775507266 | Rhizobium tropici PRF 81 | Isolate | Nodule |
| 158 | 2791355091 | Sinorhizobium sp. FG01 | Isolate | Nodule |
| 159 | 2791355092 | Sinorhizobium sp. NG07B | Isolate | Nodule |
| 160 | 2791355094 | Sinorhizobium sp. BJ1 | Isolate | Nodule |
| 161 | 2791355222 | Paenibacillus oryzae 1DrF-4 | Isolate | Unclassified |
| 162 | 2791355256 | Rhizobium sp. M10 | Isolate | Nodule |
| 163 | 2791355259 | Rhizobium hidalgonense FH14 | Isolate | Nodule |
| 164 | 2791355260 | Rhizobium sp. L9 | Isolate | Nodule |
| 165 | 2791355261 | Rhizobium sp. J15 | Isolate | Nodule |
| 166 | 2791355262 | Rhizobium sp. M1 | Isolate | Nodule |
| 167 | 2791355263 | Rhizobium chutanense C5 | Isolate | Nodule |
| 168 | 2791355264 | Rhizobium sp. S9 | Isolate | Nodule |
| 169 | 2791355265 | Rhizobium sp. H4 | Isolate | Nodule |
| 170 | 2791355266 | Rhizobium sp. L43 | Isolate | Nodule |
| 171 | 2791355267 | Rhizobium sp. L18 | Isolate | Nodule |
| 172 | 2802428858 | Sinorhizobium medicae M14-1 | Isolate | Nodule |
| 173 | 2802428859 | Sinorhizobium medicae SF3.41 | Isolate | Nodule |
| 174 | 2802428860 | Sinorhizobium medicae M19-1 | Isolate | Nodule |
| 175 | 2802428861 | Sinorhizobium medicae USDA1037 | Isolate | Nodule |
| 176 | 2802428862 | Sinorhizobium medicae M7-4 | Isolate | Nodule |
| 177 | 2802428863 | Sinorhizobium medicae M26-2 | Isolate | Nodule |
| 178 | 2802429268 | Sinorhizobium sojae CCBAU 05684 | Isolate | Unclassified |
| 179 | 2802429605 | Rhizobium sophoriradicis L101 | Isolate | Nodule |
| 180 | 2802429606 | Rhizobium sophoriradicis JJW1 | Isolate | Nodule |
| 181 | 2802429633 | Rhizobium anhuiense J3 | Isolate | Nodule |
| 182 | 2802429634 | Rhizobium anhuiense S10 | Isolate | Nodule |
| 183 | 2802429635 | Rhizobium anhuiense Y27 | Isolate | Nodule |
| 184 | 2802429636 | Rhizobium anhuiense JX3 | Isolate | Nodule |
| 185 | 2802429637 | Rhizobium anhuiense C15 | Isolate | Nodule |
| 186 | 2808606368 | Microbacterium sp. SLBN-1 | Isolate | Unclassified |
| 187 | 2808606387 | Rhizobium sp. SJZ105 | Isolate | Rhizosphere |
| 188 | 2816332139 | Pseudonocardia kunmingensis DSM 45301 | Isolate | Unclassified |
| 189 | 2818991439 | Agrobacterium tumefaciens 1187 | Isolate | Unclassified |
| 190 | 2818991448 | Rhizobium miluonense 1234 | Isolate | Unclassified |
| 191 | 2818991453 | Rhizobium lusitanum 1158 | Isolate | Unclassified |
| 192 | 2818991459 | Paenibacillus sp. 597 | Isolate | Unclassified |
| 193 | 2821443989 | Inquilinus ginsengisoli 584 | Isolate | Unclassified |
| 194 | 2835312727 | Microvirga calopogonii CCBAU 65841 | Isolate | Nodule |
| 195 | 2838016132 | Rhizobium phaseoli SEMIA 4071 | Isolate | Nodule |
| 196 | 2838022645 | Rhizobium aethiopicum SEMIA 4074 | Isolate | Nodule |
| 197 | 2838029111 | Rhizobium tropici SEMIA 4079 | Isolate | Nodule |
| 198 | 2838035591 | Rhizobium mongolense SEMIA 4087 | Isolate | Nodule |
| 199 | 2838042994 | Rhizobium esperanzae SEMIA 4089 | Isolate | Nodule |
| 200 | 2838048938 | Rhizobium pisi 27/80 | Isolate | Nodule |
| 201 | 2838061910 | Rhizobium phaseoli L15 | Isolate | Nodule |
| 202 | 2838068647 | Rhizobium esperanzae VC28 | Isolate | Nodule |
| 203 | 2838074704 | Sinorhizobium terangae SEMIA 6460 | Isolate | Unclassified |
| 204 | 2838661181 | Rhizobium mongolense SEMIA 402 | Isolate | Nodule |
| 205 | 2838668709 | Rhizobium sophoriradicis SEMIA 403 | Isolate | Nodule |
| 206 | 2838675328 | Agrobacterium radiobacter SEMIA 410 | Isolate | Nodule |
| 207 | 2838680041 | Rhizobium leguminosarum SEMIA 415 | Isolate | Nodule |
| 208 | 2838686498 | Rhizobium leguminosarum SEMIA 416 | Isolate | Nodule |
| 209 | 2838694306 | Rhizobium leguminosarum SEMIA 421 | Isolate | Nodule |
| 210 | 2838701080 | Rhizobium aethiopicum SEMIA 428 | Isolate | Nodule |
| 211 | 2838707686 | Rhizobium leguminosarum SEMIA 430 | Isolate | Nodule |
| 212 | 2838714209 | Agrobacterium radiobacter SEMIA 435 | Isolate | Nodule |
| 213 | 2838719591 | Agrobacterium radiobacter SEMIA 436 | Isolate | Nodule |
| 214 | 2838724970 | Agrobacterium radiobacter SEMIA 437 | Isolate | Nodule |
| 215 | 2840764183 | Phyllobacterium sophorae CCBAU 03422 | Isolate | Unclassified |
| 216 | 2841760612 | Bosea sp. Tri-49 | Isolate | Nodule |
| 217 | 2841846520 | Agrobacterium radiobacter SEMIA 440 | Isolate | Nodule |
| 218 | 2841851746 | Rhizobium leguminosarum SEMIA 498 | Isolate | Nodule |
| 219 | 2841859092 | Agrobacterium radiobacter SEMIA 4026 | Isolate | Nodule |
| 220 | 2841864319 | Rhizobium leguminosarum SEMIA 4052 | Isolate | Nodule |
| 221 | 2841911363 | Bosea caraganae RCAM04685 | Isolate | Nodule |
| 222 | 2841917233 | Bosea caraganae RCAM04680 | Isolate | Nodule |
| 223 | 2842077413 | Rhizobium leguminosarum SEMIA 422 | Isolate | Nodule |
| 224 | 2842110456 | Rhizobium esperanzae SEMIA 414 | Isolate | Nodule |
| 225 | 2842118031 | Rhizobium esperanzae SEMIA 420 | Isolate | Nodule |
| 226 | 2842124991 | Agrobacterium radiobacter SEMIA 434 | Isolate | Nodule |
| 227 | 2842130223 | Agrobacterium radiobacter SEMIA 441 | Isolate | Nodule |
| 228 | 2842146304 | Rhizobium sophoriradicis SEMIA 454 | Isolate | Nodule |
| 229 | 2842152218 | Agrobacterium radiobacter SEMIA 457 | Isolate | Nodule |
| 230 | 2842156927 | Rhizobium leguminosarum SEMIA 459 | Isolate | Nodule |
| 231 | 2842163707 | Rhizobium leguminosarum SEMIA 460 | Isolate | Nodule |
| 232 | 2842170452 | Agrobacterium radiobacter SEMIA 461 | Isolate | Nodule |
| 233 | 2842175837 | Agrobacterium radiobacter SEMIA 462 | Isolate | Nodule |
| 234 | 2842180545 | Rhizobium leguminosarum SEMIA 463 | Isolate | Nodule |
| 235 | 2842187318 | Agrobacterium radiobacter SEMIA 464 | Isolate | Nodule |
| 236 | 2842192696 | Rhizobium esperanzae SEMIA 468 | Isolate | Nodule |
| 237 | 2842198810 | Rhizobium aethiopicum SEMIA 470 | Isolate | Nodule |
| 238 | 2842205361 | Rhizobium etli SEMIA 471 | Isolate | Nodule |
| 239 | 2842211629 | Agrobacterium radiobacter SEMIA 472 | Isolate | Nodule |
| 240 | 2842217011 | Rhizobium leguminosarum SEMIA 475 | Isolate | Nodule |
| 241 | 2842224351 | Agrobacterium radiobacter SEMIA 480 | Isolate | Nodule |
| 242 | 2842229732 | Rhizobium leguminosarum SEMIA 481 | Isolate | Nodule |
| 243 | 2842237096 | Rhizobium leguminosarum SEMIA 482 | Isolate | Nodule |
| 244 | 2842243621 | Rhizobium leguminosarum SEMIA 483 | Isolate | Nodule |
| 245 | 2842250916 | Rhizobium etli SEMIA 484 | Isolate | Nodule |
| 246 | 2842257432 | Rhizobium leguminosarum SEMIA 485 | Isolate | Nodule |
| 247 | 2842264693 | Rhizobium phaseoli SEMIA 487 | Isolate | Nodule |
| 248 | 2842271015 | Rhizobium leguminosarum SEMIA 488 | Isolate | Nodule |
| 249 | 2842278818 | Rhizobium etli SEMIA 489 | Isolate | Nodule |
| 250 | 2842285085 | Rhizobium lentis SEMIA 490 | Isolate | Nodule |
| 251 | 2842291075 | Rhizobium leguminosarum SEMIA 491 | Isolate | Nodule |
| 252 | 2842298080 | Rhizobium leucaenae SEMIA 492 | Isolate | Nodule |
| 253 | 2842304105 | Rhizobium leguminosarum SEMIA 499 | Isolate | Nodule |
| 254 | 2842311132 | Rhizobium phaseoli SEMIA 4002 | Isolate | Nodule |
| 255 | 2842317721 | Rhizobium etli SEMIA 4004 | Isolate | Nodule |
| 256 | 2842341865 | Rhizobium leguminosarum SEMIA 4011 | Isolate | Nodule |
| 257 | 2842357229 | Rhizobium leucaenae SEMIA 4015 | Isolate | Nodule |
| 258 | 2842363717 | Rhizobium leguminosarum SEMIA 4016 | Isolate | Nodule |
| 259 | 2842370503 | Rhizobium leguminosarum SEMIA 4022 | Isolate | Nodule |
| 260 | 2842377471 | Rhizobium leguminosarum SEMIA 4024 | Isolate | Nodule |
| 261 | 2842384541 | Rhizobium leguminosarum SEMIA 4025 | Isolate | Nodule |
| 262 | 2842395702 | Rhizobium ecuadorense SEMIA 4029 | Isolate | Nodule |
| 263 | 2842402390 | Rhizobium lentis SEMIA 4033 | Isolate | Nodule |
| 264 | 2842409023 | Rhizobium lentis SEMIA 4034 | Isolate | Nodule |
| 265 | 2842415677 | Rhizobium lentis SEMIA 4036 | Isolate | Nodule |
| 266 | 2842422224 | Rhizobium esperanzae SEMIA 4042 | Isolate | Nodule |
| 267 | 2842428310 | Rhizobium phaseoli SEMIA 4050 | Isolate | Nodule |
| 268 | 2842434925 | Rhizobium esperanzae SEMIA 4051 | Isolate | Nodule |
| 269 | 2842441272 | Rhizobium esperanzae SEMIA 4053 | Isolate | Nodule |
| 270 | 2842447887 | Rhizobium esperanzae SEMIA 4055 | Isolate | Nodule |
| 271 | 2842462802 | Rhizobium phaseoli SEMIA 4057 | Isolate | Nodule |
| 272 | 2842469257 | Rhizobium phaseoli SEMIA 4058 | Isolate | Nodule |
| 273 | 2842475841 | Rhizobium tropici SEMIA 4059 | Isolate | Nodule |
| 274 | 2842482326 | Rhizobium lusitanum SEMIA 4060 | Isolate | Nodule |
| 275 | 2842489311 | Rhizobium sophoriradicis SEMIA 4061 | Isolate | Nodule |
| 276 | 2842495871 | Rhizobium etli SEMIA 4062 | Isolate | Nodule |
| 277 | 2842502639 | Rhizobium tropici SEMIA 4063 | Isolate | Nodule |
| 278 | 2842509118 | Rhizobium paranaense SEMIA 4064 | Isolate | Nodule |
| 279 | 2842515876 | Agrobacterium radiobacter SEMIA 4072 | Isolate | Nodule |
| 280 | 2842871566 | Phyllobacterium sp. R-73111 | Isolate | Unclassified |
| 281 | 2844104063 | Bosea sp. Tri-39 | Isolate | Nodule |
| 282 | 2844163670 | Ensifer sp. 1H6 | Isolate | Unclassified |
| 283 | 2844315083 | Bradyrhizobium guangzhouense CCBAU 51670 | Isolate | Unclassified |
| 284 | 2844454524 | Rhizobium leguminosarum bv. viciae BIHB 1217 | Isolate | Nodule |
| 285 | 2844533157 | Inquilinus sp. R-72501 v. 2 | Isolate | Unclassified |
| 286 | 2847417321 | Sinorhizobium fredii CCBAU 45436 | Isolate | Unclassified |
| 287 | 2848992105 | Sinorhizobium fredii CCBAU 25509 | Isolate | Unclassified |
| 288 | 2850079185 | Ensifer aridi JNVU TP6 | Isolate | Unclassified |
| 289 | 2851182111 | Bosea sp. Tri-44 | Isolate | Nodule |
| 290 | 2851246043 | Bosea sp. Tri-54 | Isolate | Nodule |
| 291 | 2852387548 | Rhizobium jaguaris CCGE525 | Isolate | Unclassified |
| 292 | 2855825444 | Sinorhizobium meliloti CXM1-105 | Isolate | Nodule |
| 293 | 2855839649 | Sinorhizobium meliloti AK555 | Isolate | Unclassified |
| 294 | 2855872281 | Sinorhizobium fredii PCH1 | Isolate | Nodule |
| 295 | 2857453340 | Paenibacillus sp. R-74130 | Isolate | Unclassified |
| 296 | 2857516855 | Rhizobium sp. R-72456 | Isolate | Unclassified |
| 297 | 2857733635 | Salinibacterium sp. R-73062 | Isolate | Unclassified |
| 298 | 2858800743 | Sinorhizobium meliloti AK170 | Isolate | Unclassified |
| 299 | 2862705112 | Streptomyces triticirhizae NEAU-YY642 | Isolate | Rhizosphere |
| 300 | 2864733723 | Paenibacillus sp. JGP012 | Isolate | Rhizosphere |
| 301 | 2864997549 | Paenibacillus sp. R-72005 | Isolate | Unclassified |
| 302 | 2867346516 | Streptomyces radicis AZ1-7 | Isolate | Unclassified |
| 303 | 2874123672 | Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 | Isolate | Nodule |
| 304 | 2888578766 | Paenibacillus lycopersici 12200R-189 | Isolate | Rhizosphere |
| 305 | 2889049205 | Paenibacillus rhizovicinus 14171R-81 | Isolate | Rhizosphere |
| 306 | 2889790730 | Chelativorans xinjiangense lm93 | Isolate | Rhizosphere |
| 307 | 2889914905 | Chelativorans alearense UJN715 | Isolate | Rhizosphere |
| 308 | 2891048133 | Martelella lutilitoris GH2-6 | Isolate | Rhizosphere |
| 309 | 2894232714 | Microvirga tunisiensis Lmie10 | Isolate | Nodule |
| 310 | 2894817345 | Aureimonas psammosilenae YIM DR1026 | Isolate | Unclassified |
| 311 | 2896384573 | Ensifer sp. MPMI2T | Isolate | Unclassified |
| 312 | 2899792073 | Agrobacterium deltaense CNPSo 3391 | Isolate | Nodule |
| 313 | 2899803654 | Agrobacterium sp. a22-2 | Isolate | Unclassified |
| 314 | 2899845264 | Agrobacterium fabacearum CNPSo 675 | Isolate | Unclassified |
| 315 | 2903727486 | Bradyrhizobium guangzhouense CCBAU 53424 | Isolate | Unclassified |
| 316 | 2904113452 | Paenibacillus paridis py1325 | Isolate | Unclassified |
| 317 | 2904755435 | Paenibacillus aceris KACC 19194 | Isolate | Rhizosphere |
| 318 | 2906602504 | Bradyrhizobium guangzhouense CCBAU 53426 | Isolate | Unclassified |
| 319 | 2909042592 | Labrys sp. LIt4 | Isolate | Nodule |
| 320 | 2913295892 | Sinorhizobium kostiensis DSM 13372 | Isolate | Nodule |
| 321 | 2915980308 | Sinorhizobium medicae USDA1149 | Isolate | Nodule |
| 322 | 2915986958 | Sinorhizobium meliloti USDA1659 | Isolate | Nodule |
| 323 | 2915993759 | Sinorhizobium meliloti USDA1336 | Isolate | Nodule |
| 324 | 2916000859 | Sinorhizobium meliloti USDA1562 | Isolate | Nodule |
| 325 | 2916007675 | Sinorhizobium meliloti USDA1289 | Isolate | Nodule |
| 326 | 2916014648 | Sinorhizobium meliloti USDA1583 | Isolate | Nodule |
| 327 | 2916021584 | Sinorhizobium meliloti USDA1550 | Isolate | Nodule |
| 328 | 2916028427 | Sinorhizobium meliloti USDA1613 | Isolate | Nodule |
| 329 | 2916035215 | Sinorhizobium meliloti 3011 | Isolate | Nodule |
| 330 | 2916041962 | Sinorhizobium meliloti USDA1795 | Isolate | Nodule |
| 331 | 2916048683 | Sinorhizobium meliloti USDA1796 | Isolate | Nodule |
| 332 | 2916055098 | Sinorhizobium meliloti USDA1770 | Isolate | Nodule |
| 333 | 2916061851 | Sinorhizobium medicae USDA1638 | Isolate | Nodule |
| 334 | 2916068649 | Sinorhizobium meliloti USDA1220 | Isolate | Nodule |
| 335 | 2916076590 | Sinorhizobium meliloti USDA1661 | Isolate | Nodule |
| 336 | 2917554339 | Chthonobacter rhizosphaerae yh7-1 | Isolate | Rhizosphere |
| 337 | 2919100787 | Rhizobium sp. 1399 | Isolate | Rhizosphere |
| 338 | 2919114240 | Agrobacterium tumefaciens 1457 | Isolate | Rhizosphere |
| 339 | 2919408235 | Rhizobium miluonense 3199 | Isolate | Unclassified |
| 340 | 2919425241 | Bacillus sp. 3255 | Isolate | Rhizosphere |
| 341 | 2920760137 | Ensifer psoraleae CCBAU 65732 | Isolate | Unclassified |
| 342 | 2920822456 | Ensifer sesbaniae CCBAU 65729 | Isolate | Unclassified |
| 343 | 2921201388 | Sinorhizobium meliloti USDA1692 | Isolate | Nodule |
| 344 | 2921208531 | Sinorhizobium meliloti USDA1660 | Isolate | Nodule |
| 345 | 2921237296 | Sinorhizobium meliloti USDA1508 | Isolate | Nodule |
| 346 | 2921244191 | Sinorhizobium meliloti 2119 | Isolate | Nodule |
| 347 | 2921250672 | Sinorhizobium medicae USDA1169 | Isolate | Nodule |
| 348 | 2921257292 | Sinorhizobium meliloti USDA1320 | Isolate | Nodule |
| 349 | 2921263974 | Sinorhizobium meliloti USDA1107 | Isolate | Nodule |
| 350 | 2921282425 | Sinorhizobium meliloti USDA1203 | Isolate | Nodule |
| 351 | 2921289301 | Sinorhizobium meliloti USDA1730 | Isolate | Nodule |
| 352 | 2921296804 | Sinorhizobium meliloti USDA1200 | Isolate | Nodule |
| 353 | 2923556063 | Rhizobium tibeticum 3740 | Isolate | Unclassified |
| 354 | 2924144063 | Sinorhizobium meliloti USDA1022 | Isolate | Nodule |
| 355 | 2924150972 | Sinorhizobium meliloti USDA1700 | Isolate | Nodule |
| 356 | 2924158325 | Sinorhizobium meliloti USDA1146 | Isolate | Nodule |
| 357 | 2924165586 | Sinorhizobium meliloti USDA1264 | Isolate | Nodule |
| 358 | 2924172951 | Sinorhizobium meliloti USDA1626 | Isolate | Nodule |
| 359 | 2924179722 | Sinorhizobium meliloti USDA1280 | Isolate | Nodule |
| 360 | 2924186466 | Sinorhizobium meliloti USDA1389 | Isolate | Nodule |
| 361 | 2924193448 | Sinorhizobium meliloti USDA1158 | Isolate | Nodule |
| 362 | 2924200457 | Sinorhizobium meliloti USDA1007 | Isolate | Nodule |
| 363 | 2924207177 | Sinorhizobium meliloti USDA1589 | Isolate | Nodule |
| 364 | 2924221636 | Sinorhizobium meliloti USDA1416 | Isolate | Nodule |
| 365 | 2924228884 | Sinorhizobium meliloti USDA1581 | Isolate | Nodule |
| 366 | 2926754445 | Agrobacterium radiobacter SLBN-94 | Isolate | Rhizosphere |
| 367 | 2926760298 | Agrobacterium tumefaciens SLBN-170 | Isolate | Rhizosphere |
| 368 | 2929138655 | Agrobacterium sp. R-72433 Hybrid assembly | Isolate | Unclassified |
| 369 | 2933006813 | Rhizobium sp. SEMIA 439 | Isolate | Unclassified |
| 370 | 2933011516 | Rhizobium sp. SEMIA 4032 | Isolate | Unclassified |
| 371 | 2933016740 | Rhizobium sp. SEMIA 4085 | Isolate | Nodule |
| 372 | 2933570622 | Rhizobium leguminosarum SEMIA 409 | Isolate | Nodule |
| 373 | 2933586486 | Rhizobium leguminosarum SEMIA 4039 | Isolate | Nodule |
| 374 | 2933594066 | Agrobacterium fabrum 35/80 | Isolate | Nodule |
| 375 | 2933599457 | Rhizobium phaseoli M3 | Isolate | Nodule |
| 376 | 2935894831 | Rhizobium leguminosarum SEMIA 419 | Isolate | Nodule |
| 377 | 2935901341 | Rhizobium leguminosarum SEMIA 4082 | Isolate | Nodule |
| 378 | 2936367885 | Rhizobium changzhiense WYCCWR 11290 | Isolate | Nodule |
| 379 | 2936375103 | Rhizobium changzhiense WYCCWR 11317 | Isolate | Nodule |
| 380 | 2936381700 | Rhizobium chutanense C16 | Isolate | Unclassified |
| 381 | 2936996657 | Sinorhizobium meliloti USDA1025 | Isolate | Nodule |
| 382 | 2937002841 | Sinorhizobium meliloti USDA1006 | Isolate | Nodule |
| 383 | 2937009748 | Sinorhizobium meliloti USDA1162 | Isolate | Nodule |
| 384 | 2937016420 | Sinorhizobium meliloti USDA1027 | Isolate | Nodule |
| 385 | 2937023124 | Sinorhizobium meliloti USDA1335 | Isolate | Nodule |
| 386 | 2937029754 | Sinorhizobium medicae USDA1624 | Isolate | Nodule |
| 387 | 2937036028 | Sinorhizobium medicae USDA1608 | Isolate | Nodule |
| 388 | 2937049772 | Sinorhizobium meliloti USDA1691 | Isolate | Nodule |
| 389 | 2937056579 | Sinorhizobium meliloti USDA1357 | Isolate | Nodule |
| 390 | 2937063883 | Sinorhizobium meliloti USDA1808 | Isolate | Nodule |
| 391 | 2937071275 | Sinorhizobium meliloti USDA1623 | Isolate | Nodule |
| 392 | 2937078374 | Sinorhizobium medicae USDA1004 | Isolate | Nodule |
| 393 | 2937084907 | Sinorhizobium medicae USDA1664 | Isolate | Nodule |
| 394 | 2937091812 | Sinorhizobium meliloti USDA1221 | Isolate | Nodule |
| 395 | 2937098957 | Sinorhizobium meliloti USDA1519 | Isolate | Nodule |
| 396 | 2937106411 | Sinorhizobium meliloti USDA1214 | Isolate | Nodule |
| 397 | 2937113482 | Sinorhizobium meliloti USDA1180 | Isolate | Nodule |
| 398 | 2937119839 | Sinorhizobium meliloti USDA1790 | Isolate | Nodule |
| 399 | 2937126314 | Sinorhizobium meliloti USDA1612 | Isolate | Nodule |
| 400 | 2937822353 | Mesorhizobium neociceri CCANP35 | Isolate | Nodule |
| 401 | 2938649242 | Paenibacillus helianthi P26E | Isolate | Rhizosphere |
| 402 | 2957375807 | Sinorhizobium medicae USDA1632 | Isolate | Nodule |
| 403 | 2957382221 | Sinorhizobium meliloti USDA1919 | Isolate | Nodule |
| 404 | 2957388812 | Sinorhizobium meliloti USDA1195 | Isolate | Nodule |
| 405 | 2957395598 | Sinorhizobium meliloti USDA1237 | Isolate | Nodule |
| 406 | 2957402308 | Sinorhizobium meliloti USDA1794 | Isolate | Nodule |
| 407 | 2957408893 | Sinorhizobium meliloti USDA1163 | Isolate | Nodule |
| 408 | 2957415311 | Sinorhizobium meliloti USDA1724 | Isolate | Nodule |
| 409 | 2957422303 | Sinorhizobium meliloti USDA1497 | Isolate | Nodule |
| 410 | 2957430029 | Sinorhizobium meliloti USDA1590 | Isolate | Nodule |
| 411 | 2957437181 | Sinorhizobium medicae USDA1694 | Isolate | Nodule |
| 412 | 2957443900 | Sinorhizobium meliloti USDA1734 | Isolate | Nodule |
| 413 | 2957450854 | Sinorhizobium meliloti USDA1655 | Isolate | Nodule |
| 414 | 2957457609 | Sinorhizobium meliloti USDA1751 | Isolate | Nodule |
| 415 | 2957464669 | Sinorhizobium meliloti USDA1520 | Isolate | Nodule |
| 416 | 2957471148 | Sinorhizobium meliloti USDA1204 | Isolate | Nodule |
| 417 | 2957478035 | Sinorhizobium meliloti USDA1171 | Isolate | Nodule |
| 418 | 2957484790 | Sinorhizobium meliloti USDA1464 | Isolate | Nodule |
| 419 | 2957491536 | Sinorhizobium meliloti USDA1804 | Isolate | Nodule |
| 420 | 2957498199 | Sinorhizobium meliloti USDA1561 | Isolate | Nodule |
| 421 | 2957505466 | Sinorhizobium meliloti USDA1696 | Isolate | Nodule |
| 422 | 2960584000 | Sinorhizobium meliloti USDA1530 | Isolate | Nodule |
| 423 | 2960591022 | Sinorhizobium medicae USDA1066 | Isolate | Nodule |
| 424 | 2960597568 | Sinorhizobium meliloti 3085 | Isolate | Nodule |
| 425 | 2960603979 | Sinorhizobium meliloti USDA1580 | Isolate | Nodule |
| 426 | 2960610863 | Sinorhizobium meliloti USDA1792 | Isolate | Nodule |
| 427 | 2960617483 | Sinorhizobium meliloti USDA1719 | Isolate | Nodule |
| 428 | 2960624210 | Sinorhizobium meliloti USDA1415 | Isolate | Nodule |
| 429 | 2960631154 | Sinorhizobium medicae USDA1629 | Isolate | Nodule |
| 430 | 2960637947 | Sinorhizobium meliloti USDA1202 | Isolate | Nodule |
| 431 | 2960645483 | Sinorhizobium meliloti USDA1703 | Isolate | Nodule |
| 432 | 2960660292 | Sinorhizobium meliloti USDA1883 | Isolate | Nodule |
| 433 | 2960667422 | Sinorhizobium meliloti USDA1170 | Isolate | Nodule |
| 434 | 2960680706 | Sinorhizobium medicae USDA1150 | Isolate | Nodule |
| 435 | 2960687367 | Sinorhizobium meliloti USDA1462 | Isolate | Nodule |
| 436 | 2960693952 | Sinorhizobium medicae USDA1630 | Isolate | Nodule |
| 437 | 2964607997 | Sinorhizobium meliloti USDA1212 | Isolate | Nodule |
| 438 | 2964615318 | Sinorhizobium meliloti USDA1248 | Isolate | Nodule |
| 439 | 2964621998 | Sinorhizobium meliloti USDA1235 | Isolate | Nodule |
| 440 | 2964628898 | Sinorhizobium meliloti USDA1191 | Isolate | Nodule |
| 441 | 2964636051 | Sinorhizobium meliloti USDA1594 | Isolate | Nodule |
| 442 | 2964643177 | Sinorhizobium meliloti USDA1760 | Isolate | Nodule |
| 443 | 2964649959 | Sinorhizobium meliloti USDA1591 | Isolate | Nodule |
| 444 | 2964656573 | Sinorhizobium meliloti USDA1308 | Isolate | Nodule |
| 445 | 2964663802 | Sinorhizobium meliloti USDA1688 | Isolate | Nodule |
| 446 | 2964678106 | Sinorhizobium meliloti USDA1210 | Isolate | Nodule |
| 447 | 2964685014 | Sinorhizobium meliloti USDA1232 | Isolate | Nodule |
| 448 | 2964691889 | Sinorhizobium meliloti USDA1379 | Isolate | Nodule |
| 449 | 2964698721 | Sinorhizobium meliloti USDA1656 | Isolate | Nodule |
| 450 | 2964705432 | Sinorhizobium meliloti USDA1614 | Isolate | Nodule |
| 451 | 2964712639 | Sinorhizobium meliloti USDA1616 | Isolate | Nodule |
| 452 | 2964719344 | Sinorhizobium meliloti USDA1456 | Isolate | Nodule |
| 453 | 2967664464 | Sinorhizobium meliloti USDA1208 | Isolate | Nodule |
| 454 | 2967671571 | Sinorhizobium meliloti USDA1496 | Isolate | Nodule |
| 455 | 2967678726 | Sinorhizobium meliloti USDA1467 | Isolate | Nodule |
| 456 | 2967686174 | Sinorhizobium medicae USDA1641 | Isolate | Nodule |
| 457 | 2967693043 | Sinorhizobium meliloti USDA1183 | Isolate | Nodule |
| 458 | 2967699805 | Sinorhizobium meliloti USDA1695 | Isolate | Nodule |
| 459 | 2967706974 | Sinorhizobium meliloti USDA1206 | Isolate | Nodule |
| 460 | 2967714385 | Sinorhizobium meliloti USDA1023 | Isolate | Nodule |
| 461 | 2967721400 | Sinorhizobium meliloti USDA1742 | Isolate | Nodule |
| 462 | 2967728569 | Sinorhizobium medicae USDA1607 | Isolate | Nodule |
| 463 | 2967735183 | Sinorhizobium meliloti USDA1710 | Isolate | Nodule |
| 464 | 2967742019 | Sinorhizobium meliloti USDA1676 | Isolate | Nodule |
| 465 | 2967748971 | Sinorhizobium meliloti USDA1024A | Isolate | Nodule |
| 466 | 2967755722 | Sinorhizobium meliloti USDA1302 | Isolate | Nodule |
| 467 | 2967762386 | Sinorhizobium meliloti USDA1397 | Isolate | Nodule |
| 468 | 2967769361 | Sinorhizobium meliloti USDA1005 | Isolate | Nodule |
| 469 | 2967775926 | Sinorhizobium meliloti USDA1678 | Isolate | Nodule |
| 470 | 2968558590 | Paenibacillus sp. P3E | Isolate | Rhizosphere |
| 471 | 2970019648 | Sinorhizobium meliloti USDA1603 | Isolate | Nodule |
| 472 | 2970026789 | Sinorhizobium medicae USDA1611 | Isolate | Nodule |
| 473 | 2970033650 | Sinorhizobium meliloti USDA1565 | Isolate | Nodule |
| 474 | 2970040964 | Sinorhizobium meliloti USDA1501 | Isolate | Nodule |
| 475 | 2970047711 | Sinorhizobium meliloti USDA1793 | Isolate | Nodule |
| 476 | 2970054988 | Sinorhizobium meliloti USDA1031 | Isolate | Nodule |
| 477 | 2970061556 | Sinorhizobium meliloti USDA1810 | Isolate | Nodule |
| 478 | 2970068827 | Sinorhizobium meliloti USDA1227 | Isolate | Nodule |
| 479 | 2970076120 | Sinorhizobium meliloti USDA1706 | Isolate | Nodule |
| 480 | 2970082768 | Sinorhizobium meliloti USDA1803 | Isolate | Nodule |
| 481 | 2970088815 | Sinorhizobium meliloti USDA1819 | Isolate | Nodule |
| 482 | 2970095765 | Sinorhizobium meliloti USDA1225 | Isolate | Nodule |
| 483 | 2970102677 | Sinorhizobium meliloti USDA1325 | Isolate | Nodule |
| 484 | 2970109326 | Sinorhizobium meliloti USDA1186 | Isolate | Nodule |
| 485 | 2970116247 | Sinorhizobium meliloti USDA1566 | Isolate | Nodule |
| 486 | 2970122695 | Sinorhizobium medicae 3082 | Isolate | Nodule |
| 487 | 2970129317 | Sinorhizobium meliloti USDA1008 | Isolate | Nodule |
| 488 | 2970136068 | Sinorhizobium meliloti USDA1699 | Isolate | Nodule |
| 489 | 2970143518 | Sinorhizobium medicae USDA1652 | Isolate | Nodule |
| 490 | 2970149975 | Sinorhizobium meliloti USDA1215 | Isolate | Nodule |
| 491 | 2970156795 | Sinorhizobium meliloti USDA1491 | Isolate | Nodule |
| 492 | 2970164137 | Sinorhizobium meliloti USDA1018 | Isolate | Nodule |
| 493 | 2970170962 | Sinorhizobium meliloti USDA1571 | Isolate | Nodule |
| 494 | 2970177841 | Sinorhizobium meliloti USDA1533 | Isolate | Nodule |
| 495 | 2970184632 | Sinorhizobium meliloti USDA1593 | Isolate | Nodule |
| 496 | 2970191845 | Sinorhizobium meliloti USDA1187 | Isolate | Nodule |
| 497 | 2971410472 | Paenibacillus oryzisoli 1ZS3-15 | Isolate | Unclassified |
| 498 | 2977516862 | Sinorhizobium meliloti USDA1791 | Isolate | Nodule |
| 499 | 2977523885 | Sinorhizobium meliloti USDA1777 | Isolate | Nodule |
| 500 | 2977530762 | Sinorhizobium medicae USDA1606 | Isolate | Nodule |
| 501 | 2977537788 | Sinorhizobium meliloti USDA1184 | Isolate | Nodule |
| 502 | 2977544691 | Sinorhizobium medicae USDA1631 | Isolate | Nodule |
| 503 | 2977551784 | Sinorhizobium meliloti USDA1035 | Isolate | Nodule |
| 504 | 2977558990 | Sinorhizobium meliloti USDA1222 | Isolate | Nodule |
| 505 | 2977565890 | Sinorhizobium meliloti USDA1617 | Isolate | Nodule |
| 506 | 2977572785 | Sinorhizobium meliloti USDA1767 | Isolate | Nodule |
| 507 | 2977579622 | Sinorhizobium meliloti USDA1161 | Isolate | Nodule |
| 508 | 2979089926 | Agrobacterium sp. SORGH_AS 745 | Isolate | Unclassified |
| 509 | 2979095461 | Agrobacterium tumefaciens SORGH_AS 749 | Isolate | Unclassified |
| 510 | 2979100975 | Agrobacterium pusense SORGH_AS 755 | Isolate | Unclassified |
| 511 | 2980125574 | Paenibacillus sp. tmac-D7 | Isolate | Unclassified |
| 512 | 2980182181 | Paenibacillus cymbidii R196 | Isolate | Unclassified |
| 513 | 2984509177 | Agrobacterium pusense SORGH_AS260 | Isolate | Aerial Root |
| 514 | 2984518228 | Agrobacterium pusense SORGH_AS285 | Isolate | Aerial Root |
| 515 | 2984527788 | Paenibacillus sp. SORGH_AS306 | Isolate | Aerial Root |
| 516 | 2984532647 | Paenibacillus sp. SORGH_AS338 | Isolate | Aerial Root |
| 517 | 2984537506 | Agrobacterium sp. SORGH_AS440 | Isolate | Aerial Root |
| 518 | 2984601300 | Rhizobium pusense SORGH_AS1083 | Isolate | Aerial Root |
| 519 | 2988225383 | Paenibacillus sp. P46E | Isolate | Rhizosphere |
| 520 | 2996632988 | Paenibacillus sp. P32E | Isolate | Rhizosphere |
| 521 | 2996887358 | Rhizobium sp. R711 | Isolate | Nodule |
| 522 | 2996893221 | Rhizobium sp. R635 | Isolate | Nodule |
| 523 | 3000017691 | Rhodobacteraceae bacterium GH2-2 | Isolate | Rhizosphere |
| 524 | 3005409236 | Rhizobium sp. P32RR-XVIII | Isolate | Rhizosphere |
| 525 | 3005416602 | Rhizobium sp. P40RR-XXII | Isolate | Rhizosphere |
| 526 | 3005445848 | Rhizobium sp. WYJ-E13 | Isolate | Unclassified |
| 527 | 3005452660 | Rhizobium grahamii BG7 | Isolate | Unclassified |
| 528 | 3006321560 | Actinacidiphila epipremni PRB2-1 | Isolate | Unclassified |
| 529 | 3006969106 | Bacillus sp. FJAT-50079 | Isolate | Rhizosphere |
| 530 | 3006988479 | Bacillus sp. FJAT-49711 | Isolate | Rhizosphere |
| 531 | 3300001979 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 | Metagenome | Rhizosphere |
| 532 | 3300002704 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB | Metagenome | Unclassified |
| 533 | 3300002705 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS | Metagenome | Unclassified |
| 534 | 3300002737 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA | Metagenome | Endosphere |
| 535 | 3300002738 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA | Metagenome | Unclassified |
| 536 | 3300002739 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA | Metagenome | Endosphere |
| 537 | 3300002741 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL | Metagenome | Unclassified |
| 538 | 3300002773 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS | Metagenome | Endosphere |
| 539 | 3300002987 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB | Metagenome | Endosphere |
| 540 | 3300003187 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB | Metagenome | Endosphere |
| 541 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 542 | 3300003214 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL | Metagenome | Endosphere |
| 543 | 3300003215 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF | Metagenome | Endosphere |
| 544 | 3300003316 | Sugarcane root Sample L1 | Metagenome | Unclassified |
| 545 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 546 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 547 | 3300003354 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS | Metagenome | Endosphere |
| 548 | 3300003374 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF | Metagenome | Endosphere |
| 549 | 3300003751 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 | Metagenome | Endosphere |
| 550 | 3300003762 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 | Metagenome | Endosphere |
| 551 | 3300003771 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 | Metagenome | Endosphere |
| 552 | 3300003775 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 | Metagenome | Endosphere |
| 553 | 3300003781 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 | Metagenome | Endosphere |
| 554 | 3300003790 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 | Metagenome | Endosphere |
| 555 | 3300003792 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 | Metagenome | Endosphere |
| 556 | 3300003856 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz | Metagenome | Rhizosphere |
| 557 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 558 | 3300004625 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 | Metagenome | Endosphere |
| 559 | 3300005262 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) | Metagenome | Endosphere |
| 560 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 561 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 562 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 563 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 564 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 565 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 566 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 567 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 568 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 569 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 570 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 571 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 572 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 573 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 574 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 575 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 576 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 577 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 578 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 579 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 580 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 581 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 582 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 583 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 584 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 585 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 586 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 587 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 588 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 589 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 590 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 591 | 3300006042 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 | Metagenome | Endosphere |
| 592 | 3300006048 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 | Metagenome | Endosphere |
| 593 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 594 | 3300006177 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 | Metagenome | Endosphere |
| 595 | 3300006178 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 | Metagenome | Endosphere |
| 596 | 3300006186 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 | Metagenome | Endosphere |
| 597 | 3300006195 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 | Metagenome | Endosphere |
| 598 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 599 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 600 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 601 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 602 | 3300006946 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG | Metagenome | Nodule |
| 603 | 3300006948 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 | Metagenome | Nodule |
| 604 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 605 | 3300009011 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG | Metagenome | Rhizosphere |
| 606 | 3300009036 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG | Metagenome | Rhizosphere |
| 607 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 608 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 609 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 610 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 611 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 612 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 613 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 614 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 615 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 616 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 617 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 618 | 3300009765 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule | Metagenome | Nodule |
| 619 | 3300009766 | Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule | Metagenome | Nodule |
| 620 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 621 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 622 | 3300012490 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 | Metagenome | Rhizosphere |
| 623 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 624 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 625 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 626 | 3300013249 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 | Metagenome | Rhizosphere |
| 627 | 3300013250 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 | Metagenome | Rhizosphere |
| 628 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 629 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 630 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 631 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 632 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 633 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 634 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 635 | 3300015265 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG | Metagenome | Rhizosphere |
| 636 | 3300015690 | Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 | Metagenome | Rhizosphere |
| 637 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 638 | 3300021320 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 | Metagenome | Nodule |
| 639 | 3300021321 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 | Metagenome | Nodule |
| 640 | 3300021327 | Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 | Metagenome | Nodule |
| 641 | 3300021388 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 | Metagenome | Unclassified |
| 642 | 3300022739 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules | Metagenome | Nodule |
| 643 | 3300022740 | Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules | Metagenome | Nodule |
| 644 | 3300025206 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) | Metagenome | Unclassified |
| 645 | 3300025208 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 646 | 3300025224 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 647 | 3300025228 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 648 | 3300025231 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 649 | 3300025233 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) | Metagenome | Endosphere |
| 650 | 3300025245 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) | Metagenome | Endosphere |
| 651 | 3300025246 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) | Metagenome | Unclassified |
| 652 | 3300025250 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) | Metagenome | Unclassified |
| 653 | 3300025253 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 654 | 3300025254 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 655 | 3300025256 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) | Metagenome | Unclassified |
| 656 | 3300025258 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) | Metagenome | Endosphere |
| 657 | 3300025261 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) | Metagenome | Endosphere |
| 658 | 3300025273 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 659 | 3300025284 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 660 | 3300025292 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 661 | 3300025294 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) | Metagenome | Endosphere |
| 662 | 3300025295 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 663 | 3300025297 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) | Metagenome | Endosphere |
| 664 | 3300025298 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 665 | 3300025299 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) | Metagenome | Endosphere |
| 666 | 3300025302 | Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) | Metagenome | Endosphere |
| 667 | 3300025303 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 668 | 3300025304 | Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) | Metagenome | Endosphere |
| 669 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 670 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 671 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 672 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 673 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 674 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 675 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 676 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 677 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 678 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 679 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 680 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 681 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 682 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 683 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 684 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 685 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 686 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 687 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 688 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 689 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 690 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 691 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 692 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 693 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 694 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 695 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 696 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 697 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 698 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 699 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 700 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 701 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 702 | 3300027111 | Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) | Metagenome | Nodule |
| 703 | 3300027312 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 704 | 3300027666 | Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) | Metagenome | Nodule |
| 705 | 3300027866 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) | Metagenome | Endosphere |
| 706 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 707 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 708 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 709 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 710 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 711 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 712 | 3300028794 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM | Metagenome | Unclassified |
| 713 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 714 | 3300030500 | Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) | Metagenome | Rhizosphere |
| 715 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 716 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 717 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 718 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 719 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 720 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 721 | 3300031616 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM | Metagenome | Unclassified |
| 722 | 3300031649 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM | Metagenome | Unclassified |
| 723 | 3300031712 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG | Metagenome | Rhizosphere |
| 724 | 3300031730 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM | Metagenome | Unclassified |
| 725 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 726 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 727 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 728 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 729 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 730 | 3300031967 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules | Metagenome | Nodule |
| 731 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 732 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 733 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 734 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 735 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 736 | 3300033179 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM | Metagenome | Unclassified |
| 737 | 3300033180 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM | Metagenome | Unclassified |
| 738 | 3300033430 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules | Metagenome | Nodule |
| 739 | 3300033464 | Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules | Metagenome | Nodule |
| 740 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 741 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 742 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 743 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 744 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 745 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 746 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 747 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 748 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 749 | 3300041413 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 | Metagenome | Rhizosphere |
| 750 | 3300041453 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG | Metagenome | Rhizoplane |
| 751 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 752 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 753 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 754 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 755 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 756 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 757 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 758 | 3300042015 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 | Metagenome | Rhizosphere |
| 759 | 3300042436 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 | Metagenome | Rhizosphere |
| 760 | 3300042438 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 | Metagenome | Rhizosphere |
| 761 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 762 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 763 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 764 | 3300044765 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R | Metagenome | Rhizosphere |
| 765 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 766 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 767 | 3300046453 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere | Metagenome | Rhizosphere |
| 768 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 769 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 770 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 771 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 772 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 773 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 774 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 775 | 3300046507 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere | Metagenome | Rhizosphere |
| 776 | 3300046512 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere | Metagenome | Rhizosphere |
| 777 | 3300046513 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere | Metagenome | Rhizosphere |
| 778 | 3300046515 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere | Metagenome | Rhizosphere |
| 779 | 3300046519 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere | Metagenome | Rhizosphere |
| 780 | 3300046522 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere | Metagenome | Rhizosphere |
| 781 | 3300046524 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere | Metagenome | Rhizosphere |
| 782 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 783 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 784 | 3300046557 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere | Metagenome | Rhizosphere |
| 785 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 786 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 787 | 3300046660 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere | Metagenome | Rhizosphere |
| 788 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 789 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 790 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 791 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 792 | 3300046810 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere | Metagenome | Rhizosphere |
| 793 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 794 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 795 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 796 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 797 | 3300047443 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere | Metagenome | Rhizosphere |
| 798 | 3300047472 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere | Metagenome | Rhizosphere |
| 799 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 800 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 801 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 802 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 803 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 804 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 805 | 3300048919 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled | Metagenome | Unclassified |
| 806 | 3300048920 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 | Metagenome | Unclassified |
| 807 | 3300048921 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 | Metagenome | Unclassified |
| 808 | 3300048922 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 | Metagenome | Unclassified |
| 809 | 3300048923 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 | Metagenome | Unclassified |
| 810 | 3300048924 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 | Metagenome | Unclassified |
| 811 | 3300048925 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled | Metagenome | Unclassified |
| 812 | 3300048926 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled | Metagenome | Unclassified |
| 813 | 3300048927 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 | Metagenome | Unclassified |
| 814 | 3300048928 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 | Metagenome | Unclassified |
| 815 | 3300048929 | Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 | Metagenome | Unclassified |
| 816 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 817 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 818 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 819 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 820 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 821 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 822 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 823 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 824 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 825 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 826 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 827 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 828 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 829 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 830 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 831 | 3300049674 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought | Metagenome | Rhizosphere |
| 832 | 3300049675 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control | Metagenome | Rhizosphere |
| 833 | 3300049708 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control | Metagenome | Rhizosphere |
| 834 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 835 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 836 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 837 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 838 | 3300050489 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation | Metagenome | Endosphere |
| 839 | 3300050490 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation | Metagenome | Endosphere |
| 840 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 841 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 842 | 3300050493 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation | Metagenome | Endosphere |
| 843 | 3300050494 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation | Metagenome | Endosphere |
| 844 | 3300050495 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation | Metagenome | Endosphere |
| 845 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 846 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 847 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 848 | 3300050516 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation | Metagenome | Endosphere |
| 849 | 3300053093 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere | Metagenome | Endosphere |
| 850 | 3300053107 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere | Metagenome | Endosphere |
| 851 | 3300053111 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere | Metagenome | Endosphere |
| 852 | 3300053119 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere | Metagenome | Endosphere |
| 853 | 3300053125 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere | Metagenome | Endosphere |
| 854 | 3300053130 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere | Metagenome | Endosphere |
| 855 | 3300053134 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere | Metagenome | Endosphere |
| 856 | 3300053135 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere | Metagenome | Endosphere |
| 857 | 3300053136 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere | Metagenome | Endosphere |
| 858 | 3300053137 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere | Metagenome | Endosphere |
| 859 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 860 | 3300053140 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere | Metagenome | Endosphere |
| 861 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 862 | 3300053156 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere | Metagenome | Endosphere |
| 863 | 3300053157 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere | Metagenome | Endosphere |
| 864 | 3300053161 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere | Metagenome | Endosphere |
| 865 | 3300053177 | Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere | Metagenome | Endosphere |
| 866 | 3300053730 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere | Metagenome | Endosphere |
| 867 | 3300053731 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere | Metagenome | Endosphere |
| 868 | 3300059508 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 869 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 870 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 871 | 3300059652 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 872 | 639633055 | Rhizobium leguminosarum bv. viciae 3841 | Isolate | Unclassified |
| 873 | 643692032 | Sinorhizobium fredii NGR234 | Isolate | Nodule |
| 874 | 648276728 | Sinorhizobium meliloti BL225C | Isolate | Nodule |
| 875 | 650716007 | Agrobacterium fabacearum H13-3 | Isolate | Rhizosphere |
| 876 | 8003570095 | Agrobacterium rhizogenes GBBC3284 | Isolate | Unclassified |
| 877 | 8003992118 | Sinorhizobium meliloti RRI128 | Isolate | Nodule |
| 878 | 8003999396 | Sinorhizobium medicae WSM1115 | Isolate | Nodule |
| 879 | 8005258706 | Rhizobium sp. R693 | Isolate | Nodule |
| 880 | 8005275841 | Rhizobium sp. N4311 | Isolate | Nodule |
| 881 | 8005282627 | Rhizobium phaseoli NC1 | Isolate | Nodule |
| 882 | 8005289223 | Rhizobium bangladeshense 1002 | Isolate | Nodule |
| 883 | 8005301065 | Rhizobium bangladeshense 1017 | Isolate | Nodule |
| 884 | 8005307578 | Rhizobium leguminosarum bv. phaseoli LCS0306 | Isolate | Unclassified |
| 885 | 8005314921 | Rhizobium sp. P28RR-XV | Isolate | Rhizosphere |
| 886 | 8005321885 | Rhizobium sp. R72 | Isolate | Nodule |
| 887 | 8005376324 | Rhizobium changzhiense WYCCWR 11279 | Isolate | Nodule |
| 888 | 8005382845 | Rhizobium sp. R634 | Isolate | Nodule |
| 889 | 8005395548 | Rhizobium sp. R339 | Isolate | Nodule |
| 890 | 8005430974 | Rhizobium phaseoli Y20 | Isolate | Nodule |
| 891 | 8005460587 | Rhizobium leguminosarum bv. viciae 248 | Isolate | Nodule |
| 892 | 8005484373 | Rhizobium tropici SARCC-755 | Isolate | Nodule |
| 893 | 8005497431 | Rhizobium phaseoli CCGM8 | Isolate | Unclassified |
| 894 | 8005542996 | Rhizobium grahamii CCGM3 | Isolate | Unclassified |
| 895 | 8005556819 | Rhizobium sp. WYCCWR 11128 | Isolate | Nodule |
| 896 | 8005563573 | Rhizobium sp. WYCCWR 11152 | Isolate | Nodule |
| 897 | 8005570704 | Rhizobium anhuiense bv. trifolii WYCCWR10015 | Isolate | Nodule |
| 898 | 8005619151 | Rhizobium phaseoli CCGM2 | Isolate | Unclassified |
| 899 | 8005626139 | Rhizobium phaseoli Y18 | Isolate | Nodule |
| 900 | 8005645114 | Rhizobium tropici IGFRI Rhizo-19 | Isolate | Rhizosphere |
| 901 | 8005658619 | Rhizobium terrae CC-HIH110 | Isolate | Unclassified |
| 902 | 8005668836 | Rhizobium phaseoli CCGM9 | Isolate | Unclassified |
| 903 | 8005682033 | Rhizobium dioscoreae S-93 | Isolate | Unclassified |
| 904 | 8005688590 | Rhizobium bangladeshense 1024 | Isolate | Nodule |
| 905 | 8005695170 | Rhizobium sp. RMa-01 | Isolate | Unclassified |
| 906 | 8008485437 | Streptomyces mimosae 3MP-10 | Isolate | Unclassified |
| 907 | 8018127388 | Rhizobium aegyptiacum 950 | Isolate | Nodule |
| 908 | 8018163183 | Rhizobium sp. WYCCWR 11146 | Isolate | Nodule |
| 909 | 8018176218 | Rhizobium sp. N122 | Isolate | Nodule |
| 910 | 8023680758 | Rhizobium leguminosarum SARCC-132 | Isolate | Nodule |
| 911 | 8024479707 | Rhizobium leguminosarum Tri-43 | Isolate | Nodule |
| 912 | 8024501048 | Rhizobium sp. H4 | Isolate | Nodule |
| 913 | 8025524527 | Streptomyces sp. 3MP-14 | Isolate | Unclassified |
| 914 | 8046767195 | Rhizobium calliandrae CCGE524 | Isolate | Unclassified |
| 915 | 8054460903 | Agrobacterium vaccinii B7.6 | Isolate | Unclassified |
| 916 | 8054465665 | Paenibacillus sonchi IIRRBNF1 | Isolate | Rhizosphere |
| 917 | 8054795415 | Paenibacillus periandrae PM10 | Isolate | Nodule |
| 918 | 8055431914 | Allorhizobium sonneratiae BGMRC 0089 | Isolate | Unclassified |
| 919 | 8056375014 | Rhizobium redzepovicii 18T | Isolate | Nodule |
| 920 | 8056382006 | Rhizobium croatiense 13T | Isolate | Nodule |
| 921 | 8056533031 | Paenibacillus qinlingensis TEGT-2 | Isolate | Unclassified |
| 922 | 8056967851 | Bradyrhizobium zhengyangense WYCCWR 12678 | Isolate | Nodule |
| 923 | 8057575449 | Rhizobium mayense CCGE526 | Isolate | Nodule |
| 924 | 8057874678 | Rhizobium acaciae 1AS12 | Isolate | Nodule |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 54.65 |
| Metatranscriptomes | 0.29 |
| Isolates | 45.06 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0.44 |
| Bulb | 0 |
| Endosphere | 17.92 |
| Nodule | 32.74 |
| Rhizoplane | 1.11 |
| Rhizosphere | 34.37 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | JGI24740J21852_10009206 | 3300001979 | Bacteria | 3881 |
| 2 | JGI25155J39150_1000004 | 3300002704 | Bacteria | 269098 |
| 3 | JGI25156J39149_1000014 | 3300002705 | Bacteria | 189257 |
| 4 | JGI25156J39149_1000015 | 3300002705 | Bacteria | 181949 |
| 5 | JGI25162J39368_1001203 | 3300002737 | Bacteria | 15095 |
| 6 | JGI25162J39368_1002942 | 3300002737 | Bacteria | 5755 |
| 7 | JGI25154J39366_1000026 | 3300002738 | Bacteria | 200613 |
| 8 | JGI25158J39367_1000160 | 3300002739 | Bacteria | 16034 |
| 9 | JGI25157J39369_1000005 | 3300002741 | Bacteria | 269089 |
| 10 | JGI25152J39213_1000861 | 3300002773 | Bacteria | 14974 |
| 11 | JGI25152J39213_1001207 | 3300002773 | Bacteria | 11855 |
| 12 | JGI25152J39213_1001531 | 3300002773 | Bacteria | 9827 |
| 13 | JGI25152J39213_1002263 | 3300002773 | Bacteria | 7434 |
| 14 | JGI25159J45721_1000242 | 3300002987 | Bacteria | 25793 |
| 15 | JGI25159J45721_1000711 | 3300002987 | Bacteria | 14533 |
| 16 | JGI25159J45721_1005637 | 3300002987 | Bacteria | 3899 |
| 17 | JGI25159J45721_1014554 | 3300002987 | Bacteria | 1770 |
| 18 | JGI25151J46595_10000387 | 3300003187 | Bacteria | 45673 |
| 19 | JGI25151J46595_10000409 | 3300003187 | Bacteria | 44077 |
| 20 | JGI25151J46595_10000714 | 3300003187 | Bacteria | 27683 |
| 21 | JGI25151J46595_10004033 | 3300003187 | Bacteria | 7876 |
| 22 | JGI25406J46586_10024954 | 3300003203 | Bacteria | 2330 |
| 23 | JGI25406J46586_10029934 | 3300003203 | Bacteria | 2054 |
| 24 | JGI25165J46597_1001246 | 3300003214 | Bacteria | 15061 |
| 25 | JGI25165J46597_1002528 | 3300003214 | Bacteria | 5747 |
| 26 | JGI25165J46597_1004993 | 3300003214 | Bacteria | 2662 |
| 27 | JGI25153J46596_10003661 | 3300003215 | Bacteria | 8510 |
| 28 | rootH1_10059358 | 3300003316 | Bacteria | 1491 |
| 29 | rootH2_10045600 | 3300003320 | Bacteria | 5742 |
| 30 | rootL2_10018043 | 3300003322 | Bacteria | 3339 |
| 31 | rootL2_10112950 | 3300003322 | Bacteria | 7748 |
| 32 | JGI25160J50197_1000022 | 3300003354 | Bacteria | 201071 |
| 33 | JGI25160J50197_1002301 | 3300003354 | Bacteria | 8957 |
| 34 | JGI25160J50197_1002712 | 3300003354 | Bacteria | 8141 |
| 35 | JGI25160J50197_1004618 | 3300003354 | Bacteria | 5921 |
| 36 | JGI25160J50197_1011926 | 3300003354 | Bacteria | 3048 |
| 37 | JGI25161J50226_1000024 | 3300003374 | Bacteria | 152176 |
| 38 | JGI25161J50226_1000206 | 3300003374 | Bacteria | 38371 |
| 39 | Ga0055538_1000546 | 3300003751 | Bacteria | 13122 |
| 40 | Ga0055542_1014899 | 3300003762 | Bacteria | 1262 |
| 41 | Ga0055526_1000489 | 3300003771 | Bacteria | 31492 |
| 42 | Ga0055526_1004307 | 3300003771 | Bacteria | 8599 |
| 43 | Ga0055526_1013134 | 3300003771 | Bacteria | 3534 |
| 44 | Ga0055524_1000517 | 3300003775 | Bacteria | 29782 |
| 45 | Ga0055524_1003779 | 3300003775 | Bacteria | 7202 |
| 46 | Ga0055524_1005189 | 3300003775 | Bacteria | 5867 |
| 47 | Ga0055524_1005277 | 3300003775 | Bacteria | 5803 |
| 48 | Ga0055524_1014466 | 3300003775 | Bacteria | 2922 |
| 49 | Ga0055524_1021523 | 3300003775 | Bacteria | 2134 |
| 50 | Ga0055536_1009179 | 3300003781 | Bacteria | 4132 |
| 51 | Ga0055536_1017062 | 3300003781 | Bacteria | 2393 |
| 52 | Ga0055528_1000478 | 3300003790 | Bacteria | 31939 |
| 53 | Ga0055528_1001760 | 3300003790 | Bacteria | 12455 |
| 54 | Ga0055528_1002389 | 3300003790 | Bacteria | 10126 |
| 55 | Ga0055528_1017305 | 3300003790 | Bacteria | 2505 |
| 56 | Ga0055528_1021586 | 3300003790 | Bacteria | 2037 |
| 57 | Ga0055540_1000320 | 3300003792 | Bacteria | 42457 |
| 58 | Ga0055540_1003981 | 3300003792 | Bacteria | 6880 |
| 59 | Ga0055540_1026234 | 3300003792 | Bacteria | 1412 |
| 60 | Ga0055540_1028718 | 3300003792 | Bacteria | 1312 |
| 61 | Ga0058692_1002641 | 3300003856 | Bacteria | 5903 |
| 62 | JGI25405J52794_10002814 | 3300003911 | Bacteria | 3018 |
| 63 | Ga0055543_1000025 | 3300004625 | Bacteria | 137886 |
| 64 | Ga0055543_1000248 | 3300004625 | Bacteria | 41302 |
| 65 | Ga0055543_1002104 | 3300004625 | Bacteria | 6913 |
| 66 | Ga0055543_1014478 | 3300004625 | Bacteria | 1537 |
| 67 | Ga0065165_1000200 | 3300005262 | Bacteria | 103564 |
| 68 | Ga0065165_1001128 | 3300005262 | Bacteria | 31425 |
| 69 | Ga0065165_1001369 | 3300005262 | Bacteria | 26829 |
| 70 | Ga0065165_1006963 | 3300005262 | Bacteria | 5725 |
| 71 | Ga0065165_1015821 | 3300005262 | Bacteria | 2858 |
| 72 | Ga0070658_10060193 | 3300005327 | Bacteria | 3092 |
| 73 | Ga0070658_10061436 | 3300005327 | Bacteria | 3061 |
| 74 | Ga0070670_100134421 | 3300005331 | Bacteria | 2137 |
| 75 | Ga0070660_100001762 | 3300005339 | Bacteria | 14850 |
| 76 | Ga0070660_100073319 | 3300005339 | Bacteria | 2677 |
| 77 | Ga0070660_100081504 | 3300005339 | Bacteria | 2540 |
| 78 | Ga0070661_100028790 | 3300005344 | Bacteria | 4008 |
| 79 | Ga0070661_100030184 | 3300005344 | Bacteria | 3916 |
| 80 | Ga0070661_100099812 | 3300005344 | Bacteria | 2158 |
| 81 | Ga0070668_100013330 | 3300005347 | Bacteria | 6135 |
| 82 | Ga0070668_100023500 | 3300005347 | Bacteria | 4663 |
| 83 | Ga0070668_100046535 | 3300005347 | Bacteria | 3332 |
| 84 | Ga0070669_100036316 | 3300005353 | Bacteria | 3570 |
| 85 | Ga0070669_100061720 | 3300005353 | Bacteria | 2755 |
| 86 | Ga0070674_100005304 | 3300005356 | Bacteria | 7427 |
| 87 | Ga0070659_100018201 | 3300005366 | Bacteria | 5301 |
| 88 | Ga0070667_100052255 | 3300005367 | Bacteria | 3448 |
| 89 | Ga0070700_100094362 | 3300005441 | Bacteria | 1959 |
| 90 | Ga0070663_100066828 | 3300005455 | Bacteria | 2606 |
| 91 | Ga0070663_100076567 | 3300005455 | Bacteria | 2447 |
| 92 | Ga0070663_100094147 | 3300005455 | Bacteria | 2224 |
| 93 | Ga0070678_100388583 | 3300005456 | Bacteria | 1209 |
| 94 | Ga0070679_100174329 | 3300005530 | Bacteria | 2123 |
| 95 | Ga0068853_100000565 | 3300005539 | Bacteria | 25355 |
| 96 | Ga0068853_100059131 | 3300005539 | Bacteria | 3311 |
| 97 | Ga0068853_100097958 | 3300005539 | Bacteria | 2589 |
| 98 | Ga0068853_100131600 | 3300005539 | Bacteria | 2240 |
| 99 | Ga0070672_100036888 | 3300005543 | Bacteria | 3727 |
| 100 | Ga0070665_100002585 | 3300005548 | Bacteria | 19803 |
| 101 | Ga0070665_100095279 | 3300005548 | Bacteria | 2981 |
| 102 | Ga0068855_100073222 | 3300005563 | Bacteria | 3981 |
| 103 | Ga0068855_100121017 | 3300005563 | Bacteria | 2996 |
| 104 | Ga0068855_100132489 | 3300005563 | Bacteria | 2845 |
| 105 | Ga0068855_100174184 | 3300005563 | Bacteria | 2435 |
| 106 | Ga0070664_100455725 | 3300005564 | Bacteria | 1175 |
| 107 | Ga0068857_100074796 | 3300005577 | Bacteria | 3019 |
| 108 | Ga0068857_100152029 | 3300005577 | Bacteria | 2097 |
| 109 | Ga0068854_100011307 | 3300005578 | Bacteria | 5805 |
| 110 | Ga0068854_100064409 | 3300005578 | Bacteria | 2663 |
| 111 | Ga0068854_100167266 | 3300005578 | Bacteria | 1708 |
| 112 | Ga0068854_100206798 | 3300005578 | Bacteria | 1546 |
| 113 | Ga0068854_100244498 | 3300005578 | Bacteria | 1430 |
| 114 | Ga0068856_100008285 | 3300005614 | Bacteria | 10132 |
| 115 | Ga0068856_100066245 | 3300005614 | Bacteria | 3569 |
| 116 | Ga0068856_100073534 | 3300005614 | Bacteria | 3384 |
| 117 | Ga0068856_100117479 | 3300005614 | Bacteria | 2660 |
| 118 | Ga0068856_100155283 | 3300005614 | Bacteria | 2298 |
| 119 | Ga0068852_100002107 | 3300005616 | Bacteria | 13607 |
| 120 | Ga0068852_100006927 | 3300005616 | Bacteria | 8245 |
| 121 | Ga0068852_100010073 | 3300005616 | Bacteria | 7035 |
| 122 | Ga0068852_100029002 | 3300005616 | Bacteria | 4539 |
| 123 | Ga0068852_100092772 | 3300005616 | Bacteria | 2705 |
| 124 | Ga0068851_10027371 | 3300005834 | Bacteria | 2810 |
| 125 | Ga0068863_100171095 | 3300005841 | Bacteria | 2084 |
| 126 | Ga0068858_100113296 | 3300005842 | Bacteria | 2533 |
| 127 | Ga0068862_100035487 | 3300005844 | Bacteria | 4223 |
| 128 | Ga0068862_100040706 | 3300005844 | Bacteria | 3950 |
| 129 | Ga0081455_10000482 | 3300005937 | Bacteria | 51729 |
| 130 | Ga0081455_10243547 | 3300005937 | Bacteria | 1320 |
| 131 | Ga0081538_10032965 | 3300005981 | Bacteria | 3458 |
| 132 | Ga0081540_1040509 | 3300005983 | Bacteria | 2428 |
| 133 | Ga0081539_10001783 | 3300005985 | Bacteria | 34177 |
| 134 | Ga0081539_10002139 | 3300005985 | Bacteria | 29179 |
| 135 | Ga0081539_10012392 | 3300005985 | Bacteria | 6578 |
| 136 | Ga0075365_10000641 | 3300006038 | Bacteria | 13855 |
| 137 | Ga0075365_10001348 | 3300006038 | Bacteria | 11002 |
| 138 | Ga0075365_10002567 | 3300006038 | Bacteria | 8967 |
| 139 | Ga0075365_10004465 | 3300006038 | Bacteria | 7415 |
| 140 | Ga0075365_10008876 | 3300006038 | Bacteria | 5740 |
| 141 | Ga0075365_10019507 | 3300006038 | Bacteria | 4187 |
| 142 | Ga0075365_10026065 | 3300006038 | Bacteria | 3707 |
| 143 | Ga0075365_10032251 | 3300006038 | Bacteria | 3366 |
| 144 | Ga0075368_10015660 | 3300006042 | Bacteria | 2817 |
| 145 | Ga0075368_10036305 | 3300006042 | Bacteria | 1925 |
| 146 | Ga0075368_10047512 | 3300006042 | Bacteria | 1699 |
| 147 | Ga0075368_10051207 | 3300006042 | Bacteria | 1641 |
| 148 | Ga0075368_10066825 | 3300006042 | Bacteria | 1446 |
| 149 | Ga0075363_100001601 | 3300006048 | Bacteria | 8712 |
| 150 | Ga0075363_100003108 | 3300006048 | Bacteria | 6970 |
| 151 | Ga0075363_100018367 | 3300006048 | Bacteria | 3483 |
| 152 | Ga0075363_100020501 | 3300006048 | Bacteria | 3316 |
| 153 | Ga0075363_100116753 | 3300006048 | Bacteria | 1487 |
| 154 | Ga0075364_10012258 | 3300006051 | Bacteria | 5241 |
| 155 | Ga0075364_10019248 | 3300006051 | Bacteria | 4283 |
| 156 | Ga0075364_10023714 | 3300006051 | Bacteria | 3887 |
| 157 | Ga0075364_10030856 | 3300006051 | Bacteria | 3442 |
| 158 | Ga0075364_10103742 | 3300006051 | Bacteria | 1894 |
| 159 | Ga0075362_10003917 | 3300006177 | Bacteria | 5290 |
| 160 | Ga0075362_10010334 | 3300006177 | Bacteria | 3642 |
| 161 | Ga0075362_10024045 | 3300006177 | Bacteria | 2582 |
| 162 | Ga0075367_10000605 | 3300006178 | Bacteria | 13802 |
| 163 | Ga0075367_10002193 | 3300006178 | Bacteria | 8804 |
| 164 | Ga0075367_10010227 | 3300006178 | Bacteria | 4922 |
| 165 | Ga0075367_10031237 | 3300006178 | Bacteria | 3057 |
| 166 | Ga0075367_10052945 | 3300006178 | Bacteria | 2404 |
| 167 | Ga0075367_10081821 | 3300006178 | Bacteria | 1954 |
| 168 | Ga0075367_10101282 | 3300006178 | Bacteria | 1761 |
| 169 | Ga0075369_10005102 | 3300006186 | Bacteria | 4890 |
| 170 | Ga0075369_10009196 | 3300006186 | Bacteria | 3831 |
| 171 | Ga0075369_10016168 | 3300006186 | Bacteria | 3006 |
| 172 | Ga0075369_10021032 | 3300006186 | Bacteria | 2677 |
| 173 | Ga0075369_10062541 | 3300006186 | Bacteria | 1627 |
| 174 | Ga0075369_10064522 | 3300006186 | Bacteria | 1604 |
| 175 | Ga0075366_10001240 | 3300006195 | Bacteria | 12657 |
| 176 | Ga0075366_10021217 | 3300006195 | Bacteria | 3775 |
| 177 | Ga0075366_10049433 | 3300006195 | Bacteria | 2495 |
| 178 | Ga0075366_10060071 | 3300006195 | Bacteria | 2259 |
| 179 | Ga0075366_10142145 | 3300006195 | Bacteria | 1451 |
| 180 | Ga0075370_10000790 | 3300006353 | Bacteria | 12649 |
| 181 | Ga0075370_10001831 | 3300006353 | Bacteria | 9513 |
| 182 | Ga0075370_10010473 | 3300006353 | Bacteria | 4848 |
| 183 | Ga0075370_10012225 | 3300006353 | Bacteria | 4531 |
| 184 | Ga0075370_10034470 | 3300006353 | Bacteria | 2837 |
| 185 | Ga0075428_100070600 | 3300006844 | Bacteria | 3818 |
| 186 | Ga0068865_100231903 | 3300006881 | Bacteria | 1449 |
| 187 | Ga0068865_100324855 | 3300006881 | Bacteria | 1239 |
| 188 | Ga0075436_100038129 | 3300006914 | Bacteria | 3318 |
| 189 | Ga0079104_1008652 | 3300006946 | Bacteria | 3531 |
| 190 | Ga0099826_10000040 | 3300006948 | Bacteria | 98176 |
| 191 | Ga0099826_10080445 | 3300006948 | Bacteria | 2032 |
| 192 | Ga0099795_10045681 | 3300007788 | Bacteria | 1575 |
| 193 | Ga0105251_10008485 | 3300009011 | Bacteria | 6176 |
| 194 | Ga0105244_10097039 | 3300009036 | Bacteria | 1445 |
| 195 | Ga0105240_10000013 | 3300009093 | Bacteria | 483458 |
| 196 | Ga0105240_10007818 | 3300009093 | Bacteria | 15442 |
| 197 | Ga0105240_10018416 | 3300009093 | Bacteria | 9377 |
| 198 | Ga0105240_10139857 | 3300009093 | Bacteria | 2895 |
| 199 | Ga0111539_10180832 | 3300009094 | Bacteria | 2463 |
| 200 | Ga0111539_10417531 | 3300009094 | Bacteria | 1563 |
| 201 | Ga0105245_10249836 | 3300009098 | Bacteria | 1723 |
| 202 | Ga0105247_10009605 | 3300009101 | Bacteria | 5871 |
| 203 | Ga0114129_10790522 | 3300009147 | Bacteria | 1211 |
| 204 | Ga0105243_10028578 | 3300009148 | Bacteria | 4281 |
| 205 | Ga0105243_10056337 | 3300009148 | Bacteria | 3125 |
| 206 | Ga0105241_10028242 | 3300009174 | Bacteria | 4180 |
| 207 | Ga0105241_10042714 | 3300009174 | Bacteria | 3432 |
| 208 | Ga0105241_10049194 | 3300009174 | Bacteria | 3210 |
| 209 | Ga0105241_10062149 | 3300009174 | Bacteria | 2878 |
| 210 | Ga0105248_10009144 | 3300009177 | Bacteria | 10897 |
| 211 | Ga0105248_10081859 | 3300009177 | Bacteria | 3629 |
| 212 | Ga0105237_10000071 | 3300009545 | Bacteria | 135695 |
| 213 | Ga0105237_10002420 | 3300009545 | Bacteria | 23173 |
| 214 | Ga0105237_10010647 | 3300009545 | Bacteria | 9772 |
| 215 | Ga0105237_10016814 | 3300009545 | Bacteria | 7593 |
| 216 | Ga0105237_10308890 | 3300009545 | Bacteria | 1584 |
| 217 | Ga0105237_10451609 | 3300009545 | Bacteria | 1291 |
| 218 | Ga0105238_10018899 | 3300009551 | Bacteria | 7017 |
| 219 | Ga0105249_10064625 | 3300009553 | Bacteria | 3365 |
| 220 | Ga0105249_10082542 | 3300009553 | Bacteria | 2991 |
| 221 | Ga0105249_10180725 | 3300009553 | Bacteria | 2052 |
| 222 | Ga0105249_10344701 | 3300009553 | Bacteria | 1508 |
| 223 | Ga0123341_1083945 | 3300009765 | Bacteria | 1215 |
| 224 | Ga0123342_1020788 | 3300009766 | Bacteria | 4728 |
| 225 | Ga0123342_1033145 | 3300009766 | Bacteria | 2367 |
| 226 | Ga0105239_10001189 | 3300010375 | Bacteria | 35605 |
| 227 | Ga0105239_10028181 | 3300010375 | Bacteria | 6178 |
| 228 | Ga0105239_10069958 | 3300010375 | Bacteria | 3855 |
| 229 | Ga0105239_10078512 | 3300010375 | Bacteria | 3633 |
| 230 | Ga0105239_10116563 | 3300010375 | Bacteria | 2964 |
| 231 | Ga0105239_10123270 | 3300010375 | Bacteria | 2880 |
| 232 | Ga0105246_10038060 | 3300011119 | Bacteria | 3231 |
| 233 | Ga0105246_10080022 | 3300011119 | Bacteria | 2325 |
| 234 | Ga0105246_10105769 | 3300011119 | Bacteria | 2057 |
| 235 | Ga0157322_1000363 | 3300012490 | Bacteria | 1595 |
| 236 | Ga0157371_10000042 | 3300013102 | Bacteria | 198938 |
| 237 | Ga0157371_10270803 | 3300013102 | Bacteria | 1225 |
| 238 | Ga0157370_10000035 | 3300013104 | Bacteria | 137103 |
| 239 | Ga0157370_10003431 | 3300013104 | Bacteria | 18611 |
| 240 | Ga0157370_10060171 | 3300013104 | Bacteria | 3607 |
| 241 | Ga0157370_10158271 | 3300013104 | Bacteria | 2107 |
| 242 | Ga0157370_10217126 | 3300013104 | Bacteria | 1772 |
| 243 | Ga0157369_10002596 | 3300013105 | Bacteria | 21609 |
| 244 | Ga0157369_10064646 | 3300013105 | Bacteria | 3939 |
| 245 | Ga0171463_1002 | 3300013249 | Bacteria | 1274851 |
| 246 | Ga0171462_1067 | 3300013250 | Bacteria | 13661 |
| 247 | Ga0157374_10118195 | 3300013296 | Bacteria | 2556 |
| 248 | Ga0163162_10068227 | 3300013306 | Bacteria | 3607 |
| 249 | Ga0157372_10052860 | 3300013307 | Bacteria | 4526 |
| 250 | Ga0157375_10339005 | 3300013308 | Bacteria | 1669 |
| 251 | Ga0157375_10410050 | 3300013308 | Bacteria | 1521 |
| 252 | Ga0163163_10028230 | 3300014325 | Bacteria | 5386 |
| 253 | Ga0157380_10017440 | 3300014326 | Bacteria | 5313 |
| 254 | Ga0182008_10022222 | 3300014497 | Bacteria | 3249 |
| 255 | Ga0182005_1001647 | 3300015265 | Bacteria | 8685 |
| 256 | Ga0183363_1046 | 3300015690 | Bacteria | 40582 |
| 257 | Ga0163161_10182099 | 3300017792 | Bacteria | 1611 |
| 258 | Ga0214544_1000771 | 3300021320 | Bacteria | 61917 |
| 259 | Ga0214542_1000032 | 3300021321 | Bacteria | 171690 |
| 260 | Ga0214542_1021618 | 3300021321 | Bacteria | 4352 |
| 261 | Ga0214543_1000016 | 3300021327 | Bacteria | 295257 |
| 262 | Ga0214543_1009269 | 3300021327 | Bacteria | 15462 |
| 263 | Ga0213875_10123936 | 3300021388 | Bacteria | 1207 |
| 264 | Ga0228711_1000006 | 3300022739 | Bacteria | 202437 |
| 265 | Ga0228710_1000004 | 3300022740 | Bacteria | 250560 |
| 266 | Ga0209435_100009 | 3300025206 | Bacteria | 476614 |
| 267 | Ga0209436_100127 | 3300025208 | Bacteria | 37528 |
| 268 | Ga0209436_109131 | 3300025208 | Bacteria | 1914 |
| 269 | Ga0209784_100078 | 3300025224 | Bacteria | 137701 |
| 270 | Ga0209672_102531 | 3300025228 | Bacteria | 4406 |
| 271 | Ga0207427_103104 | 3300025231 | Bacteria | 3742 |
| 272 | Ga0209437_100057 | 3300025233 | Bacteria | 362922 |
| 273 | Ga0209437_100772 | 3300025233 | Bacteria | 15151 |
| 274 | Ga0207425_1014088 | 3300025245 | Bacteria | 1824 |
| 275 | Ga0209646_1000018 | 3300025246 | Bacteria | 476716 |
| 276 | Ga0209026_1000043 | 3300025250 | Bacteria | 269142 |
| 277 | Ga0209677_100426 | 3300025253 | Bacteria | 25046 |
| 278 | Ga0209148_1000305 | 3300025254 | Bacteria | 70375 |
| 279 | Ga0209759_1000007 | 3300025256 | Bacteria | 476614 |
| 280 | Ga0209129_1000312 | 3300025258 | Bacteria | 43311 |
| 281 | Ga0209129_1000357 | 3300025258 | Bacteria | 38204 |
| 282 | Ga0209129_1001779 | 3300025258 | Bacteria | 11495 |
| 283 | Ga0209129_1004734 | 3300025258 | Bacteria | 5161 |
| 284 | Ga0209233_1000130 | 3300025261 | Bacteria | 205687 |
| 285 | Ga0209233_1000255 | 3300025261 | Bacteria | 82230 |
| 286 | Ga0209233_1000290 | 3300025261 | Bacteria | 64394 |
| 287 | Ga0209233_1000332 | 3300025261 | Bacteria | 48225 |
| 288 | Ga0209233_1004820 | 3300025261 | Bacteria | 4543 |
| 289 | Ga0209673_1000584 | 3300025273 | Bacteria | 57616 |
| 290 | Ga0209673_1000890 | 3300025273 | Bacteria | 38476 |
| 291 | Ga0209673_1001948 | 3300025273 | Bacteria | 16219 |
| 292 | Ga0209673_1002261 | 3300025273 | Bacteria | 13869 |
| 293 | Ga0209673_1002508 | 3300025273 | Bacteria | 12618 |
| 294 | Ga0209673_1002576 | 3300025273 | Bacteria | 12296 |
| 295 | Ga0209130_1000002 | 3300025284 | Bacteria | 722648 |
| 296 | Ga0209130_1000164 | 3300025284 | Bacteria | 97595 |
| 297 | Ga0209130_1000252 | 3300025284 | Bacteria | 67611 |
| 298 | Ga0209130_1000830 | 3300025284 | Bacteria | 25965 |
| 299 | Ga0209130_1006186 | 3300025284 | Bacteria | 3939 |
| 300 | Ga0209676_1000097 | 3300025292 | Bacteria | 237203 |
| 301 | Ga0209676_1000256 | 3300025292 | Bacteria | 112819 |
| 302 | Ga0209676_1029891 | 3300025292 | Bacteria | 1675 |
| 303 | Ga0209025_1000374 | 3300025294 | Bacteria | 93607 |
| 304 | Ga0209025_1000857 | 3300025294 | Bacteria | 48082 |
| 305 | Ga0209025_1000908 | 3300025294 | Bacteria | 45749 |
| 306 | Ga0209025_1001024 | 3300025294 | Bacteria | 41149 |
| 307 | Ga0209025_1001822 | 3300025294 | Bacteria | 25091 |
| 308 | Ga0209025_1006010 | 3300025294 | Bacteria | 9634 |
| 309 | Ga0209025_1015222 | 3300025294 | Bacteria | 4659 |
| 310 | Ga0209564_1000914 | 3300025295 | Bacteria | 38607 |
| 311 | Ga0209564_1001996 | 3300025295 | Bacteria | 17840 |
| 312 | Ga0209564_1011645 | 3300025295 | Bacteria | 3917 |
| 313 | Ga0209758_1001197 | 3300025297 | Bacteria | 32795 |
| 314 | Ga0209758_1001464 | 3300025297 | Bacteria | 27679 |
| 315 | Ga0209758_1001885 | 3300025297 | Bacteria | 22881 |
| 316 | Ga0209758_1002066 | 3300025297 | Bacteria | 21435 |
| 317 | Ga0209758_1002227 | 3300025297 | Bacteria | 20142 |
| 318 | Ga0209758_1003392 | 3300025297 | Bacteria | 14554 |
| 319 | Ga0209758_1026422 | 3300025297 | Bacteria | 2512 |
| 320 | Ga0209758_1028154 | 3300025297 | Bacteria | 2384 |
| 321 | Ga0209758_1029811 | 3300025297 | Bacteria | 2272 |
| 322 | Ga0209758_1037090 | 3300025297 | Bacteria | 1890 |
| 323 | Ga0209050_1023572 | 3300025298 | Bacteria | 2160 |
| 324 | Ga0209256_1000260 | 3300025299 | Bacteria | 93956 |
| 325 | Ga0209256_1000739 | 3300025299 | Bacteria | 42871 |
| 326 | Ga0209256_1001817 | 3300025299 | Bacteria | 20042 |
| 327 | Ga0209256_1005354 | 3300025299 | Bacteria | 7432 |
| 328 | Ga0209256_1007001 | 3300025299 | Bacteria | 5731 |
| 329 | Ga0207426_1000013 | 3300025302 | Bacteria | 721897 |
| 330 | Ga0207426_1000082 | 3300025302 | Bacteria | 298939 |
| 331 | Ga0207426_1000098 | 3300025302 | Bacteria | 264264 |
| 332 | Ga0207426_1000287 | 3300025302 | Bacteria | 100566 |
| 333 | Ga0207426_1000812 | 3300025302 | Bacteria | 33529 |
| 334 | Ga0207426_1001778 | 3300025302 | Bacteria | 16206 |
| 335 | Ga0209051_1000195 | 3300025303 | Bacteria | 107201 |
| 336 | Ga0209051_1002486 | 3300025303 | Bacteria | 13148 |
| 337 | Ga0209051_1007413 | 3300025303 | Bacteria | 5998 |
| 338 | Ga0209051_1062767 | 3300025303 | Bacteria | 1160 |
| 339 | Ga0209257_1004297 | 3300025304 | Bacteria | 11202 |
| 340 | Ga0209257_1007822 | 3300025304 | Bacteria | 6326 |
| 341 | Ga0207710_10046785 | 3300025900 | Bacteria | 1932 |
| 342 | Ga0207688_10010706 | 3300025901 | Bacteria | 4991 |
| 343 | Ga0207688_10045465 | 3300025901 | Bacteria | 2449 |
| 344 | Ga0207680_10148648 | 3300025903 | Bacteria | 1560 |
| 345 | Ga0207647_10021122 | 3300025904 | Bacteria | 4351 |
| 346 | Ga0207705_10002602 | 3300025909 | Bacteria | 13868 |
| 347 | Ga0207705_10018987 | 3300025909 | Bacteria | 4916 |
| 348 | Ga0207705_10161161 | 3300025909 | Bacteria | 1685 |
| 349 | Ga0207695_10000044 | 3300025913 | Bacteria | 440819 |
| 350 | Ga0207695_10000136 | 3300025913 | Bacteria | 217596 |
| 351 | Ga0207695_10029206 | 3300025913 | Bacteria | 6099 |
| 352 | Ga0207695_10307984 | 3300025913 | Bacteria | 1474 |
| 353 | Ga0207671_10000043 | 3300025914 | Bacteria | 206915 |
| 354 | Ga0207671_10000099 | 3300025914 | Bacteria | 132378 |
| 355 | Ga0207657_10003030 | 3300025919 | Bacteria | 17989 |
| 356 | Ga0207657_10004936 | 3300025919 | Bacteria | 14029 |
| 357 | Ga0207649_10038059 | 3300025920 | Bacteria | 2910 |
| 358 | Ga0207649_10047558 | 3300025920 | Bacteria | 2641 |
| 359 | Ga0207649_10077321 | 3300025920 | Bacteria | 2144 |
| 360 | Ga0207649_10094290 | 3300025920 | Bacteria | 1966 |
| 361 | Ga0207652_10322124 | 3300025921 | Bacteria | 1395 |
| 362 | Ga0207694_10414682 | 3300025924 | Bacteria | 1121 |
| 363 | Ga0207687_10348640 | 3300025927 | Bacteria | 1206 |
| 364 | Ga0207690_10091750 | 3300025932 | Bacteria | 2147 |
| 365 | Ga0207706_10213667 | 3300025933 | Bacteria | 1690 |
| 366 | Ga0207709_10021898 | 3300025935 | Bacteria | 3621 |
| 367 | Ga0207669_10022958 | 3300025937 | Bacteria | 3323 |
| 368 | Ga0207669_10062514 | 3300025937 | Bacteria | 2294 |
| 369 | Ga0207669_10389146 | 3300025937 | Bacteria | 1089 |
| 370 | Ga0207691_10039264 | 3300025940 | Bacteria | 4379 |
| 371 | Ga0207691_10168156 | 3300025940 | Bacteria | 1921 |
| 372 | Ga0207711_10037909 | 3300025941 | Bacteria | 4097 |
| 373 | Ga0207679_10188639 | 3300025945 | Bacteria | 1712 |
| 374 | Ga0207667_10032885 | 3300025949 | Bacteria | 5582 |
| 375 | Ga0207667_10137137 | 3300025949 | Bacteria | 2519 |
| 376 | Ga0207651_10009486 | 3300025960 | Bacteria | 5335 |
| 377 | Ga0207712_10079253 | 3300025961 | Bacteria | 2385 |
| 378 | Ga0207668_10035197 | 3300025972 | Bacteria | 3332 |
| 379 | Ga0207668_10168681 | 3300025972 | Bacteria | 1714 |
| 380 | Ga0207668_10190996 | 3300025972 | Bacteria | 1623 |
| 381 | Ga0207640_10050225 | 3300025981 | Bacteria | 2704 |
| 382 | Ga0207640_10053820 | 3300025981 | Bacteria | 2629 |
| 383 | Ga0207703_10048242 | 3300026035 | Bacteria | 3437 |
| 384 | Ga0207639_10001011 | 3300026041 | Bacteria | 19136 |
| 385 | Ga0207639_10033504 | 3300026041 | Bacteria | 3789 |
| 386 | Ga0207639_10159493 | 3300026041 | Bacteria | 1899 |
| 387 | Ga0207639_10383083 | 3300026041 | Bacteria | 1263 |
| 388 | Ga0207678_10029480 | 3300026067 | Bacteria | 4790 |
| 389 | Ga0207678_10046776 | 3300026067 | Bacteria | 3742 |
| 390 | Ga0207678_10105168 | 3300026067 | Bacteria | 2408 |
| 391 | Ga0207708_10124796 | 3300026075 | Bacteria | 2009 |
| 392 | Ga0207708_10177328 | 3300026075 | Bacteria | 1690 |
| 393 | Ga0207702_10006190 | 3300026078 | Bacteria | 10352 |
| 394 | Ga0207702_10017912 | 3300026078 | Bacteria | 5861 |
| 395 | Ga0207702_10073450 | 3300026078 | Bacteria | 2949 |
| 396 | Ga0207648_10268943 | 3300026089 | Bacteria | 1522 |
| 397 | Ga0207674_10052495 | 3300026116 | Bacteria | 4158 |
| 398 | Ga0207683_10027732 | 3300026121 | Bacteria | 4893 |
| 399 | Ga0207683_10206493 | 3300026121 | Bacteria | 1787 |
| 400 | Ga0207698_10007021 | 3300026142 | Bacteria | 7054 |
| 401 | Ga0207698_10157080 | 3300026142 | Bacteria | 1983 |
| 402 | Ga0207698_10168149 | 3300026142 | Bacteria | 1927 |
| 403 | Ga0209281_1000102 | 3300027111 | Bacteria | 221665 |
| 404 | Ga0209281_1000563 | 3300027111 | Bacteria | 44757 |
| 405 | Ga0209371_1000003 | 3300027312 | Bacteria | 1122971 |
| 406 | Ga0209371_1000998 | 3300027312 | Bacteria | 21742 |
| 407 | Ga0209371_1001347 | 3300027312 | Bacteria | 17020 |
| 408 | Ga0209282_1000013 | 3300027666 | Bacteria | 215053 |
| 409 | Ga0209282_1000150 | 3300027666 | Bacteria | 41053 |
| 410 | Ga0209282_1080876 | 3300027666 | Bacteria | 1735 |
| 411 | Ga0209813_10001001 | 3300027866 | Bacteria | 6338 |
| 412 | Ga0209813_10002610 | 3300027866 | Bacteria | 4139 |
| 413 | Ga0209813_10005108 | 3300027866 | Bacteria | 3173 |
| 414 | Ga0209813_10027957 | 3300027866 | Bacteria | 1641 |
| 415 | Ga0207428_10132694 | 3300027907 | Bacteria | 1905 |
| 416 | Ga0268266_10000391 | 3300028379 | Bacteria | 66400 |
| 417 | Ga0268266_10002425 | 3300028379 | Bacteria | 20076 |
| 418 | Ga0268266_10303773 | 3300028379 | Bacteria | 1489 |
| 419 | Ga0268265_10122312 | 3300028380 | Bacteria | 2146 |
| 420 | Ga0268265_10163308 | 3300028380 | Bacteria | 1895 |
| 421 | Ga0268265_10199821 | 3300028380 | Bacteria | 1733 |
| 422 | Ga0268264_10125499 | 3300028381 | Bacteria | 2268 |
| 423 | Ga0265323_10020328 | 3300028653 | Bacteria | 2558 |
| 424 | Ga0265322_10001864 | 3300028654 | Bacteria | 6676 |
| 425 | Ga0307515_10004240 | 3300028794 | Bacteria | 29769 |
| 426 | Ga0265338_10128710 | 3300028800 | Bacteria | 2004 |
| 427 | Ga0268256_1000004 | 3300030500 | Bacteria | 1122967 |
| 428 | Ga0268256_1001200 | 3300030500 | Bacteria | 16565 |
| 429 | Ga0268256_1002297 | 3300030500 | Bacteria | 9909 |
| 430 | Ga0265330_10022425 | 3300031235 | Bacteria | 2873 |
| 431 | Ga0265328_10036213 | 3300031239 | Bacteria | 1824 |
| 432 | Ga0265320_10070181 | 3300031240 | Bacteria | 1653 |
| 433 | Ga0265320_10077447 | 3300031240 | Bacteria | 1556 |
| 434 | Ga0265316_10060596 | 3300031344 | Bacteria | 2941 |
| 435 | Ga0307513_10018636 | 3300031456 | Bacteria | 8288 |
| 436 | Ga0307408_100039293 | 3300031548 | Bacteria | 3344 |
| 437 | Ga0307408_100130609 | 3300031548 | Bacteria | 1959 |
| 438 | Ga0307508_10017913 | 3300031616 | Bacteria | 6436 |
| 439 | Ga0307514_10023355 | 3300031649 | Bacteria | 5018 |
| 440 | Ga0265342_10003529 | 3300031712 | Bacteria | 12794 |
| 441 | Ga0307516_10028576 | 3300031730 | Bacteria | 5642 |
| 442 | Ga0307413_10020232 | 3300031824 | Bacteria | 3535 |
| 443 | Ga0307413_10030735 | 3300031824 | Bacteria | 3020 |
| 444 | Ga0307410_10051199 | 3300031852 | Bacteria | 2782 |
| 445 | Ga0307410_10147885 | 3300031852 | Bacteria | 1745 |
| 446 | Ga0307406_10010585 | 3300031901 | Bacteria | 5206 |
| 447 | Ga0307407_10035282 | 3300031903 | Bacteria | 2747 |
| 448 | Ga0307407_10188317 | 3300031903 | Bacteria | 1373 |
| 449 | Ga0307412_10015156 | 3300031911 | Bacteria | 4562 |
| 450 | Ga0307412_10057088 | 3300031911 | Bacteria | 2604 |
| 451 | Ga0307412_10115653 | 3300031911 | Bacteria | 1923 |
| 452 | Ga0307412_10294173 | 3300031911 | Bacteria | 1280 |
| 453 | Ga0307412_10295612 | 3300031911 | Bacteria | 1278 |
| 454 | Ga0307412_10298340 | 3300031911 | Bacteria | 1272 |
| 455 | Ga0315914_1000004 | 3300031967 | Bacteria | 288534 |
| 456 | Ga0307409_100051405 | 3300031995 | Bacteria | 3153 |
| 457 | Ga0307409_100064948 | 3300031995 | Bacteria | 2869 |
| 458 | Ga0307409_100081884 | 3300031995 | Bacteria | 2611 |
| 459 | Ga0307409_100179512 | 3300031995 | Bacteria | 1873 |
| 460 | Ga0307416_100096972 | 3300032002 | Bacteria | 2552 |
| 461 | Ga0307416_100230775 | 3300032002 | Bacteria | 1784 |
| 462 | Ga0307416_100266096 | 3300032002 | Bacteria | 1679 |
| 463 | Ga0307414_10011787 | 3300032004 | Bacteria | 5144 |
| 464 | Ga0307414_10224116 | 3300032004 | Bacteria | 1545 |
| 465 | Ga0307414_10430791 | 3300032004 | Bacteria | 1152 |
| 466 | Ga0307411_10037459 | 3300032005 | Bacteria | 3050 |
| 467 | Ga0307415_100034769 | 3300032126 | Bacteria | 3285 |
| 468 | Ga0307507_10000031 | 3300033179 | Bacteria | 195619 |
| 469 | Ga0307507_10027619 | 3300033179 | Bacteria | 6077 |
| 470 | Ga0307510_10054575 | 3300033180 | Bacteria | 4183 |
| 471 | Ga0307510_10081429 | 3300033180 | Bacteria | 3139 |
| 472 | Ga0315913_1000055 | 3300033430 | Bacteria | 58182 |
| 473 | Ga0315915_1000003 | 3300033464 | Bacteria | 407996 |
| 474 | Ga0373927_0257806 | 3300035695 | Bacteria | 1147 |
| 475 | Ga0373937_0619954 | 3300036401 | Bacteria | 1027 |
| 476 | Ga0373925_0242447 | 3300037068 | Bacteria | 1444 |
| 477 | Ga0395899_0006280 | 3300037312 | Bacteria | 9202 |
| 478 | Ga0395899_0033153 | 3300037312 | Bacteria | 3879 |
| 479 | Ga0395899_0048208 | 3300037312 | Bacteria | 3171 |
| 480 | Ga0395899_0071224 | 3300037312 | Bacteria | 2544 |
| 481 | Ga0395900_0003467 | 3300037418 | Bacteria | 17031 |
| 482 | Ga0395900_0021722 | 3300037418 | Bacteria | 6561 |
| 483 | Ga0395900_0436125 | 3300037418 | Bacteria | 1268 |
| 484 | Ga0395900_0502445 | 3300037418 | Bacteria | 1163 |
| 485 | Ga0395898_0160851 | 3300037466 | Bacteria | 2147 |
| 486 | Ga0395898_0358951 | 3300037466 | Bacteria | 1389 |
| 487 | Ga0436364_0049675 | 3300037853 | Bacteria | 9744 |
| 488 | Ga0395901_0043533 | 3300038443 | Bacteria | 4657 |
| 489 | Ga0395901_0064452 | 3300038443 | Bacteria | 3814 |
| 490 | Ga0395901_0101100 | 3300038443 | Bacteria | 3025 |
| 491 | Ga0395901_0121877 | 3300038443 | Bacteria | 2740 |
| 492 | Ga0395901_0345048 | 3300038443 | Bacteria | 1538 |
| 493 | Ga0436360_0070791 | 3300039438 | Bacteria | 2255 |
| 494 | Ga0436360_1222189 | 3300039438 | Bacteria | 1673 |
| 495 | Ga0436360_1362121 | 3300039438 | Bacteria | 4724 |
| 496 | Ga0439465_0028012 | 3300041413 | Bacteria | 1785 |
| 497 | Ga0451797_0381403 | 3300041453 | Bacteria | 2763 |
| 498 | Ga0451798_0043797 | 3300041458 | Bacteria | 1666 |
| 499 | Ga0451800_0474694 | 3300041459 | Bacteria | 998 |
| 500 | Ga0451839_0282160 | 3300041496 | Bacteria | 2520 |
| 501 | Ga0451841_1056658 | 3300041498 | Bacteria | 2202 |
| 502 | Ga0451845_0333885 | 3300041501 | Bacteria | 4304 |
| 503 | Ga0439433_0003847 | 3300041999 | Bacteria | 3229 |
| 504 | Ga0439449_0000030 | 3300042007 | Bacteria | 42422 |
| 505 | Ga0439462_0000211 | 3300042015 | Bacteria | 10221 |
| 506 | Ga0439435_0000577 | 3300042436 | Bacteria | 5937 |
| 507 | Ga0439435_0008601 | 3300042436 | Bacteria | 2371 |
| 508 | Ga0439459_0012984 | 3300042438 | Bacteria | 1492 |
| 509 | Ga0466969_0009201 | 3300044656 | Bacteria | 5238 |
| 510 | Ga0466969_0015324 | 3300044656 | Bacteria | 4018 |
| 511 | Ga0466965_0207935 | 3300044683 | Bacteria | 1040 |
| 512 | Ga0466968_0066731 | 3300044735 | Bacteria | 1559 |
| 513 | Ga0466970_0174421 | 3300044765 | Bacteria | 1192 |
| 514 | Ga0466958_0199331 | 3300045836 | Bacteria | 1274 |
| 515 | Ga0466967_0365170 | 3300045976 | Bacteria | 1399 |
| 516 | Ga0466967_0952200 | 3300045976 | Bacteria | 854 |
| 517 | Ga0495627_048861 | 3300046453 | Bacteria | 1279 |
| 518 | Ga0495592_0015000 | 3300046454 | Bacteria | 5883 |
| 519 | Ga0495580_0003246 | 3300046472 | Bacteria | 13908 |
| 520 | Ga0495605_0123267 | 3300046474 | Bacteria | 1174 |
| 521 | Ga0495664_0100690 | 3300046477 | Bacteria | 1741 |
| 522 | Ga0495585_0006815 | 3300046492 | Bacteria | 7049 |
| 523 | Ga0495596_0038697 | 3300046500 | Bacteria | 1885 |
| 524 | Ga0495607_0030405 | 3300046501 | Bacteria | 3316 |
| 525 | Ga0495606_0001613 | 3300046507 | Bacteria | 29410 |
| 526 | Ga0495606_0017853 | 3300046507 | Bacteria | 5343 |
| 527 | Ga0495606_0101858 | 3300046507 | Bacteria | 1747 |
| 528 | Ga0495606_0162551 | 3300046507 | Bacteria | 1302 |
| 529 | Ga0495610_0004867 | 3300046512 | Bacteria | 9766 |
| 530 | Ga0495610_0006514 | 3300046512 | Bacteria | 8009 |
| 531 | Ga0495610_0050685 | 3300046512 | Bacteria | 2025 |
| 532 | Ga0495616_0052731 | 3300046513 | Bacteria | 2024 |
| 533 | Ga0495620_0035733 | 3300046515 | Bacteria | 2230 |
| 534 | Ga0495632_0004032 | 3300046519 | Bacteria | 10137 |
| 535 | Ga0495643_0010669 | 3300046522 | Bacteria | 5644 |
| 536 | Ga0495643_0049454 | 3300046522 | Bacteria | 2267 |
| 537 | Ga0495648_0043505 | 3300046524 | Bacteria | 2814 |
| 538 | Ga0495648_0049708 | 3300046524 | Bacteria | 2568 |
| 539 | Ga0495648_0097122 | 3300046524 | Bacteria | 1635 |
| 540 | Ga0495648_0152277 | 3300046524 | Bacteria | 1205 |
| 541 | Ga0495652_0134912 | 3300046529 | Bacteria | 1949 |
| 542 | Ga0495645_0018535 | 3300046543 | Bacteria | 5001 |
| 543 | Ga0495622_0115960 | 3300046557 | Bacteria | 1225 |
| 544 | Ga0495633_0033803 | 3300046558 | Bacteria | 2464 |
| 545 | Ga0495633_0033929 | 3300046558 | Bacteria | 2457 |
| 546 | Ga0495668_0034453 | 3300046616 | Bacteria | 2840 |
| 547 | Ga0495625_0125786 | 3300046660 | Bacteria | 1740 |
| 548 | Ga0495625_0137960 | 3300046660 | Bacteria | 1647 |
| 549 | Ga0495625_0143473 | 3300046660 | Bacteria | 1609 |
| 550 | Ga0495624_0166512 | 3300046690 | Bacteria | 1345 |
| 551 | Ga0495670_0027101 | 3300046691 | Bacteria | 2837 |
| 552 | Ga0495670_0102610 | 3300046691 | Bacteria | 1474 |
| 553 | Ga0495649_0028640 | 3300046694 | Bacteria | 3087 |
| 554 | Ga0495600_0030281 | 3300046809 | Bacteria | 3506 |
| 555 | Ga0495660_0042753 | 3300046810 | Bacteria | 2502 |
| 556 | Ga0495604_0012273 | 3300047317 | Bacteria | 6811 |
| 557 | Ga0495604_0025521 | 3300047317 | Bacteria | 4709 |
| 558 | Ga0495636_0099378 | 3300047318 | Bacteria | 1271 |
| 559 | Ga0495680_0070768 | 3300047322 | Bacteria | 2658 |
| 560 | Ga0495683_0032607 | 3300047323 | Bacteria | 2653 |
| 561 | Ga0495683_0094314 | 3300047323 | Bacteria | 1446 |
| 562 | Ga0495687_011064 | 3300047443 | Bacteria | 4882 |
| 563 | Ga0495686_0013754 | 3300047472 | Bacteria | 5606 |
| 564 | Ga0495686_0017404 | 3300047472 | Bacteria | 4845 |
| 565 | Ga0495626_0039058 | 3300048091 | Bacteria | 2248 |
| 566 | Ga0496104_0041056 | 3300048907 | Bacteria | 4337 |
| 567 | Ga0496106_0000490 | 3300048909 | Bacteria | 28105 |
| 568 | Ga0496106_0000825 | 3300048909 | Bacteria | 22458 |
| 569 | Ga0496106_0175938 | 3300048909 | Bacteria | 1698 |
| 570 | Ga0496110_0147742 | 3300048913 | Bacteria | 2127 |
| 571 | Ga0496112_0319663 | 3300048915 | Bacteria | 1496 |
| 572 | Ga0496115_0073680 | 3300048918 | Bacteria | 2772 |
| 573 | Ga0496116_0008774 | 3300048919 | Bacteria | 8720 |
| 574 | Ga0496116_0015457 | 3300048919 | Bacteria | 6033 |
| 575 | Ga0496116_0019715 | 3300048919 | Bacteria | 5155 |
| 576 | Ga0496117_0000036 | 3300048920 | Bacteria | 325635 |
| 577 | Ga0496117_0012929 | 3300048920 | Bacteria | 7315 |
| 578 | Ga0496118_0019730 | 3300048921 | Bacteria | 6012 |
| 579 | Ga0496118_0027736 | 3300048921 | Bacteria | 4784 |
| 580 | Ga0496118_0083178 | 3300048921 | Bacteria | 2239 |
| 581 | Ga0496119_0185140 | 3300048922 | Bacteria | 1089 |
| 582 | Ga0496120_0000036 | 3300048923 | Bacteria | 206505 |
| 583 | Ga0496120_0004721 | 3300048923 | Bacteria | 11220 |
| 584 | Ga0496121_0000005 | 3300048924 | Bacteria | 1034486 |
| 585 | Ga0496121_0000759 | 3300048924 | Bacteria | 59261 |
| 586 | Ga0496121_0002070 | 3300048924 | Bacteria | 31759 |
| 587 | Ga0496121_0041492 | 3300048924 | Bacteria | 4020 |
| 588 | Ga0496121_0147816 | 3300048924 | Bacteria | 1734 |
| 589 | Ga0496121_0155643 | 3300048924 | Bacteria | 1677 |
| 590 | Ga0496121_0187494 | 3300048924 | Bacteria | 1486 |
| 591 | Ga0496122_0000002 | 3300048925 | Bacteria | 905834 |
| 592 | Ga0496122_0000006 | 3300048925 | Bacteria | 625811 |
| 593 | Ga0496122_0005964 | 3300048925 | Bacteria | 14259 |
| 594 | Ga0496122_0008486 | 3300048925 | Bacteria | 11065 |
| 595 | Ga0496122_0016734 | 3300048925 | Bacteria | 6911 |
| 596 | Ga0496122_0128499 | 3300048925 | Bacteria | 1616 |
| 597 | Ga0496122_0130891 | 3300048925 | Bacteria | 1594 |
| 598 | Ga0496122_0154459 | 3300048925 | Bacteria | 1410 |
| 599 | Ga0496123_0000002 | 3300048926 | Bacteria | 1811682 |
| 600 | Ga0496123_0007011 | 3300048926 | Bacteria | 10743 |
| 601 | Ga0496123_0011879 | 3300048926 | Bacteria | 7485 |
| 602 | Ga0496123_0016819 | 3300048926 | Bacteria | 5913 |
| 603 | Ga0496124_0000080 | 3300048927 | Bacteria | 210439 |
| 604 | Ga0496124_0013952 | 3300048927 | Bacteria | 7804 |
| 605 | Ga0496124_0091559 | 3300048927 | Bacteria | 2477 |
| 606 | Ga0496124_0134733 | 3300048927 | Bacteria | 1957 |
| 607 | Ga0496124_0213432 | 3300048927 | Bacteria | 1458 |
| 608 | Ga0496125_0000157 | 3300048928 | Bacteria | 151351 |
| 609 | Ga0496125_0000159 | 3300048928 | Bacteria | 151205 |
| 610 | Ga0496125_0000381 | 3300048928 | Bacteria | 82386 |
| 611 | Ga0496125_0012248 | 3300048928 | Bacteria | 8528 |
| 612 | Ga0496125_0038894 | 3300048928 | Bacteria | 4107 |
| 613 | Ga0496125_0049918 | 3300048928 | Bacteria | 3470 |
| 614 | Ga0496126_0000016 | 3300048929 | Bacteria | 625843 |
| 615 | Ga0496126_0189926 | 3300048929 | Bacteria | 1740 |
| 616 | Ga0496126_0214915 | 3300048929 | Bacteria | 1618 |
| 617 | Ga0501031_0143633 | 3300049568 | Bacteria | 1559 |
| 618 | Ga0501031_0158256 | 3300049568 | Bacteria | 1481 |
| 619 | Ga0501032_0018412 | 3300049569 | Bacteria | 4894 |
| 620 | Ga0501032_0019351 | 3300049569 | Bacteria | 4763 |
| 621 | Ga0501033_0003769 | 3300049570 | Bacteria | 12316 |
| 622 | Ga0501033_0017798 | 3300049570 | Bacteria | 5366 |
| 623 | Ga0501033_0024093 | 3300049570 | Bacteria | 4593 |
| 624 | Ga0501033_0087165 | 3300049570 | Bacteria | 2285 |
| 625 | Ga0501034_0009157 | 3300049571 | Bacteria | 10386 |
| 626 | Ga0501034_0027120 | 3300049571 | Bacteria | 5827 |
| 627 | Ga0501034_0035747 | 3300049571 | Bacteria | 5036 |
| 628 | Ga0501034_0049658 | 3300049571 | Bacteria | 4233 |
| 629 | Ga0501034_0051191 | 3300049571 | Bacteria | 4164 |
| 630 | Ga0501034_0053440 | 3300049571 | Bacteria | 4067 |
| 631 | Ga0501034_0055346 | 3300049571 | Bacteria | 3992 |
| 632 | Ga0501034_0094033 | 3300049571 | Bacteria | 2994 |
| 633 | Ga0501034_0106081 | 3300049571 | Bacteria | 2802 |
| 634 | Ga0501034_0162302 | 3300049571 | Bacteria | 2205 |
| 635 | Ga0501034_0194599 | 3300049571 | Bacteria | 1988 |
| 636 | Ga0501034_0262567 | 3300049571 | Bacteria | 1669 |
| 637 | Ga0501036_0021649 | 3300049572 | Bacteria | 5405 |
| 638 | Ga0501036_0040760 | 3300049572 | Bacteria | 3929 |
| 639 | Ga0501036_0073083 | 3300049572 | Bacteria | 2900 |
| 640 | Ga0501036_0089301 | 3300049572 | Bacteria | 2604 |
| 641 | Ga0501037_0007341 | 3300049573 | Bacteria | 8060 |
| 642 | Ga0501037_0049740 | 3300049573 | Bacteria | 3069 |
| 643 | Ga0501038_0006334 | 3300049574 | Bacteria | 10950 |
| 644 | Ga0501038_0018372 | 3300049574 | Bacteria | 6312 |
| 645 | Ga0501038_0047708 | 3300049574 | Bacteria | 3709 |
| 646 | Ga0501038_0073514 | 3300049574 | Bacteria | 2895 |
| 647 | Ga0501038_0172259 | 3300049574 | Bacteria | 1751 |
| 648 | Ga0501039_0136324 | 3300049575 | Bacteria | 1927 |
| 649 | Ga0501046_0022934 | 3300049580 | Bacteria | 5140 |
| 650 | Ga0501046_0070745 | 3300049580 | Bacteria | 2712 |
| 651 | Ga0501047_0031860 | 3300049581 | Bacteria | 5087 |
| 652 | Ga0501047_0032607 | 3300049581 | Bacteria | 5029 |
| 653 | Ga0501047_0215888 | 3300049581 | Bacteria | 1775 |
| 654 | Ga0501067_0269767 | 3300049583 | Bacteria | 948 |
| 655 | Ga0501070_0019852 | 3300049586 | Bacteria | 5635 |
| 656 | Ga0501070_0030405 | 3300049586 | Bacteria | 4525 |
| 657 | Ga0501073_0117499 | 3300049589 | Bacteria | 1843 |
| 658 | Ga0501073_0190278 | 3300049589 | Bacteria | 1420 |
| 659 | Ga0501217_011460 | 3300049661 | Bacteria | 1962 |
| 660 | Ga0501217_050909 | 3300049661 | Bacteria | 1082 |
| 661 | Ga0501233_016079 | 3300049668 | Bacteria | 1548 |
| 662 | Ga0501242_016380 | 3300049674 | Bacteria | 929 |
| 663 | Ga0501243_005207 | 3300049675 | Bacteria | 1956 |
| 664 | Ga0501245_004493 | 3300049708 | Bacteria | 1916 |
| 665 | Ga0501080_0072761 | 3300049742 | Bacteria | 3198 |
| 666 | Ga0501080_0370275 | 3300049742 | Bacteria | 1292 |
| 667 | Ga0501270_003511 | 3300049767 | Bacteria | 1698 |
| 668 | Ga0501035_0020784 | 3300049822 | Bacteria | 6032 |
| 669 | Ga0501035_0020842 | 3300049822 | Bacteria | 6023 |
| 670 | Ga0501035_0174302 | 3300049822 | Bacteria | 1856 |
| 671 | Ga0501035_0400769 | 3300049822 | Bacteria | 1141 |
| 672 | Ga0501044_0063429 | 3300049823 | Bacteria | 3775 |
| 673 | Ga0501044_0089190 | 3300049823 | Bacteria | 3113 |
| 674 | Ga0501044_0272994 | 3300049823 | Bacteria | 1626 |
| 675 | Ga0501044_0288956 | 3300049823 | Bacteria | 1571 |
| 676 | nmdc:mga03683_170205_c1 | 3300050489 | Bacteria | 989 |
| 677 | nmdc:mga03n38_181885_c1 | 3300050490 | Bacteria | 1078 |
| 678 | nmdc:mga03n38_5252_c1 | 3300050490 | Bacteria | 4390 |
| 679 | nmdc:mga00v17_19_c1 | 3300050491 | Bacteria | 115002 |
| 680 | nmdc:mga00v17_27140_c1 | 3300050491 | Bacteria | 3341 |
| 681 | nmdc:mga00v17_45003_c1 | 3300050491 | Bacteria | 2664 |
| 682 | nmdc:mga00v17_90406_c1 | 3300050491 | Bacteria | 1922 |
| 683 | nmdc:mga0yw44_1027_c1 | 3300050492 | Bacteria | 10708 |
| 684 | nmdc:mga0yw44_2126_c1 | 3300050492 | Bacteria | 8307 |
| 685 | nmdc:mga0yw44_26417_c1 | 3300050492 | Bacteria | 3316 |
| 686 | nmdc:mga0yw44_337590_c1 | 3300050492 | Bacteria | 1013 |
| 687 | nmdc:mga0yw44_5426_c1 | 3300050492 | Bacteria | 6023 |
| 688 | nmdc:mga0yw44_57140_c1 | 3300050492 | Bacteria | 2380 |
| 689 | nmdc:mga0yw44_972_c1 | 3300050492 | Bacteria | 10912 |
| 690 | nmdc:mga0k408_45584_c1 | 3300050493 | Bacteria | 2530 |
| 691 | nmdc:mga0k408_52776_c1 | 3300050493 | Bacteria | 2356 |
| 692 | nmdc:mga0k408_58554_c1 | 3300050493 | Bacteria | 2238 |
| 693 | nmdc:mga06z11_2365_c1 | 3300050494 | Bacteria | 7181 |
| 694 | nmdc:mga06z11_261837_c1 | 3300050494 | Bacteria | 1021 |
| 695 | nmdc:mga06z11_2714_c1 | 3300050494 | Bacteria | 6779 |
| 696 | nmdc:mga06z11_2817_c1 | 3300050494 | Bacteria | 6671 |
| 697 | nmdc:mga04h51_2124_c1 | 3300050495 | Bacteria | 4646 |
| 698 | nmdc:mga04h51_21632_c1 | 3300050495 | Bacteria | 1641 |
| 699 | nmdc:mga04h51_4204_c1 | 3300050495 | Bacteria | 3561 |
| 700 | nmdc:mga07m45_10042_c1 | 3300050496 | Bacteria | 4929 |
| 701 | nmdc:mga07m45_105104_c1 | 3300050496 | Bacteria | 1624 |
| 702 | nmdc:mga07m45_48111_c1 | 3300050496 | Bacteria | 2398 |
| 703 | nmdc:mga07m45_51046_c1 | 3300050496 | Bacteria | 2332 |
| 704 | nmdc:mga07m45_5763_c1 | 3300050496 | Bacteria | 5215 |
| 705 | nmdc:mga07m45_81937_c1 | 3300050496 | Bacteria | 1843 |
| 706 | nmdc:mga08y16_358915_c1 | 3300050511 | Bacteria | 1496 |
| 707 | nmdc:mga08y16_388677_c1 | 3300050511 | Bacteria | 1429 |
| 708 | nmdc:mga08x19_52150_c1 | 3300050514 | Bacteria | 2630 |
| 709 | nmdc:mga0sz30_14395_c1 | 3300050516 | Bacteria | 3112 |
| 710 | nmdc:mga0sz30_1633_c1 | 3300050516 | Bacteria | 7984 |
| 711 | nmdc:mga0sz30_19320_c1 | 3300050516 | Bacteria | 2738 |
| 712 | nmdc:mga0sz30_48680_c1 | 3300050516 | Bacteria | 1794 |
| 713 | Ga0500651_0012275 | 3300053093 | Bacteria | 5193 |
| 714 | Ga0500560_000204 | 3300053107 | Bacteria | 7053 |
| 715 | Ga0500560_035782 | 3300053107 | Bacteria | 1530 |
| 716 | Ga0500572_001954 | 3300053111 | Bacteria | 5169 |
| 717 | Ga0500572_011801 | 3300053111 | Bacteria | 2124 |
| 718 | Ga0500595_000538 | 3300053119 | Bacteria | 22785 |
| 719 | Ga0500618_001007 | 3300053125 | Bacteria | 14209 |
| 720 | Ga0500642_0028242 | 3300053130 | Bacteria | 2312 |
| 721 | Ga0500658_0000083 | 3300053134 | Bacteria | 43599 |
| 722 | Ga0500659_0046074 | 3300053135 | Bacteria | 2360 |
| 723 | Ga0500559_0000052 | 3300053136 | Bacteria | 91218 |
| 724 | Ga0500561_0000036 | 3300053137 | Bacteria | 27979 |
| 725 | Ga0500568_0004136 | 3300053139 | Bacteria | 7850 |
| 726 | Ga0500568_0030232 | 3300053139 | Bacteria | 2244 |
| 727 | Ga0500573_0054464 | 3300053140 | Bacteria | 2296 |
| 728 | Ga0500616_0000027 | 3300053153 | Bacteria | 441053 |
| 729 | Ga0500622_0000308 | 3300053156 | Bacteria | 50027 |
| 730 | Ga0500622_0061320 | 3300053156 | Bacteria | 1917 |
| 731 | Ga0500624_001367 | 3300053157 | Bacteria | 4088 |
| 732 | Ga0500624_004302 | 3300053157 | Bacteria | 1871 |
| 733 | Ga0500634_0000016 | 3300053161 | Bacteria | 112185 |
| 734 | Ga0500634_0000032 | 3300053161 | Bacteria | 74391 |
| 735 | Ga0500634_0000373 | 3300053161 | Bacteria | 14283 |
| 736 | Ga0500636_0000011 | 3300053177 | Bacteria | 140769 |
| 737 | Ga0500636_0000283 | 3300053177 | Bacteria | 28087 |
| 738 | Ga0500645_003845 | 3300053730 | Bacteria | 5949 |
| 739 | Ga0500645_009307 | 3300053730 | Bacteria | 3305 |
| 740 | Ga0500609_004423 | 3300053731 | Bacteria | 1943 |
| 741 | Ga0587088_016049 | 3300059508 | Bacteria | 1188 |
| 742 | Ga0587067_000714 | 3300059640 | Bacteria | 3159 |
| 743 | Ga0587079_006606 | 3300059647 | Bacteria | 1698 |
| 744 | Ga0587107_001655 | 3300059652 | Bacteria | 1860 |
Family Sequences
| Sample | Scaffold | Protein | Protein Length | |
|---|---|---|---|---|
| 1 | 3300045976 | Ga0466967_0952200 | Ga0466967_0952200_16_786 | 251 |
| 2 | 3300009036 | Ga0105244_10097039 | Ga0105244_100970392 | 264 |
| 3 | 3300049674 | Ga0501242_016380 | Ga0501242_016380_28_852 | 272 |
| 4 | 3300049580 | Ga0501046_0070745 | Ga0501046_0070745_412_1347 | 274 |
| 5 | 3300049581 | Ga0501047_0215888 | Ga0501047_0215888_118_1053 | 274 |
| 6 | 3300049823 | Ga0501044_0063429 | Ga0501044_0063429_1159_2094 | 274 |
| 7 | iso_pu_bacteria | 2840764183 | 2840768351 | 275 |
| 8 | 3300005937 | Ga0081455_10243547 | Ga0081455_102435472 | 278 |
| 9 | iso_pu_bacteria | 2889790730 | 2889795100 | 278 |
| 10 | 3300049583 | Ga0501067_0269767 | Ga0501067_0269767_21_872 | 280 |
| 11 | 3300005539 | Ga0068853_100059131 | Ga0068853_1000591312 | 281 |
| 12 | 3300005563 | Ga0068855_100073222 | Ga0068855_1000732222 | 281 |
| 13 | 3300025904 | Ga0207647_10021122 | Ga0207647_100211225 | 281 |
| 14 | 3300037312 | Ga0395899_0006280 | Ga0395899_0006280_3953_4858 | 281 |
| 15 | 3300037418 | Ga0395900_0003467 | Ga0395900_0003467_2518_3423 | 281 |
| 16 | 3300037466 | Ga0395898_0358951 | Ga0395898_0358951_369_1274 | 281 |
| 17 | 3300038443 | Ga0395901_0121877 | Ga0395901_0121877_564_1469 | 281 |
| 18 | 3300002987 | JGI25159J45721_1014554 | JGI25159J45721_10145542 | 282 |
| 19 | 3300003316 | rootH1_10059358 | rootH1_100593582 | 282 |
| 20 | 3300003354 | JGI25160J50197_1011926 | JGI25160J50197_10119262 | 282 |
| 21 | 3300036401 | Ga0373937_0619954 | Ga0373937_0619954_160_1008 | 282 |
| 22 | 3300046512 | Ga0495610_0004867 | Ga0495610_0004867_8627_9475 | 282 |
| 23 | 3300037853 | Ga0436364_0049675 | Ga0436364_0049675_5176_6039 | 283 |
| 24 | 3300046492 | Ga0495585_0006815 | Ga0495585_0006815_3181_4152 | 283 |
| 25 | 3300047317 | Ga0495604_0012273 | Ga0495604_0012273_2685_3656 | 283 |
| 26 | 3300009094 | Ga0111539_10180832 | Ga0111539_101808322 | 284 |
| 27 | 3300046477 | Ga0495664_0100690 | Ga0495664_0100690_870_1724 | 284 |
| 28 | 3300050511 | nmdc:mga08y16_358915_c1 | nmdc:mga08y16_358915_c1_275_1189 | 284 |
| 29 | 3300003781 | Ga0055536_1017062 | Ga0055536_10170622 | 285 |
| 30 | 3300025292 | Ga0209676_1000256 | Ga0209676_100025618 | 285 |
| 31 | 3300025298 | Ga0209050_1023572 | Ga0209050_10235722 | 285 |
| 32 | iso_pu_bacteria | 2857733635 | 2857735609 | 285 |
| 33 | 3300028653 | Ga0265323_10020328 | Ga0265323_100203282 | 286 |
| 34 | 3300028654 | Ga0265322_10001864 | Ga0265322_100018647 | 286 |
| 35 | 3300031235 | Ga0265330_10022425 | Ga0265330_100224252 | 286 |
| 36 | 3300031344 | Ga0265316_10060596 | Ga0265316_100605963 | 286 |
| 37 | 3300031712 | Ga0265342_10003529 | Ga0265342_100035293 | 286 |
| 38 | 3300048924 | Ga0496121_0147816 | Ga0496121_0147816_705_1637 | 287 |
| 39 | 3300053139 | Ga0500568_0030232 | Ga0500568_0030232_604_1506 | 287 |
| 40 | 3300003775 | Ga0055524_1000517 | Ga0055524_10005172 | 288 |
| 41 | 3300013249 | Ga0171463_1002 | Ga0171463_1002383 | 288 |
| 42 | 3300015690 | Ga0183363_1046 | Ga0183363_104612 | 288 |
| 43 | 3300025299 | Ga0209256_1000260 | Ga0209256_100026031 | 288 |
| 44 | 3300049742 | Ga0501080_0370275 | Ga0501080_0370275_305_1225 | 288 |
| 45 | iso_pu_bacteria | 2513237094 | 2513641466 | 288 |
| 46 | iso_pu_bacteria | 2593339198 | 2595316128 | 288 |
| 47 | 3300031239 | Ga0265328_10036213 | Ga0265328_100362132 | 289 |
| 48 | 3300031240 | Ga0265320_10070181 | Ga0265320_100701811 | 289 |
| 49 | 3300048924 | Ga0496121_0187494 | Ga0496121_0187494_566_1438 | 290 |
| 50 | iso_pu_bacteria | 2585428059 | 2587737654 | 290 |
| 51 | iso_pu_bacteria | 2643221676 | 2644423258 | 290 |
| 52 | iso_pu_bacteria | 2791355222 | 2793185479 | 290 |
| 53 | iso_pu_bacteria | 2818991459 | 2819670665 | 290 |
| 54 | iso_pu_bacteria | 2864997549 | 2865000619 | 290 |
| 55 | iso_pu_bacteria | 2904113452 | 2904115525 | 290 |
| 56 | iso_pu_bacteria | 2904755435 | 2904759953 | 290 |
| 57 | iso_pu_bacteria | 2919425241 | 2919429232 | 290 |
| 58 | iso_pu_bacteria | 2980125574 | 2980126155 | 290 |
| 59 | iso_pu_bacteria | 3006969106 | 3006971405 | 290 |
| 60 | iso_pu_bacteria | 8005658619 | 8005661175 | 290 |
| 61 | 3300005539 | Ga0068853_100131600 | Ga0068853_1001316002 | 291 |
| 62 | 3300007788 | Ga0099795_10045681 | Ga0099795_100456811 | 291 |
| 63 | 3300026041 | Ga0207639_10383083 | Ga0207639_103830832 | 291 |
| 64 | 3300049571 | Ga0501034_0055346 | Ga0501034_0055346_1549_2424 | 291 |
| 65 | iso_pu_bacteria | 2511231027 | 2511391066 | 291 |
| 66 | iso_pu_bacteria | 2513237351 | 2514587952 | 291 |
| 67 | iso_pu_bacteria | 2857453340 | 2857454712 | 291 |
| 68 | iso_pu_bacteria | 2971410472 | 2971413126 | 291 |
| 69 | iso_pu_bacteria | 2980182181 | 2980185150 | 291 |
| 70 | iso_pu_bacteria | 8056533031 | 8056538254 | 291 |
| 71 | 3300005985 | Ga0081539_10002139 | Ga0081539_100021399 | 292 |
| 72 | 3300037312 | Ga0395899_0033153 | Ga0395899_0033153_2771_3667 | 292 |
| 73 | 3300037312 | Ga0395899_0071224 | Ga0395899_0071224_891_1787 | 292 |
| 74 | 3300041999 | Ga0439433_0003847 | Ga0439433_0003847_1133_2032 | 292 |
| 75 | 3300042007 | Ga0439449_0000030 | Ga0439449_0000030_26536_27435 | 292 |
| 76 | 3300042015 | Ga0439462_0000211 | Ga0439462_0000211_2635_3534 | 292 |
| 77 | 3300044656 | Ga0466969_0015324 | Ga0466969_0015324_63_962 | 292 |
| 78 | iso_pu_bacteria | 2515154155 | 2515857267 | 292 |
| 79 | iso_pu_bacteria | 2593339198 | 2595318716 | 292 |
| 80 | iso_pu_bacteria | 2857453340 | 2857458960 | 292 |
| 81 | iso_pu_bacteria | 2971410472 | 2971414273 | 292 |
| 82 | iso_pu_bacteria | 2984527788 | 2984532597 | 292 |
| 83 | iso_pu_bacteria | 2984532647 | 2984533854 | 292 |
| 84 | iso_pu_bacteria | 8056533031 | 8056535505 | 292 |
| 85 | 3300003751 | Ga0055538_1000546 | Ga0055538_10005462 | 293 |
| 86 | 3300025224 | Ga0209784_100078 | Ga0209784_10007823 | 293 |
| 87 | 3300048919 | Ga0496116_0008774 | Ga0496116_0008774_533_1432 | 293 |
| 88 | 3300048928 | Ga0496125_0049918 | Ga0496125_0049918_1653_2570 | 293 |
| 89 | iso_pu_bacteria | 2585428059 | 2587745177 | 293 |
| 90 | iso_pu_bacteria | 2864733723 | 2864737734 | 293 |
| 91 | iso_pu_bacteria | 3006988479 | 3006991278 | 293 |
| 92 | 3300048919 | Ga0496116_0015457 | Ga0496116_0015457_4669_5571 | 294 |
| 93 | 3300048925 | Ga0496122_0000006 | Ga0496122_0000006_607847_608752 | 294 |
| 94 | 3300048925 | Ga0496122_0005964 | Ga0496122_0005964_5522_6424 | 294 |
| 95 | 3300048926 | Ga0496123_0007011 | Ga0496123_0007011_7836_8738 | 294 |
| 96 | 3300048926 | Ga0496123_0016819 | Ga0496123_0016819_4921_5826 | 294 |
| 97 | 3300048927 | Ga0496124_0013952 | Ga0496124_0013952_3561_4463 | 294 |
| 98 | 3300048928 | Ga0496125_0012248 | Ga0496125_0012248_3710_4612 | 294 |
| 99 | 3300048929 | Ga0496126_0000016 | Ga0496126_0000016_607847_608752 | 294 |
| 100 | iso_pu_bacteria | 2512564039 | 2512731944 | 294 |
| 101 | iso_pu_bacteria | 2585428059 | 2587742403 | 294 |
| 102 | iso_pu_bacteria | 2593339198 | 2595318937 | 294 |
| 103 | iso_pu_bacteria | 2643221676 | 2644427208 | 294 |
| 104 | iso_pu_bacteria | 2818991459 | 2819673572 | 294 |
| 105 | iso_pu_bacteria | 2904755435 | 2904757091 | 294 |
| 106 | 3300025304 | Ga0209257_1004297 | Ga0209257_10042977 | 295 |
| 107 | 3300044765 | Ga0466970_0174421 | Ga0466970_0174421_190_1077 | 295 |
| 108 | 3300048925 | Ga0496122_0130891 | Ga0496122_0130891_654_1541 | 295 |
| 109 | 3300048925 | Ga0496122_0154459 | Ga0496122_0154459_54_941 | 295 |
| 110 | 3300048929 | Ga0496126_0189926 | Ga0496126_0189926_797_1684 | 295 |
| 111 | 3300049570 | Ga0501033_0003769 | Ga0501033_0003769_8401_9399 | 295 |
| 112 | 3300049571 | Ga0501034_0094033 | Ga0501034_0094033_334_1332 | 295 |
| 113 | 3300049572 | Ga0501036_0073083 | Ga0501036_0073083_1689_2687 | 295 |
| 114 | 3300053139 | Ga0500568_0004136 | Ga0500568_0004136_2340_3290 | 295 |
| 115 | 3300053161 | Ga0500634_0000016 | Ga0500634_0000016_67257_68156 | 295 |
| 116 | 3300053731 | Ga0500609_004423 | Ga0500609_004423_521_1471 | 295 |
| 117 | iso_pu_bacteria | 2519899620 | 2520378319 | 295 |
| 118 | iso_pu_bacteria | 2838022645 | 2838028209 | 295 |
| 119 | iso_pu_bacteria | 2838686498 | 2838689957 | 295 |
| 120 | iso_pu_bacteria | 2842198810 | 2842204363 | 295 |
| 121 | iso_pu_bacteria | 2842205361 | 2842208780 | 295 |
| 122 | iso_pu_bacteria | 2842243621 | 2842245737 | 295 |
| 123 | iso_pu_bacteria | 2842257432 | 2842260115 | 295 |
| 124 | iso_pu_bacteria | 2842271015 | 2842273559 | 295 |
| 125 | iso_pu_bacteria | 2842278818 | 2842282530 | 295 |
| 126 | iso_pu_bacteria | 2844533157 | 2844537565 | 295 |
| 127 | 3300002987 | JGI25159J45721_1005637 | JGI25159J45721_10056373 | 296 |
| 128 | 3300003187 | JGI25151J46595_10000387 | JGI25151J46595_1000038711 | 296 |
| 129 | 3300003203 | JGI25406J46586_10024954 | JGI25406J46586_100249542 | 296 |
| 130 | 3300003354 | JGI25160J50197_1004618 | JGI25160J50197_10046184 | 296 |
| 131 | 3300005985 | Ga0081539_10012392 | Ga0081539_100123927 | 296 |
| 132 | 3300025284 | Ga0209130_1000252 | Ga0209130_10002528 | 296 |
| 133 | 3300025294 | Ga0209025_1000908 | Ga0209025_100090831 | 296 |
| 134 | 3300025297 | Ga0209758_1002227 | Ga0209758_10022274 | 296 |
| 135 | 3300025302 | Ga0207426_1000098 | Ga0207426_1000098173 | 296 |
| 136 | 3300046512 | Ga0495610_0050685 | Ga0495610_0050685_461_1381 | 296 |
| 137 | 3300048927 | Ga0496124_0134733 | Ga0496124_0134733_707_1621 | 296 |
| 138 | 3300045836 | Ga0466958_0199331 | Ga0466958_0199331_123_1112 | 297 |
| 139 | iso_pu_bacteria | 2643221629 | 2644168390 | 297 |
| 140 | iso_pu_bacteria | 2643221662 | 2644349924 | 297 |
| 141 | iso_pu_bacteria | 2842871566 | 2842874210 | 297 |
| 142 | 3300003214 | JGI25165J46597_1004993 | JGI25165J46597_10049932 | 298 |
| 143 | 3300025231 | Ga0207427_103104 | Ga0207427_1031042 | 298 |
| 144 | 3300025261 | Ga0209233_1000290 | Ga0209233_100029040 | 298 |
| 145 | 3300031911 | Ga0307412_10015156 | Ga0307412_100151564 | 298 |
| 146 | 3300032002 | Ga0307416_100096972 | Ga0307416_1000969723 | 298 |
| 147 | 3300032004 | Ga0307414_10430791 | Ga0307414_104307912 | 298 |
| 148 | 3300033179 | Ga0307507_10000031 | Ga0307507_1000003199 | 298 |
| 149 | 3300037068 | Ga0373925_0242447 | Ga0373925_0242447_277_1311 | 298 |
| 150 | 3300049581 | Ga0501047_0031860 | Ga0501047_0031860_1200_2159 | 298 |
| 151 | 3300006186 | Ga0075369_10062541 | Ga0075369_100625412 | 299 |
| 152 | 3300041459 | Ga0451800_0474694 | Ga0451800_0474694_25_924 | 299 |
| 153 | iso_pu_bacteria | 2841760612 | 2841765113 | 299 |
| 154 | iso_pu_bacteria | 2844104063 | 2844106723 | 299 |
| 155 | iso_pu_bacteria | 2851182111 | 2851187719 | 299 |
| 156 | iso_pu_bacteria | 2851246043 | 2851248763 | 299 |
| 157 | 3300025933 | Ga0207706_10213667 | Ga0207706_102136672 | 300 |
| 158 | iso_pu_bacteria | 8054795415 | 8054802513 | 300 |
| 159 | 3300021388 | Ga0213875_10123936 | Ga0213875_101239362 | 301 |
| 160 | 3300025294 | Ga0209025_1006010 | Ga0209025_10060106 | 301 |
| 161 | 3300048923 | Ga0496120_0004721 | Ga0496120_0004721_1917_2849 | 301 |
| 162 | 3300049571 | Ga0501034_0009157 | Ga0501034_0009157_310_1242 | 301 |
| 163 | iso_pu_bacteria | 8054795415 | 8054803513 | 301 |
| 164 | 3300003203 | JGI25406J46586_10029934 | JGI25406J46586_100299342 | 302 |
| 165 | 3300005985 | Ga0081539_10001783 | Ga0081539_1000178310 | 302 |
| 166 | 3300025297 | Ga0209758_1029811 | Ga0209758_10298112 | 302 |
| 167 | 3300039438 | Ga0436360_1222189 | Ga0436360_1222189_379_1314 | 302 |
| 168 | 3300046453 | Ga0495627_048861 | Ga0495627_048861_99_1085 | 302 |
| 169 | iso_pu_bacteria | 2838016132 | 2838020792 | 302 |
| 170 | iso_pu_bacteria | 2838042994 | 2838044972 | 302 |
| 171 | iso_pu_bacteria | 2838048938 | 2838053065 | 302 |
| 172 | iso_pu_bacteria | 2838068647 | 2838070369 | 302 |
| 173 | iso_pu_bacteria | 2838668709 | 2838672658 | 302 |
| 174 | iso_pu_bacteria | 2838680041 | 2838685464 | 302 |
| 175 | iso_pu_bacteria | 2838694306 | 2838696080 | 302 |
| 176 | iso_pu_bacteria | 2838701080 | 2838705019 | 302 |
| 177 | iso_pu_bacteria | 2838707686 | 2838713479 | 302 |
| 178 | iso_pu_bacteria | 2841851746 | 2841852828 | 302 |
| 179 | iso_pu_bacteria | 2841864319 | 2841870344 | 302 |
| 180 | iso_pu_bacteria | 2842077413 | 2842082713 | 302 |
| 181 | iso_pu_bacteria | 2842118031 | 2842123728 | 302 |
| 182 | iso_pu_bacteria | 2842146304 | 2842150013 | 302 |
| 183 | iso_pu_bacteria | 2842156927 | 2842160155 | 302 |
| 184 | iso_pu_bacteria | 2842163707 | 2842165866 | 302 |
| 185 | iso_pu_bacteria | 2842180545 | 2842184179 | 302 |
| 186 | iso_pu_bacteria | 2842192696 | 2842196491 | 302 |
| 187 | iso_pu_bacteria | 2842229732 | 2842231761 | 302 |
| 188 | iso_pu_bacteria | 2842237096 | 2842242783 | 302 |
| 189 | iso_pu_bacteria | 2842250916 | 2842254700 | 302 |
| 190 | iso_pu_bacteria | 2842285085 | 2842289924 | 302 |
| 191 | iso_pu_bacteria | 2842291075 | 2842296856 | 302 |
| 192 | iso_pu_bacteria | 2842304105 | 2842308589 | 302 |
| 193 | iso_pu_bacteria | 2842311132 | 2842312101 | 302 |
| 194 | iso_pu_bacteria | 2842317721 | 2842321659 | 302 |
| 195 | iso_pu_bacteria | 2842341865 | 2842348228 | 302 |
| 196 | iso_pu_bacteria | 2842370503 | 2842376151 | 302 |
| 197 | iso_pu_bacteria | 2842377471 | 2842383360 | 302 |
| 198 | iso_pu_bacteria | 2842384541 | 2842390493 | 302 |
| 199 | iso_pu_bacteria | 2842395702 | 2842397994 | 302 |
| 200 | iso_pu_bacteria | 2842402390 | 2842407533 | 302 |
| 201 | iso_pu_bacteria | 2842409023 | 2842414164 | 302 |
| 202 | iso_pu_bacteria | 2842415677 | 2842420976 | 302 |
| 203 | iso_pu_bacteria | 2842422224 | 2842423983 | 302 |
| 204 | iso_pu_bacteria | 2842489311 | 2842493982 | 302 |
| 205 | iso_pu_bacteria | 2844454524 | 2844456705 | 302 |
| 206 | iso_pu_bacteria | 2857516855 | 2857521006 | 302 |
| 207 | iso_pu_bacteria | 2919100787 | 2919101984 | 302 |
| 208 | iso_pu_bacteria | 2926754445 | 2926760221 | 302 |
| 209 | 3300009093 | Ga0105240_10018416 | Ga0105240_100184167 | 303 |
| 210 | 3300009545 | Ga0105237_10451609 | Ga0105237_104516092 | 303 |
| 211 | 3300031548 | Ga0307408_100039293 | Ga0307408_1000392933 | 303 |
| 212 | 3300031911 | Ga0307412_10057088 | Ga0307412_100570883 | 303 |
| 213 | 3300032004 | Ga0307414_10011787 | Ga0307414_100117875 | 303 |
| 214 | 3300053730 | Ga0500645_009307 | Ga0500645_009307_2061_3041 | 303 |
| 215 | iso_pu_bacteria | 2582581283 | 2585167301 | 303 |
| 216 | iso_pu_bacteria | 2585428059 | 2587743767 | 303 |
| 217 | iso_pu_bacteria | 2643221618 | 2644105947 | 303 |
| 218 | iso_pu_bacteria | 2643221626 | 2644147088 | 303 |
| 219 | iso_pu_bacteria | 2643221655 | 2644310559 | 303 |
| 220 | iso_pu_bacteria | 2643221659 | 2644334656 | 303 |
| 221 | iso_pu_bacteria | 2643221698 | 2644545149 | 303 |
| 222 | iso_pu_bacteria | 2643221712 | 2644612661 | 303 |
| 223 | iso_pu_bacteria | 2844163670 | 2844165647 | 303 |
| 224 | 3300006038 | Ga0075365_10032251 | Ga0075365_100322512 | 304 |
| 225 | 3300006042 | Ga0075368_10051207 | Ga0075368_100512072 | 304 |
| 226 | 3300027866 | Ga0209813_10027957 | Ga0209813_100279572 | 304 |
| 227 | 3300028800 | Ga0265338_10128710 | Ga0265338_101287102 | 304 |
| 228 | 3300031240 | Ga0265320_10077447 | Ga0265320_100774472 | 304 |
| 229 | 3300049569 | Ga0501032_0018412 | Ga0501032_0018412_354_1331 | 304 |
| 230 | 3300049571 | Ga0501034_0262567 | Ga0501034_0262567_510_1487 | 304 |
| 231 | 3300049574 | Ga0501038_0006334 | Ga0501038_0006334_2911_3888 | 304 |
| 232 | 3300050492 | nmdc:mga0yw44_26417_c1 | nmdc:mga0yw44_26417_c1_942_1916 | 304 |
| 233 | 3300050495 | nmdc:mga04h51_21632_c1 | nmdc:mga04h51_21632_c1_486_1460 | 304 |
| 234 | iso_pu_bacteria | 2548877040 | 2550904936 | 304 |
| 235 | iso_pu_bacteria | 2571042143 | 2571530388 | 304 |
| 236 | iso_pu_bacteria | 2728368933 | 2728532564 | 304 |
| 237 | iso_pu_bacteria | 2841911363 | 2841914355 | 304 |
| 238 | iso_pu_bacteria | 2841917233 | 2841919807 | 304 |
| 239 | iso_pu_bacteria | 2920822456 | 2920827531 | 304 |
| 240 | iso_pu_bacteria | 2937822353 | 2937827153 | 304 |
| 241 | iso_pu_bacteria | 2938649242 | 2938649751 | 304 |
| 242 | iso_pu_bacteria | 2968558590 | 2968563975 | 304 |
| 243 | iso_pu_bacteria | 2988225383 | 2988229315 | 304 |
| 244 | iso_pu_bacteria | 2996632988 | 2996639090 | 304 |
| 245 | iso_pu_bacteria | 8054465665 | 8054467993 | 304 |
| 246 | 3300028380 | Ga0268265_10163308 | Ga0268265_101633082 | 305 |
| 247 | 3300028794 | Ga0307515_10004240 | Ga0307515_100042404 | 305 |
| 248 | 3300031616 | Ga0307508_10017913 | Ga0307508_100179133 | 305 |
| 249 | 3300031649 | Ga0307514_10023355 | Ga0307514_100233553 | 305 |
| 250 | 3300033179 | Ga0307507_10027619 | Ga0307507_100276195 | 305 |
| 251 | 3300049823 | Ga0501044_0089190 | Ga0501044_0089190_908_1825 | 305 |
| 252 | 3300053125 | Ga0500618_001007 | Ga0500618_001007_527_1477 | 305 |
| 253 | iso_pu_bacteria | 2585428157 | 2588107829 | 305 |
| 254 | iso_pu_bacteria | 2857453340 | 2857453512 | 305 |
| 255 | iso_pu_bacteria | 2971410472 | 2971415403 | 305 |
| 256 | iso_pu_bacteria | 8054795415 | 8054800560 | 305 |
| 257 | 3300044656 | Ga0466969_0009201 | Ga0466969_0009201_2278_3240 | 306 |
| 258 | 3300046472 | Ga0495580_0003246 | Ga0495580_0003246_6445_7383 | 306 |
| 259 | 3300049571 | Ga0501034_0162302 | Ga0501034_0162302_1048_1995 | 306 |
| 260 | iso_pu_bacteria | 2821443989 | 2821445655 | 306 |
| 261 | iso_pu_bacteria | 2844533157 | 2844533832 | 306 |
| 262 | iso_pu_bacteria | 2909042592 | 2909045130 | 306 |
| 263 | iso_pu_bacteria | 2919425241 | 2919426441 | 306 |
| 264 | iso_pu_bacteria | 3006321560 | 3006328362 | 306 |
| 265 | 3300005262 | Ga0065165_1001369 | Ga0065165_100136926 | 307 |
| 266 | 3300006038 | Ga0075365_10002567 | Ga0075365_100025674 | 307 |
| 267 | 3300025937 | Ga0207669_10062514 | Ga0207669_100625142 | 307 |
| 268 | iso_pu_bacteria | 2508501050 | 2508727107 | 307 |
| 269 | iso_pu_bacteria | 2508501114 | 2509074856 | 307 |
| 270 | iso_pu_bacteria | 2643221736 | 2644744367 | 307 |
| 271 | iso_pu_bacteria | 2775506901 | 2776262738 | 307 |
| 272 | iso_pu_bacteria | 2835312727 | 2835318610 | 307 |
| 273 | iso_pu_bacteria | 2888578766 | 2888580062 | 307 |
| 274 | iso_pu_bacteria | 2889049205 | 2889051336 | 307 |
| 275 | iso_pu_bacteria | 2889914905 | 2889914915 | 307 |
| 276 | iso_pu_bacteria | 2894232714 | 2894241244 | 307 |
| 277 | iso_pu_bacteria | 2904113452 | 2904115423 | 307 |
| 278 | 3300003781 | Ga0055536_1009179 | Ga0055536_10091793 | 308 |
| 279 | 3300009147 | Ga0114129_10790522 | Ga0114129_107905222 | 308 |
| 280 | 3300013105 | Ga0157369_10064646 | Ga0157369_100646462 | 308 |
| 281 | 3300025292 | Ga0209676_1000097 | Ga0209676_1000097235 | 308 |
| 282 | 3300027907 | Ga0207428_10132694 | Ga0207428_101326942 | 308 |
| 283 | 3300031911 | Ga0307412_10115653 | Ga0307412_101156531 | 308 |
| 284 | 3300037312 | Ga0395899_0048208 | Ga0395899_0048208_1428_2381 | 308 |
| 285 | 3300037418 | Ga0395900_0021722 | Ga0395900_0021722_5408_6361 | 308 |
| 286 | 3300038443 | Ga0395901_0101100 | Ga0395901_0101100_1023_1976 | 308 |
| 287 | 3300042436 | Ga0439435_0008601 | Ga0439435_0008601_428_1360 | 308 |
| 288 | 3300048922 | Ga0496119_0185140 | Ga0496119_0185140_103_1056 | 308 |
| 289 | iso_pu_bacteria | 2643221557 | 2643809550 | 308 |
| 290 | iso_pu_bacteria | 2643221668 | 2644375890 | 308 |
| 291 | 3300005347 | Ga0070668_100023500 | Ga0070668_1000235004 | 309 |
| 292 | 3300005844 | Ga0068862_100040706 | Ga0068862_1000407063 | 309 |
| 293 | 3300006038 | Ga0075365_10026065 | Ga0075365_100260653 | 309 |
| 294 | 3300006042 | Ga0075368_10015660 | Ga0075368_100156602 | 309 |
| 295 | 3300006048 | Ga0075363_100003108 | Ga0075363_1000031083 | 309 |
| 296 | 3300006048 | Ga0075363_100018367 | Ga0075363_1000183672 | 309 |
| 297 | 3300006051 | Ga0075364_10019248 | Ga0075364_100192484 | 309 |
| 298 | 3300006178 | Ga0075367_10002193 | Ga0075367_100021932 | 309 |
| 299 | 3300006178 | Ga0075367_10101282 | Ga0075367_101012822 | 309 |
| 300 | 3300006195 | Ga0075366_10060071 | Ga0075366_100600712 | 309 |
| 301 | 3300006353 | Ga0075370_10012225 | Ga0075370_100122252 | 309 |
| 302 | 3300009553 | Ga0105249_10180725 | Ga0105249_101807252 | 309 |
| 303 | 3300027866 | Ga0209813_10001001 | Ga0209813_100010013 | 309 |
| 304 | 3300028380 | Ga0268265_10122312 | Ga0268265_101223122 | 309 |
| 305 | 3300038443 | Ga0395901_0043533 | Ga0395901_0043533_1061_2014 | 309 |
| 306 | 3300039438 | Ga0436360_0070791 | Ga0436360_0070791_71_1006 | 309 |
| 307 | 3300048919 | Ga0496116_0019715 | Ga0496116_0019715_494_1423 | 309 |
| 308 | 3300048920 | Ga0496117_0000036 | Ga0496117_0000036_237796_238725 | 309 |
| 309 | 3300048921 | Ga0496118_0019730 | Ga0496118_0019730_515_1444 | 309 |
| 310 | 3300048928 | Ga0496125_0000157 | Ga0496125_0000157_16215_17222 | 309 |
| 311 | 3300050489 | nmdc:mga03683_170205_c1 | nmdc:mga03683_170205_c1_12_947 | 309 |
| 312 | 3300050492 | nmdc:mga0yw44_337590_c1 | nmdc:mga0yw44_337590_c1_44_979 | 309 |
| 313 | 3300050492 | nmdc:mga0yw44_57140_c1 | nmdc:mga0yw44_57140_c1_1372_2319 | 309 |
| 314 | 3300050492 | nmdc:mga0yw44_972_c1 | nmdc:mga0yw44_972_c1_5003_5995 | 309 |
| 315 | 3300050493 | nmdc:mga0k408_52776_c1 | nmdc:mga0k408_52776_c1_1175_2110 | 309 |
| 316 | 3300050493 | nmdc:mga0k408_58554_c1 | nmdc:mga0k408_58554_c1_1207_2136 | 309 |
| 317 | 3300050494 | nmdc:mga06z11_2365_c1 | nmdc:mga06z11_2365_c1_4891_5838 | 309 |
| 318 | 3300050495 | nmdc:mga04h51_2124_c1 | nmdc:mga04h51_2124_c1_2969_3916 | 309 |
| 319 | 3300050496 | nmdc:mga07m45_48111_c1 | nmdc:mga07m45_48111_c1_253_1188 | 309 |
| 320 | iso_pu_bacteria | 2643221543 | 2643738247 | 309 |
| 321 | 3300003187 | JGI25151J46595_10000714 | JGI25151J46595_100007141 | 310 |
| 322 | 3300003911 | JGI25405J52794_10002814 | JGI25405J52794_100028143 | 310 |
| 323 | 3300005937 | Ga0081455_10000482 | Ga0081455_1000048220 | 310 |
| 324 | 3300005983 | Ga0081540_1040509 | Ga0081540_10405092 | 310 |
| 325 | 3300025284 | Ga0209130_1000830 | Ga0209130_10008305 | 310 |
| 326 | 3300025294 | Ga0209025_1001024 | Ga0209025_100102427 | 310 |
| 327 | 3300025297 | Ga0209758_1001464 | Ga0209758_100146427 | 310 |
| 328 | 3300025302 | Ga0207426_1000287 | Ga0207426_100028790 | 310 |
| 329 | 3300042438 | Ga0439459_0012984 | Ga0439459_0012984_392_1324 | 310 |
| 330 | 3300046454 | Ga0495592_0015000 | Ga0495592_0015000_1417_2421 | 310 |
| 331 | 3300046691 | Ga0495670_0102610 | Ga0495670_0102610_356_1312 | 310 |
| 332 | 3300048924 | Ga0496121_0000759 | Ga0496121_0000759_27864_28802 | 310 |
| 333 | 3300048925 | Ga0496122_0016734 | Ga0496122_0016734_5438_6370 | 310 |
| 334 | 3300053153 | Ga0500616_0000027 | Ga0500616_0000027_369804_370760 | 310 |
| 335 | 3300053730 | Ga0500645_003845 | Ga0500645_003845_3821_4777 | 310 |
| 336 | iso_pu_bacteria | 2643221591 | 2643965927 | 310 |
| 337 | iso_pu_bacteria | 2775506901 | 2776262897 | 310 |
| 338 | iso_pu_bacteria | 2816332139 | 2816503938 | 310 |
| 339 | iso_pu_bacteria | 2844315083 | 2844320828 | 310 |
| 340 | iso_pu_bacteria | 2891048133 | 2891048938 | 310 |
| 341 | iso_pu_bacteria | 2894232714 | 2894236170 | 310 |
| 342 | iso_pu_bacteria | 2903727486 | 2903728102 | 310 |
| 343 | iso_pu_bacteria | 2906602504 | 2906608111 | 310 |
| 344 | iso_pu_bacteria | 3005445848 | 3005450606 | 310 |
| 345 | iso_pu_bacteria | 8005301065 | 8005301678 | 310 |
| 346 | iso_pu_bacteria | 8018127388 | 8018128485 | 310 |
| 347 | iso_pu_bacteria | 8056967851 | 8056969205 | 310 |
| 348 | 3300005331 | Ga0070670_100134421 | Ga0070670_1001344212 | 311 |
| 349 | 3300005347 | Ga0070668_100046535 | Ga0070668_1000465353 | 311 |
| 350 | 3300005353 | Ga0070669_100036316 | Ga0070669_1000363162 | 311 |
| 351 | 3300005367 | Ga0070667_100052255 | Ga0070667_1000522554 | 311 |
| 352 | 3300005456 | Ga0070678_100388583 | Ga0070678_1003885832 | 311 |
| 353 | 3300005577 | Ga0068857_100074796 | Ga0068857_1000747963 | 311 |
| 354 | 3300005841 | Ga0068863_100171095 | Ga0068863_1001710952 | 311 |
| 355 | 3300005842 | Ga0068858_100113296 | Ga0068858_1001132962 | 311 |
| 356 | 3300005844 | Ga0068862_100035487 | Ga0068862_1000354873 | 311 |
| 357 | 3300006048 | Ga0075363_100020501 | Ga0075363_1000205013 | 311 |
| 358 | 3300006177 | Ga0075362_10024045 | Ga0075362_100240452 | 311 |
| 359 | 3300006178 | Ga0075367_10081821 | Ga0075367_100818212 | 311 |
| 360 | 3300006195 | Ga0075366_10021217 | Ga0075366_100212172 | 311 |
| 361 | 3300006353 | Ga0075370_10034470 | Ga0075370_100344703 | 311 |
| 362 | 3300006844 | Ga0075428_100070600 | Ga0075428_1000706003 | 311 |
| 363 | 3300006881 | Ga0068865_100324855 | Ga0068865_1003248551 | 311 |
| 364 | 3300009093 | Ga0105240_10139857 | Ga0105240_101398573 | 311 |
| 365 | 3300009094 | Ga0111539_10417531 | Ga0111539_104175311 | 311 |
| 366 | 3300009101 | Ga0105247_10009605 | Ga0105247_100096053 | 311 |
| 367 | 3300009148 | Ga0105243_10028578 | Ga0105243_100285783 | 311 |
| 368 | 3300009174 | Ga0105241_10049194 | Ga0105241_100491942 | 311 |
| 369 | 3300009177 | Ga0105248_10081859 | Ga0105248_100818592 | 311 |
| 370 | 3300009545 | Ga0105237_10016814 | Ga0105237_100168143 | 311 |
| 371 | 3300009553 | Ga0105249_10082542 | Ga0105249_100825423 | 311 |
| 372 | 3300010375 | Ga0105239_10123270 | Ga0105239_101232703 | 311 |
| 373 | 3300011119 | Ga0105246_10080022 | Ga0105246_100800222 | 311 |
| 374 | 3300013306 | Ga0163162_10068227 | Ga0163162_100682272 | 311 |
| 375 | 3300013308 | Ga0157375_10339005 | Ga0157375_103390052 | 311 |
| 376 | 3300013308 | Ga0157375_10410050 | Ga0157375_104100502 | 311 |
| 377 | 3300014325 | Ga0163163_10028230 | Ga0163163_100282304 | 311 |
| 378 | 3300014326 | Ga0157380_10017440 | Ga0157380_100174404 | 311 |
| 379 | 3300017792 | Ga0163161_10182099 | Ga0163161_101820992 | 311 |
| 380 | 3300025900 | Ga0207710_10046785 | Ga0207710_100467852 | 311 |
| 381 | 3300025901 | Ga0207688_10010706 | Ga0207688_100107062 | 311 |
| 382 | 3300025901 | Ga0207688_10045465 | Ga0207688_100454652 | 311 |
| 383 | 3300025913 | Ga0207695_10307984 | Ga0207695_103079842 | 311 |
| 384 | 3300025937 | Ga0207669_10389146 | Ga0207669_103891461 | 311 |
| 385 | 3300025940 | Ga0207691_10168156 | Ga0207691_101681562 | 311 |
| 386 | 3300025972 | Ga0207668_10035197 | Ga0207668_100351973 | 311 |
| 387 | 3300025972 | Ga0207668_10190996 | Ga0207668_101909962 | 311 |
| 388 | 3300026035 | Ga0207703_10048242 | Ga0207703_100482422 | 311 |
| 389 | 3300026041 | Ga0207639_10159493 | Ga0207639_101594932 | 311 |
| 390 | 3300026075 | Ga0207708_10124796 | Ga0207708_101247962 | 311 |
| 391 | 3300026078 | Ga0207702_10073450 | Ga0207702_100734502 | 311 |
| 392 | 3300026116 | Ga0207674_10052495 | Ga0207674_100524952 | 311 |
| 393 | 3300028380 | Ga0268265_10199821 | Ga0268265_101998212 | 311 |
| 394 | 3300028381 | Ga0268264_10125499 | Ga0268264_101254993 | 311 |
| 395 | 3300031824 | Ga0307413_10030735 | Ga0307413_100307352 | 311 |
| 396 | 3300031852 | Ga0307410_10147885 | Ga0307410_101478852 | 311 |
| 397 | 3300031911 | Ga0307412_10298340 | Ga0307412_102983402 | 311 |
| 398 | 3300031995 | Ga0307409_100051405 | Ga0307409_1000514052 | 311 |
| 399 | 3300031995 | Ga0307409_100064948 | Ga0307409_1000649482 | 311 |
| 400 | 3300032005 | Ga0307411_10037459 | Ga0307411_100374592 | 311 |
| 401 | 3300032126 | Ga0307415_100034769 | Ga0307415_1000347692 | 311 |
| 402 | 3300046474 | Ga0495605_0123267 | Ga0495605_0123267_86_1021 | 311 |
| 403 | 3300046507 | Ga0495606_0101858 | Ga0495606_0101858_447_1382 | 311 |
| 404 | 3300046513 | Ga0495616_0052731 | Ga0495616_0052731_730_1665 | 311 |
| 405 | 3300046522 | Ga0495643_0010669 | Ga0495643_0010669_306_1241 | 311 |
| 406 | 3300046524 | Ga0495648_0152277 | Ga0495648_0152277_116_1051 | 311 |
| 407 | 3300046616 | Ga0495668_0034453 | Ga0495668_0034453_456_1391 | 311 |
| 408 | 3300047323 | Ga0495683_0094314 | Ga0495683_0094314_210_1145 | 311 |
| 409 | 3300047443 | Ga0495687_011064 | Ga0495687_011064_153_1088 | 311 |
| 410 | 3300048907 | Ga0496104_0041056 | Ga0496104_0041056_1824_2759 | 311 |
| 411 | 3300048909 | Ga0496106_0000825 | Ga0496106_0000825_5011_5952 | 311 |
| 412 | 3300048913 | Ga0496110_0147742 | Ga0496110_0147742_794_1729 | 311 |
| 413 | 3300048915 | Ga0496112_0319663 | Ga0496112_0319663_498_1433 | 311 |
| 414 | 3300048921 | Ga0496118_0083178 | Ga0496118_0083178_915_1850 | 311 |
| 415 | 3300049661 | Ga0501217_011460 | Ga0501217_011460_325_1284 | 311 |
| 416 | 3300049661 | Ga0501217_050909 | Ga0501217_050909_121_1062 | 311 |
| 417 | 3300049668 | Ga0501233_016079 | Ga0501233_016079_497_1456 | 311 |
| 418 | 3300049708 | Ga0501245_004493 | Ga0501245_004493_181_1140 | 311 |
| 419 | 3300049767 | Ga0501270_003511 | Ga0501270_003511_54_1013 | 311 |
| 420 | 3300050491 | nmdc:mga00v17_45003_c1 | nmdc:mga00v17_45003_c1_1672_2607 | 311 |
| 421 | 3300050494 | nmdc:mga06z11_261837_c1 | nmdc:mga06z11_261837_c1_21_956 | 311 |
| 422 | 3300050496 | nmdc:mga07m45_51046_c1 | nmdc:mga07m45_51046_c1_83_1018 | 311 |
| 423 | 3300050511 | nmdc:mga08y16_388677_c1 | nmdc:mga08y16_388677_c1_413_1369 | 311 |
| 424 | 3300050516 | nmdc:mga0sz30_19320_c1 | nmdc:mga0sz30_19320_c1_281_1216 | 311 |
| 425 | 3300053136 | Ga0500559_0000052 | Ga0500559_0000052_41897_42892 | 311 |
| 426 | iso_pu_bacteria | 2510065057 | 2510307138 | 311 |
| 427 | iso_pu_bacteria | 2511231052 | 2511498715 | 311 |
| 428 | iso_pu_bacteria | 2512875026 | 2512973320 | 311 |
| 429 | iso_pu_bacteria | 2513237086 | 2513587035 | 311 |
| 430 | iso_pu_bacteria | 2513237089 | 2513603675 | 311 |
| 431 | iso_pu_bacteria | 2513237091 | 2513619443 | 311 |
| 432 | iso_pu_bacteria | 2513237140 | 2513886041 | 311 |
| 433 | iso_pu_bacteria | 2513237143 | 2513904379 | 311 |
| 434 | iso_pu_bacteria | 2513237156 | 2513983383 | 311 |
| 435 | iso_pu_bacteria | 2513237160 | 2514005915 | 311 |
| 436 | iso_pu_bacteria | 2516653046 | 2516894992 | 311 |
| 437 | iso_pu_bacteria | 2517487022 | 2517571677 | 311 |
| 438 | iso_pu_bacteria | 2551306084 | 2551675563 | 311 |
| 439 | iso_pu_bacteria | 2551306085 | 2551685322 | 311 |
| 440 | iso_pu_bacteria | 2551306086 | 2551693959 | 311 |
| 441 | iso_pu_bacteria | 2551306087 | 2551698092 | 311 |
| 442 | iso_pu_bacteria | 2551306089 | 2551713110 | 311 |
| 443 | iso_pu_bacteria | 2551306090 | 2551716948 | 311 |
| 444 | iso_pu_bacteria | 2551306091 | 2551728263 | 311 |
| 445 | iso_pu_bacteria | 2551306091 | 2551728572 | 311 |
| 446 | iso_pu_bacteria | 2551306092 | 2551733166 | 311 |
| 447 | iso_pu_bacteria | 2551306093 | 2551744594 | 311 |
| 448 | iso_pu_bacteria | 2643221580 | 2643910909 | 311 |
| 449 | iso_pu_bacteria | 2643221629 | 2644167349 | 311 |
| 450 | iso_pu_bacteria | 2643221662 | 2644349865 | 311 |
| 451 | iso_pu_bacteria | 2643221674 | 2644412157 | 311 |
| 452 | iso_pu_bacteria | 2802428858 | 2802721249 | 311 |
| 453 | iso_pu_bacteria | 2802428859 | 2802724562 | 311 |
| 454 | iso_pu_bacteria | 2802428860 | 2802729771 | 311 |
| 455 | iso_pu_bacteria | 2802428861 | 2802737117 | 311 |
| 456 | iso_pu_bacteria | 2802428862 | 2802746870 | 311 |
| 457 | iso_pu_bacteria | 2802428863 | 2802751734 | 311 |
| 458 | iso_pu_bacteria | 2838061910 | 2838064856 | 311 |
| 459 | iso_pu_bacteria | 2838074704 | 2838075793 | 311 |
| 460 | iso_pu_bacteria | 2842110456 | 2842112871 | 311 |
| 461 | iso_pu_bacteria | 2842264693 | 2842266996 | 311 |
| 462 | iso_pu_bacteria | 2842363717 | 2842367631 | 311 |
| 463 | iso_pu_bacteria | 2842428310 | 2842431308 | 311 |
| 464 | iso_pu_bacteria | 2842434925 | 2842437643 | 311 |
| 465 | iso_pu_bacteria | 2842441272 | 2842444458 | 311 |
| 466 | iso_pu_bacteria | 2842447887 | 2842451118 | 311 |
| 467 | iso_pu_bacteria | 2842462802 | 2842465451 | 311 |
| 468 | iso_pu_bacteria | 2842469257 | 2842472080 | 311 |
| 469 | iso_pu_bacteria | 2842495871 | 2842502109 | 311 |
| 470 | iso_pu_bacteria | 2850079185 | 2850079283 | 311 |
| 471 | iso_pu_bacteria | 2855825444 | 2855827627 | 311 |
| 472 | iso_pu_bacteria | 2855839649 | 2855843003 | 311 |
| 473 | iso_pu_bacteria | 2858800743 | 2858801958 | 311 |
| 474 | iso_pu_bacteria | 2874123672 | 2874128763 | 311 |
| 475 | iso_pu_bacteria | 2896384573 | 2896388242 | 311 |
| 476 | iso_pu_bacteria | 2915980308 | 2915983214 | 311 |
| 477 | iso_pu_bacteria | 2915986958 | 2915991695 | 311 |
| 478 | iso_pu_bacteria | 2915993759 | 2915998941 | 311 |
| 479 | iso_pu_bacteria | 2916000859 | 2916002892 | 311 |
| 480 | iso_pu_bacteria | 2916007675 | 2916011230 | 311 |
| 481 | iso_pu_bacteria | 2916014648 | 2916018750 | 311 |
| 482 | iso_pu_bacteria | 2916021584 | 2916025410 | 311 |
| 483 | iso_pu_bacteria | 2916028427 | 2916032220 | 311 |
| 484 | iso_pu_bacteria | 2916035215 | 2916038117 | 311 |
| 485 | iso_pu_bacteria | 2916041962 | 2916042357 | 311 |
| 486 | iso_pu_bacteria | 2916048683 | 2916050082 | 311 |
| 487 | iso_pu_bacteria | 2916055098 | 2916059014 | 311 |
| 488 | iso_pu_bacteria | 2916061851 | 2916063525 | 311 |
| 489 | iso_pu_bacteria | 2916068649 | 2916075084 | 311 |
| 490 | iso_pu_bacteria | 2916076590 | 2916078507 | 311 |
| 491 | iso_pu_bacteria | 2920760137 | 2920764351 | 311 |
| 492 | iso_pu_bacteria | 2921201388 | 2921206389 | 311 |
| 493 | iso_pu_bacteria | 2921208531 | 2921211241 | 311 |
| 494 | iso_pu_bacteria | 2921237296 | 2921241211 | 311 |
| 495 | iso_pu_bacteria | 2921244191 | 2921249359 | 311 |
| 496 | iso_pu_bacteria | 2921250672 | 2921256210 | 311 |
| 497 | iso_pu_bacteria | 2921257292 | 2921258745 | 311 |
| 498 | iso_pu_bacteria | 2921263974 | 2921268224 | 311 |
| 499 | iso_pu_bacteria | 2921282425 | 2921285261 | 311 |
| 500 | iso_pu_bacteria | 2921289301 | 2921293421 | 311 |
| 501 | iso_pu_bacteria | 2921296804 | 2921297978 | 311 |
| 502 | iso_pu_bacteria | 2924144063 | 2924147843 | 311 |
| 503 | iso_pu_bacteria | 2924150972 | 2924151906 | 311 |
| 504 | iso_pu_bacteria | 2924158325 | 2924163296 | 311 |
| 505 | iso_pu_bacteria | 2924165586 | 2924171099 | 311 |
| 506 | iso_pu_bacteria | 2924172951 | 2924178488 | 311 |
| 507 | iso_pu_bacteria | 2924179722 | 2924185003 | 311 |
| 508 | iso_pu_bacteria | 2924186466 | 2924192108 | 311 |
| 509 | iso_pu_bacteria | 2924193448 | 2924196285 | 311 |
| 510 | iso_pu_bacteria | 2924200457 | 2924203999 | 311 |
| 511 | iso_pu_bacteria | 2924207177 | 2924210665 | 311 |
| 512 | iso_pu_bacteria | 2924221636 | 2924225547 | 311 |
| 513 | iso_pu_bacteria | 2924228884 | 2924232395 | 311 |
| 514 | iso_pu_bacteria | 2937002841 | 2937007133 | 311 |
| 515 | iso_pu_bacteria | 2937009748 | 2937013265 | 311 |
| 516 | iso_pu_bacteria | 2937016420 | 2937019955 | 311 |
| 517 | iso_pu_bacteria | 2937023124 | 2937025551 | 311 |
| 518 | iso_pu_bacteria | 2937029754 | 2937032507 | 311 |
| 519 | iso_pu_bacteria | 2937036028 | 2937039170 | 311 |
| 520 | iso_pu_bacteria | 2937049772 | 2937053159 | 311 |
| 521 | iso_pu_bacteria | 2937056579 | 2937061975 | 311 |
| 522 | iso_pu_bacteria | 2937063883 | 2937065709 | 311 |
| 523 | iso_pu_bacteria | 2937071275 | 2937075756 | 311 |
| 524 | iso_pu_bacteria | 2937078374 | 2937084041 | 311 |
| 525 | iso_pu_bacteria | 2937084907 | 2937087346 | 311 |
| 526 | iso_pu_bacteria | 2937091812 | 2937097657 | 311 |
| 527 | iso_pu_bacteria | 2937098957 | 2937100245 | 311 |
| 528 | iso_pu_bacteria | 2937113482 | 2937115946 | 311 |
| 529 | iso_pu_bacteria | 2937119839 | 2937123510 | 311 |
| 530 | iso_pu_bacteria | 2937126314 | 2937129167 | 311 |
| 531 | iso_pu_bacteria | 2957375807 | 2957378135 | 311 |
| 532 | iso_pu_bacteria | 2957382221 | 2957386329 | 311 |
| 533 | iso_pu_bacteria | 2957388812 | 2957392680 | 311 |
| 534 | iso_pu_bacteria | 2957395598 | 2957401629 | 311 |
| 535 | iso_pu_bacteria | 2957402308 | 2957404964 | 311 |
| 536 | iso_pu_bacteria | 2957408893 | 2957411935 | 311 |
| 537 | iso_pu_bacteria | 2957415311 | 2957417143 | 311 |
| 538 | iso_pu_bacteria | 2957422303 | 2957427989 | 311 |
| 539 | iso_pu_bacteria | 2957430029 | 2957433001 | 311 |
| 540 | iso_pu_bacteria | 2957437181 | 2957439246 | 311 |
| 541 | iso_pu_bacteria | 2957443900 | 2957446580 | 311 |
| 542 | iso_pu_bacteria | 2957450854 | 2957455827 | 311 |
| 543 | iso_pu_bacteria | 2957457609 | 2957461205 | 311 |
| 544 | iso_pu_bacteria | 2957464669 | 2957467689 | 311 |
| 545 | iso_pu_bacteria | 2957471148 | 2957471792 | 311 |
| 546 | iso_pu_bacteria | 2957478035 | 2957483181 | 311 |
| 547 | iso_pu_bacteria | 2957484790 | 2957486982 | 311 |
| 548 | iso_pu_bacteria | 2957491536 | 2957493852 | 311 |
| 549 | iso_pu_bacteria | 2957498199 | 2957502332 | 311 |
| 550 | iso_pu_bacteria | 2957505466 | 2957506287 | 311 |
| 551 | iso_pu_bacteria | 2960584000 | 2960587203 | 311 |
| 552 | iso_pu_bacteria | 2960591022 | 2960593050 | 311 |
| 553 | iso_pu_bacteria | 2960597568 | 2960601181 | 311 |
| 554 | iso_pu_bacteria | 2960603979 | 2960608170 | 311 |
| 555 | iso_pu_bacteria | 2960610863 | 2960612270 | 311 |
| 556 | iso_pu_bacteria | 2960617483 | 2960620261 | 311 |
| 557 | iso_pu_bacteria | 2960624210 | 2960626010 | 311 |
| 558 | iso_pu_bacteria | 2960631154 | 2960635491 | 311 |
| 559 | iso_pu_bacteria | 2960637947 | 2960643895 | 311 |
| 560 | iso_pu_bacteria | 2960645483 | 2960651956 | 311 |
| 561 | iso_pu_bacteria | 2960660292 | 2960663091 | 311 |
| 562 | iso_pu_bacteria | 2960667422 | 2960671322 | 311 |
| 563 | iso_pu_bacteria | 2960680706 | 2960683820 | 311 |
| 564 | iso_pu_bacteria | 2960687367 | 2960689235 | 311 |
| 565 | iso_pu_bacteria | 2960693952 | 2960697054 | 311 |
| 566 | iso_pu_bacteria | 2964607997 | 2964613681 | 311 |
| 567 | iso_pu_bacteria | 2964615318 | 2964616377 | 311 |
| 568 | iso_pu_bacteria | 2964621998 | 2964625347 | 311 |
| 569 | iso_pu_bacteria | 2964628898 | 2964632051 | 311 |
| 570 | iso_pu_bacteria | 2964636051 | 2964640464 | 311 |
| 571 | iso_pu_bacteria | 2964643177 | 2964647372 | 311 |
| 572 | iso_pu_bacteria | 2964649959 | 2964653746 | 311 |
| 573 | iso_pu_bacteria | 2964656573 | 2964662409 | 311 |
| 574 | iso_pu_bacteria | 2964663802 | 2964667432 | 311 |
| 575 | iso_pu_bacteria | 2964678106 | 2964684972 | 311 |
| 576 | iso_pu_bacteria | 2964685014 | 2964687823 | 311 |
| 577 | iso_pu_bacteria | 2964691889 | 2964695718 | 311 |
| 578 | iso_pu_bacteria | 2964698721 | 2964702354 | 311 |
| 579 | iso_pu_bacteria | 2964705432 | 2964708148 | 311 |
| 580 | iso_pu_bacteria | 2964712639 | 2964717428 | 311 |
| 581 | iso_pu_bacteria | 2964719344 | 2964722584 | 311 |
| 582 | iso_pu_bacteria | 2967664464 | 2967669726 | 311 |
| 583 | iso_pu_bacteria | 2967671571 | 2967675224 | 311 |
| 584 | iso_pu_bacteria | 2967678726 | 2967684291 | 311 |
| 585 | iso_pu_bacteria | 2967686174 | 2967688335 | 311 |
| 586 | iso_pu_bacteria | 2967693043 | 2967695754 | 311 |
| 587 | iso_pu_bacteria | 2967699805 | 2967700215 | 311 |
| 588 | iso_pu_bacteria | 2967706974 | 2967711266 | 311 |
| 589 | iso_pu_bacteria | 2967714385 | 2967719509 | 311 |
| 590 | iso_pu_bacteria | 2967721400 | 2967727578 | 311 |
| 591 | iso_pu_bacteria | 2967728569 | 2967733932 | 311 |
| 592 | iso_pu_bacteria | 2967735183 | 2967738585 | 311 |
| 593 | iso_pu_bacteria | 2967742019 | 2967747577 | 311 |
| 594 | iso_pu_bacteria | 2967748971 | 2967752886 | 311 |
| 595 | iso_pu_bacteria | 2967755722 | 2967756435 | 311 |
| 596 | iso_pu_bacteria | 2967762386 | 2967765333 | 311 |
| 597 | iso_pu_bacteria | 2967769361 | 2967773033 | 311 |
| 598 | iso_pu_bacteria | 2967775926 | 2967781437 | 311 |
| 599 | iso_pu_bacteria | 2970019648 | 2970025353 | 311 |
| 600 | iso_pu_bacteria | 2970026789 | 2970028826 | 311 |
| 601 | iso_pu_bacteria | 2970033650 | 2970038100 | 311 |
| 602 | iso_pu_bacteria | 2970040964 | 2970044377 | 311 |
| 603 | iso_pu_bacteria | 2970047711 | 2970054284 | 311 |
| 604 | iso_pu_bacteria | 2970054988 | 2970059133 | 311 |
| 605 | iso_pu_bacteria | 2970061556 | 2970067968 | 311 |
| 606 | iso_pu_bacteria | 2970068827 | 2970074328 | 311 |
| 607 | iso_pu_bacteria | 2970076120 | 2970080245 | 311 |
| 608 | iso_pu_bacteria | 2970082768 | 2970087640 | 311 |
| 609 | iso_pu_bacteria | 2970088815 | 2970092135 | 311 |
| 610 | iso_pu_bacteria | 2970095765 | 2970097857 | 311 |
| 611 | iso_pu_bacteria | 2970102677 | 2970104376 | 311 |
| 612 | iso_pu_bacteria | 2970109326 | 2970111793 | 311 |
| 613 | iso_pu_bacteria | 2970116247 | 2970120830 | 311 |
| 614 | iso_pu_bacteria | 2970122695 | 2970122895 | 311 |
| 615 | iso_pu_bacteria | 2970129317 | 2970132270 | 311 |
| 616 | iso_pu_bacteria | 2970136068 | 2970137745 | 311 |
| 617 | iso_pu_bacteria | 2970143518 | 2970145420 | 311 |
| 618 | iso_pu_bacteria | 2970149975 | 2970153765 | 311 |
| 619 | iso_pu_bacteria | 2970156795 | 2970163865 | 311 |
| 620 | iso_pu_bacteria | 2970164137 | 2970168521 | 311 |
| 621 | iso_pu_bacteria | 2970170962 | 2970174557 | 311 |
| 622 | iso_pu_bacteria | 2970177841 | 2970184373 | 311 |
| 623 | iso_pu_bacteria | 2970184632 | 2970190353 | 311 |
| 624 | iso_pu_bacteria | 2970191845 | 2970195875 | 311 |
| 625 | iso_pu_bacteria | 2977516862 | 2977522225 | 311 |
| 626 | iso_pu_bacteria | 2977523885 | 2977525682 | 311 |
| 627 | iso_pu_bacteria | 2977530762 | 2977530783 | 311 |
| 628 | iso_pu_bacteria | 2977537788 | 2977540693 | 311 |
| 629 | iso_pu_bacteria | 2977544691 | 2977546810 | 311 |
| 630 | iso_pu_bacteria | 2977551784 | 2977557134 | 311 |
| 631 | iso_pu_bacteria | 2977558990 | 2977562076 | 311 |
| 632 | iso_pu_bacteria | 2977565890 | 2977568755 | 311 |
| 633 | iso_pu_bacteria | 2977572785 | 2977576785 | 311 |
| 634 | iso_pu_bacteria | 2977579622 | 2977582561 | 311 |
| 635 | iso_pu_bacteria | 648276728 | 648740450 | 311 |
| 636 | iso_pu_bacteria | 8003992118 | 8003995582 | 311 |
| 637 | iso_pu_bacteria | 8003999396 | 8004003349 | 311 |
| 638 | 3300006038 | Ga0075365_10000641 | Ga0075365_100006419 | 312 |
| 639 | 3300006048 | Ga0075363_100001601 | Ga0075363_1000016016 | 312 |
| 640 | 3300006051 | Ga0075364_10012258 | Ga0075364_100122584 | 312 |
| 641 | 3300006178 | Ga0075367_10000605 | Ga0075367_100006057 | 312 |
| 642 | 3300006186 | Ga0075369_10064522 | Ga0075369_100645221 | 312 |
| 643 | 3300006353 | Ga0075370_10001831 | Ga0075370_100018312 | 312 |
| 644 | 3300006914 | Ga0075436_100038129 | Ga0075436_1000381293 | 312 |
| 645 | 3300027866 | Ga0209813_10002610 | Ga0209813_100026102 | 312 |
| 646 | 3300035695 | Ga0373927_0257806 | Ga0373927_0257806_82_1020 | 312 |
| 647 | 3300039438 | Ga0436360_1362121 | Ga0436360_1362121_12_956 | 312 |
| 648 | 3300048091 | Ga0495626_0039058 | Ga0495626_0039058_792_1784 | 312 |
| 649 | 3300050490 | nmdc:mga03n38_5252_c1 | nmdc:mga03n38_5252_c1_2528_3481 | 312 |
| 650 | 3300050492 | nmdc:mga0yw44_5426_c1 | nmdc:mga0yw44_5426_c1_2178_3131 | 312 |
| 651 | 3300050494 | nmdc:mga06z11_2817_c1 | nmdc:mga06z11_2817_c1_2407_3360 | 312 |
| 652 | 3300050495 | nmdc:mga04h51_4204_c1 | nmdc:mga04h51_4204_c1_1836_2789 | 312 |
| 653 | 3300050496 | nmdc:mga07m45_5763_c1 | nmdc:mga07m45_5763_c1_183_1136 | 312 |
| 654 | 3300050514 | nmdc:mga08x19_52150_c1 | nmdc:mga08x19_52150_c1_212_1150 | 312 |
| 655 | iso_pu_bacteria | 2558860983 | 2561467605 | 312 |
| 656 | iso_pu_bacteria | 2821443989 | 2821447256 | 312 |
| 657 | iso_pu_bacteria | 2838035591 | 2838039613 | 312 |
| 658 | iso_pu_bacteria | 2838661181 | 2838663885 | 312 |
| 659 | iso_pu_bacteria | 2867346516 | 2867350202 | 312 |
| 660 | 3300005339 | Ga0070660_100001762 | Ga0070660_1000017627 | 313 |
| 661 | 3300005455 | Ga0070663_100076567 | Ga0070663_1000765671 | 313 |
| 662 | 3300005530 | Ga0070679_100174329 | Ga0070679_1001743291 | 313 |
| 663 | 3300005563 | Ga0068855_100174184 | Ga0068855_1001741842 | 313 |
| 664 | 3300025297 | Ga0209758_1003392 | Ga0209758_100339211 | 313 |
| 665 | 3300025909 | Ga0207705_10002602 | Ga0207705_100026028 | 313 |
| 666 | 3300025919 | Ga0207657_10003030 | Ga0207657_100030308 | 313 |
| 667 | 3300025921 | Ga0207652_10322124 | Ga0207652_103221241 | 313 |
| 668 | 3300025949 | Ga0207667_10032885 | Ga0207667_100328853 | 313 |
| 669 | 3300026067 | Ga0207678_10105168 | Ga0207678_101051683 | 313 |
| 670 | 3300031730 | Ga0307516_10028576 | Ga0307516_100285766 | 313 |
| 671 | 3300045976 | Ga0466967_0365170 | Ga0466967_0365170_364_1320 | 313 |
| 672 | 3300048918 | Ga0496115_0073680 | Ga0496115_0073680_276_1217 | 313 |
| 673 | iso_pu_bacteria | 2537561587 | 2537873469 | 313 |
| 674 | iso_pu_bacteria | 2554235003 | 2554245856 | 313 |
| 675 | iso_pu_bacteria | 2558860242 | 2559296378 | 313 |
| 676 | iso_pu_bacteria | 2599185210 | 2599605573 | 313 |
| 677 | iso_pu_bacteria | 2600255279 | 2601611768 | 313 |
| 678 | iso_pu_bacteria | 2600255308 | 2601749501 | 313 |
| 679 | iso_pu_bacteria | 2643221582 | 2643917657 | 313 |
| 680 | iso_pu_bacteria | 2643221693 | 2644522820 | 313 |
| 681 | iso_pu_bacteria | 2757320392 | 2757572241 | 313 |
| 682 | iso_pu_bacteria | 2808606368 | 2808884156 | 313 |
| 683 | iso_pu_bacteria | 2808606387 | 2808988596 | 313 |
| 684 | iso_pu_bacteria | 2818991439 | 2819557826 | 313 |
| 685 | iso_pu_bacteria | 2838675328 | 2838679776 | 313 |
| 686 | iso_pu_bacteria | 2838714209 | 2838717454 | 313 |
| 687 | iso_pu_bacteria | 2838719591 | 2838724345 | 313 |
| 688 | iso_pu_bacteria | 2838724970 | 2838729338 | 313 |
| 689 | iso_pu_bacteria | 2841846520 | 2841850765 | 313 |
| 690 | iso_pu_bacteria | 2841859092 | 2841864054 | 313 |
| 691 | iso_pu_bacteria | 2842124991 | 2842129570 | 313 |
| 692 | iso_pu_bacteria | 2842130223 | 2842134715 | 313 |
| 693 | iso_pu_bacteria | 2842152218 | 2842156767 | 313 |
| 694 | iso_pu_bacteria | 2842170452 | 2842173025 | 313 |
| 695 | iso_pu_bacteria | 2842175837 | 2842180385 | 313 |
| 696 | iso_pu_bacteria | 2842187318 | 2842191956 | 313 |
| 697 | iso_pu_bacteria | 2842211629 | 2842216272 | 313 |
| 698 | iso_pu_bacteria | 2842224351 | 2842228992 | 313 |
| 699 | iso_pu_bacteria | 2842515876 | 2842520836 | 313 |
| 700 | iso_pu_bacteria | 2899792073 | 2899793630 | 313 |
| 701 | iso_pu_bacteria | 2899845264 | 2899848723 | 313 |
| 702 | iso_pu_bacteria | 2917554339 | 2917555076 | 313 |
| 703 | iso_pu_bacteria | 2919114240 | 2919119208 | 313 |
| 704 | iso_pu_bacteria | 2926754445 | 2926759239 | 313 |
| 705 | iso_pu_bacteria | 2926760298 | 2926763324 | 313 |
| 706 | iso_pu_bacteria | 2929138655 | 2929142965 | 313 |
| 707 | iso_pu_bacteria | 2933006813 | 2933011372 | 313 |
| 708 | iso_pu_bacteria | 2933011516 | 2933016551 | 313 |
| 709 | iso_pu_bacteria | 2933594066 | 2933596056 | 313 |
| 710 | iso_pu_bacteria | 2979089926 | 2979091643 | 313 |
| 711 | iso_pu_bacteria | 2979095461 | 2979097164 | 313 |
| 712 | iso_pu_bacteria | 2979100975 | 2979102867 | 313 |
| 713 | iso_pu_bacteria | 2984509177 | 2984509244 | 313 |
| 714 | iso_pu_bacteria | 2984518228 | 2984520057 | 313 |
| 715 | iso_pu_bacteria | 2984537506 | 2984537573 | 313 |
| 716 | iso_pu_bacteria | 2984601300 | 2984604321 | 313 |
| 717 | iso_pu_bacteria | 650716007 | 650842771 | 313 |
| 718 | iso_pu_bacteria | 8003570095 | 8003574806 | 313 |
| 719 | iso_pu_bacteria | 8054460903 | 8054464675 | 313 |
| 720 | 3300003322 | rootL2_10018043 | rootL2_100180432 | 314 |
| 721 | 3300003762 | Ga0055542_1014899 | Ga0055542_10148992 | 314 |
| 722 | 3300004625 | Ga0055543_1014478 | Ga0055543_10144781 | 314 |
| 723 | 3300005262 | Ga0065165_1001128 | Ga0065165_100112815 | 314 |
| 724 | 3300005441 | Ga0070700_100094362 | Ga0070700_1000943622 | 314 |
| 725 | 3300005548 | Ga0070665_100095279 | Ga0070665_1000952792 | 314 |
| 726 | 3300005578 | Ga0068854_100064409 | Ga0068854_1000644093 | 314 |
| 727 | 3300005616 | Ga0068852_100002107 | Ga0068852_1000021078 | 314 |
| 728 | 3300009093 | Ga0105240_10007818 | Ga0105240_100078189 | 314 |
| 729 | 3300009148 | Ga0105243_10056337 | Ga0105243_100563371 | 314 |
| 730 | 3300009174 | Ga0105241_10062149 | Ga0105241_100621493 | 314 |
| 731 | 3300009545 | Ga0105237_10000071 | Ga0105237_10000071132 | 314 |
| 732 | 3300009545 | Ga0105237_10002420 | Ga0105237_100024209 | 314 |
| 733 | 3300009553 | Ga0105249_10064625 | Ga0105249_100646254 | 314 |
| 734 | 3300010375 | Ga0105239_10001189 | Ga0105239_100011895 | 314 |
| 735 | 3300011119 | Ga0105246_10038060 | Ga0105246_100380602 | 314 |
| 736 | 3300025254 | Ga0209148_1000305 | Ga0209148_100030533 | 314 |
| 737 | 3300025261 | Ga0209233_1004820 | Ga0209233_10048203 | 314 |
| 738 | 3300025913 | Ga0207695_10000136 | Ga0207695_10000136112 | 314 |
| 739 | 3300025914 | Ga0207671_10000099 | Ga0207671_1000009948 | 314 |
| 740 | 3300025935 | Ga0207709_10021898 | Ga0207709_100218983 | 314 |
| 741 | 3300025961 | Ga0207712_10079253 | Ga0207712_100792531 | 314 |
| 742 | 3300025981 | Ga0207640_10050225 | Ga0207640_100502252 | 314 |
| 743 | 3300026075 | Ga0207708_10177328 | Ga0207708_101773282 | 314 |
| 744 | 3300026121 | Ga0207683_10206493 | Ga0207683_102064932 | 314 |
| 745 | 3300028379 | Ga0268266_10000391 | Ga0268266_1000039153 | 314 |
| 746 | 3300031548 | Ga0307408_100130609 | Ga0307408_1001306092 | 314 |
| 747 | 3300031824 | Ga0307413_10020232 | Ga0307413_100202322 | 314 |
| 748 | 3300031903 | Ga0307407_10188317 | Ga0307407_101883172 | 314 |
| 749 | 3300031911 | Ga0307412_10294173 | Ga0307412_102941732 | 314 |
| 750 | 3300032002 | Ga0307416_100266096 | Ga0307416_1002660962 | 314 |
| 751 | 3300033180 | Ga0307510_10081429 | Ga0307510_100814293 | 314 |
| 752 | 3300044735 | Ga0466968_0066731 | Ga0466968_0066731_202_1146 | 314 |
| 753 | 3300046524 | Ga0495648_0043505 | Ga0495648_0043505_1297_2241 | 314 |
| 754 | 3300046529 | Ga0495652_0134912 | Ga0495652_0134912_213_1157 | 314 |
| 755 | 3300046543 | Ga0495645_0018535 | Ga0495645_0018535_2264_3217 | 314 |
| 756 | 3300046557 | Ga0495622_0115960 | Ga0495622_0115960_244_1188 | 314 |
| 757 | 3300046660 | Ga0495625_0137960 | Ga0495625_0137960_153_1097 | 314 |
| 758 | 3300047317 | Ga0495604_0025521 | Ga0495604_0025521_1544_2488 | 314 |
| 759 | 3300047472 | Ga0495686_0017404 | Ga0495686_0017404_3204_4148 | 314 |
| 760 | 3300048924 | Ga0496121_0041492 | Ga0496121_0041492_2453_3397 | 314 |
| 761 | 3300048928 | Ga0496125_0000381 | Ga0496125_0000381_42303_43247 | 314 |
| 762 | 3300049571 | Ga0501034_0049658 | Ga0501034_0049658_1838_2782 | 314 |
| 763 | 3300049675 | Ga0501243_005207 | Ga0501243_005207_442_1404 | 314 |
| 764 | 3300053111 | Ga0500572_011801 | Ga0500572_011801_520_1467 | 314 |
| 765 | iso_pu_bacteria | 2508501122 | 2509112218 | 314 |
| 766 | iso_pu_bacteria | 2509276019 | 2509379501 | 314 |
| 767 | iso_pu_bacteria | 2510917028 | 2511185269 | 314 |
| 768 | iso_pu_bacteria | 2512047086 | 2512534852 | 314 |
| 769 | iso_pu_bacteria | 2513237088 | 2513595667 | 314 |
| 770 | iso_pu_bacteria | 2513237138 | 2513865304 | 314 |
| 771 | iso_pu_bacteria | 2515154107 | 2515607155 | 314 |
| 772 | iso_pu_bacteria | 2516143018 | 2516208009 | 314 |
| 773 | iso_pu_bacteria | 2524023207 | 2524452594 | 314 |
| 774 | iso_pu_bacteria | 2558860100 | 2558867610 | 314 |
| 775 | iso_pu_bacteria | 2582581299 | 2585231003 | 314 |
| 776 | iso_pu_bacteria | 2582581867 | 2585399153 | 314 |
| 777 | iso_pu_bacteria | 2585427590 | 2585818698 | 314 |
| 778 | iso_pu_bacteria | 2643221634 | 2644191162 | 314 |
| 779 | iso_pu_bacteria | 2657244999 | 2657684930 | 314 |
| 780 | iso_pu_bacteria | 2690316117 | 2692319027 | 314 |
| 781 | iso_pu_bacteria | 2751185821 | 2753463608 | 314 |
| 782 | iso_pu_bacteria | 2791355091 | 2792621651 | 314 |
| 783 | iso_pu_bacteria | 2791355092 | 2792627664 | 314 |
| 784 | iso_pu_bacteria | 2791355094 | 2792640381 | 314 |
| 785 | iso_pu_bacteria | 2802429268 | 2804755715 | 314 |
| 786 | iso_pu_bacteria | 2847417321 | 2847422473 | 314 |
| 787 | iso_pu_bacteria | 2848992105 | 2848998118 | 314 |
| 788 | iso_pu_bacteria | 2855872281 | 2855875810 | 314 |
| 789 | iso_pu_bacteria | 2913295892 | 2913296235 | 314 |
| 790 | iso_pu_bacteria | 2923556063 | 2923556126 | 314 |
| 791 | iso_pu_bacteria | 2936996657 | 2936998858 | 314 |
| 792 | iso_pu_bacteria | 2937106411 | 2937111199 | 314 |
| 793 | iso_pu_bacteria | 2996887358 | 2996889686 | 314 |
| 794 | iso_pu_bacteria | 643692032 | 643823655 | 314 |
| 795 | iso_pu_bacteria | 8005258706 | 8005261534 | 314 |
| 796 | iso_pu_bacteria | 8005321885 | 8005324213 | 314 |
| 797 | iso_pu_bacteria | 8008485437 | 8008491367 | 314 |
| 798 | iso_pu_bacteria | 8025524527 | 8025530697 | 314 |
| 799 | 3300003320 | rootH2_10045600 | rootH2_100456006 | 315 |
| 800 | 3300005327 | Ga0070658_10060193 | Ga0070658_100601931 | 315 |
| 801 | 3300005327 | Ga0070658_10061436 | Ga0070658_100614362 | 315 |
| 802 | 3300005339 | Ga0070660_100073319 | Ga0070660_1000733192 | 315 |
| 803 | 3300005339 | Ga0070660_100081504 | Ga0070660_1000815043 | 315 |
| 804 | 3300005344 | Ga0070661_100028790 | Ga0070661_1000287904 | 315 |
| 805 | 3300005344 | Ga0070661_100030184 | Ga0070661_1000301844 | 315 |
| 806 | 3300005344 | Ga0070661_100099812 | Ga0070661_1000998122 | 315 |
| 807 | 3300005356 | Ga0070674_100005304 | Ga0070674_1000053042 | 315 |
| 808 | 3300005366 | Ga0070659_100018201 | Ga0070659_1000182014 | 315 |
| 809 | 3300005539 | Ga0068853_100097958 | Ga0068853_1000979582 | 315 |
| 810 | 3300005543 | Ga0070672_100036888 | Ga0070672_1000368882 | 315 |
| 811 | 3300005563 | Ga0068855_100121017 | Ga0068855_1001210172 | 315 |
| 812 | 3300005563 | Ga0068855_100132489 | Ga0068855_1001324892 | 315 |
| 813 | 3300005564 | Ga0070664_100455725 | Ga0070664_1004557252 | 315 |
| 814 | 3300005577 | Ga0068857_100152029 | Ga0068857_1001520293 | 315 |
| 815 | 3300005578 | Ga0068854_100011307 | Ga0068854_1000113073 | 315 |
| 816 | 3300005578 | Ga0068854_100167266 | Ga0068854_1001672662 | 315 |
| 817 | 3300005614 | Ga0068856_100066245 | Ga0068856_1000662452 | 315 |
| 818 | 3300005614 | Ga0068856_100073534 | Ga0068856_1000735342 | 315 |
| 819 | 3300005614 | Ga0068856_100117479 | Ga0068856_1001174793 | 315 |
| 820 | 3300005614 | Ga0068856_100155283 | Ga0068856_1001552832 | 315 |
| 821 | 3300005616 | Ga0068852_100006927 | Ga0068852_1000069272 | 315 |
| 822 | 3300005616 | Ga0068852_100010073 | Ga0068852_1000100734 | 315 |
| 823 | 3300005616 | Ga0068852_100029002 | Ga0068852_1000290023 | 315 |
| 824 | 3300005834 | Ga0068851_10027371 | Ga0068851_100273713 | 315 |
| 825 | 3300005981 | Ga0081538_10032965 | Ga0081538_100329652 | 315 |
| 826 | 3300006042 | Ga0075368_10036305 | Ga0075368_100363052 | 315 |
| 827 | 3300006051 | Ga0075364_10103742 | Ga0075364_101037422 | 315 |
| 828 | 3300006177 | Ga0075362_10003917 | Ga0075362_100039172 | 315 |
| 829 | 3300006178 | Ga0075367_10010227 | Ga0075367_100102273 | 315 |
| 830 | 3300006186 | Ga0075369_10016168 | Ga0075369_100161683 | 315 |
| 831 | 3300006195 | Ga0075366_10049433 | Ga0075366_100494331 | 315 |
| 832 | 3300006353 | Ga0075370_10000790 | Ga0075370_1000079013 | 315 |
| 833 | 3300006881 | Ga0068865_100231903 | Ga0068865_1002319032 | 315 |
| 834 | 3300006946 | Ga0079104_1008652 | Ga0079104_10086522 | 315 |
| 835 | 3300009098 | Ga0105245_10249836 | Ga0105245_102498362 | 315 |
| 836 | 3300009174 | Ga0105241_10028242 | Ga0105241_100282422 | 315 |
| 837 | 3300009174 | Ga0105241_10042714 | Ga0105241_100427142 | 315 |
| 838 | 3300009545 | Ga0105237_10308890 | Ga0105237_103088902 | 315 |
| 839 | 3300009551 | Ga0105238_10018899 | Ga0105238_100188992 | 315 |
| 840 | 3300009553 | Ga0105249_10344701 | Ga0105249_103447012 | 315 |
| 841 | 3300010375 | Ga0105239_10028181 | Ga0105239_100281815 | 315 |
| 842 | 3300010375 | Ga0105239_10069958 | Ga0105239_100699583 | 315 |
| 843 | 3300010375 | Ga0105239_10078512 | Ga0105239_100785124 | 315 |
| 844 | 3300013102 | Ga0157371_10270803 | Ga0157371_102708031 | 315 |
| 845 | 3300013104 | Ga0157370_10060171 | Ga0157370_100601712 | 315 |
| 846 | 3300013104 | Ga0157370_10158271 | Ga0157370_101582712 | 315 |
| 847 | 3300013105 | Ga0157369_10002596 | Ga0157369_1000259612 | 315 |
| 848 | 3300013250 | Ga0171462_1067 | Ga0171462_10677 | 315 |
| 849 | 3300013307 | Ga0157372_10052860 | Ga0157372_100528602 | 315 |
| 850 | 3300022739 | Ga0228711_1000006 | Ga0228711_1000006174 | 315 |
| 851 | 3300022740 | Ga0228710_1000004 | Ga0228710_1000004225 | 315 |
| 852 | 3300025909 | Ga0207705_10018987 | Ga0207705_100189872 | 315 |
| 853 | 3300025909 | Ga0207705_10161161 | Ga0207705_101611612 | 315 |
| 854 | 3300025913 | Ga0207695_10029206 | Ga0207695_100292064 | 315 |
| 855 | 3300025919 | Ga0207657_10004936 | Ga0207657_1000493618 | 315 |
| 856 | 3300025920 | Ga0207649_10038059 | Ga0207649_100380592 | 315 |
| 857 | 3300025920 | Ga0207649_10047558 | Ga0207649_100475583 | 315 |
| 858 | 3300025920 | Ga0207649_10077321 | Ga0207649_100773212 | 315 |
| 859 | 3300025920 | Ga0207649_10094290 | Ga0207649_100942902 | 315 |
| 860 | 3300025924 | Ga0207694_10414682 | Ga0207694_104146822 | 315 |
| 861 | 3300025927 | Ga0207687_10348640 | Ga0207687_103486401 | 315 |
| 862 | 3300025932 | Ga0207690_10091750 | Ga0207690_100917502 | 315 |
| 863 | 3300025937 | Ga0207669_10022958 | Ga0207669_100229584 | 315 |
| 864 | 3300025940 | Ga0207691_10039264 | Ga0207691_100392644 | 315 |
| 865 | 3300025945 | Ga0207679_10188639 | Ga0207679_101886392 | 315 |
| 866 | 3300025949 | Ga0207667_10137137 | Ga0207667_101371372 | 315 |
| 867 | 3300025960 | Ga0207651_10009486 | Ga0207651_100094863 | 315 |
| 868 | 3300026041 | Ga0207639_10033504 | Ga0207639_100335043 | 315 |
| 869 | 3300026078 | Ga0207702_10017912 | Ga0207702_100179123 | 315 |
| 870 | 3300026089 | Ga0207648_10268943 | Ga0207648_102689431 | 315 |
| 871 | 3300026121 | Ga0207683_10027732 | Ga0207683_100277323 | 315 |
| 872 | 3300026142 | Ga0207698_10007021 | Ga0207698_100070217 | 315 |
| 873 | 3300026142 | Ga0207698_10168149 | Ga0207698_101681492 | 315 |
| 874 | 3300027111 | Ga0209281_1000102 | Ga0209281_1000102157 | 315 |
| 875 | 3300027111 | Ga0209281_1000563 | Ga0209281_100056318 | 315 |
| 876 | 3300027666 | Ga0209282_1000013 | Ga0209282_1000013192 | 315 |
| 877 | 3300031456 | Ga0307513_10018636 | Ga0307513_100186362 | 315 |
| 878 | 3300031903 | Ga0307407_10035282 | Ga0307407_100352822 | 315 |
| 879 | 3300031967 | Ga0315914_1000004 | Ga0315914_1000004227 | 315 |
| 880 | 3300032004 | Ga0307414_10224116 | Ga0307414_102241162 | 315 |
| 881 | 3300033430 | Ga0315913_1000055 | Ga0315913_100005522 | 315 |
| 882 | 3300033464 | Ga0315915_1000003 | Ga0315915_1000003334 | 315 |
| 883 | 3300037418 | Ga0395900_0436125 | Ga0395900_0436125_78_1025 | 315 |
| 884 | 3300037466 | Ga0395898_0160851 | Ga0395898_0160851_12_959 | 315 |
| 885 | 3300038443 | Ga0395901_0064452 | Ga0395901_0064452_2250_3197 | 315 |
| 886 | 3300042436 | Ga0439435_0000577 | Ga0439435_0000577_2095_3066 | 315 |
| 887 | 3300044683 | Ga0466965_0207935 | Ga0466965_0207935_38_985 | 315 |
| 888 | 3300046690 | Ga0495624_0166512 | Ga0495624_0166512_60_1064 | 315 |
| 889 | 3300049571 | Ga0501034_0027120 | Ga0501034_0027120_2180_3133 | 315 |
| 890 | 3300049571 | Ga0501034_0051191 | Ga0501034_0051191_2517_3464 | 315 |
| 891 | 3300049571 | Ga0501034_0053440 | Ga0501034_0053440_487_1434 | 315 |
| 892 | 3300049571 | Ga0501034_0106081 | Ga0501034_0106081_991_1938 | 315 |
| 893 | 3300049571 | Ga0501034_0194599 | Ga0501034_0194599_41_988 | 315 |
| 894 | 3300050491 | nmdc:mga00v17_90406_c1 | nmdc:mga00v17_90406_c1_209_1213 | 315 |
| 895 | 3300050496 | nmdc:mga07m45_10042_c1 | nmdc:mga07m45_10042_c1_1325_2278 | 315 |
| 896 | 3300050516 | nmdc:mga0sz30_14395_c1 | nmdc:mga0sz30_14395_c1_218_1165 | 315 |
| 897 | iso_pu_bacteria | 2509276021 | 2509389143 | 315 |
| 898 | iso_pu_bacteria | 2509276033 | 2509444697 | 315 |
| 899 | iso_pu_bacteria | 2510065019 | 2510135518 | 315 |
| 900 | iso_pu_bacteria | 2510461076 | 2510896980 | 315 |
| 901 | iso_pu_bacteria | 2510917030 | 2511194385 | 315 |
| 902 | iso_pu_bacteria | 2513237084 | 2513570712 | 315 |
| 903 | iso_pu_bacteria | 2513237085 | 2513575069 | 315 |
| 904 | iso_pu_bacteria | 2513237093 | 2513633856 | 315 |
| 905 | iso_pu_bacteria | 2513237103 | 2513712995 | 315 |
| 906 | iso_pu_bacteria | 2513237162 | 2514023508 | 315 |
| 907 | iso_pu_bacteria | 2515075009 | 2515114708 | 315 |
| 908 | iso_pu_bacteria | 2515154113 | 2515636709 | 315 |
| 909 | iso_pu_bacteria | 2515154114 | 2515644878 | 315 |
| 910 | iso_pu_bacteria | 2515154116 | 2515661186 | 315 |
| 911 | iso_pu_bacteria | 2515154134 | 2515741295 | 315 |
| 912 | iso_pu_bacteria | 2516653077 | 2517038335 | 315 |
| 913 | iso_pu_bacteria | 2516653085 | 2517078613 | 315 |
| 914 | iso_pu_bacteria | 2517093000 | 2517097350 | 315 |
| 915 | iso_pu_bacteria | 2517287029 | 2517408803 | 315 |
| 916 | iso_pu_bacteria | 2529292951 | 2530648457 | 315 |
| 917 | iso_pu_bacteria | 2582581298 | 2585223139 | 315 |
| 918 | iso_pu_bacteria | 2585427526 | 2585524072 | 315 |
| 919 | iso_pu_bacteria | 2585427528 | 2585543570 | 315 |
| 920 | iso_pu_bacteria | 2585427529 | 2585546265 | 315 |
| 921 | iso_pu_bacteria | 2585427593 | 2585841998 | 315 |
| 922 | iso_pu_bacteria | 2615840624 | 2616294066 | 315 |
| 923 | iso_pu_bacteria | 2718217882 | 2719183222 | 315 |
| 924 | iso_pu_bacteria | 2718217927 | 2719387947 | 315 |
| 925 | iso_pu_bacteria | 2718217997 | 2719667564 | 315 |
| 926 | iso_pu_bacteria | 2718218009 | 2719733939 | 315 |
| 927 | iso_pu_bacteria | 2718218199 | 2720493984 | 315 |
| 928 | iso_pu_bacteria | 2718218232 | 2720615447 | 315 |
| 929 | iso_pu_bacteria | 2718218233 | 2720622231 | 315 |
| 930 | iso_pu_bacteria | 2718218235 | 2720633585 | 315 |
| 931 | iso_pu_bacteria | 2718218269 | 2720777285 | 315 |
| 932 | iso_pu_bacteria | 2718218363 | 2721149334 | 315 |
| 933 | iso_pu_bacteria | 2718218365 | 2721160736 | 315 |
| 934 | iso_pu_bacteria | 2718218366 | 2721166147 | 315 |
| 935 | iso_pu_bacteria | 2718218423 | 2721401580 | 315 |
| 936 | iso_pu_bacteria | 2721755514 | 2722842317 | 315 |
| 937 | iso_pu_bacteria | 2721755556 | 2723028883 | 315 |
| 938 | iso_pu_bacteria | 2721755684 | 2723562499 | 315 |
| 939 | iso_pu_bacteria | 2721755685 | 2723569192 | 315 |
| 940 | iso_pu_bacteria | 2721755809 | 2724040394 | 315 |
| 941 | iso_pu_bacteria | 2721755810 | 2724046695 | 315 |
| 942 | iso_pu_bacteria | 2721755819 | 2724091892 | 315 |
| 943 | iso_pu_bacteria | 2721755822 | 2724106457 | 315 |
| 944 | iso_pu_bacteria | 2721755823 | 2724112262 | 315 |
| 945 | iso_pu_bacteria | 2724679232 | 2725947220 | 315 |
| 946 | iso_pu_bacteria | 2728369352 | 2730109819 | 315 |
| 947 | iso_pu_bacteria | 2728369365 | 2730166457 | 315 |
| 948 | iso_pu_bacteria | 2728369397 | 2730300368 | 315 |
| 949 | iso_pu_bacteria | 2738541333 | 2739038819 | 315 |
| 950 | iso_pu_bacteria | 2765235942 | 2766067322 | 315 |
| 951 | iso_pu_bacteria | 2791355256 | 2793298345 | 315 |
| 952 | iso_pu_bacteria | 2791355259 | 2793315810 | 315 |
| 953 | iso_pu_bacteria | 2791355260 | 2793323595 | 315 |
| 954 | iso_pu_bacteria | 2791355261 | 2793330364 | 315 |
| 955 | iso_pu_bacteria | 2791355262 | 2793335529 | 315 |
| 956 | iso_pu_bacteria | 2791355263 | 2793340916 | 315 |
| 957 | iso_pu_bacteria | 2791355264 | 2793350901 | 315 |
| 958 | iso_pu_bacteria | 2791355265 | 2793354655 | 315 |
| 959 | iso_pu_bacteria | 2791355266 | 2793358649 | 315 |
| 960 | iso_pu_bacteria | 2791355267 | 2793369133 | 315 |
| 961 | iso_pu_bacteria | 2802429605 | 2805929028 | 315 |
| 962 | iso_pu_bacteria | 2802429606 | 2805934650 | 315 |
| 963 | iso_pu_bacteria | 2802429633 | 2806049229 | 315 |
| 964 | iso_pu_bacteria | 2802429634 | 2806056146 | 315 |
| 965 | iso_pu_bacteria | 2802429635 | 2806063154 | 315 |
| 966 | iso_pu_bacteria | 2802429636 | 2806070752 | 315 |
| 967 | iso_pu_bacteria | 2802429637 | 2806077613 | 315 |
| 968 | iso_pu_bacteria | 2842217011 | 2842219541 | 315 |
| 969 | iso_pu_bacteria | 2862705112 | 2862708550 | 315 |
| 970 | iso_pu_bacteria | 2894817345 | 2894818904 | 315 |
| 971 | iso_pu_bacteria | 2933570622 | 2933575037 | 315 |
| 972 | iso_pu_bacteria | 2933586486 | 2933588239 | 315 |
| 973 | iso_pu_bacteria | 2933599457 | 2933601173 | 315 |
| 974 | iso_pu_bacteria | 2935894831 | 2935900097 | 315 |
| 975 | iso_pu_bacteria | 2935901341 | 2935902208 | 315 |
| 976 | iso_pu_bacteria | 2936367885 | 2936369657 | 315 |
| 977 | iso_pu_bacteria | 2936375103 | 2936380395 | 315 |
| 978 | iso_pu_bacteria | 2936381700 | 2936385138 | 315 |
| 979 | iso_pu_bacteria | 2996893221 | 2996896242 | 315 |
| 980 | iso_pu_bacteria | 3005445848 | 3005449948 | 315 |
| 981 | iso_pu_bacteria | 639633055 | 639645956 | 315 |
| 982 | iso_pu_bacteria | 8005275841 | 8005278147 | 315 |
| 983 | iso_pu_bacteria | 8005282627 | 8005282825 | 315 |
| 984 | iso_pu_bacteria | 8005289223 | 8005291767 | 315 |
| 985 | iso_pu_bacteria | 8005301065 | 8005305366 | 315 |
| 986 | iso_pu_bacteria | 8005307578 | 8005310138 | 315 |
| 987 | iso_pu_bacteria | 8005376324 | 8005378214 | 315 |
| 988 | iso_pu_bacteria | 8005382845 | 8005384240 | 315 |
| 989 | iso_pu_bacteria | 8005395548 | 8005399484 | 315 |
| 990 | iso_pu_bacteria | 8005430974 | 8005432405 | 315 |
| 991 | iso_pu_bacteria | 8005460587 | 8005465403 | 315 |
| 992 | iso_pu_bacteria | 8005497431 | 8005497955 | 315 |
| 993 | iso_pu_bacteria | 8005556819 | 8005559852 | 315 |
| 994 | iso_pu_bacteria | 8005563573 | 8005564650 | 315 |
| 995 | iso_pu_bacteria | 8005570704 | 8005570982 | 315 |
| 996 | iso_pu_bacteria | 8005619151 | 8005619171 | 315 |
| 997 | iso_pu_bacteria | 8005626139 | 8005627734 | 315 |
| 998 | iso_pu_bacteria | 8005668836 | 8005669362 | 315 |
| 999 | iso_pu_bacteria | 8005688590 | 8005692881 | 315 |
| 1000 | iso_pu_bacteria | 8005695170 | 8005701620 | 315 |
| 1001 | iso_pu_bacteria | 8018127388 | 8018132428 | 315 |
| 1002 | iso_pu_bacteria | 8018163183 | 8018167112 | 315 |
| 1003 | iso_pu_bacteria | 8018176218 | 8018176764 | 315 |
| 1004 | iso_pu_bacteria | 8023680758 | 8023681386 | 315 |
| 1005 | iso_pu_bacteria | 8024479707 | 8024481781 | 315 |
| 1006 | iso_pu_bacteria | 8024501048 | 8024506214 | 315 |
| 1007 | iso_pu_bacteria | 8056375014 | 8056381337 | 315 |
| 1008 | iso_pu_bacteria | 8056382006 | 8056382794 | 315 |
| 1009 | iso_pu_bacteria | 8057874678 | 8057877238 | 315 |
| 1010 | 3300005539 | Ga0068853_100000565 | Ga0068853_1000005657 | 316 |
| 1011 | 3300006038 | Ga0075365_10008876 | Ga0075365_100088764 | 316 |
| 1012 | 3300006038 | Ga0075365_10019507 | Ga0075365_100195073 | 316 |
| 1013 | 3300013104 | Ga0157370_10217126 | Ga0157370_102171262 | 316 |
| 1014 | 3300013296 | Ga0157374_10118195 | Ga0157374_101181953 | 316 |
| 1015 | 3300026041 | Ga0207639_10001011 | Ga0207639_100010112 | 316 |
| 1016 | 3300033180 | Ga0307510_10054575 | Ga0307510_100545752 | 316 |
| 1017 | 3300037418 | Ga0395900_0502445 | Ga0395900_0502445_154_1107 | 316 |
| 1018 | 3300038443 | Ga0395901_0345048 | Ga0395901_0345048_445_1398 | 316 |
| 1019 | 3300046809 | Ga0495600_0030281 | Ga0495600_0030281_530_1489 | 316 |
| 1020 | 3300047322 | Ga0495680_0070768 | Ga0495680_0070768_1440_2399 | 316 |
| 1021 | 3300049568 | Ga0501031_0143633 | Ga0501031_0143633_44_994 | 316 |
| 1022 | 3300049568 | Ga0501031_0158256 | Ga0501031_0158256_221_1180 | 316 |
| 1023 | 3300049569 | Ga0501032_0019351 | Ga0501032_0019351_2474_3424 | 316 |
| 1024 | 3300049570 | Ga0501033_0017798 | Ga0501033_0017798_2049_3002 | 316 |
| 1025 | 3300049570 | Ga0501033_0024093 | Ga0501033_0024093_1602_2552 | 316 |
| 1026 | 3300049571 | Ga0501034_0035747 | Ga0501034_0035747_2631_3584 | 316 |
| 1027 | 3300049572 | Ga0501036_0021649 | Ga0501036_0021649_1908_2858 | 316 |
| 1028 | 3300049572 | Ga0501036_0040760 | Ga0501036_0040760_608_1561 | 316 |
| 1029 | 3300049573 | Ga0501037_0007341 | Ga0501037_0007341_4403_5353 | 316 |
| 1030 | 3300049573 | Ga0501037_0049740 | Ga0501037_0049740_473_1423 | 316 |
| 1031 | 3300049574 | Ga0501038_0047708 | Ga0501038_0047708_920_1870 | 316 |
| 1032 | 3300049574 | Ga0501038_0073514 | Ga0501038_0073514_1240_2193 | 316 |
| 1033 | 3300049574 | Ga0501038_0172259 | Ga0501038_0172259_414_1367 | 316 |
| 1034 | 3300049575 | Ga0501039_0136324 | Ga0501039_0136324_833_1783 | 316 |
| 1035 | 3300049580 | Ga0501046_0022934 | Ga0501046_0022934_3952_4905 | 316 |
| 1036 | 3300049581 | Ga0501047_0032607 | Ga0501047_0032607_2360_3310 | 316 |
| 1037 | 3300049586 | Ga0501070_0019852 | Ga0501070_0019852_2188_3138 | 316 |
| 1038 | 3300049586 | Ga0501070_0030405 | Ga0501070_0030405_1297_2250 | 316 |
| 1039 | 3300049589 | Ga0501073_0190278 | Ga0501073_0190278_133_1086 | 316 |
| 1040 | 3300049742 | Ga0501080_0072761 | Ga0501080_0072761_1842_2795 | 316 |
| 1041 | 3300049822 | Ga0501035_0020784 | Ga0501035_0020784_2474_3427 | 316 |
| 1042 | 3300049822 | Ga0501035_0020842 | Ga0501035_0020842_4557_5510 | 316 |
| 1043 | 3300049822 | Ga0501035_0400769 | Ga0501035_0400769_31_981 | 316 |
| 1044 | 3300049823 | Ga0501044_0272994 | Ga0501044_0272994_303_1256 | 316 |
| 1045 | 3300049823 | Ga0501044_0288956 | Ga0501044_0288956_163_1116 | 316 |
| 1046 | 3300053119 | Ga0500595_000538 | Ga0500595_000538_7975_8925 | 316 |
| 1047 | 3300053140 | Ga0500573_0054464 | Ga0500573_0054464_444_1409 | 316 |
| 1048 | iso_pu_bacteria | 2513237144 | 2513912566 | 316 |
| 1049 | iso_pu_bacteria | 2513237146 | 2513924189 | 316 |
| 1050 | iso_pu_bacteria | 2534681796 | 2535514518 | 316 |
| 1051 | iso_pu_bacteria | 2582581294 | 2585201346 | 316 |
| 1052 | iso_pu_bacteria | 2599185170 | 2599419858 | 316 |
| 1053 | iso_pu_bacteria | 2643221599 | 2644004281 | 316 |
| 1054 | iso_pu_bacteria | 2933016740 | 2933020584 | 316 |
| 1055 | iso_pu_bacteria | 3005409236 | 3005410514 | 316 |
| 1056 | iso_pu_bacteria | 3005452660 | 3005456281 | 316 |
| 1057 | iso_pu_bacteria | 8005542996 | 8005543171 | 316 |
| 1058 | iso_pu_bacteria | 8055431914 | 8055435339 | 316 |
| 1059 | 3300002773 | JGI25152J39213_1002263 | JGI25152J39213_10022634 | 317 |
| 1060 | 3300003187 | JGI25151J46595_10004033 | JGI25151J46595_100040333 | 317 |
| 1061 | 3300003771 | Ga0055526_1013134 | Ga0055526_10131342 | 317 |
| 1062 | 3300003775 | Ga0055524_1003779 | Ga0055524_10037794 | 317 |
| 1063 | 3300003790 | Ga0055528_1017305 | Ga0055528_10173052 | 317 |
| 1064 | 3300003856 | Ga0058692_1002641 | Ga0058692_10026411 | 317 |
| 1065 | 3300005347 | Ga0070668_100013330 | Ga0070668_1000133305 | 317 |
| 1066 | 3300005455 | Ga0070663_100066828 | Ga0070663_1000668282 | 317 |
| 1067 | 3300005455 | Ga0070663_100094147 | Ga0070663_1000941472 | 317 |
| 1068 | 3300005548 | Ga0070665_100002585 | Ga0070665_10000258523 | 317 |
| 1069 | 3300005578 | Ga0068854_100244498 | Ga0068854_1002444982 | 317 |
| 1070 | 3300006038 | Ga0075365_10004465 | Ga0075365_100044655 | 317 |
| 1071 | 3300006042 | Ga0075368_10047512 | Ga0075368_100475122 | 317 |
| 1072 | 3300006048 | Ga0075363_100116753 | Ga0075363_1001167532 | 317 |
| 1073 | 3300006051 | Ga0075364_10023714 | Ga0075364_100237143 | 317 |
| 1074 | 3300006051 | Ga0075364_10030856 | Ga0075364_100308562 | 317 |
| 1075 | 3300006178 | Ga0075367_10052945 | Ga0075367_100529453 | 317 |
| 1076 | 3300006186 | Ga0075369_10005102 | Ga0075369_100051022 | 317 |
| 1077 | 3300006186 | Ga0075369_10021032 | Ga0075369_100210323 | 317 |
| 1078 | 3300006195 | Ga0075366_10142145 | Ga0075366_101421452 | 317 |
| 1079 | 3300006948 | Ga0099826_10000040 | Ga0099826_1000004054 | 317 |
| 1080 | 3300006948 | Ga0099826_10080445 | Ga0099826_100804452 | 317 |
| 1081 | 3300009011 | Ga0105251_10008485 | Ga0105251_100084852 | 317 |
| 1082 | 3300009177 | Ga0105248_10009144 | Ga0105248_100091444 | 317 |
| 1083 | 3300009765 | Ga0123341_1083945 | Ga0123341_10839451 | 317 |
| 1084 | 3300009766 | Ga0123342_1020788 | Ga0123342_10207883 | 317 |
| 1085 | 3300011119 | Ga0105246_10105769 | Ga0105246_101057692 | 317 |
| 1086 | 3300013102 | Ga0157371_10000042 | Ga0157371_10000042121 | 317 |
| 1087 | 3300013104 | Ga0157370_10000035 | Ga0157370_1000003571 | 317 |
| 1088 | 3300025258 | Ga0209129_1001779 | Ga0209129_10017798 | 317 |
| 1089 | 3300025273 | Ga0209673_1002508 | Ga0209673_10025086 | 317 |
| 1090 | 3300025284 | Ga0209130_1006186 | Ga0209130_10061864 | 317 |
| 1091 | 3300025294 | Ga0209025_1000374 | Ga0209025_100037455 | 317 |
| 1092 | 3300025295 | Ga0209564_1011645 | Ga0209564_10116452 | 317 |
| 1093 | 3300025297 | Ga0209758_1028154 | Ga0209758_10281542 | 317 |
| 1094 | 3300025299 | Ga0209256_1005354 | Ga0209256_10053542 | 317 |
| 1095 | 3300025302 | Ga0207426_1001778 | Ga0207426_10017785 | 317 |
| 1096 | 3300025903 | Ga0207680_10148648 | Ga0207680_101486482 | 317 |
| 1097 | 3300025941 | Ga0207711_10037909 | Ga0207711_100379093 | 317 |
| 1098 | 3300025972 | Ga0207668_10168681 | Ga0207668_101686812 | 317 |
| 1099 | 3300026067 | Ga0207678_10029480 | Ga0207678_100294804 | 317 |
| 1100 | 3300026067 | Ga0207678_10046776 | Ga0207678_100467762 | 317 |
| 1101 | 3300027312 | Ga0209371_1000003 | Ga0209371_1000003146 | 317 |
| 1102 | 3300027312 | Ga0209371_1000998 | Ga0209371_10009987 | 317 |
| 1103 | 3300027666 | Ga0209282_1000150 | Ga0209282_100015039 | 317 |
| 1104 | 3300027666 | Ga0209282_1080876 | Ga0209282_10808762 | 317 |
| 1105 | 3300027866 | Ga0209813_10005108 | Ga0209813_100051081 | 317 |
| 1106 | 3300028379 | Ga0268266_10002425 | Ga0268266_100024255 | 317 |
| 1107 | 3300030500 | Ga0268256_1000004 | Ga0268256_1000004905 | 317 |
| 1108 | 3300030500 | Ga0268256_1002297 | Ga0268256_10022976 | 317 |
| 1109 | 3300031911 | Ga0307412_10295612 | Ga0307412_102956122 | 317 |
| 1110 | 3300031995 | Ga0307409_100081884 | Ga0307409_1000818842 | 317 |
| 1111 | 3300031995 | Ga0307409_100179512 | Ga0307409_1001795122 | 317 |
| 1112 | 3300032002 | Ga0307416_100230775 | Ga0307416_1002307752 | 317 |
| 1113 | 3300046519 | Ga0495632_0004032 | Ga0495632_0004032_8579_9541 | 317 |
| 1114 | 3300046558 | Ga0495633_0033929 | Ga0495633_0033929_1350_2303 | 317 |
| 1115 | 3300048920 | Ga0496117_0012929 | Ga0496117_0012929_1084_2037 | 317 |
| 1116 | 3300048921 | Ga0496118_0027736 | Ga0496118_0027736_424_1377 | 317 |
| 1117 | 3300048923 | Ga0496120_0000036 | Ga0496120_0000036_143535_144488 | 317 |
| 1118 | 3300048924 | Ga0496121_0000005 | Ga0496121_0000005_910582_911535 | 317 |
| 1119 | 3300048924 | Ga0496121_0002070 | Ga0496121_0002070_13025_13978 | 317 |
| 1120 | 3300048925 | Ga0496122_0000002 | Ga0496122_0000002_642617_643570 | 317 |
| 1121 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_1168113_1169066 | 317 |
| 1122 | 3300048926 | Ga0496123_0000002 | Ga0496123_0000002_642617_643570 | 317 |
| 1123 | 3300048927 | Ga0496124_0000080 | Ga0496124_0000080_107117_108070 | 317 |
| 1124 | 3300048927 | Ga0496124_0091559 | Ga0496124_0091559_69_1022 | 317 |
| 1125 | 3300048928 | Ga0496125_0000159 | Ga0496125_0000159_34679_35632 | 317 |
| 1126 | 3300049570 | Ga0501033_0087165 | Ga0501033_0087165_1011_1967 | 317 |
| 1127 | 3300049572 | Ga0501036_0089301 | Ga0501036_0089301_615_1571 | 317 |
| 1128 | 3300049574 | Ga0501038_0018372 | Ga0501038_0018372_1109_2065 | 317 |
| 1129 | 3300049589 | Ga0501073_0117499 | Ga0501073_0117499_697_1653 | 317 |
| 1130 | 3300049822 | Ga0501035_0174302 | Ga0501035_0174302_835_1791 | 317 |
| 1131 | 3300050490 | nmdc:mga03n38_181885_c1 | nmdc:mga03n38_181885_c1_79_1032 | 317 |
| 1132 | 3300050491 | nmdc:mga00v17_19_c1 | nmdc:mga00v17_19_c1_83375_84328 | 317 |
| 1133 | 3300050491 | nmdc:mga00v17_27140_c1 | nmdc:mga00v17_27140_c1_839_1792 | 317 |
| 1134 | 3300050492 | nmdc:mga0yw44_1027_c1 | nmdc:mga0yw44_1027_c1_3339_4292 | 317 |
| 1135 | 3300050496 | nmdc:mga07m45_81937_c1 | nmdc:mga07m45_81937_c1_567_1520 | 317 |
| 1136 | 3300050516 | nmdc:mga0sz30_1633_c1 | nmdc:mga0sz30_1633_c1_5107_6060 | 317 |
| 1137 | 3300050516 | nmdc:mga0sz30_48680_c1 | nmdc:mga0sz30_48680_c1_201_1154 | 317 |
| 1138 | 3300053093 | Ga0500651_0012275 | Ga0500651_0012275_816_1769 | 317 |
| 1139 | 3300053107 | Ga0500560_000204 | Ga0500560_000204_5651_6604 | 317 |
| 1140 | 3300053107 | Ga0500560_035782 | Ga0500560_035782_543_1496 | 317 |
| 1141 | 3300053111 | Ga0500572_001954 | Ga0500572_001954_430_1383 | 317 |
| 1142 | 3300053130 | Ga0500642_0028242 | Ga0500642_0028242_91_1044 | 317 |
| 1143 | 3300053137 | Ga0500561_0000036 | Ga0500561_0000036_9222_10175 | 317 |
| 1144 | 3300053157 | Ga0500624_001367 | Ga0500624_001367_2640_3593 | 317 |
| 1145 | 3300053157 | Ga0500624_004302 | Ga0500624_004302_371_1324 | 317 |
| 1146 | 3300053161 | Ga0500634_0000032 | Ga0500634_0000032_12896_13849 | 317 |
| 1147 | 3300053161 | Ga0500634_0000373 | Ga0500634_0000373_542_1495 | 317 |
| 1148 | 3300053177 | Ga0500636_0000011 | Ga0500636_0000011_129669_130622 | 317 |
| 1149 | 3300053177 | Ga0500636_0000283 | Ga0500636_0000283_22149_23102 | 317 |
| 1150 | 3300059508 | Ga0587088_016049 | Ga0587088_016049_163_1116 | 317 |
| 1151 | 3300002739 | JGI25158J39367_1000160 | JGI25158J39367_100016012 | 318 |
| 1152 | 3300002773 | JGI25152J39213_1001531 | JGI25152J39213_10015316 | 318 |
| 1153 | 3300002987 | JGI25159J45721_1000711 | JGI25159J45721_10007118 | 318 |
| 1154 | 3300003187 | JGI25151J46595_10000409 | JGI25151J46595_1000040915 | 318 |
| 1155 | 3300003215 | JGI25153J46596_10003661 | JGI25153J46596_100036618 | 318 |
| 1156 | 3300003354 | JGI25160J50197_1002301 | JGI25160J50197_10023016 | 318 |
| 1157 | 3300003354 | JGI25160J50197_1002712 | JGI25160J50197_10027126 | 318 |
| 1158 | 3300003374 | JGI25161J50226_1000206 | JGI25161J50226_100020631 | 318 |
| 1159 | 3300003771 | Ga0055526_1000489 | Ga0055526_100048918 | 318 |
| 1160 | 3300003771 | Ga0055526_1004307 | Ga0055526_10043076 | 318 |
| 1161 | 3300003775 | Ga0055524_1005189 | Ga0055524_10051895 | 318 |
| 1162 | 3300003775 | Ga0055524_1005277 | Ga0055524_10052771 | 318 |
| 1163 | 3300003790 | Ga0055528_1001760 | Ga0055528_10017607 | 318 |
| 1164 | 3300003790 | Ga0055528_1002389 | Ga0055528_10023898 | 318 |
| 1165 | 3300003790 | Ga0055528_1021586 | Ga0055528_10215861 | 318 |
| 1166 | 3300003792 | Ga0055540_1000320 | Ga0055540_100032026 | 318 |
| 1167 | 3300003792 | Ga0055540_1003981 | Ga0055540_10039814 | 318 |
| 1168 | 3300003792 | Ga0055540_1028718 | Ga0055540_10287182 | 318 |
| 1169 | 3300004625 | Ga0055543_1000248 | Ga0055543_100024823 | 318 |
| 1170 | 3300004625 | Ga0055543_1002104 | Ga0055543_10021045 | 318 |
| 1171 | 3300005262 | Ga0065165_1006963 | Ga0065165_10069634 | 318 |
| 1172 | 3300005353 | Ga0070669_100061720 | Ga0070669_1000617202 | 318 |
| 1173 | 3300006038 | Ga0075365_10001348 | Ga0075365_100013488 | 318 |
| 1174 | 3300006042 | Ga0075368_10066825 | Ga0075368_100668251 | 318 |
| 1175 | 3300006177 | Ga0075362_10010334 | Ga0075362_100103342 | 318 |
| 1176 | 3300006178 | Ga0075367_10031237 | Ga0075367_100312373 | 318 |
| 1177 | 3300006186 | Ga0075369_10009196 | Ga0075369_100091962 | 318 |
| 1178 | 3300006195 | Ga0075366_10001240 | Ga0075366_1000124011 | 318 |
| 1179 | 3300009766 | Ga0123342_1033145 | Ga0123342_10331452 | 318 |
| 1180 | 3300012490 | Ga0157322_1000363 | Ga0157322_10003632 | 318 |
| 1181 | 3300021320 | Ga0214544_1000771 | Ga0214544_100077136 | 318 |
| 1182 | 3300021321 | Ga0214542_1000032 | Ga0214542_100003254 | 318 |
| 1183 | 3300021321 | Ga0214542_1021618 | Ga0214542_10216183 | 318 |
| 1184 | 3300021327 | Ga0214543_1000016 | Ga0214543_1000016224 | 318 |
| 1185 | 3300021327 | Ga0214543_1009269 | Ga0214543_100926910 | 318 |
| 1186 | 3300025208 | Ga0209436_100127 | Ga0209436_10012732 | 318 |
| 1187 | 3300025245 | Ga0207425_1014088 | Ga0207425_10140882 | 318 |
| 1188 | 3300025258 | Ga0209129_1000312 | Ga0209129_100031222 | 318 |
| 1189 | 3300025258 | Ga0209129_1004734 | Ga0209129_10047343 | 318 |
| 1190 | 3300025273 | Ga0209673_1000584 | Ga0209673_100058429 | 318 |
| 1191 | 3300025273 | Ga0209673_1001948 | Ga0209673_100194813 | 318 |
| 1192 | 3300025273 | Ga0209673_1002261 | Ga0209673_10022616 | 318 |
| 1193 | 3300025273 | Ga0209673_1002576 | Ga0209673_10025768 | 318 |
| 1194 | 3300025284 | Ga0209130_1000002 | Ga0209130_1000002698 | 318 |
| 1195 | 3300025294 | Ga0209025_1000857 | Ga0209025_100085724 | 318 |
| 1196 | 3300025294 | Ga0209025_1015222 | Ga0209025_10152225 | 318 |
| 1197 | 3300025295 | Ga0209564_1000914 | Ga0209564_100091425 | 318 |
| 1198 | 3300025295 | Ga0209564_1001996 | Ga0209564_100199613 | 318 |
| 1199 | 3300025297 | Ga0209758_1001197 | Ga0209758_100119723 | 318 |
| 1200 | 3300025297 | Ga0209758_1001885 | Ga0209758_100188512 | 318 |
| 1201 | 3300025297 | Ga0209758_1002066 | Ga0209758_100206618 | 318 |
| 1202 | 3300025297 | Ga0209758_1026422 | Ga0209758_10264222 | 318 |
| 1203 | 3300025299 | Ga0209256_1000739 | Ga0209256_100073925 | 318 |
| 1204 | 3300025299 | Ga0209256_1007001 | Ga0209256_10070014 | 318 |
| 1205 | 3300025302 | Ga0207426_1000013 | Ga0207426_1000013698 | 318 |
| 1206 | 3300025302 | Ga0207426_1000812 | Ga0207426_100081223 | 318 |
| 1207 | 3300025303 | Ga0209051_1000195 | Ga0209051_100019528 | 318 |
| 1208 | 3300025303 | Ga0209051_1002486 | Ga0209051_10024861 | 318 |
| 1209 | 3300025303 | Ga0209051_1007413 | Ga0209051_10074134 | 318 |
| 1210 | 3300025304 | Ga0209257_1007822 | Ga0209257_10078224 | 318 |
| 1211 | 3300028379 | Ga0268266_10303773 | Ga0268266_103037732 | 318 |
| 1212 | 3300031852 | Ga0307410_10051199 | Ga0307410_100511992 | 318 |
| 1213 | 3300041413 | Ga0439465_0028012 | Ga0439465_0028012_376_1335 | 318 |
| 1214 | 3300041453 | Ga0451797_0381403 | Ga0451797_0381403_1590_2549 | 318 |
| 1215 | 3300041458 | Ga0451798_0043797 | Ga0451798_0043797_164_1123 | 318 |
| 1216 | 3300041496 | Ga0451839_0282160 | Ga0451839_0282160_333_1292 | 318 |
| 1217 | 3300041498 | Ga0451841_1056658 | Ga0451841_1056658_268_1227 | 318 |
| 1218 | 3300041501 | Ga0451845_0333885 | Ga0451845_0333885_270_1229 | 318 |
| 1219 | 3300046500 | Ga0495596_0038697 | Ga0495596_0038697_689_1648 | 318 |
| 1220 | 3300046501 | Ga0495607_0030405 | Ga0495607_0030405_811_1770 | 318 |
| 1221 | 3300046507 | Ga0495606_0017853 | Ga0495606_0017853_3354_4313 | 318 |
| 1222 | 3300046507 | Ga0495606_0162551 | Ga0495606_0162551_178_1137 | 318 |
| 1223 | 3300046512 | Ga0495610_0006514 | Ga0495610_0006514_4899_5858 | 318 |
| 1224 | 3300046515 | Ga0495620_0035733 | Ga0495620_0035733_967_1926 | 318 |
| 1225 | 3300046522 | Ga0495643_0049454 | Ga0495643_0049454_292_1251 | 318 |
| 1226 | 3300046524 | Ga0495648_0097122 | Ga0495648_0097122_121_1080 | 318 |
| 1227 | 3300046558 | Ga0495633_0033803 | Ga0495633_0033803_698_1657 | 318 |
| 1228 | 3300046660 | Ga0495625_0125786 | Ga0495625_0125786_703_1662 | 318 |
| 1229 | 3300046660 | Ga0495625_0143473 | Ga0495625_0143473_73_1032 | 318 |
| 1230 | 3300046691 | Ga0495670_0027101 | Ga0495670_0027101_1610_2569 | 318 |
| 1231 | 3300046694 | Ga0495649_0028640 | Ga0495649_0028640_1554_2513 | 318 |
| 1232 | 3300046810 | Ga0495660_0042753 | Ga0495660_0042753_1252_2211 | 318 |
| 1233 | 3300047318 | Ga0495636_0099378 | Ga0495636_0099378_227_1186 | 318 |
| 1234 | 3300047323 | Ga0495683_0032607 | Ga0495683_0032607_439_1398 | 318 |
| 1235 | 3300047472 | Ga0495686_0013754 | Ga0495686_0013754_1522_2481 | 318 |
| 1236 | 3300048909 | Ga0496106_0000490 | Ga0496106_0000490_1401_2360 | 318 |
| 1237 | 3300048924 | Ga0496121_0155643 | Ga0496121_0155643_176_1135 | 318 |
| 1238 | 3300048925 | Ga0496122_0008486 | Ga0496122_0008486_5593_6552 | 318 |
| 1239 | 3300048926 | Ga0496123_0011879 | Ga0496123_0011879_5538_6497 | 318 |
| 1240 | 3300048927 | Ga0496124_0213432 | Ga0496124_0213432_346_1305 | 318 |
| 1241 | 3300048928 | Ga0496125_0038894 | Ga0496125_0038894_2015_2974 | 318 |
| 1242 | 3300050492 | nmdc:mga0yw44_2126_c1 | nmdc:mga0yw44_2126_c1_6241_7200 | 318 |
| 1243 | 3300050493 | nmdc:mga0k408_45584_c1 | nmdc:mga0k408_45584_c1_123_1082 | 318 |
| 1244 | 3300050494 | nmdc:mga06z11_2714_c1 | nmdc:mga06z11_2714_c1_4086_5045 | 318 |
| 1245 | 3300050496 | nmdc:mga07m45_105104_c1 | nmdc:mga07m45_105104_c1_572_1531 | 318 |
| 1246 | 3300053134 | Ga0500658_0000083 | Ga0500658_0000083_29901_30860 | 318 |
| 1247 | 3300053135 | Ga0500659_0046074 | Ga0500659_0046074_459_1418 | 318 |
| 1248 | 3300053156 | Ga0500622_0000308 | Ga0500622_0000308_12730_13689 | 318 |
| 1249 | 3300053156 | Ga0500622_0061320 | Ga0500622_0061320_944_1903 | 318 |
| 1250 | iso_pu_bacteria | 2510917022 | 2511133098 | 318 |
| 1251 | iso_pu_bacteria | 2524023209 | 2524458620 | 318 |
| 1252 | iso_pu_bacteria | 2582581307 | 2585271835 | 318 |
| 1253 | iso_pu_bacteria | 2582581308 | 2585279799 | 318 |
| 1254 | iso_pu_bacteria | 2582581315 | 2585326661 | 318 |
| 1255 | iso_pu_bacteria | 2582581316 | 2585333827 | 318 |
| 1256 | iso_pu_bacteria | 2585427527 | 2585531797 | 318 |
| 1257 | iso_pu_bacteria | 2585427530 | 2585551255 | 318 |
| 1258 | iso_pu_bacteria | 2585427531 | 2585563799 | 318 |
| 1259 | iso_pu_bacteria | 2585427608 | 2585897003 | 318 |
| 1260 | iso_pu_bacteria | 2585427609 | 2585907138 | 318 |
| 1261 | iso_pu_bacteria | 2585428125 | 2587982868 | 318 |
| 1262 | iso_pu_bacteria | 2615840626 | 2616306590 | 318 |
| 1263 | iso_pu_bacteria | 2615840698 | 2616551227 | 318 |
| 1264 | iso_pu_bacteria | 2617270742 | 2617382978 | 318 |
| 1265 | iso_pu_bacteria | 2667528174 | 2671113351 | 318 |
| 1266 | iso_pu_bacteria | 2775507266 | 2778179042 | 318 |
| 1267 | iso_pu_bacteria | 2818991448 | 2819611636 | 318 |
| 1268 | iso_pu_bacteria | 2818991453 | 2819638686 | 318 |
| 1269 | iso_pu_bacteria | 2838029111 | 2838031063 | 318 |
| 1270 | iso_pu_bacteria | 2842298080 | 2842300119 | 318 |
| 1271 | iso_pu_bacteria | 2842357229 | 2842359030 | 318 |
| 1272 | iso_pu_bacteria | 2842475841 | 2842477795 | 318 |
| 1273 | iso_pu_bacteria | 2842482326 | 2842485092 | 318 |
| 1274 | iso_pu_bacteria | 2842502639 | 2842504333 | 318 |
| 1275 | iso_pu_bacteria | 2842509118 | 2842511552 | 318 |
| 1276 | iso_pu_bacteria | 2852387548 | 2852391907 | 318 |
| 1277 | iso_pu_bacteria | 2899803654 | 2899804633 | 318 |
| 1278 | iso_pu_bacteria | 2919408235 | 2919411194 | 318 |
| 1279 | iso_pu_bacteria | 3005416602 | 3005421490 | 318 |
| 1280 | iso_pu_bacteria | 8005314921 | 8005319807 | 318 |
| 1281 | iso_pu_bacteria | 8005484373 | 8005490432 | 318 |
| 1282 | iso_pu_bacteria | 8005645114 | 8005647075 | 318 |
| 1283 | iso_pu_bacteria | 8005682033 | 8005687005 | 318 |
| 1284 | iso_pu_bacteria | 8046767195 | 8046767402 | 318 |
| 1285 | iso_pu_bacteria | 8057575449 | 8057578462 | 318 |
| 1286 | 3300002773 | JGI25152J39213_1000861 | JGI25152J39213_10008617 | 319 |
| 1287 | 3300002773 | JGI25152J39213_1001207 | JGI25152J39213_10012078 | 319 |
| 1288 | 3300003775 | Ga0055524_1014466 | Ga0055524_10144663 | 319 |
| 1289 | 3300003775 | Ga0055524_1021523 | Ga0055524_10215232 | 319 |
| 1290 | 3300003790 | Ga0055528_1000478 | Ga0055528_100047812 | 319 |
| 1291 | 3300003792 | Ga0055540_1026234 | Ga0055540_10262341 | 319 |
| 1292 | 3300005262 | Ga0065165_1015821 | Ga0065165_10158212 | 319 |
| 1293 | 3300025258 | Ga0209129_1000357 | Ga0209129_100035718 | 319 |
| 1294 | 3300025273 | Ga0209673_1000890 | Ga0209673_100089016 | 319 |
| 1295 | 3300025292 | Ga0209676_1029891 | Ga0209676_10298912 | 319 |
| 1296 | 3300025294 | Ga0209025_1001822 | Ga0209025_100182220 | 319 |
| 1297 | 3300025297 | Ga0209758_1037090 | Ga0209758_10370902 | 319 |
| 1298 | 3300025299 | Ga0209256_1001817 | Ga0209256_100181713 | 319 |
| 1299 | 3300025303 | Ga0209051_1062767 | Ga0209051_10627672 | 319 |
| 1300 | 3300031901 | Ga0307406_10010585 | Ga0307406_100105853 | 319 |
| 1301 | 3300048909 | Ga0496106_0175938 | Ga0496106_0175938_222_1184 | 319 |
| 1302 | 3300048925 | Ga0496122_0128499 | Ga0496122_0128499_115_1077 | 319 |
| 1303 | 3300048929 | Ga0496126_0214915 | Ga0496126_0214915_644_1606 | 319 |
| 1304 | 3300046507 | Ga0495606_0001613 | Ga0495606_0001613_15359_16324 | 321 |
| 1305 | 3300046524 | Ga0495648_0049708 | Ga0495648_0049708_44_1009 | 321 |
| 1306 | iso_pu_bacteria | 3000017691 | 3000021223 | 321 |
| 1307 | 3300001979 | JGI24740J21852_10009206 | JGI24740J21852_100092062 | 322 |
| 1308 | 3300002704 | JGI25155J39150_1000004 | JGI25155J39150_1000004127 | 322 |
| 1309 | 3300002705 | JGI25156J39149_1000014 | JGI25156J39149_100001453 | 322 |
| 1310 | 3300002705 | JGI25156J39149_1000015 | JGI25156J39149_100001543 | 322 |
| 1311 | 3300002737 | JGI25162J39368_1001203 | JGI25162J39368_100120312 | 322 |
| 1312 | 3300002737 | JGI25162J39368_1002942 | JGI25162J39368_10029422 | 322 |
| 1313 | 3300002738 | JGI25154J39366_1000026 | JGI25154J39366_100002655 | 322 |
| 1314 | 3300002741 | JGI25157J39369_1000005 | JGI25157J39369_1000005136 | 322 |
| 1315 | 3300002987 | JGI25159J45721_1000242 | JGI25159J45721_100024212 | 322 |
| 1316 | 3300003214 | JGI25165J46597_1001246 | JGI25165J46597_10012462 | 322 |
| 1317 | 3300003214 | JGI25165J46597_1002528 | JGI25165J46597_10025282 | 322 |
| 1318 | 3300003322 | rootL2_10112950 | rootL2_101129504 | 322 |
| 1319 | 3300003354 | JGI25160J50197_1000022 | JGI25160J50197_100002240 | 322 |
| 1320 | 3300003374 | JGI25161J50226_1000024 | JGI25161J50226_100002492 | 322 |
| 1321 | 3300004625 | Ga0055543_1000025 | Ga0055543_100002540 | 322 |
| 1322 | 3300005262 | Ga0065165_1000200 | Ga0065165_100020040 | 322 |
| 1323 | 3300005578 | Ga0068854_100206798 | Ga0068854_1002067982 | 322 |
| 1324 | 3300005614 | Ga0068856_100008285 | Ga0068856_1000082855 | 322 |
| 1325 | 3300005616 | Ga0068852_100092772 | Ga0068852_1000927722 | 322 |
| 1326 | 3300006353 | Ga0075370_10010473 | Ga0075370_100104734 | 322 |
| 1327 | 3300009093 | Ga0105240_10000013 | Ga0105240_10000013360 | 322 |
| 1328 | 3300009545 | Ga0105237_10010647 | Ga0105237_100106472 | 322 |
| 1329 | 3300010375 | Ga0105239_10116563 | Ga0105239_101165632 | 322 |
| 1330 | 3300013104 | Ga0157370_10003431 | Ga0157370_1000343114 | 322 |
| 1331 | 3300014497 | Ga0182008_10022222 | Ga0182008_100222223 | 322 |
| 1332 | 3300015265 | Ga0182005_1001647 | Ga0182005_10016475 | 322 |
| 1333 | 3300025206 | Ga0209435_100009 | Ga0209435_100009133 | 322 |
| 1334 | 3300025208 | Ga0209436_109131 | Ga0209436_1091311 | 322 |
| 1335 | 3300025228 | Ga0209672_102531 | Ga0209672_1025312 | 322 |
| 1336 | 3300025233 | Ga0209437_100057 | Ga0209437_100057340 | 322 |
| 1337 | 3300025233 | Ga0209437_100772 | Ga0209437_1007722 | 322 |
| 1338 | 3300025246 | Ga0209646_1000018 | Ga0209646_1000018133 | 322 |
| 1339 | 3300025250 | Ga0209026_1000043 | Ga0209026_1000043133 | 322 |
| 1340 | 3300025253 | Ga0209677_100426 | Ga0209677_1004267 | 322 |
| 1341 | 3300025256 | Ga0209759_1000007 | Ga0209759_1000007133 | 322 |
| 1342 | 3300025261 | Ga0209233_1000130 | Ga0209233_1000130142 | 322 |
| 1343 | 3300025261 | Ga0209233_1000255 | Ga0209233_100025523 | 322 |
| 1344 | 3300025261 | Ga0209233_1000332 | Ga0209233_100033239 | 322 |
| 1345 | 3300025284 | Ga0209130_1000164 | Ga0209130_100016453 | 322 |
| 1346 | 3300025302 | Ga0207426_1000082 | Ga0207426_100008253 | 322 |
| 1347 | 3300025913 | Ga0207695_10000044 | Ga0207695_10000044317 | 322 |
| 1348 | 3300025914 | Ga0207671_10000043 | Ga0207671_10000043171 | 322 |
| 1349 | 3300025981 | Ga0207640_10053820 | Ga0207640_100538202 | 322 |
| 1350 | 3300026078 | Ga0207702_10006190 | Ga0207702_100061905 | 322 |
| 1351 | 3300026142 | Ga0207698_10157080 | Ga0207698_101570802 | 322 |
| 1352 | 3300027312 | Ga0209371_1001347 | Ga0209371_10013476 | 322 |
| 1353 | 3300030500 | Ga0268256_1001200 | Ga0268256_100120010 | 322 |
| 1354 | 3300059640 | Ga0587067_000714 | Ga0587067_000714_505_1473 | 322 |
| 1355 | 3300059647 | Ga0587079_006606 | Ga0587079_006606_431_1399 | 322 |
| 1356 | 3300059652 | Ga0587107_001655 | Ga0587107_001655_553_1521 | 322 |
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
PF00528
BPD_transp_1
Binding-protein-dependent transport system inner membrane component
106
339
0.8
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.9344 | 34 | 311 |
| 8hpl-assembly1.cif.gz_A | lpqy-sugabc in state 1 | 0.9262 | 34 | 310 |
| 7cad-assembly1.cif.gz_A | mycobacterium smegmatis sugabc complex | 0.9117 | 34 | 311 |
| 8ja7-assembly1.cif.gz_A | cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose | 0.9037 | 32 | 317 |
| 8hps-assembly1.cif.gz_A | lpqy-sugabc in state 5 | 0.9005 | 34 | 310 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9574 | 75 | 315 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9555 | 75 | 319 | 1.10.3720.10 |
| af_P71896_49_286_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9516 | 75 | 319 | 1.10.3720.10 |
| af_O53484_49_294_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9347 | 75 | 315 | 1.10.3720.10 |
| af_P0AFR7_53_289_1.10.3720.10 | Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like | 0.9287 | 75 | 315 | 1.10.3720.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A7V4SPS8-F1-model_v4 | Sugar ABC transporter permease | 0.984 | 189 | 310 |
GO:0005886
GO:0055085 |
| AF-A0A0U1QYT1-F1-model_v4 | Oligogalacturonide ABC tansporter, permease protein | 0.9815 | 34 | 321 |
GO:0005886
GO:0055085 |
| AF-A0A1E4DXD2-F1-model_v4 | deleted | 0.9791 | 28 | 322 |
|
| AF-A0A2S0UH26-F1-model_v4 | ABC transporter permease | 0.9768 | 37 | 321 |
GO:0005886
GO:0055085 |
| AF-A0A359EGJ3-F1-model_v4 | ABC transporter permease | 0.9686 | 58 | 321 |
GO:0005886
GO:0055085 |
Predicted Structure (AlphaFold2)
Powered by PDBe Molstar