F493285

General Info

Members Datasets Scaffolds Average Seq Length
1356 924 744 312

Family's Representative Sequence

Representative Sequence 3300013250|Ga0171462_1067|Ga0171462_10677
Length 343
Sequence MDEHFSHHQINFVNNENFGCYRYFSFLSFANIERGPGEEPMSNATAASTRAVQRDDLAAYGFLLPWLLGFLLLTLGPVAASFYLSLTDYSGLSAPNWVGIENYTRIATDDPRFITAMTVTFTFVLLSVPLKLLFALGVAVALNKGLTGLSFFRAVFYLPSLIGGSVAIAVLWRQVFAGDGLLNQALHTLFGYEGPSWIANPSTSLYTLVLLAVWQFGSSMIIFLAGLRQIPQDVYEAASIDGAQPVRQFFKITLPLLTPVIFFNAVIQTIDAFKAFTSAFVISDGTGGPIDSTLFYTLYLYQEAFTNFRFGYASALAWILVLIIAIFTALSFLSARYWVHYDD

Samples

Sample ID Description Type Environment
1 2508501050 Microvirga lupini Lut6 Isolate Nodule
2 2508501114 Microvirga lotononidis WSM3557 Isolate Nodule
3 2508501122 Ensifer yinggardensis WSM1721 Isolate Nodule
4 2509276019 Ensifer aridi TW10 Isolate Nodule
5 2509276021 Rhizobium leguminosarum bv. trifolii WSM597 Isolate Nodule
6 2509276033 Rhizobium leguminosarum bv. trifolii WSM2012 Isolate Nodule
7 2510065019 Rhizobium leguminosarum bv. trifolii WSM1689 Isolate Nodule
8 2510065057 Sinorhizobium meliloti WSM1022 Isolate Nodule
9 2510461076 Rhizobium leguminosarum bv. trifolii TA1 Isolate Nodule
10 2510917022 Rhizobium sp. AP16 Isolate Rhizosphere
11 2510917028 Rhizobium sp. CF122 Isolate Rhizosphere
12 2510917030 Rhizobium sp. CF142 Isolate Rhizosphere
13 2511231027 Phyllobacterium sp. YR531 Isolate Rhizosphere
14 2511231052 Sinorhizobium meliloti AK58 Isolate Nodule
15 2512047086 Sinorhizobium arboris LMG 14919 Isolate Nodule
16 2512564039 Paenibacillus mucilaginosus 3016 Isolate Rhizosphere
17 2512875026 Sinorhizobium medicae WSM1115 Isolate Nodule
18 2513237084 Rhizobium leguminosarum bv. viciae UPM1131 Isolate Nodule
19 2513237085 Rhizobium leguminosarum bv. viciae UPM1137 Isolate Nodule
20 2513237086 Sinorhizobium meliloti MVII-I Isolate Nodule
21 2513237088 Rhizobium mesoamericanum STM6155 Isolate Nodule
22 2513237089 Sinorhizobium medicae DI28 Isolate Nodule
23 2513237091 Sinorhizobium meliloti RRI128 Isolate Nodule
24 2513237093 Rhizobium leguminosarum bv. phaseoli FA23 Isolate Nodule
25 2513237094 Bradyrhizobium sp. WSM3983 Isolate Nodule
26 2513237103 Rhizobium leguminosarum bv. viciae VF39 Isolate Nodule
27 2513237138 Rhizobium favelukesii OR191 Isolate Nodule
28 2513237140 Sinorhizobium meliloti GVPV12 Isolate Nodule
29 2513237143 Sinorhizobium meliloti Mlalz-1 Isolate Nodule
30 2513237144 Rhizobium sullae WSM1592 Isolate Nodule
31 2513237146 Rhizobium mongolense USDA 1844 (Illumina) Isolate Nodule
32 2513237156 Sinorhizobium medicae WSM1369 Isolate Nodule
33 2513237160 Sinorhizobium medicae WSM244 Isolate Nodule
34 2513237162 Rhizobium ruizarguesonis GB30 Isolate Nodule
35 2513237351 Mesorhizobium alhagi CCNWXJ12-2 Isolate Nodule
36 2515075009 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
37 2515154107 Sinorhizobium meliloti 4H41 Isolate Nodule
38 2515154113 Rhizobium ruizarguesonis Vc2 Isolate Nodule
39 2515154114 Rhizobium ruizarguesonis Vh3 Isolate Nodule
40 2515154116 Rhizobium ruizarguesonis Ps8 Isolate Nodule
41 2515154134 Rhizobium gallicum bv. gallicum R602sp Isolate Nodule
42 2515154155 Actinopolymorpha alba DSM 45243 Isolate Rhizosphere
43 2516143018 Ensifer sp. BR816 Isolate Nodule
44 2516653046 Sinorhizobium meliloti BO21CC Isolate Nodule
45 2516653077 Rhizobium acaciae WSM1481 Isolate Nodule
46 2516653085 Rhizobium leguminosarum bv. phaseoli 4292 Isolate Nodule
47 2517093000 Rhizobium leguminosarum bv. trifolii SRDI943 Isolate Nodule
48 2517287029 Rhizobium leguminosarum bv. trifolii SRDI565 Isolate Nodule
49 2517487022 Sinorhizobium medicae WSM4191 Isolate Nodule
50 2519899620 Rhizobium sp. Pop5 Isolate Nodule
51 2524023207 Ensifer sp. USDA 6670 Isolate Nodule
52 2524023209 Rhizobium leucaenae USDA 9039 Isolate Nodule
53 2529292951 Rhizobium sp. CCGE 510 Isolate Nodule
54 2534681796 Rhizobium grahamii CCGE 502 Isolate Nodule
55 2537561587 Agrobacterium tumefaciens Cherry 2E-2-2 Isolate Rhizosphere
56 2548877040 Paenibacillus sonchi X19-5 Isolate Rhizosphere
57 2551306084 Sinorhizobium meliloti 5A14 Isolate Nodule
58 2551306085 Sinorhizobium meliloti AE608H Isolate Nodule
59 2551306086 Sinorhizobium meliloti AK11 Isolate Nodule
60 2551306087 Sinorhizobium meliloti A0643DD Isolate Nodule
61 2551306089 Sinorhizobium meliloti 1A42 Isolate Nodule
62 2551306090 Sinorhizobium meliloti A0641M Isolate Nodule
63 2551306091 Sinorhizobium meliloti C0431A Isolate Nodule
64 2551306092 Sinorhizobium meliloti AK75 Isolate Nodule
65 2551306093 Sinorhizobium meliloti C0438LL Isolate Nodule
66 2554235003 Agrobacterium tumefaciens WRT31 Isolate Rhizosphere
67 2558860100 Sinorhizobium sp. PC2 Isolate Nodule
68 2558860242 Agrobacterium fabacearum P4 Isolate Rhizosphere
69 2558860983 Allorhizobium undicola ATCC 700741 Isolate Rhizoplane
70 2571042143 Paenibacillus graminis RSA19 Isolate Unclassified
71 2582581283 Rhizobium sp. OK665 Isolate Rhizosphere
72 2582581294 Rhizobium sp. CF394 Isolate Rhizosphere
73 2582581298 Rhizobium alamii YR540 Isolate Rhizosphere
74 2582581299 Rhizobium leguminosarum OV483 Isolate Rhizosphere
75 2582581307 Rhizobium sp. YR060 Isolate Rhizosphere
76 2582581308 Rhizobium sp. OK494 Isolate Rhizosphere
77 2582581315 Agrobacterium rhizogenes YR147 Isolate Rhizosphere
78 2582581316 Agrobacterium rhizogenes OK036 Isolate Rhizosphere
79 2582581867 Rhizobium sp. OV201 Isolate Rhizosphere
80 2585427526 Rhizobium leguminosarum OV152 Isolate Rhizosphere
81 2585427527 Rhizobium lusitanum YR374 Isolate Rhizosphere
82 2585427528 Rhizobium leguminosarum CF307 Isolate Rhizosphere
83 2585427529 Rhizobium alamii YR584 Isolate Rhizosphere
84 2585427530 Rhizobium tropici YR635 Isolate Rhizosphere
85 2585427531 Agrobacterium rhizogenes YR530 Isolate Rhizosphere
86 2585427590 Rhizobium sp. CF048 Isolate Rhizosphere
87 2585427593 Rhizobium tropici CF286 Isolate Rhizosphere
88 2585427608 Agrobacterium rhizogenes OV677 Isolate Rhizosphere
89 2585427609 Agrobacterium rhizogenes CF263 Isolate Rhizosphere
90 2585428059 Paenibacillus chondroitinus OK414 Isolate Rhizosphere
91 2585428125 Agrobacterium rhizogenes CF262 Isolate Rhizosphere
92 2585428157 Microbacterium sp. CF335 Isolate Rhizosphere
93 2593339198 Paenibacillus sp. UNCCL117 Isolate Unclassified
94 2599185170 Rhizobium mongolense USDA 1844 (PacBio) Isolate Nodule
95 2599185210 Rhizobium sp. NFACC06-2 Isolate Rhizoplane
96 2600255279 Rhizobium sp. NFIX01 Isolate Rhizoplane
97 2600255308 Rhizobium sp. NFIX02 Isolate Rhizoplane
98 2615840624 Rhizobium aethiopicum HBR26 Isolate Nodule
99 2615840626 Rhizobium lusitanum P1-7 Isolate Nodule
100 2615840698 Rhizobium multihospitium HAMBI 2975 Isolate Nodule
101 2617270742 Rhizobium miluonense HAMBI 2971 Isolate Nodule
102 2643221543 Paenibacillus sp. Root52 Isolate Unclassified
103 2643221557 Ensifer sp. Root558 Isolate Unclassified
104 2643221580 Devosia sp. Root635 Isolate Unclassified
105 2643221582 Rhizobium sp. Root651 Isolate Unclassified
106 2643221591 Devosia sp. Root685 Isolate Unclassified
107 2643221599 Rhizobium sp. Root708 Isolate Unclassified
108 2643221618 Ensifer sp. Root231 Isolate Unclassified
109 2643221626 Ensifer sp. Root31 Isolate Unclassified
110 2643221629 Devosia sp. Root105 Isolate Unclassified
111 2643221634 Rhizobium sp. Root1203 Isolate Unclassified
112 2643221655 Ensifer sp. Root1252 Isolate Unclassified
113 2643221659 Ensifer sp. Root127 Isolate Unclassified
114 2643221662 Devosia sp. Root413D1 Isolate Unclassified
115 2643221668 Ensifer sp. Root423 Isolate Unclassified
116 2643221674 Devosia sp. Root436 Isolate Unclassified
117 2643221676 Paenibacillus sp. Root444D2 Isolate Unclassified
118 2643221693 Rhizobium sp. Root491 Isolate Unclassified
119 2643221698 Ensifer sp. Root142 Isolate Unclassified
120 2643221712 Ensifer sp. Root258 Isolate Unclassified
121 2643221736 Bosea sp. Root483D1 Isolate Unclassified
122 2657244999 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
123 2667528174 Rhizobium sp. NFR17 Isolate Rhizoplane
124 2690316117 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
125 2718217882 Rhizobium sp. N741 Isolate Nodule
126 2718217927 Rhizobium sp. N324 Isolate Nodule
127 2718217997 Rhizobium phaseoli sv. phaseoli R723 Isolate Nodule
128 2718218009 Rhizobium sp. N561 Isolate Nodule
129 2718218199 Rhizobium phaseoli sv. phaseoli N261 Isolate Nodule
130 2718218232 Rhizobium phaseoli sv. phaseoli N161 Isolate Nodule
131 2718218233 Rhizobium phaseoli sv. phaseoli R744 Isolate Nodule
132 2718218235 Rhizobium phaseoli sv. phaseoli R620 Isolate Nodule
133 2718218269 Rhizobium phaseoli sv. phaseoli N671 Isolate Nodule
134 2718218363 Rhizobium sp. N113 Isolate Nodule
135 2718218365 Rhizobium sp. N731 Isolate Nodule
136 2718218366 Rhizobium sp. N621 Isolate Nodule
137 2718218423 Rhizobium sp. N941 Isolate Nodule
138 2721755514 Rhizobium sp. N6212 Isolate Nodule
139 2721755556 Rhizobium phaseoli sv. phaseoli N931 Isolate Nodule
140 2721755684 Rhizobium phaseoli sv. phaseoli N841 Isolate Nodule
141 2721755685 Rhizobium phaseoli sv. phaseoli R611 Isolate Nodule
142 2721755809 Rhizobium sp. N541 Isolate Nodule
143 2721755810 Rhizobium sp. N871 Isolate Nodule
144 2721755819 Rhizobium phaseoli sv. phaseoli N771 Isolate Nodule
145 2721755822 Rhizobium phaseoli sv. phaseoli R650 Isolate Nodule
146 2721755823 Rhizobium phaseoli sv. phaseoli R630 Isolate Nodule
147 2724679232 Rhizobium leguminosarum Vaf12 Isolate Unclassified
148 2728368933 Paenibacillus jilunlii DSM 23019 Isolate Rhizosphere
149 2728369352 Rhizobium phaseoli sv. phaseoli N831 Isolate Nodule
150 2728369365 Rhizobium sp. N1341 Isolate Nodule
151 2728369397 Rhizobium sp. N1314 Isolate Nodule
152 2738541333 Rhizobium sophoriradicis CCBAU 03470 Isolate Unclassified
153 2751185821 Ensifer shofinae CCBAU 251167 Isolate Unclassified
154 2757320392 Phyllobacterium leguminum ORS 1419 Isolate Nodule
155 2765235942 Rhizobium sp. WYCCWR10014 Isolate Nodule
156 2775506901 Microvirga ossetica V5/3m Isolate Unclassified
157 2775507266 Rhizobium tropici PRF 81 Isolate Nodule
158 2791355091 Sinorhizobium sp. FG01 Isolate Nodule
159 2791355092 Sinorhizobium sp. NG07B Isolate Nodule
160 2791355094 Sinorhizobium sp. BJ1 Isolate Nodule
161 2791355222 Paenibacillus oryzae 1DrF-4 Isolate Unclassified
162 2791355256 Rhizobium sp. M10 Isolate Nodule
163 2791355259 Rhizobium hidalgonense FH14 Isolate Nodule
164 2791355260 Rhizobium sp. L9 Isolate Nodule
165 2791355261 Rhizobium sp. J15 Isolate Nodule
166 2791355262 Rhizobium sp. M1 Isolate Nodule
167 2791355263 Rhizobium chutanense C5 Isolate Nodule
168 2791355264 Rhizobium sp. S9 Isolate Nodule
169 2791355265 Rhizobium sp. H4 Isolate Nodule
170 2791355266 Rhizobium sp. L43 Isolate Nodule
171 2791355267 Rhizobium sp. L18 Isolate Nodule
172 2802428858 Sinorhizobium medicae M14-1 Isolate Nodule
173 2802428859 Sinorhizobium medicae SF3.41 Isolate Nodule
174 2802428860 Sinorhizobium medicae M19-1 Isolate Nodule
175 2802428861 Sinorhizobium medicae USDA1037 Isolate Nodule
176 2802428862 Sinorhizobium medicae M7-4 Isolate Nodule
177 2802428863 Sinorhizobium medicae M26-2 Isolate Nodule
178 2802429268 Sinorhizobium sojae CCBAU 05684 Isolate Unclassified
179 2802429605 Rhizobium sophoriradicis L101 Isolate Nodule
180 2802429606 Rhizobium sophoriradicis JJW1 Isolate Nodule
181 2802429633 Rhizobium anhuiense J3 Isolate Nodule
182 2802429634 Rhizobium anhuiense S10 Isolate Nodule
183 2802429635 Rhizobium anhuiense Y27 Isolate Nodule
184 2802429636 Rhizobium anhuiense JX3 Isolate Nodule
185 2802429637 Rhizobium anhuiense C15 Isolate Nodule
186 2808606368 Microbacterium sp. SLBN-1 Isolate Unclassified
187 2808606387 Rhizobium sp. SJZ105 Isolate Rhizosphere
188 2816332139 Pseudonocardia kunmingensis DSM 45301 Isolate Unclassified
189 2818991439 Agrobacterium tumefaciens 1187 Isolate Unclassified
190 2818991448 Rhizobium miluonense 1234 Isolate Unclassified
191 2818991453 Rhizobium lusitanum 1158 Isolate Unclassified
192 2818991459 Paenibacillus sp. 597 Isolate Unclassified
193 2821443989 Inquilinus ginsengisoli 584 Isolate Unclassified
194 2835312727 Microvirga calopogonii CCBAU 65841 Isolate Nodule
195 2838016132 Rhizobium phaseoli SEMIA 4071 Isolate Nodule
196 2838022645 Rhizobium aethiopicum SEMIA 4074 Isolate Nodule
197 2838029111 Rhizobium tropici SEMIA 4079 Isolate Nodule
198 2838035591 Rhizobium mongolense SEMIA 4087 Isolate Nodule
199 2838042994 Rhizobium esperanzae SEMIA 4089 Isolate Nodule
200 2838048938 Rhizobium pisi 27/80 Isolate Nodule
201 2838061910 Rhizobium phaseoli L15 Isolate Nodule
202 2838068647 Rhizobium esperanzae VC28 Isolate Nodule
203 2838074704 Sinorhizobium terangae SEMIA 6460 Isolate Unclassified
204 2838661181 Rhizobium mongolense SEMIA 402 Isolate Nodule
205 2838668709 Rhizobium sophoriradicis SEMIA 403 Isolate Nodule
206 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
207 2838680041 Rhizobium leguminosarum SEMIA 415 Isolate Nodule
208 2838686498 Rhizobium leguminosarum SEMIA 416 Isolate Nodule
209 2838694306 Rhizobium leguminosarum SEMIA 421 Isolate Nodule
210 2838701080 Rhizobium aethiopicum SEMIA 428 Isolate Nodule
211 2838707686 Rhizobium leguminosarum SEMIA 430 Isolate Nodule
212 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
213 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
214 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
215 2840764183 Phyllobacterium sophorae CCBAU 03422 Isolate Unclassified
216 2841760612 Bosea sp. Tri-49 Isolate Nodule
217 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
218 2841851746 Rhizobium leguminosarum SEMIA 498 Isolate Nodule
219 2841859092 Agrobacterium radiobacter SEMIA 4026 Isolate Nodule
220 2841864319 Rhizobium leguminosarum SEMIA 4052 Isolate Nodule
221 2841911363 Bosea caraganae RCAM04685 Isolate Nodule
222 2841917233 Bosea caraganae RCAM04680 Isolate Nodule
223 2842077413 Rhizobium leguminosarum SEMIA 422 Isolate Nodule
224 2842110456 Rhizobium esperanzae SEMIA 414 Isolate Nodule
225 2842118031 Rhizobium esperanzae SEMIA 420 Isolate Nodule
226 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
227 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
228 2842146304 Rhizobium sophoriradicis SEMIA 454 Isolate Nodule
229 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
230 2842156927 Rhizobium leguminosarum SEMIA 459 Isolate Nodule
231 2842163707 Rhizobium leguminosarum SEMIA 460 Isolate Nodule
232 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
233 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
234 2842180545 Rhizobium leguminosarum SEMIA 463 Isolate Nodule
235 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
236 2842192696 Rhizobium esperanzae SEMIA 468 Isolate Nodule
237 2842198810 Rhizobium aethiopicum SEMIA 470 Isolate Nodule
238 2842205361 Rhizobium etli SEMIA 471 Isolate Nodule
239 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
240 2842217011 Rhizobium leguminosarum SEMIA 475 Isolate Nodule
241 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
242 2842229732 Rhizobium leguminosarum SEMIA 481 Isolate Nodule
243 2842237096 Rhizobium leguminosarum SEMIA 482 Isolate Nodule
244 2842243621 Rhizobium leguminosarum SEMIA 483 Isolate Nodule
245 2842250916 Rhizobium etli SEMIA 484 Isolate Nodule
246 2842257432 Rhizobium leguminosarum SEMIA 485 Isolate Nodule
247 2842264693 Rhizobium phaseoli SEMIA 487 Isolate Nodule
248 2842271015 Rhizobium leguminosarum SEMIA 488 Isolate Nodule
249 2842278818 Rhizobium etli SEMIA 489 Isolate Nodule
250 2842285085 Rhizobium lentis SEMIA 490 Isolate Nodule
251 2842291075 Rhizobium leguminosarum SEMIA 491 Isolate Nodule
252 2842298080 Rhizobium leucaenae SEMIA 492 Isolate Nodule
253 2842304105 Rhizobium leguminosarum SEMIA 499 Isolate Nodule
254 2842311132 Rhizobium phaseoli SEMIA 4002 Isolate Nodule
255 2842317721 Rhizobium etli SEMIA 4004 Isolate Nodule
256 2842341865 Rhizobium leguminosarum SEMIA 4011 Isolate Nodule
257 2842357229 Rhizobium leucaenae SEMIA 4015 Isolate Nodule
258 2842363717 Rhizobium leguminosarum SEMIA 4016 Isolate Nodule
259 2842370503 Rhizobium leguminosarum SEMIA 4022 Isolate Nodule
260 2842377471 Rhizobium leguminosarum SEMIA 4024 Isolate Nodule
261 2842384541 Rhizobium leguminosarum SEMIA 4025 Isolate Nodule
262 2842395702 Rhizobium ecuadorense SEMIA 4029 Isolate Nodule
263 2842402390 Rhizobium lentis SEMIA 4033 Isolate Nodule
264 2842409023 Rhizobium lentis SEMIA 4034 Isolate Nodule
265 2842415677 Rhizobium lentis SEMIA 4036 Isolate Nodule
266 2842422224 Rhizobium esperanzae SEMIA 4042 Isolate Nodule
267 2842428310 Rhizobium phaseoli SEMIA 4050 Isolate Nodule
268 2842434925 Rhizobium esperanzae SEMIA 4051 Isolate Nodule
269 2842441272 Rhizobium esperanzae SEMIA 4053 Isolate Nodule
270 2842447887 Rhizobium esperanzae SEMIA 4055 Isolate Nodule
271 2842462802 Rhizobium phaseoli SEMIA 4057 Isolate Nodule
272 2842469257 Rhizobium phaseoli SEMIA 4058 Isolate Nodule
273 2842475841 Rhizobium tropici SEMIA 4059 Isolate Nodule
274 2842482326 Rhizobium lusitanum SEMIA 4060 Isolate Nodule
275 2842489311 Rhizobium sophoriradicis SEMIA 4061 Isolate Nodule
276 2842495871 Rhizobium etli SEMIA 4062 Isolate Nodule
277 2842502639 Rhizobium tropici SEMIA 4063 Isolate Nodule
278 2842509118 Rhizobium paranaense SEMIA 4064 Isolate Nodule
279 2842515876 Agrobacterium radiobacter SEMIA 4072 Isolate Nodule
280 2842871566 Phyllobacterium sp. R-73111 Isolate Unclassified
281 2844104063 Bosea sp. Tri-39 Isolate Nodule
282 2844163670 Ensifer sp. 1H6 Isolate Unclassified
283 2844315083 Bradyrhizobium guangzhouense CCBAU 51670 Isolate Unclassified
284 2844454524 Rhizobium leguminosarum bv. viciae BIHB 1217 Isolate Nodule
285 2844533157 Inquilinus sp. R-72501 v. 2 Isolate Unclassified
286 2847417321 Sinorhizobium fredii CCBAU 45436 Isolate Unclassified
287 2848992105 Sinorhizobium fredii CCBAU 25509 Isolate Unclassified
288 2850079185 Ensifer aridi JNVU TP6 Isolate Unclassified
289 2851182111 Bosea sp. Tri-44 Isolate Nodule
290 2851246043 Bosea sp. Tri-54 Isolate Nodule
291 2852387548 Rhizobium jaguaris CCGE525 Isolate Unclassified
292 2855825444 Sinorhizobium meliloti CXM1-105 Isolate Nodule
293 2855839649 Sinorhizobium meliloti AK555 Isolate Unclassified
294 2855872281 Sinorhizobium fredii PCH1 Isolate Nodule
295 2857453340 Paenibacillus sp. R-74130 Isolate Unclassified
296 2857516855 Rhizobium sp. R-72456 Isolate Unclassified
297 2857733635 Salinibacterium sp. R-73062 Isolate Unclassified
298 2858800743 Sinorhizobium meliloti AK170 Isolate Unclassified
299 2862705112 Streptomyces triticirhizae NEAU-YY642 Isolate Rhizosphere
300 2864733723 Paenibacillus sp. JGP012 Isolate Rhizosphere
301 2864997549 Paenibacillus sp. R-72005 Isolate Unclassified
302 2867346516 Streptomyces radicis AZ1-7 Isolate Unclassified
303 2874123672 Mesorhizobium sp. M00.F.Ca.ET.216.01.1.1 Isolate Nodule
304 2888578766 Paenibacillus lycopersici 12200R-189 Isolate Rhizosphere
305 2889049205 Paenibacillus rhizovicinus 14171R-81 Isolate Rhizosphere
306 2889790730 Chelativorans xinjiangense lm93 Isolate Rhizosphere
307 2889914905 Chelativorans alearense UJN715 Isolate Rhizosphere
308 2891048133 Martelella lutilitoris GH2-6 Isolate Rhizosphere
309 2894232714 Microvirga tunisiensis Lmie10 Isolate Nodule
310 2894817345 Aureimonas psammosilenae YIM DR1026 Isolate Unclassified
311 2896384573 Ensifer sp. MPMI2T Isolate Unclassified
312 2899792073 Agrobacterium deltaense CNPSo 3391 Isolate Nodule
313 2899803654 Agrobacterium sp. a22-2 Isolate Unclassified
314 2899845264 Agrobacterium fabacearum CNPSo 675 Isolate Unclassified
315 2903727486 Bradyrhizobium guangzhouense CCBAU 53424 Isolate Unclassified
316 2904113452 Paenibacillus paridis py1325 Isolate Unclassified
317 2904755435 Paenibacillus aceris KACC 19194 Isolate Rhizosphere
318 2906602504 Bradyrhizobium guangzhouense CCBAU 53426 Isolate Unclassified
319 2909042592 Labrys sp. LIt4 Isolate Nodule
320 2913295892 Sinorhizobium kostiensis DSM 13372 Isolate Nodule
321 2915980308 Sinorhizobium medicae USDA1149 Isolate Nodule
322 2915986958 Sinorhizobium meliloti USDA1659 Isolate Nodule
323 2915993759 Sinorhizobium meliloti USDA1336 Isolate Nodule
324 2916000859 Sinorhizobium meliloti USDA1562 Isolate Nodule
325 2916007675 Sinorhizobium meliloti USDA1289 Isolate Nodule
326 2916014648 Sinorhizobium meliloti USDA1583 Isolate Nodule
327 2916021584 Sinorhizobium meliloti USDA1550 Isolate Nodule
328 2916028427 Sinorhizobium meliloti USDA1613 Isolate Nodule
329 2916035215 Sinorhizobium meliloti 3011 Isolate Nodule
330 2916041962 Sinorhizobium meliloti USDA1795 Isolate Nodule
331 2916048683 Sinorhizobium meliloti USDA1796 Isolate Nodule
332 2916055098 Sinorhizobium meliloti USDA1770 Isolate Nodule
333 2916061851 Sinorhizobium medicae USDA1638 Isolate Nodule
334 2916068649 Sinorhizobium meliloti USDA1220 Isolate Nodule
335 2916076590 Sinorhizobium meliloti USDA1661 Isolate Nodule
336 2917554339 Chthonobacter rhizosphaerae yh7-1 Isolate Rhizosphere
337 2919100787 Rhizobium sp. 1399 Isolate Rhizosphere
338 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
339 2919408235 Rhizobium miluonense 3199 Isolate Unclassified
340 2919425241 Bacillus sp. 3255 Isolate Rhizosphere
341 2920760137 Ensifer psoraleae CCBAU 65732 Isolate Unclassified
342 2920822456 Ensifer sesbaniae CCBAU 65729 Isolate Unclassified
343 2921201388 Sinorhizobium meliloti USDA1692 Isolate Nodule
344 2921208531 Sinorhizobium meliloti USDA1660 Isolate Nodule
345 2921237296 Sinorhizobium meliloti USDA1508 Isolate Nodule
346 2921244191 Sinorhizobium meliloti 2119 Isolate Nodule
347 2921250672 Sinorhizobium medicae USDA1169 Isolate Nodule
348 2921257292 Sinorhizobium meliloti USDA1320 Isolate Nodule
349 2921263974 Sinorhizobium meliloti USDA1107 Isolate Nodule
350 2921282425 Sinorhizobium meliloti USDA1203 Isolate Nodule
351 2921289301 Sinorhizobium meliloti USDA1730 Isolate Nodule
352 2921296804 Sinorhizobium meliloti USDA1200 Isolate Nodule
353 2923556063 Rhizobium tibeticum 3740 Isolate Unclassified
354 2924144063 Sinorhizobium meliloti USDA1022 Isolate Nodule
355 2924150972 Sinorhizobium meliloti USDA1700 Isolate Nodule
356 2924158325 Sinorhizobium meliloti USDA1146 Isolate Nodule
357 2924165586 Sinorhizobium meliloti USDA1264 Isolate Nodule
358 2924172951 Sinorhizobium meliloti USDA1626 Isolate Nodule
359 2924179722 Sinorhizobium meliloti USDA1280 Isolate Nodule
360 2924186466 Sinorhizobium meliloti USDA1389 Isolate Nodule
361 2924193448 Sinorhizobium meliloti USDA1158 Isolate Nodule
362 2924200457 Sinorhizobium meliloti USDA1007 Isolate Nodule
363 2924207177 Sinorhizobium meliloti USDA1589 Isolate Nodule
364 2924221636 Sinorhizobium meliloti USDA1416 Isolate Nodule
365 2924228884 Sinorhizobium meliloti USDA1581 Isolate Nodule
366 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
367 2926760298 Agrobacterium tumefaciens SLBN-170 Isolate Rhizosphere
368 2929138655 Agrobacterium sp. R-72433 Hybrid assembly Isolate Unclassified
369 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
370 2933011516 Rhizobium sp. SEMIA 4032 Isolate Unclassified
371 2933016740 Rhizobium sp. SEMIA 4085 Isolate Nodule
372 2933570622 Rhizobium leguminosarum SEMIA 409 Isolate Nodule
373 2933586486 Rhizobium leguminosarum SEMIA 4039 Isolate Nodule
374 2933594066 Agrobacterium fabrum 35/80 Isolate Nodule
375 2933599457 Rhizobium phaseoli M3 Isolate Nodule
376 2935894831 Rhizobium leguminosarum SEMIA 419 Isolate Nodule
377 2935901341 Rhizobium leguminosarum SEMIA 4082 Isolate Nodule
378 2936367885 Rhizobium changzhiense WYCCWR 11290 Isolate Nodule
379 2936375103 Rhizobium changzhiense WYCCWR 11317 Isolate Nodule
380 2936381700 Rhizobium chutanense C16 Isolate Unclassified
381 2936996657 Sinorhizobium meliloti USDA1025 Isolate Nodule
382 2937002841 Sinorhizobium meliloti USDA1006 Isolate Nodule
383 2937009748 Sinorhizobium meliloti USDA1162 Isolate Nodule
384 2937016420 Sinorhizobium meliloti USDA1027 Isolate Nodule
385 2937023124 Sinorhizobium meliloti USDA1335 Isolate Nodule
386 2937029754 Sinorhizobium medicae USDA1624 Isolate Nodule
387 2937036028 Sinorhizobium medicae USDA1608 Isolate Nodule
388 2937049772 Sinorhizobium meliloti USDA1691 Isolate Nodule
389 2937056579 Sinorhizobium meliloti USDA1357 Isolate Nodule
390 2937063883 Sinorhizobium meliloti USDA1808 Isolate Nodule
391 2937071275 Sinorhizobium meliloti USDA1623 Isolate Nodule
392 2937078374 Sinorhizobium medicae USDA1004 Isolate Nodule
393 2937084907 Sinorhizobium medicae USDA1664 Isolate Nodule
394 2937091812 Sinorhizobium meliloti USDA1221 Isolate Nodule
395 2937098957 Sinorhizobium meliloti USDA1519 Isolate Nodule
396 2937106411 Sinorhizobium meliloti USDA1214 Isolate Nodule
397 2937113482 Sinorhizobium meliloti USDA1180 Isolate Nodule
398 2937119839 Sinorhizobium meliloti USDA1790 Isolate Nodule
399 2937126314 Sinorhizobium meliloti USDA1612 Isolate Nodule
400 2937822353 Mesorhizobium neociceri CCANP35 Isolate Nodule
401 2938649242 Paenibacillus helianthi P26E Isolate Rhizosphere
402 2957375807 Sinorhizobium medicae USDA1632 Isolate Nodule
403 2957382221 Sinorhizobium meliloti USDA1919 Isolate Nodule
404 2957388812 Sinorhizobium meliloti USDA1195 Isolate Nodule
405 2957395598 Sinorhizobium meliloti USDA1237 Isolate Nodule
406 2957402308 Sinorhizobium meliloti USDA1794 Isolate Nodule
407 2957408893 Sinorhizobium meliloti USDA1163 Isolate Nodule
408 2957415311 Sinorhizobium meliloti USDA1724 Isolate Nodule
409 2957422303 Sinorhizobium meliloti USDA1497 Isolate Nodule
410 2957430029 Sinorhizobium meliloti USDA1590 Isolate Nodule
411 2957437181 Sinorhizobium medicae USDA1694 Isolate Nodule
412 2957443900 Sinorhizobium meliloti USDA1734 Isolate Nodule
413 2957450854 Sinorhizobium meliloti USDA1655 Isolate Nodule
414 2957457609 Sinorhizobium meliloti USDA1751 Isolate Nodule
415 2957464669 Sinorhizobium meliloti USDA1520 Isolate Nodule
416 2957471148 Sinorhizobium meliloti USDA1204 Isolate Nodule
417 2957478035 Sinorhizobium meliloti USDA1171 Isolate Nodule
418 2957484790 Sinorhizobium meliloti USDA1464 Isolate Nodule
419 2957491536 Sinorhizobium meliloti USDA1804 Isolate Nodule
420 2957498199 Sinorhizobium meliloti USDA1561 Isolate Nodule
421 2957505466 Sinorhizobium meliloti USDA1696 Isolate Nodule
422 2960584000 Sinorhizobium meliloti USDA1530 Isolate Nodule
423 2960591022 Sinorhizobium medicae USDA1066 Isolate Nodule
424 2960597568 Sinorhizobium meliloti 3085 Isolate Nodule
425 2960603979 Sinorhizobium meliloti USDA1580 Isolate Nodule
426 2960610863 Sinorhizobium meliloti USDA1792 Isolate Nodule
427 2960617483 Sinorhizobium meliloti USDA1719 Isolate Nodule
428 2960624210 Sinorhizobium meliloti USDA1415 Isolate Nodule
429 2960631154 Sinorhizobium medicae USDA1629 Isolate Nodule
430 2960637947 Sinorhizobium meliloti USDA1202 Isolate Nodule
431 2960645483 Sinorhizobium meliloti USDA1703 Isolate Nodule
432 2960660292 Sinorhizobium meliloti USDA1883 Isolate Nodule
433 2960667422 Sinorhizobium meliloti USDA1170 Isolate Nodule
434 2960680706 Sinorhizobium medicae USDA1150 Isolate Nodule
435 2960687367 Sinorhizobium meliloti USDA1462 Isolate Nodule
436 2960693952 Sinorhizobium medicae USDA1630 Isolate Nodule
437 2964607997 Sinorhizobium meliloti USDA1212 Isolate Nodule
438 2964615318 Sinorhizobium meliloti USDA1248 Isolate Nodule
439 2964621998 Sinorhizobium meliloti USDA1235 Isolate Nodule
440 2964628898 Sinorhizobium meliloti USDA1191 Isolate Nodule
441 2964636051 Sinorhizobium meliloti USDA1594 Isolate Nodule
442 2964643177 Sinorhizobium meliloti USDA1760 Isolate Nodule
443 2964649959 Sinorhizobium meliloti USDA1591 Isolate Nodule
444 2964656573 Sinorhizobium meliloti USDA1308 Isolate Nodule
445 2964663802 Sinorhizobium meliloti USDA1688 Isolate Nodule
446 2964678106 Sinorhizobium meliloti USDA1210 Isolate Nodule
447 2964685014 Sinorhizobium meliloti USDA1232 Isolate Nodule
448 2964691889 Sinorhizobium meliloti USDA1379 Isolate Nodule
449 2964698721 Sinorhizobium meliloti USDA1656 Isolate Nodule
450 2964705432 Sinorhizobium meliloti USDA1614 Isolate Nodule
451 2964712639 Sinorhizobium meliloti USDA1616 Isolate Nodule
452 2964719344 Sinorhizobium meliloti USDA1456 Isolate Nodule
453 2967664464 Sinorhizobium meliloti USDA1208 Isolate Nodule
454 2967671571 Sinorhizobium meliloti USDA1496 Isolate Nodule
455 2967678726 Sinorhizobium meliloti USDA1467 Isolate Nodule
456 2967686174 Sinorhizobium medicae USDA1641 Isolate Nodule
457 2967693043 Sinorhizobium meliloti USDA1183 Isolate Nodule
458 2967699805 Sinorhizobium meliloti USDA1695 Isolate Nodule
459 2967706974 Sinorhizobium meliloti USDA1206 Isolate Nodule
460 2967714385 Sinorhizobium meliloti USDA1023 Isolate Nodule
461 2967721400 Sinorhizobium meliloti USDA1742 Isolate Nodule
462 2967728569 Sinorhizobium medicae USDA1607 Isolate Nodule
463 2967735183 Sinorhizobium meliloti USDA1710 Isolate Nodule
464 2967742019 Sinorhizobium meliloti USDA1676 Isolate Nodule
465 2967748971 Sinorhizobium meliloti USDA1024A Isolate Nodule
466 2967755722 Sinorhizobium meliloti USDA1302 Isolate Nodule
467 2967762386 Sinorhizobium meliloti USDA1397 Isolate Nodule
468 2967769361 Sinorhizobium meliloti USDA1005 Isolate Nodule
469 2967775926 Sinorhizobium meliloti USDA1678 Isolate Nodule
470 2968558590 Paenibacillus sp. P3E Isolate Rhizosphere
471 2970019648 Sinorhizobium meliloti USDA1603 Isolate Nodule
472 2970026789 Sinorhizobium medicae USDA1611 Isolate Nodule
473 2970033650 Sinorhizobium meliloti USDA1565 Isolate Nodule
474 2970040964 Sinorhizobium meliloti USDA1501 Isolate Nodule
475 2970047711 Sinorhizobium meliloti USDA1793 Isolate Nodule
476 2970054988 Sinorhizobium meliloti USDA1031 Isolate Nodule
477 2970061556 Sinorhizobium meliloti USDA1810 Isolate Nodule
478 2970068827 Sinorhizobium meliloti USDA1227 Isolate Nodule
479 2970076120 Sinorhizobium meliloti USDA1706 Isolate Nodule
480 2970082768 Sinorhizobium meliloti USDA1803 Isolate Nodule
481 2970088815 Sinorhizobium meliloti USDA1819 Isolate Nodule
482 2970095765 Sinorhizobium meliloti USDA1225 Isolate Nodule
483 2970102677 Sinorhizobium meliloti USDA1325 Isolate Nodule
484 2970109326 Sinorhizobium meliloti USDA1186 Isolate Nodule
485 2970116247 Sinorhizobium meliloti USDA1566 Isolate Nodule
486 2970122695 Sinorhizobium medicae 3082 Isolate Nodule
487 2970129317 Sinorhizobium meliloti USDA1008 Isolate Nodule
488 2970136068 Sinorhizobium meliloti USDA1699 Isolate Nodule
489 2970143518 Sinorhizobium medicae USDA1652 Isolate Nodule
490 2970149975 Sinorhizobium meliloti USDA1215 Isolate Nodule
491 2970156795 Sinorhizobium meliloti USDA1491 Isolate Nodule
492 2970164137 Sinorhizobium meliloti USDA1018 Isolate Nodule
493 2970170962 Sinorhizobium meliloti USDA1571 Isolate Nodule
494 2970177841 Sinorhizobium meliloti USDA1533 Isolate Nodule
495 2970184632 Sinorhizobium meliloti USDA1593 Isolate Nodule
496 2970191845 Sinorhizobium meliloti USDA1187 Isolate Nodule
497 2971410472 Paenibacillus oryzisoli 1ZS3-15 Isolate Unclassified
498 2977516862 Sinorhizobium meliloti USDA1791 Isolate Nodule
499 2977523885 Sinorhizobium meliloti USDA1777 Isolate Nodule
500 2977530762 Sinorhizobium medicae USDA1606 Isolate Nodule
501 2977537788 Sinorhizobium meliloti USDA1184 Isolate Nodule
502 2977544691 Sinorhizobium medicae USDA1631 Isolate Nodule
503 2977551784 Sinorhizobium meliloti USDA1035 Isolate Nodule
504 2977558990 Sinorhizobium meliloti USDA1222 Isolate Nodule
505 2977565890 Sinorhizobium meliloti USDA1617 Isolate Nodule
506 2977572785 Sinorhizobium meliloti USDA1767 Isolate Nodule
507 2977579622 Sinorhizobium meliloti USDA1161 Isolate Nodule
508 2979089926 Agrobacterium sp. SORGH_AS 745 Isolate Unclassified
509 2979095461 Agrobacterium tumefaciens SORGH_AS 749 Isolate Unclassified
510 2979100975 Agrobacterium pusense SORGH_AS 755 Isolate Unclassified
511 2980125574 Paenibacillus sp. tmac-D7 Isolate Unclassified
512 2980182181 Paenibacillus cymbidii R196 Isolate Unclassified
513 2984509177 Agrobacterium pusense SORGH_AS260 Isolate Aerial Root
514 2984518228 Agrobacterium pusense SORGH_AS285 Isolate Aerial Root
515 2984527788 Paenibacillus sp. SORGH_AS306 Isolate Aerial Root
516 2984532647 Paenibacillus sp. SORGH_AS338 Isolate Aerial Root
517 2984537506 Agrobacterium sp. SORGH_AS440 Isolate Aerial Root
518 2984601300 Rhizobium pusense SORGH_AS1083 Isolate Aerial Root
519 2988225383 Paenibacillus sp. P46E Isolate Rhizosphere
520 2996632988 Paenibacillus sp. P32E Isolate Rhizosphere
521 2996887358 Rhizobium sp. R711 Isolate Nodule
522 2996893221 Rhizobium sp. R635 Isolate Nodule
523 3000017691 Rhodobacteraceae bacterium GH2-2 Isolate Rhizosphere
524 3005409236 Rhizobium sp. P32RR-XVIII Isolate Rhizosphere
525 3005416602 Rhizobium sp. P40RR-XXII Isolate Rhizosphere
526 3005445848 Rhizobium sp. WYJ-E13 Isolate Unclassified
527 3005452660 Rhizobium grahamii BG7 Isolate Unclassified
528 3006321560 Actinacidiphila epipremni PRB2-1 Isolate Unclassified
529 3006969106 Bacillus sp. FJAT-50079 Isolate Rhizosphere
530 3006988479 Bacillus sp. FJAT-49711 Isolate Rhizosphere
531 3300001979 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6 Metagenome Rhizosphere
532 3300002704 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB Metagenome Unclassified
533 3300002705 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS Metagenome Unclassified
534 3300002737 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA Metagenome Endosphere
535 3300002738 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA Metagenome Unclassified
536 3300002739 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA Metagenome Endosphere
537 3300002741 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL Metagenome Unclassified
538 3300002773 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS Metagenome Endosphere
539 3300002987 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB Metagenome Endosphere
540 3300003187 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB Metagenome Endosphere
541 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
542 3300003214 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL Metagenome Endosphere
543 3300003215 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF Metagenome Endosphere
544 3300003316 Sugarcane root Sample L1 Metagenome Unclassified
545 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
546 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
547 3300003354 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS Metagenome Endosphere
548 3300003374 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF Metagenome Endosphere
549 3300003751 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 Metagenome Endosphere
550 3300003762 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 Metagenome Endosphere
551 3300003771 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 Metagenome Endosphere
552 3300003775 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 Metagenome Endosphere
553 3300003781 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 Metagenome Endosphere
554 3300003790 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 Metagenome Endosphere
555 3300003792 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 Metagenome Endosphere
556 3300003856 Agave microbial communities from Guanajuato, Mexico - At.Am.rz Metagenome Rhizosphere
557 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
558 3300004625 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMF_r2 Metagenome Endosphere
559 3300005262 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMF (version 2) (version 3) Metagenome Endosphere
560 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
561 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
562 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
563 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
564 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
565 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
566 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
567 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
568 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
569 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
570 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
571 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
572 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
573 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
574 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
575 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
576 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
577 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
578 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
579 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
580 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
581 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
582 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
583 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
584 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
585 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
586 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
587 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
588 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
589 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
590 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
591 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
592 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
593 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
594 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
595 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
596 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
597 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
598 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
599 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
600 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
601 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
602 3300006946 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG Metagenome Nodule
603 3300006948 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 Metagenome Nodule
604 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
605 3300009011 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-4 metaG Metagenome Rhizosphere
606 3300009036 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-4 metaG Metagenome Rhizosphere
607 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
608 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
609 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
610 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
611 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
612 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
613 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
614 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
615 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
616 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
617 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
618 3300009765 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico pink nodule Metagenome Nodule
619 3300009766 Root nodule microbial communities of legume samples collected from Mexico - Turtle bean Mexico white nodule Metagenome Nodule
620 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
621 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
622 3300012490 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.4.old.040610 Metagenome Rhizosphere
623 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
624 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
625 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
626 3300013249 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.3_F06 Metagenome Rhizosphere
627 3300013250 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_C05 Metagenome Rhizosphere
628 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
629 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
630 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
631 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
632 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
633 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
634 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
635 3300015265 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-103_1 MetaG Metagenome Rhizosphere
636 3300015690 Rizhosphere microbial communities from mature sugarcane plants Campinas, Sao Paulo, Brazil - 001.1_D05 Metagenome Rhizosphere
637 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
638 3300021320 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS3 Metagenome Nodule
639 3300021321 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS1 Metagenome Nodule
640 3300021327 Root nodule microbial communities from cowpea collected in UCLA plant growth center, Los Angeles, California, USA - CNSS2 Metagenome Nodule
641 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
642 3300022739 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - brown nodules Metagenome Nodule
643 3300022740 Root nodule microbial communities from Medicago polymorpha collected in Santa Monica, California, United States - pink nodules Metagenome Nodule
644 3300025206 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mLB (SPAdes) (version 2) Metagenome Unclassified
645 3300025208 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
646 3300025224 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
647 3300025228 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
648 3300025231 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
649 3300025233 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mTSA (SPAdes) (version 2) Metagenome Endosphere
650 3300025245 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mTSA (SPAdes) (version 3) Metagenome Endosphere
651 3300025246 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mTSA (SPAdes) (version 2) Metagenome Unclassified
652 3300025250 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mCL (SPAdes) (version 2) Metagenome Unclassified
653 3300025253 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
654 3300025254 Arabidopsis root microbial communities from North Carolina, USA - plate scrape CL_Col_mMF_r2 (SPAdes) (version 2) Metagenome Endosphere
655 3300025256 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Col_mMS (SPAdes) (version 2) Metagenome Unclassified
656 3300025258 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMS (SPAdes) (version 3) Metagenome Endosphere
657 3300025261 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape CL_Cvi_mCL (SPAdes) (version 2) Metagenome Endosphere
658 3300025273 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMS_r2 (SPAdes) (version 3) Metagenome Endosphere
659 3300025284 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mLB (SPAdes) (version 2) Metagenome Endosphere
660 3300025292 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mLB_r2 (SPAdes) (version 2) Metagenome Endosphere
661 3300025294 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mLB (SPAdes) (version 2) Metagenome Endosphere
662 3300025295 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mMF_r2 (SPAdes) (version 3) Metagenome Endosphere
663 3300025297 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Col_mMF (SPAdes) (version 2) Metagenome Endosphere
664 3300025298 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mTSA_r2 (SPAdes) (version 2) Metagenome Endosphere
665 3300025299 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Col_mCL_r2 (SPAdes) (version 3) Metagenome Endosphere
666 3300025302 Arabidopsis root microbial communities from the University of North Carolina, USA - plate scrape MF_Cvi_mMS (SPAdes) (version 2) Metagenome Endosphere
667 3300025303 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mMS_r2 (SPAdes) (version 2) Metagenome Endosphere
668 3300025304 Arabidopsis root microbial communities from North Carolina, USA - plate scrape MF_Cvi_mCL_r2 (SPAdes) (version 2) Metagenome Endosphere
669 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
670 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
671 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
672 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
673 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
674 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
675 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
676 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
677 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
678 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
679 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
680 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
681 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
682 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
683 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
684 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
685 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
686 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
687 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
688 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
689 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
690 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
691 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
692 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
693 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
694 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
695 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
696 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
697 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
698 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
699 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
700 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
701 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
702 3300027111 Root nodule microbial communities of legume samples collected from California, USA - Medicago truncatula BG (SPAdes) (version 2) Metagenome Nodule
703 3300027312 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (SPAdes) (version 2) Metagenome Rhizosphere
704 3300027666 Root nodule microbial communities of legume samples collected from California, USA - M. trunc garden sep15 (SPAdes) (version 2) Metagenome Nodule
705 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
706 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
707 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
708 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
709 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
710 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
711 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
712 3300028794 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 17_EM Metagenome Unclassified
713 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
714 3300030500 Agave microbial communities from Guanajuato, Mexico - At.Am.rz (v2) (version 3) Metagenome Rhizosphere
715 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
716 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
717 3300031240 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG Metagenome Rhizosphere
718 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
719 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
720 3300031548 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 Metagenome Rhizosphere
721 3300031616 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 9_EM Metagenome Unclassified
722 3300031649 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 16_EM Metagenome Unclassified
723 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
724 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
725 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
726 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
727 3300031901 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 Metagenome Rhizosphere
728 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
729 3300031911 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 Metagenome Rhizosphere
730 3300031967 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - elongated nodules Metagenome Nodule
731 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
732 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
733 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
734 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
735 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
736 3300033179 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 7_EM Metagenome Unclassified
737 3300033180 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 12_EM Metagenome Unclassified
738 3300033430 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - small nodules Metagenome Nodule
739 3300033464 Medicago polymorpha root nodule microbial communities from Los Angeles, California, United States - branched nodules Metagenome Nodule
740 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
741 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
742 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
743 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
744 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
745 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
746 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
747 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
748 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
749 3300041413 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0710WE14Z080117_6839 Metagenome Rhizosphere
750 3300041453 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_6 MetaG Metagenome Rhizoplane
751 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
752 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
753 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
754 3300041498 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG Metagenome Unclassified
755 3300041501 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG Metagenome Unclassified
756 3300041999 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 Metagenome Rhizosphere
757 3300042007 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 Metagenome Rhizosphere
758 3300042015 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z070717_5287 Metagenome Rhizosphere
759 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
760 3300042438 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311FE14Z081617_5533 Metagenome Rhizosphere
761 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
762 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
763 3300044735 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R Metagenome Rhizosphere
764 3300044765 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA2R Metagenome Rhizosphere
765 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
766 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
767 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
768 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
769 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
770 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
771 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
772 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
773 3300046500 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere Metagenome Rhizosphere
774 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
775 3300046507 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co2_62_14 rhizosphere Metagenome Rhizosphere
776 3300046512 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-331-Co2_50_17 rhizosphere Metagenome Rhizosphere
777 3300046513 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co2_42_17 rhizosphere Metagenome Rhizosphere
778 3300046515 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co2_62_25 rhizosphere Metagenome Rhizosphere
779 3300046519 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co2_51_16 rhizosphere Metagenome Rhizosphere
780 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
781 3300046524 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co1_12_9 rhizosphere Metagenome Rhizosphere
782 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
783 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
784 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
785 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
786 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
787 3300046660 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co1_32_7 rhizosphere Metagenome Rhizosphere
788 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
789 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
790 3300046694 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere Metagenome Rhizosphere
791 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
792 3300046810 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co2_51_17 rhizosphere Metagenome Rhizosphere
793 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
794 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
795 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
796 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
797 3300047443 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co3_24_32 rhizosphere Metagenome Rhizosphere
798 3300047472 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 rhizosphere Metagenome Rhizosphere
799 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
800 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
801 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
802 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
803 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
804 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
805 3300048919 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_7x unlabeled Metagenome Unclassified
806 3300048920 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1e N15 Metagenome Unclassified
807 3300048921 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_1f N15 Metagenome Unclassified
808 3300048922 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2e N15 Metagenome Unclassified
809 3300048923 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_2f N15 Metagenome Unclassified
810 3300048924 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR root_3e N15 Metagenome Unclassified
811 3300048925 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8x unlabeled Metagenome Unclassified
812 3300048926 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_8y unlabeled Metagenome Unclassified
813 3300048927 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_4e N15 Metagenome Unclassified
814 3300048928 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_5e N15 Metagenome Unclassified
815 3300048929 Root microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW root_6e N15 Metagenome Unclassified
816 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
817 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
818 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
819 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
820 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
821 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
822 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
823 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
824 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
825 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
826 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
827 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
828 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
829 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
830 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
831 3300049674 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F11_A_3_drought Metagenome Rhizosphere
832 3300049675 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I12_A_3_control Metagenome Rhizosphere
833 3300049708 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D14_A_3_control Metagenome Rhizosphere
834 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
835 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
836 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
837 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
838 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
839 3300050490 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 re-annotation Metagenome Endosphere
840 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
841 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
842 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
843 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
844 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
845 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
846 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
847 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
848 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
849 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
850 3300053107 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 endosphere Metagenome Endosphere
851 3300053111 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 endosphere Metagenome Endosphere
852 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
853 3300053125 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 endosphere Metagenome Endosphere
854 3300053130 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 endosphere Metagenome Endosphere
855 3300053134 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 endosphere Metagenome Endosphere
856 3300053135 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co2_54_22 endosphere Metagenome Endosphere
857 3300053136 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 endosphere Metagenome Endosphere
858 3300053137 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 endosphere Metagenome Endosphere
859 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
860 3300053140 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 endosphere Metagenome Endosphere
861 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
862 3300053156 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 endosphere Metagenome Endosphere
863 3300053157 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 endosphere Metagenome Endosphere
864 3300053161 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 endosphere Metagenome Endosphere
865 3300053177 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 endosphere Metagenome Endosphere
866 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
867 3300053731 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 endosphere Metagenome Endosphere
868 3300059508 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 53R_CD_T2_R1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
869 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
870 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
871 3300059652 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 72R_SD_T2_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
872 639633055 Rhizobium leguminosarum bv. viciae 3841 Isolate Unclassified
873 643692032 Sinorhizobium fredii NGR234 Isolate Nodule
874 648276728 Sinorhizobium meliloti BL225C Isolate Nodule
875 650716007 Agrobacterium fabacearum H13-3 Isolate Rhizosphere
876 8003570095 Agrobacterium rhizogenes GBBC3284 Isolate Unclassified
877 8003992118 Sinorhizobium meliloti RRI128 Isolate Nodule
878 8003999396 Sinorhizobium medicae WSM1115 Isolate Nodule
879 8005258706 Rhizobium sp. R693 Isolate Nodule
880 8005275841 Rhizobium sp. N4311 Isolate Nodule
881 8005282627 Rhizobium phaseoli NC1 Isolate Nodule
882 8005289223 Rhizobium bangladeshense 1002 Isolate Nodule
883 8005301065 Rhizobium bangladeshense 1017 Isolate Nodule
884 8005307578 Rhizobium leguminosarum bv. phaseoli LCS0306 Isolate Unclassified
885 8005314921 Rhizobium sp. P28RR-XV Isolate Rhizosphere
886 8005321885 Rhizobium sp. R72 Isolate Nodule
887 8005376324 Rhizobium changzhiense WYCCWR 11279 Isolate Nodule
888 8005382845 Rhizobium sp. R634 Isolate Nodule
889 8005395548 Rhizobium sp. R339 Isolate Nodule
890 8005430974 Rhizobium phaseoli Y20 Isolate Nodule
891 8005460587 Rhizobium leguminosarum bv. viciae 248 Isolate Nodule
892 8005484373 Rhizobium tropici SARCC-755 Isolate Nodule
893 8005497431 Rhizobium phaseoli CCGM8 Isolate Unclassified
894 8005542996 Rhizobium grahamii CCGM3 Isolate Unclassified
895 8005556819 Rhizobium sp. WYCCWR 11128 Isolate Nodule
896 8005563573 Rhizobium sp. WYCCWR 11152 Isolate Nodule
897 8005570704 Rhizobium anhuiense bv. trifolii WYCCWR10015 Isolate Nodule
898 8005619151 Rhizobium phaseoli CCGM2 Isolate Unclassified
899 8005626139 Rhizobium phaseoli Y18 Isolate Nodule
900 8005645114 Rhizobium tropici IGFRI Rhizo-19 Isolate Rhizosphere
901 8005658619 Rhizobium terrae CC-HIH110 Isolate Unclassified
902 8005668836 Rhizobium phaseoli CCGM9 Isolate Unclassified
903 8005682033 Rhizobium dioscoreae S-93 Isolate Unclassified
904 8005688590 Rhizobium bangladeshense 1024 Isolate Nodule
905 8005695170 Rhizobium sp. RMa-01 Isolate Unclassified
906 8008485437 Streptomyces mimosae 3MP-10 Isolate Unclassified
907 8018127388 Rhizobium aegyptiacum 950 Isolate Nodule
908 8018163183 Rhizobium sp. WYCCWR 11146 Isolate Nodule
909 8018176218 Rhizobium sp. N122 Isolate Nodule
910 8023680758 Rhizobium leguminosarum SARCC-132 Isolate Nodule
911 8024479707 Rhizobium leguminosarum Tri-43 Isolate Nodule
912 8024501048 Rhizobium sp. H4 Isolate Nodule
913 8025524527 Streptomyces sp. 3MP-14 Isolate Unclassified
914 8046767195 Rhizobium calliandrae CCGE524 Isolate Unclassified
915 8054460903 Agrobacterium vaccinii B7.6 Isolate Unclassified
916 8054465665 Paenibacillus sonchi IIRRBNF1 Isolate Rhizosphere
917 8054795415 Paenibacillus periandrae PM10 Isolate Nodule
918 8055431914 Allorhizobium sonneratiae BGMRC 0089 Isolate Unclassified
919 8056375014 Rhizobium redzepovicii 18T Isolate Nodule
920 8056382006 Rhizobium croatiense 13T Isolate Nodule
921 8056533031 Paenibacillus qinlingensis TEGT-2 Isolate Unclassified
922 8056967851 Bradyrhizobium zhengyangense WYCCWR 12678 Isolate Nodule
923 8057575449 Rhizobium mayense CCGE526 Isolate Nodule
924 8057874678 Rhizobium acaciae 1AS12 Isolate Nodule

Type Distribution

Type Percentage (%)
Metagenomes 54.65
Metatranscriptomes 0.29
Isolates 45.06

Biome Distribution

Category Percentage (%)
Aerial Root 0.44
Bulb 0
Endosphere 17.92
Nodule 32.74
Rhizoplane 1.11
Rhizosphere 34.37
Stem 0
Stem Tuber 0
Unclassified 13.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24740J21852_10009206 3300001979 Bacteria 3881
2 JGI25155J39150_1000004 3300002704 Bacteria 269098
3 JGI25156J39149_1000014 3300002705 Bacteria 189257
4 JGI25156J39149_1000015 3300002705 Bacteria 181949
5 JGI25162J39368_1001203 3300002737 Bacteria 15095
6 JGI25162J39368_1002942 3300002737 Bacteria 5755
7 JGI25154J39366_1000026 3300002738 Bacteria 200613
8 JGI25158J39367_1000160 3300002739 Bacteria 16034
9 JGI25157J39369_1000005 3300002741 Bacteria 269089
10 JGI25152J39213_1000861 3300002773 Bacteria 14974
11 JGI25152J39213_1001207 3300002773 Bacteria 11855
12 JGI25152J39213_1001531 3300002773 Bacteria 9827
13 JGI25152J39213_1002263 3300002773 Bacteria 7434
14 JGI25159J45721_1000242 3300002987 Bacteria 25793
15 JGI25159J45721_1000711 3300002987 Bacteria 14533
16 JGI25159J45721_1005637 3300002987 Bacteria 3899
17 JGI25159J45721_1014554 3300002987 Bacteria 1770
18 JGI25151J46595_10000387 3300003187 Bacteria 45673
19 JGI25151J46595_10000409 3300003187 Bacteria 44077
20 JGI25151J46595_10000714 3300003187 Bacteria 27683
21 JGI25151J46595_10004033 3300003187 Bacteria 7876
22 JGI25406J46586_10024954 3300003203 Bacteria 2330
23 JGI25406J46586_10029934 3300003203 Bacteria 2054
24 JGI25165J46597_1001246 3300003214 Bacteria 15061
25 JGI25165J46597_1002528 3300003214 Bacteria 5747
26 JGI25165J46597_1004993 3300003214 Bacteria 2662
27 JGI25153J46596_10003661 3300003215 Bacteria 8510
28 rootH1_10059358 3300003316 Bacteria 1491
29 rootH2_10045600 3300003320 Bacteria 5742
30 rootL2_10018043 3300003322 Bacteria 3339
31 rootL2_10112950 3300003322 Bacteria 7748
32 JGI25160J50197_1000022 3300003354 Bacteria 201071
33 JGI25160J50197_1002301 3300003354 Bacteria 8957
34 JGI25160J50197_1002712 3300003354 Bacteria 8141
35 JGI25160J50197_1004618 3300003354 Bacteria 5921
36 JGI25160J50197_1011926 3300003354 Bacteria 3048
37 JGI25161J50226_1000024 3300003374 Bacteria 152176
38 JGI25161J50226_1000206 3300003374 Bacteria 38371
39 Ga0055538_1000546 3300003751 Bacteria 13122
40 Ga0055542_1014899 3300003762 Bacteria 1262
41 Ga0055526_1000489 3300003771 Bacteria 31492
42 Ga0055526_1004307 3300003771 Bacteria 8599
43 Ga0055526_1013134 3300003771 Bacteria 3534
44 Ga0055524_1000517 3300003775 Bacteria 29782
45 Ga0055524_1003779 3300003775 Bacteria 7202
46 Ga0055524_1005189 3300003775 Bacteria 5867
47 Ga0055524_1005277 3300003775 Bacteria 5803
48 Ga0055524_1014466 3300003775 Bacteria 2922
49 Ga0055524_1021523 3300003775 Bacteria 2134
50 Ga0055536_1009179 3300003781 Bacteria 4132
51 Ga0055536_1017062 3300003781 Bacteria 2393
52 Ga0055528_1000478 3300003790 Bacteria 31939
53 Ga0055528_1001760 3300003790 Bacteria 12455
54 Ga0055528_1002389 3300003790 Bacteria 10126
55 Ga0055528_1017305 3300003790 Bacteria 2505
56 Ga0055528_1021586 3300003790 Bacteria 2037
57 Ga0055540_1000320 3300003792 Bacteria 42457
58 Ga0055540_1003981 3300003792 Bacteria 6880
59 Ga0055540_1026234 3300003792 Bacteria 1412
60 Ga0055540_1028718 3300003792 Bacteria 1312
61 Ga0058692_1002641 3300003856 Bacteria 5903
62 JGI25405J52794_10002814 3300003911 Bacteria 3018
63 Ga0055543_1000025 3300004625 Bacteria 137886
64 Ga0055543_1000248 3300004625 Bacteria 41302
65 Ga0055543_1002104 3300004625 Bacteria 6913
66 Ga0055543_1014478 3300004625 Bacteria 1537
67 Ga0065165_1000200 3300005262 Bacteria 103564
68 Ga0065165_1001128 3300005262 Bacteria 31425
69 Ga0065165_1001369 3300005262 Bacteria 26829
70 Ga0065165_1006963 3300005262 Bacteria 5725
71 Ga0065165_1015821 3300005262 Bacteria 2858
72 Ga0070658_10060193 3300005327 Bacteria 3092
73 Ga0070658_10061436 3300005327 Bacteria 3061
74 Ga0070670_100134421 3300005331 Bacteria 2137
75 Ga0070660_100001762 3300005339 Bacteria 14850
76 Ga0070660_100073319 3300005339 Bacteria 2677
77 Ga0070660_100081504 3300005339 Bacteria 2540
78 Ga0070661_100028790 3300005344 Bacteria 4008
79 Ga0070661_100030184 3300005344 Bacteria 3916
80 Ga0070661_100099812 3300005344 Bacteria 2158
81 Ga0070668_100013330 3300005347 Bacteria 6135
82 Ga0070668_100023500 3300005347 Bacteria 4663
83 Ga0070668_100046535 3300005347 Bacteria 3332
84 Ga0070669_100036316 3300005353 Bacteria 3570
85 Ga0070669_100061720 3300005353 Bacteria 2755
86 Ga0070674_100005304 3300005356 Bacteria 7427
87 Ga0070659_100018201 3300005366 Bacteria 5301
88 Ga0070667_100052255 3300005367 Bacteria 3448
89 Ga0070700_100094362 3300005441 Bacteria 1959
90 Ga0070663_100066828 3300005455 Bacteria 2606
91 Ga0070663_100076567 3300005455 Bacteria 2447
92 Ga0070663_100094147 3300005455 Bacteria 2224
93 Ga0070678_100388583 3300005456 Bacteria 1209
94 Ga0070679_100174329 3300005530 Bacteria 2123
95 Ga0068853_100000565 3300005539 Bacteria 25355
96 Ga0068853_100059131 3300005539 Bacteria 3311
97 Ga0068853_100097958 3300005539 Bacteria 2589
98 Ga0068853_100131600 3300005539 Bacteria 2240
99 Ga0070672_100036888 3300005543 Bacteria 3727
100 Ga0070665_100002585 3300005548 Bacteria 19803
101 Ga0070665_100095279 3300005548 Bacteria 2981
102 Ga0068855_100073222 3300005563 Bacteria 3981
103 Ga0068855_100121017 3300005563 Bacteria 2996
104 Ga0068855_100132489 3300005563 Bacteria 2845
105 Ga0068855_100174184 3300005563 Bacteria 2435
106 Ga0070664_100455725 3300005564 Bacteria 1175
107 Ga0068857_100074796 3300005577 Bacteria 3019
108 Ga0068857_100152029 3300005577 Bacteria 2097
109 Ga0068854_100011307 3300005578 Bacteria 5805
110 Ga0068854_100064409 3300005578 Bacteria 2663
111 Ga0068854_100167266 3300005578 Bacteria 1708
112 Ga0068854_100206798 3300005578 Bacteria 1546
113 Ga0068854_100244498 3300005578 Bacteria 1430
114 Ga0068856_100008285 3300005614 Bacteria 10132
115 Ga0068856_100066245 3300005614 Bacteria 3569
116 Ga0068856_100073534 3300005614 Bacteria 3384
117 Ga0068856_100117479 3300005614 Bacteria 2660
118 Ga0068856_100155283 3300005614 Bacteria 2298
119 Ga0068852_100002107 3300005616 Bacteria 13607
120 Ga0068852_100006927 3300005616 Bacteria 8245
121 Ga0068852_100010073 3300005616 Bacteria 7035
122 Ga0068852_100029002 3300005616 Bacteria 4539
123 Ga0068852_100092772 3300005616 Bacteria 2705
124 Ga0068851_10027371 3300005834 Bacteria 2810
125 Ga0068863_100171095 3300005841 Bacteria 2084
126 Ga0068858_100113296 3300005842 Bacteria 2533
127 Ga0068862_100035487 3300005844 Bacteria 4223
128 Ga0068862_100040706 3300005844 Bacteria 3950
129 Ga0081455_10000482 3300005937 Bacteria 51729
130 Ga0081455_10243547 3300005937 Bacteria 1320
131 Ga0081538_10032965 3300005981 Bacteria 3458
132 Ga0081540_1040509 3300005983 Bacteria 2428
133 Ga0081539_10001783 3300005985 Bacteria 34177
134 Ga0081539_10002139 3300005985 Bacteria 29179
135 Ga0081539_10012392 3300005985 Bacteria 6578
136 Ga0075365_10000641 3300006038 Bacteria 13855
137 Ga0075365_10001348 3300006038 Bacteria 11002
138 Ga0075365_10002567 3300006038 Bacteria 8967
139 Ga0075365_10004465 3300006038 Bacteria 7415
140 Ga0075365_10008876 3300006038 Bacteria 5740
141 Ga0075365_10019507 3300006038 Bacteria 4187
142 Ga0075365_10026065 3300006038 Bacteria 3707
143 Ga0075365_10032251 3300006038 Bacteria 3366
144 Ga0075368_10015660 3300006042 Bacteria 2817
145 Ga0075368_10036305 3300006042 Bacteria 1925
146 Ga0075368_10047512 3300006042 Bacteria 1699
147 Ga0075368_10051207 3300006042 Bacteria 1641
148 Ga0075368_10066825 3300006042 Bacteria 1446
149 Ga0075363_100001601 3300006048 Bacteria 8712
150 Ga0075363_100003108 3300006048 Bacteria 6970
151 Ga0075363_100018367 3300006048 Bacteria 3483
152 Ga0075363_100020501 3300006048 Bacteria 3316
153 Ga0075363_100116753 3300006048 Bacteria 1487
154 Ga0075364_10012258 3300006051 Bacteria 5241
155 Ga0075364_10019248 3300006051 Bacteria 4283
156 Ga0075364_10023714 3300006051 Bacteria 3887
157 Ga0075364_10030856 3300006051 Bacteria 3442
158 Ga0075364_10103742 3300006051 Bacteria 1894
159 Ga0075362_10003917 3300006177 Bacteria 5290
160 Ga0075362_10010334 3300006177 Bacteria 3642
161 Ga0075362_10024045 3300006177 Bacteria 2582
162 Ga0075367_10000605 3300006178 Bacteria 13802
163 Ga0075367_10002193 3300006178 Bacteria 8804
164 Ga0075367_10010227 3300006178 Bacteria 4922
165 Ga0075367_10031237 3300006178 Bacteria 3057
166 Ga0075367_10052945 3300006178 Bacteria 2404
167 Ga0075367_10081821 3300006178 Bacteria 1954
168 Ga0075367_10101282 3300006178 Bacteria 1761
169 Ga0075369_10005102 3300006186 Bacteria 4890
170 Ga0075369_10009196 3300006186 Bacteria 3831
171 Ga0075369_10016168 3300006186 Bacteria 3006
172 Ga0075369_10021032 3300006186 Bacteria 2677
173 Ga0075369_10062541 3300006186 Bacteria 1627
174 Ga0075369_10064522 3300006186 Bacteria 1604
175 Ga0075366_10001240 3300006195 Bacteria 12657
176 Ga0075366_10021217 3300006195 Bacteria 3775
177 Ga0075366_10049433 3300006195 Bacteria 2495
178 Ga0075366_10060071 3300006195 Bacteria 2259
179 Ga0075366_10142145 3300006195 Bacteria 1451
180 Ga0075370_10000790 3300006353 Bacteria 12649
181 Ga0075370_10001831 3300006353 Bacteria 9513
182 Ga0075370_10010473 3300006353 Bacteria 4848
183 Ga0075370_10012225 3300006353 Bacteria 4531
184 Ga0075370_10034470 3300006353 Bacteria 2837
185 Ga0075428_100070600 3300006844 Bacteria 3818
186 Ga0068865_100231903 3300006881 Bacteria 1449
187 Ga0068865_100324855 3300006881 Bacteria 1239
188 Ga0075436_100038129 3300006914 Bacteria 3318
189 Ga0079104_1008652 3300006946 Bacteria 3531
190 Ga0099826_10000040 3300006948 Bacteria 98176
191 Ga0099826_10080445 3300006948 Bacteria 2032
192 Ga0099795_10045681 3300007788 Bacteria 1575
193 Ga0105251_10008485 3300009011 Bacteria 6176
194 Ga0105244_10097039 3300009036 Bacteria 1445
195 Ga0105240_10000013 3300009093 Bacteria 483458
196 Ga0105240_10007818 3300009093 Bacteria 15442
197 Ga0105240_10018416 3300009093 Bacteria 9377
198 Ga0105240_10139857 3300009093 Bacteria 2895
199 Ga0111539_10180832 3300009094 Bacteria 2463
200 Ga0111539_10417531 3300009094 Bacteria 1563
201 Ga0105245_10249836 3300009098 Bacteria 1723
202 Ga0105247_10009605 3300009101 Bacteria 5871
203 Ga0114129_10790522 3300009147 Bacteria 1211
204 Ga0105243_10028578 3300009148 Bacteria 4281
205 Ga0105243_10056337 3300009148 Bacteria 3125
206 Ga0105241_10028242 3300009174 Bacteria 4180
207 Ga0105241_10042714 3300009174 Bacteria 3432
208 Ga0105241_10049194 3300009174 Bacteria 3210
209 Ga0105241_10062149 3300009174 Bacteria 2878
210 Ga0105248_10009144 3300009177 Bacteria 10897
211 Ga0105248_10081859 3300009177 Bacteria 3629
212 Ga0105237_10000071 3300009545 Bacteria 135695
213 Ga0105237_10002420 3300009545 Bacteria 23173
214 Ga0105237_10010647 3300009545 Bacteria 9772
215 Ga0105237_10016814 3300009545 Bacteria 7593
216 Ga0105237_10308890 3300009545 Bacteria 1584
217 Ga0105237_10451609 3300009545 Bacteria 1291
218 Ga0105238_10018899 3300009551 Bacteria 7017
219 Ga0105249_10064625 3300009553 Bacteria 3365
220 Ga0105249_10082542 3300009553 Bacteria 2991
221 Ga0105249_10180725 3300009553 Bacteria 2052
222 Ga0105249_10344701 3300009553 Bacteria 1508
223 Ga0123341_1083945 3300009765 Bacteria 1215
224 Ga0123342_1020788 3300009766 Bacteria 4728
225 Ga0123342_1033145 3300009766 Bacteria 2367
226 Ga0105239_10001189 3300010375 Bacteria 35605
227 Ga0105239_10028181 3300010375 Bacteria 6178
228 Ga0105239_10069958 3300010375 Bacteria 3855
229 Ga0105239_10078512 3300010375 Bacteria 3633
230 Ga0105239_10116563 3300010375 Bacteria 2964
231 Ga0105239_10123270 3300010375 Bacteria 2880
232 Ga0105246_10038060 3300011119 Bacteria 3231
233 Ga0105246_10080022 3300011119 Bacteria 2325
234 Ga0105246_10105769 3300011119 Bacteria 2057
235 Ga0157322_1000363 3300012490 Bacteria 1595
236 Ga0157371_10000042 3300013102 Bacteria 198938
237 Ga0157371_10270803 3300013102 Bacteria 1225
238 Ga0157370_10000035 3300013104 Bacteria 137103
239 Ga0157370_10003431 3300013104 Bacteria 18611
240 Ga0157370_10060171 3300013104 Bacteria 3607
241 Ga0157370_10158271 3300013104 Bacteria 2107
242 Ga0157370_10217126 3300013104 Bacteria 1772
243 Ga0157369_10002596 3300013105 Bacteria 21609
244 Ga0157369_10064646 3300013105 Bacteria 3939
245 Ga0171463_1002 3300013249 Bacteria 1274851
246 Ga0171462_1067 3300013250 Bacteria 13661
247 Ga0157374_10118195 3300013296 Bacteria 2556
248 Ga0163162_10068227 3300013306 Bacteria 3607
249 Ga0157372_10052860 3300013307 Bacteria 4526
250 Ga0157375_10339005 3300013308 Bacteria 1669
251 Ga0157375_10410050 3300013308 Bacteria 1521
252 Ga0163163_10028230 3300014325 Bacteria 5386
253 Ga0157380_10017440 3300014326 Bacteria 5313
254 Ga0182008_10022222 3300014497 Bacteria 3249
255 Ga0182005_1001647 3300015265 Bacteria 8685
256 Ga0183363_1046 3300015690 Bacteria 40582
257 Ga0163161_10182099 3300017792 Bacteria 1611
258 Ga0214544_1000771 3300021320 Bacteria 61917
259 Ga0214542_1000032 3300021321 Bacteria 171690
260 Ga0214542_1021618 3300021321 Bacteria 4352
261 Ga0214543_1000016 3300021327 Bacteria 295257
262 Ga0214543_1009269 3300021327 Bacteria 15462
263 Ga0213875_10123936 3300021388 Bacteria 1207
264 Ga0228711_1000006 3300022739 Bacteria 202437
265 Ga0228710_1000004 3300022740 Bacteria 250560
266 Ga0209435_100009 3300025206 Bacteria 476614
267 Ga0209436_100127 3300025208 Bacteria 37528
268 Ga0209436_109131 3300025208 Bacteria 1914
269 Ga0209784_100078 3300025224 Bacteria 137701
270 Ga0209672_102531 3300025228 Bacteria 4406
271 Ga0207427_103104 3300025231 Bacteria 3742
272 Ga0209437_100057 3300025233 Bacteria 362922
273 Ga0209437_100772 3300025233 Bacteria 15151
274 Ga0207425_1014088 3300025245 Bacteria 1824
275 Ga0209646_1000018 3300025246 Bacteria 476716
276 Ga0209026_1000043 3300025250 Bacteria 269142
277 Ga0209677_100426 3300025253 Bacteria 25046
278 Ga0209148_1000305 3300025254 Bacteria 70375
279 Ga0209759_1000007 3300025256 Bacteria 476614
280 Ga0209129_1000312 3300025258 Bacteria 43311
281 Ga0209129_1000357 3300025258 Bacteria 38204
282 Ga0209129_1001779 3300025258 Bacteria 11495
283 Ga0209129_1004734 3300025258 Bacteria 5161
284 Ga0209233_1000130 3300025261 Bacteria 205687
285 Ga0209233_1000255 3300025261 Bacteria 82230
286 Ga0209233_1000290 3300025261 Bacteria 64394
287 Ga0209233_1000332 3300025261 Bacteria 48225
288 Ga0209233_1004820 3300025261 Bacteria 4543
289 Ga0209673_1000584 3300025273 Bacteria 57616
290 Ga0209673_1000890 3300025273 Bacteria 38476
291 Ga0209673_1001948 3300025273 Bacteria 16219
292 Ga0209673_1002261 3300025273 Bacteria 13869
293 Ga0209673_1002508 3300025273 Bacteria 12618
294 Ga0209673_1002576 3300025273 Bacteria 12296
295 Ga0209130_1000002 3300025284 Bacteria 722648
296 Ga0209130_1000164 3300025284 Bacteria 97595
297 Ga0209130_1000252 3300025284 Bacteria 67611
298 Ga0209130_1000830 3300025284 Bacteria 25965
299 Ga0209130_1006186 3300025284 Bacteria 3939
300 Ga0209676_1000097 3300025292 Bacteria 237203
301 Ga0209676_1000256 3300025292 Bacteria 112819
302 Ga0209676_1029891 3300025292 Bacteria 1675
303 Ga0209025_1000374 3300025294 Bacteria 93607
304 Ga0209025_1000857 3300025294 Bacteria 48082
305 Ga0209025_1000908 3300025294 Bacteria 45749
306 Ga0209025_1001024 3300025294 Bacteria 41149
307 Ga0209025_1001822 3300025294 Bacteria 25091
308 Ga0209025_1006010 3300025294 Bacteria 9634
309 Ga0209025_1015222 3300025294 Bacteria 4659
310 Ga0209564_1000914 3300025295 Bacteria 38607
311 Ga0209564_1001996 3300025295 Bacteria 17840
312 Ga0209564_1011645 3300025295 Bacteria 3917
313 Ga0209758_1001197 3300025297 Bacteria 32795
314 Ga0209758_1001464 3300025297 Bacteria 27679
315 Ga0209758_1001885 3300025297 Bacteria 22881
316 Ga0209758_1002066 3300025297 Bacteria 21435
317 Ga0209758_1002227 3300025297 Bacteria 20142
318 Ga0209758_1003392 3300025297 Bacteria 14554
319 Ga0209758_1026422 3300025297 Bacteria 2512
320 Ga0209758_1028154 3300025297 Bacteria 2384
321 Ga0209758_1029811 3300025297 Bacteria 2272
322 Ga0209758_1037090 3300025297 Bacteria 1890
323 Ga0209050_1023572 3300025298 Bacteria 2160
324 Ga0209256_1000260 3300025299 Bacteria 93956
325 Ga0209256_1000739 3300025299 Bacteria 42871
326 Ga0209256_1001817 3300025299 Bacteria 20042
327 Ga0209256_1005354 3300025299 Bacteria 7432
328 Ga0209256_1007001 3300025299 Bacteria 5731
329 Ga0207426_1000013 3300025302 Bacteria 721897
330 Ga0207426_1000082 3300025302 Bacteria 298939
331 Ga0207426_1000098 3300025302 Bacteria 264264
332 Ga0207426_1000287 3300025302 Bacteria 100566
333 Ga0207426_1000812 3300025302 Bacteria 33529
334 Ga0207426_1001778 3300025302 Bacteria 16206
335 Ga0209051_1000195 3300025303 Bacteria 107201
336 Ga0209051_1002486 3300025303 Bacteria 13148
337 Ga0209051_1007413 3300025303 Bacteria 5998
338 Ga0209051_1062767 3300025303 Bacteria 1160
339 Ga0209257_1004297 3300025304 Bacteria 11202
340 Ga0209257_1007822 3300025304 Bacteria 6326
341 Ga0207710_10046785 3300025900 Bacteria 1932
342 Ga0207688_10010706 3300025901 Bacteria 4991
343 Ga0207688_10045465 3300025901 Bacteria 2449
344 Ga0207680_10148648 3300025903 Bacteria 1560
345 Ga0207647_10021122 3300025904 Bacteria 4351
346 Ga0207705_10002602 3300025909 Bacteria 13868
347 Ga0207705_10018987 3300025909 Bacteria 4916
348 Ga0207705_10161161 3300025909 Bacteria 1685
349 Ga0207695_10000044 3300025913 Bacteria 440819
350 Ga0207695_10000136 3300025913 Bacteria 217596
351 Ga0207695_10029206 3300025913 Bacteria 6099
352 Ga0207695_10307984 3300025913 Bacteria 1474
353 Ga0207671_10000043 3300025914 Bacteria 206915
354 Ga0207671_10000099 3300025914 Bacteria 132378
355 Ga0207657_10003030 3300025919 Bacteria 17989
356 Ga0207657_10004936 3300025919 Bacteria 14029
357 Ga0207649_10038059 3300025920 Bacteria 2910
358 Ga0207649_10047558 3300025920 Bacteria 2641
359 Ga0207649_10077321 3300025920 Bacteria 2144
360 Ga0207649_10094290 3300025920 Bacteria 1966
361 Ga0207652_10322124 3300025921 Bacteria 1395
362 Ga0207694_10414682 3300025924 Bacteria 1121
363 Ga0207687_10348640 3300025927 Bacteria 1206
364 Ga0207690_10091750 3300025932 Bacteria 2147
365 Ga0207706_10213667 3300025933 Bacteria 1690
366 Ga0207709_10021898 3300025935 Bacteria 3621
367 Ga0207669_10022958 3300025937 Bacteria 3323
368 Ga0207669_10062514 3300025937 Bacteria 2294
369 Ga0207669_10389146 3300025937 Bacteria 1089
370 Ga0207691_10039264 3300025940 Bacteria 4379
371 Ga0207691_10168156 3300025940 Bacteria 1921
372 Ga0207711_10037909 3300025941 Bacteria 4097
373 Ga0207679_10188639 3300025945 Bacteria 1712
374 Ga0207667_10032885 3300025949 Bacteria 5582
375 Ga0207667_10137137 3300025949 Bacteria 2519
376 Ga0207651_10009486 3300025960 Bacteria 5335
377 Ga0207712_10079253 3300025961 Bacteria 2385
378 Ga0207668_10035197 3300025972 Bacteria 3332
379 Ga0207668_10168681 3300025972 Bacteria 1714
380 Ga0207668_10190996 3300025972 Bacteria 1623
381 Ga0207640_10050225 3300025981 Bacteria 2704
382 Ga0207640_10053820 3300025981 Bacteria 2629
383 Ga0207703_10048242 3300026035 Bacteria 3437
384 Ga0207639_10001011 3300026041 Bacteria 19136
385 Ga0207639_10033504 3300026041 Bacteria 3789
386 Ga0207639_10159493 3300026041 Bacteria 1899
387 Ga0207639_10383083 3300026041 Bacteria 1263
388 Ga0207678_10029480 3300026067 Bacteria 4790
389 Ga0207678_10046776 3300026067 Bacteria 3742
390 Ga0207678_10105168 3300026067 Bacteria 2408
391 Ga0207708_10124796 3300026075 Bacteria 2009
392 Ga0207708_10177328 3300026075 Bacteria 1690
393 Ga0207702_10006190 3300026078 Bacteria 10352
394 Ga0207702_10017912 3300026078 Bacteria 5861
395 Ga0207702_10073450 3300026078 Bacteria 2949
396 Ga0207648_10268943 3300026089 Bacteria 1522
397 Ga0207674_10052495 3300026116 Bacteria 4158
398 Ga0207683_10027732 3300026121 Bacteria 4893
399 Ga0207683_10206493 3300026121 Bacteria 1787
400 Ga0207698_10007021 3300026142 Bacteria 7054
401 Ga0207698_10157080 3300026142 Bacteria 1983
402 Ga0207698_10168149 3300026142 Bacteria 1927
403 Ga0209281_1000102 3300027111 Bacteria 221665
404 Ga0209281_1000563 3300027111 Bacteria 44757
405 Ga0209371_1000003 3300027312 Bacteria 1122971
406 Ga0209371_1000998 3300027312 Bacteria 21742
407 Ga0209371_1001347 3300027312 Bacteria 17020
408 Ga0209282_1000013 3300027666 Bacteria 215053
409 Ga0209282_1000150 3300027666 Bacteria 41053
410 Ga0209282_1080876 3300027666 Bacteria 1735
411 Ga0209813_10001001 3300027866 Bacteria 6338
412 Ga0209813_10002610 3300027866 Bacteria 4139
413 Ga0209813_10005108 3300027866 Bacteria 3173
414 Ga0209813_10027957 3300027866 Bacteria 1641
415 Ga0207428_10132694 3300027907 Bacteria 1905
416 Ga0268266_10000391 3300028379 Bacteria 66400
417 Ga0268266_10002425 3300028379 Bacteria 20076
418 Ga0268266_10303773 3300028379 Bacteria 1489
419 Ga0268265_10122312 3300028380 Bacteria 2146
420 Ga0268265_10163308 3300028380 Bacteria 1895
421 Ga0268265_10199821 3300028380 Bacteria 1733
422 Ga0268264_10125499 3300028381 Bacteria 2268
423 Ga0265323_10020328 3300028653 Bacteria 2558
424 Ga0265322_10001864 3300028654 Bacteria 6676
425 Ga0307515_10004240 3300028794 Bacteria 29769
426 Ga0265338_10128710 3300028800 Bacteria 2004
427 Ga0268256_1000004 3300030500 Bacteria 1122967
428 Ga0268256_1001200 3300030500 Bacteria 16565
429 Ga0268256_1002297 3300030500 Bacteria 9909
430 Ga0265330_10022425 3300031235 Bacteria 2873
431 Ga0265328_10036213 3300031239 Bacteria 1824
432 Ga0265320_10070181 3300031240 Bacteria 1653
433 Ga0265320_10077447 3300031240 Bacteria 1556
434 Ga0265316_10060596 3300031344 Bacteria 2941
435 Ga0307513_10018636 3300031456 Bacteria 8288
436 Ga0307408_100039293 3300031548 Bacteria 3344
437 Ga0307408_100130609 3300031548 Bacteria 1959
438 Ga0307508_10017913 3300031616 Bacteria 6436
439 Ga0307514_10023355 3300031649 Bacteria 5018
440 Ga0265342_10003529 3300031712 Bacteria 12794
441 Ga0307516_10028576 3300031730 Bacteria 5642
442 Ga0307413_10020232 3300031824 Bacteria 3535
443 Ga0307413_10030735 3300031824 Bacteria 3020
444 Ga0307410_10051199 3300031852 Bacteria 2782
445 Ga0307410_10147885 3300031852 Bacteria 1745
446 Ga0307406_10010585 3300031901 Bacteria 5206
447 Ga0307407_10035282 3300031903 Bacteria 2747
448 Ga0307407_10188317 3300031903 Bacteria 1373
449 Ga0307412_10015156 3300031911 Bacteria 4562
450 Ga0307412_10057088 3300031911 Bacteria 2604
451 Ga0307412_10115653 3300031911 Bacteria 1923
452 Ga0307412_10294173 3300031911 Bacteria 1280
453 Ga0307412_10295612 3300031911 Bacteria 1278
454 Ga0307412_10298340 3300031911 Bacteria 1272
455 Ga0315914_1000004 3300031967 Bacteria 288534
456 Ga0307409_100051405 3300031995 Bacteria 3153
457 Ga0307409_100064948 3300031995 Bacteria 2869
458 Ga0307409_100081884 3300031995 Bacteria 2611
459 Ga0307409_100179512 3300031995 Bacteria 1873
460 Ga0307416_100096972 3300032002 Bacteria 2552
461 Ga0307416_100230775 3300032002 Bacteria 1784
462 Ga0307416_100266096 3300032002 Bacteria 1679
463 Ga0307414_10011787 3300032004 Bacteria 5144
464 Ga0307414_10224116 3300032004 Bacteria 1545
465 Ga0307414_10430791 3300032004 Bacteria 1152
466 Ga0307411_10037459 3300032005 Bacteria 3050
467 Ga0307415_100034769 3300032126 Bacteria 3285
468 Ga0307507_10000031 3300033179 Bacteria 195619
469 Ga0307507_10027619 3300033179 Bacteria 6077
470 Ga0307510_10054575 3300033180 Bacteria 4183
471 Ga0307510_10081429 3300033180 Bacteria 3139
472 Ga0315913_1000055 3300033430 Bacteria 58182
473 Ga0315915_1000003 3300033464 Bacteria 407996
474 Ga0373927_0257806 3300035695 Bacteria 1147
475 Ga0373937_0619954 3300036401 Bacteria 1027
476 Ga0373925_0242447 3300037068 Bacteria 1444
477 Ga0395899_0006280 3300037312 Bacteria 9202
478 Ga0395899_0033153 3300037312 Bacteria 3879
479 Ga0395899_0048208 3300037312 Bacteria 3171
480 Ga0395899_0071224 3300037312 Bacteria 2544
481 Ga0395900_0003467 3300037418 Bacteria 17031
482 Ga0395900_0021722 3300037418 Bacteria 6561
483 Ga0395900_0436125 3300037418 Bacteria 1268
484 Ga0395900_0502445 3300037418 Bacteria 1163
485 Ga0395898_0160851 3300037466 Bacteria 2147
486 Ga0395898_0358951 3300037466 Bacteria 1389
487 Ga0436364_0049675 3300037853 Bacteria 9744
488 Ga0395901_0043533 3300038443 Bacteria 4657
489 Ga0395901_0064452 3300038443 Bacteria 3814
490 Ga0395901_0101100 3300038443 Bacteria 3025
491 Ga0395901_0121877 3300038443 Bacteria 2740
492 Ga0395901_0345048 3300038443 Bacteria 1538
493 Ga0436360_0070791 3300039438 Bacteria 2255
494 Ga0436360_1222189 3300039438 Bacteria 1673
495 Ga0436360_1362121 3300039438 Bacteria 4724
496 Ga0439465_0028012 3300041413 Bacteria 1785
497 Ga0451797_0381403 3300041453 Bacteria 2763
498 Ga0451798_0043797 3300041458 Bacteria 1666
499 Ga0451800_0474694 3300041459 Bacteria 998
500 Ga0451839_0282160 3300041496 Bacteria 2520
501 Ga0451841_1056658 3300041498 Bacteria 2202
502 Ga0451845_0333885 3300041501 Bacteria 4304
503 Ga0439433_0003847 3300041999 Bacteria 3229
504 Ga0439449_0000030 3300042007 Bacteria 42422
505 Ga0439462_0000211 3300042015 Bacteria 10221
506 Ga0439435_0000577 3300042436 Bacteria 5937
507 Ga0439435_0008601 3300042436 Bacteria 2371
508 Ga0439459_0012984 3300042438 Bacteria 1492
509 Ga0466969_0009201 3300044656 Bacteria 5238
510 Ga0466969_0015324 3300044656 Bacteria 4018
511 Ga0466965_0207935 3300044683 Bacteria 1040
512 Ga0466968_0066731 3300044735 Bacteria 1559
513 Ga0466970_0174421 3300044765 Bacteria 1192
514 Ga0466958_0199331 3300045836 Bacteria 1274
515 Ga0466967_0365170 3300045976 Bacteria 1399
516 Ga0466967_0952200 3300045976 Bacteria 854
517 Ga0495627_048861 3300046453 Bacteria 1279
518 Ga0495592_0015000 3300046454 Bacteria 5883
519 Ga0495580_0003246 3300046472 Bacteria 13908
520 Ga0495605_0123267 3300046474 Bacteria 1174
521 Ga0495664_0100690 3300046477 Bacteria 1741
522 Ga0495585_0006815 3300046492 Bacteria 7049
523 Ga0495596_0038697 3300046500 Bacteria 1885
524 Ga0495607_0030405 3300046501 Bacteria 3316
525 Ga0495606_0001613 3300046507 Bacteria 29410
526 Ga0495606_0017853 3300046507 Bacteria 5343
527 Ga0495606_0101858 3300046507 Bacteria 1747
528 Ga0495606_0162551 3300046507 Bacteria 1302
529 Ga0495610_0004867 3300046512 Bacteria 9766
530 Ga0495610_0006514 3300046512 Bacteria 8009
531 Ga0495610_0050685 3300046512 Bacteria 2025
532 Ga0495616_0052731 3300046513 Bacteria 2024
533 Ga0495620_0035733 3300046515 Bacteria 2230
534 Ga0495632_0004032 3300046519 Bacteria 10137
535 Ga0495643_0010669 3300046522 Bacteria 5644
536 Ga0495643_0049454 3300046522 Bacteria 2267
537 Ga0495648_0043505 3300046524 Bacteria 2814
538 Ga0495648_0049708 3300046524 Bacteria 2568
539 Ga0495648_0097122 3300046524 Bacteria 1635
540 Ga0495648_0152277 3300046524 Bacteria 1205
541 Ga0495652_0134912 3300046529 Bacteria 1949
542 Ga0495645_0018535 3300046543 Bacteria 5001
543 Ga0495622_0115960 3300046557 Bacteria 1225
544 Ga0495633_0033803 3300046558 Bacteria 2464
545 Ga0495633_0033929 3300046558 Bacteria 2457
546 Ga0495668_0034453 3300046616 Bacteria 2840
547 Ga0495625_0125786 3300046660 Bacteria 1740
548 Ga0495625_0137960 3300046660 Bacteria 1647
549 Ga0495625_0143473 3300046660 Bacteria 1609
550 Ga0495624_0166512 3300046690 Bacteria 1345
551 Ga0495670_0027101 3300046691 Bacteria 2837
552 Ga0495670_0102610 3300046691 Bacteria 1474
553 Ga0495649_0028640 3300046694 Bacteria 3087
554 Ga0495600_0030281 3300046809 Bacteria 3506
555 Ga0495660_0042753 3300046810 Bacteria 2502
556 Ga0495604_0012273 3300047317 Bacteria 6811
557 Ga0495604_0025521 3300047317 Bacteria 4709
558 Ga0495636_0099378 3300047318 Bacteria 1271
559 Ga0495680_0070768 3300047322 Bacteria 2658
560 Ga0495683_0032607 3300047323 Bacteria 2653
561 Ga0495683_0094314 3300047323 Bacteria 1446
562 Ga0495687_011064 3300047443 Bacteria 4882
563 Ga0495686_0013754 3300047472 Bacteria 5606
564 Ga0495686_0017404 3300047472 Bacteria 4845
565 Ga0495626_0039058 3300048091 Bacteria 2248
566 Ga0496104_0041056 3300048907 Bacteria 4337
567 Ga0496106_0000490 3300048909 Bacteria 28105
568 Ga0496106_0000825 3300048909 Bacteria 22458
569 Ga0496106_0175938 3300048909 Bacteria 1698
570 Ga0496110_0147742 3300048913 Bacteria 2127
571 Ga0496112_0319663 3300048915 Bacteria 1496
572 Ga0496115_0073680 3300048918 Bacteria 2772
573 Ga0496116_0008774 3300048919 Bacteria 8720
574 Ga0496116_0015457 3300048919 Bacteria 6033
575 Ga0496116_0019715 3300048919 Bacteria 5155
576 Ga0496117_0000036 3300048920 Bacteria 325635
577 Ga0496117_0012929 3300048920 Bacteria 7315
578 Ga0496118_0019730 3300048921 Bacteria 6012
579 Ga0496118_0027736 3300048921 Bacteria 4784
580 Ga0496118_0083178 3300048921 Bacteria 2239
581 Ga0496119_0185140 3300048922 Bacteria 1089
582 Ga0496120_0000036 3300048923 Bacteria 206505
583 Ga0496120_0004721 3300048923 Bacteria 11220
584 Ga0496121_0000005 3300048924 Bacteria 1034486
585 Ga0496121_0000759 3300048924 Bacteria 59261
586 Ga0496121_0002070 3300048924 Bacteria 31759
587 Ga0496121_0041492 3300048924 Bacteria 4020
588 Ga0496121_0147816 3300048924 Bacteria 1734
589 Ga0496121_0155643 3300048924 Bacteria 1677
590 Ga0496121_0187494 3300048924 Bacteria 1486
591 Ga0496122_0000002 3300048925 Bacteria 905834
592 Ga0496122_0000006 3300048925 Bacteria 625811
593 Ga0496122_0005964 3300048925 Bacteria 14259
594 Ga0496122_0008486 3300048925 Bacteria 11065
595 Ga0496122_0016734 3300048925 Bacteria 6911
596 Ga0496122_0128499 3300048925 Bacteria 1616
597 Ga0496122_0130891 3300048925 Bacteria 1594
598 Ga0496122_0154459 3300048925 Bacteria 1410
599 Ga0496123_0000002 3300048926 Bacteria 1811682
600 Ga0496123_0007011 3300048926 Bacteria 10743
601 Ga0496123_0011879 3300048926 Bacteria 7485
602 Ga0496123_0016819 3300048926 Bacteria 5913
603 Ga0496124_0000080 3300048927 Bacteria 210439
604 Ga0496124_0013952 3300048927 Bacteria 7804
605 Ga0496124_0091559 3300048927 Bacteria 2477
606 Ga0496124_0134733 3300048927 Bacteria 1957
607 Ga0496124_0213432 3300048927 Bacteria 1458
608 Ga0496125_0000157 3300048928 Bacteria 151351
609 Ga0496125_0000159 3300048928 Bacteria 151205
610 Ga0496125_0000381 3300048928 Bacteria 82386
611 Ga0496125_0012248 3300048928 Bacteria 8528
612 Ga0496125_0038894 3300048928 Bacteria 4107
613 Ga0496125_0049918 3300048928 Bacteria 3470
614 Ga0496126_0000016 3300048929 Bacteria 625843
615 Ga0496126_0189926 3300048929 Bacteria 1740
616 Ga0496126_0214915 3300048929 Bacteria 1618
617 Ga0501031_0143633 3300049568 Bacteria 1559
618 Ga0501031_0158256 3300049568 Bacteria 1481
619 Ga0501032_0018412 3300049569 Bacteria 4894
620 Ga0501032_0019351 3300049569 Bacteria 4763
621 Ga0501033_0003769 3300049570 Bacteria 12316
622 Ga0501033_0017798 3300049570 Bacteria 5366
623 Ga0501033_0024093 3300049570 Bacteria 4593
624 Ga0501033_0087165 3300049570 Bacteria 2285
625 Ga0501034_0009157 3300049571 Bacteria 10386
626 Ga0501034_0027120 3300049571 Bacteria 5827
627 Ga0501034_0035747 3300049571 Bacteria 5036
628 Ga0501034_0049658 3300049571 Bacteria 4233
629 Ga0501034_0051191 3300049571 Bacteria 4164
630 Ga0501034_0053440 3300049571 Bacteria 4067
631 Ga0501034_0055346 3300049571 Bacteria 3992
632 Ga0501034_0094033 3300049571 Bacteria 2994
633 Ga0501034_0106081 3300049571 Bacteria 2802
634 Ga0501034_0162302 3300049571 Bacteria 2205
635 Ga0501034_0194599 3300049571 Bacteria 1988
636 Ga0501034_0262567 3300049571 Bacteria 1669
637 Ga0501036_0021649 3300049572 Bacteria 5405
638 Ga0501036_0040760 3300049572 Bacteria 3929
639 Ga0501036_0073083 3300049572 Bacteria 2900
640 Ga0501036_0089301 3300049572 Bacteria 2604
641 Ga0501037_0007341 3300049573 Bacteria 8060
642 Ga0501037_0049740 3300049573 Bacteria 3069
643 Ga0501038_0006334 3300049574 Bacteria 10950
644 Ga0501038_0018372 3300049574 Bacteria 6312
645 Ga0501038_0047708 3300049574 Bacteria 3709
646 Ga0501038_0073514 3300049574 Bacteria 2895
647 Ga0501038_0172259 3300049574 Bacteria 1751
648 Ga0501039_0136324 3300049575 Bacteria 1927
649 Ga0501046_0022934 3300049580 Bacteria 5140
650 Ga0501046_0070745 3300049580 Bacteria 2712
651 Ga0501047_0031860 3300049581 Bacteria 5087
652 Ga0501047_0032607 3300049581 Bacteria 5029
653 Ga0501047_0215888 3300049581 Bacteria 1775
654 Ga0501067_0269767 3300049583 Bacteria 948
655 Ga0501070_0019852 3300049586 Bacteria 5635
656 Ga0501070_0030405 3300049586 Bacteria 4525
657 Ga0501073_0117499 3300049589 Bacteria 1843
658 Ga0501073_0190278 3300049589 Bacteria 1420
659 Ga0501217_011460 3300049661 Bacteria 1962
660 Ga0501217_050909 3300049661 Bacteria 1082
661 Ga0501233_016079 3300049668 Bacteria 1548
662 Ga0501242_016380 3300049674 Bacteria 929
663 Ga0501243_005207 3300049675 Bacteria 1956
664 Ga0501245_004493 3300049708 Bacteria 1916
665 Ga0501080_0072761 3300049742 Bacteria 3198
666 Ga0501080_0370275 3300049742 Bacteria 1292
667 Ga0501270_003511 3300049767 Bacteria 1698
668 Ga0501035_0020784 3300049822 Bacteria 6032
669 Ga0501035_0020842 3300049822 Bacteria 6023
670 Ga0501035_0174302 3300049822 Bacteria 1856
671 Ga0501035_0400769 3300049822 Bacteria 1141
672 Ga0501044_0063429 3300049823 Bacteria 3775
673 Ga0501044_0089190 3300049823 Bacteria 3113
674 Ga0501044_0272994 3300049823 Bacteria 1626
675 Ga0501044_0288956 3300049823 Bacteria 1571
676 nmdc:mga03683_170205_c1 3300050489 Bacteria 989
677 nmdc:mga03n38_181885_c1 3300050490 Bacteria 1078
678 nmdc:mga03n38_5252_c1 3300050490 Bacteria 4390
679 nmdc:mga00v17_19_c1 3300050491 Bacteria 115002
680 nmdc:mga00v17_27140_c1 3300050491 Bacteria 3341
681 nmdc:mga00v17_45003_c1 3300050491 Bacteria 2664
682 nmdc:mga00v17_90406_c1 3300050491 Bacteria 1922
683 nmdc:mga0yw44_1027_c1 3300050492 Bacteria 10708
684 nmdc:mga0yw44_2126_c1 3300050492 Bacteria 8307
685 nmdc:mga0yw44_26417_c1 3300050492 Bacteria 3316
686 nmdc:mga0yw44_337590_c1 3300050492 Bacteria 1013
687 nmdc:mga0yw44_5426_c1 3300050492 Bacteria 6023
688 nmdc:mga0yw44_57140_c1 3300050492 Bacteria 2380
689 nmdc:mga0yw44_972_c1 3300050492 Bacteria 10912
690 nmdc:mga0k408_45584_c1 3300050493 Bacteria 2530
691 nmdc:mga0k408_52776_c1 3300050493 Bacteria 2356
692 nmdc:mga0k408_58554_c1 3300050493 Bacteria 2238
693 nmdc:mga06z11_2365_c1 3300050494 Bacteria 7181
694 nmdc:mga06z11_261837_c1 3300050494 Bacteria 1021
695 nmdc:mga06z11_2714_c1 3300050494 Bacteria 6779
696 nmdc:mga06z11_2817_c1 3300050494 Bacteria 6671
697 nmdc:mga04h51_2124_c1 3300050495 Bacteria 4646
698 nmdc:mga04h51_21632_c1 3300050495 Bacteria 1641
699 nmdc:mga04h51_4204_c1 3300050495 Bacteria 3561
700 nmdc:mga07m45_10042_c1 3300050496 Bacteria 4929
701 nmdc:mga07m45_105104_c1 3300050496 Bacteria 1624
702 nmdc:mga07m45_48111_c1 3300050496 Bacteria 2398
703 nmdc:mga07m45_51046_c1 3300050496 Bacteria 2332
704 nmdc:mga07m45_5763_c1 3300050496 Bacteria 5215
705 nmdc:mga07m45_81937_c1 3300050496 Bacteria 1843
706 nmdc:mga08y16_358915_c1 3300050511 Bacteria 1496
707 nmdc:mga08y16_388677_c1 3300050511 Bacteria 1429
708 nmdc:mga08x19_52150_c1 3300050514 Bacteria 2630
709 nmdc:mga0sz30_14395_c1 3300050516 Bacteria 3112
710 nmdc:mga0sz30_1633_c1 3300050516 Bacteria 7984
711 nmdc:mga0sz30_19320_c1 3300050516 Bacteria 2738
712 nmdc:mga0sz30_48680_c1 3300050516 Bacteria 1794
713 Ga0500651_0012275 3300053093 Bacteria 5193
714 Ga0500560_000204 3300053107 Bacteria 7053
715 Ga0500560_035782 3300053107 Bacteria 1530
716 Ga0500572_001954 3300053111 Bacteria 5169
717 Ga0500572_011801 3300053111 Bacteria 2124
718 Ga0500595_000538 3300053119 Bacteria 22785
719 Ga0500618_001007 3300053125 Bacteria 14209
720 Ga0500642_0028242 3300053130 Bacteria 2312
721 Ga0500658_0000083 3300053134 Bacteria 43599
722 Ga0500659_0046074 3300053135 Bacteria 2360
723 Ga0500559_0000052 3300053136 Bacteria 91218
724 Ga0500561_0000036 3300053137 Bacteria 27979
725 Ga0500568_0004136 3300053139 Bacteria 7850
726 Ga0500568_0030232 3300053139 Bacteria 2244
727 Ga0500573_0054464 3300053140 Bacteria 2296
728 Ga0500616_0000027 3300053153 Bacteria 441053
729 Ga0500622_0000308 3300053156 Bacteria 50027
730 Ga0500622_0061320 3300053156 Bacteria 1917
731 Ga0500624_001367 3300053157 Bacteria 4088
732 Ga0500624_004302 3300053157 Bacteria 1871
733 Ga0500634_0000016 3300053161 Bacteria 112185
734 Ga0500634_0000032 3300053161 Bacteria 74391
735 Ga0500634_0000373 3300053161 Bacteria 14283
736 Ga0500636_0000011 3300053177 Bacteria 140769
737 Ga0500636_0000283 3300053177 Bacteria 28087
738 Ga0500645_003845 3300053730 Bacteria 5949
739 Ga0500645_009307 3300053730 Bacteria 3305
740 Ga0500609_004423 3300053731 Bacteria 1943
741 Ga0587088_016049 3300059508 Bacteria 1188
742 Ga0587067_000714 3300059640 Bacteria 3159
743 Ga0587079_006606 3300059647 Bacteria 1698
744 Ga0587107_001655 3300059652 Bacteria 1860

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300045976 Ga0466967_0952200 Ga0466967_0952200_16_786 251
2 3300009036 Ga0105244_10097039 Ga0105244_100970392 264
3 3300049674 Ga0501242_016380 Ga0501242_016380_28_852 272
4 3300049580 Ga0501046_0070745 Ga0501046_0070745_412_1347 274
5 3300049581 Ga0501047_0215888 Ga0501047_0215888_118_1053 274
6 3300049823 Ga0501044_0063429 Ga0501044_0063429_1159_2094 274
7 iso_pu_bacteria 2840764183 2840768351 275
8 3300005937 Ga0081455_10243547 Ga0081455_102435472 278
9 iso_pu_bacteria 2889790730 2889795100 278
10 3300049583 Ga0501067_0269767 Ga0501067_0269767_21_872 280
11 3300005539 Ga0068853_100059131 Ga0068853_1000591312 281
12 3300005563 Ga0068855_100073222 Ga0068855_1000732222 281
13 3300025904 Ga0207647_10021122 Ga0207647_100211225 281
14 3300037312 Ga0395899_0006280 Ga0395899_0006280_3953_4858 281
15 3300037418 Ga0395900_0003467 Ga0395900_0003467_2518_3423 281
16 3300037466 Ga0395898_0358951 Ga0395898_0358951_369_1274 281
17 3300038443 Ga0395901_0121877 Ga0395901_0121877_564_1469 281
18 3300002987 JGI25159J45721_1014554 JGI25159J45721_10145542 282
19 3300003316 rootH1_10059358 rootH1_100593582 282
20 3300003354 JGI25160J50197_1011926 JGI25160J50197_10119262 282
21 3300036401 Ga0373937_0619954 Ga0373937_0619954_160_1008 282
22 3300046512 Ga0495610_0004867 Ga0495610_0004867_8627_9475 282
23 3300037853 Ga0436364_0049675 Ga0436364_0049675_5176_6039 283
24 3300046492 Ga0495585_0006815 Ga0495585_0006815_3181_4152 283
25 3300047317 Ga0495604_0012273 Ga0495604_0012273_2685_3656 283
26 3300009094 Ga0111539_10180832 Ga0111539_101808322 284
27 3300046477 Ga0495664_0100690 Ga0495664_0100690_870_1724 284
28 3300050511 nmdc:mga08y16_358915_c1 nmdc:mga08y16_358915_c1_275_1189 284
29 3300003781 Ga0055536_1017062 Ga0055536_10170622 285
30 3300025292 Ga0209676_1000256 Ga0209676_100025618 285
31 3300025298 Ga0209050_1023572 Ga0209050_10235722 285
32 iso_pu_bacteria 2857733635 2857735609 285
33 3300028653 Ga0265323_10020328 Ga0265323_100203282 286
34 3300028654 Ga0265322_10001864 Ga0265322_100018647 286
35 3300031235 Ga0265330_10022425 Ga0265330_100224252 286
36 3300031344 Ga0265316_10060596 Ga0265316_100605963 286
37 3300031712 Ga0265342_10003529 Ga0265342_100035293 286
38 3300048924 Ga0496121_0147816 Ga0496121_0147816_705_1637 287
39 3300053139 Ga0500568_0030232 Ga0500568_0030232_604_1506 287
40 3300003775 Ga0055524_1000517 Ga0055524_10005172 288
41 3300013249 Ga0171463_1002 Ga0171463_1002383 288
42 3300015690 Ga0183363_1046 Ga0183363_104612 288
43 3300025299 Ga0209256_1000260 Ga0209256_100026031 288
44 3300049742 Ga0501080_0370275 Ga0501080_0370275_305_1225 288
45 iso_pu_bacteria 2513237094 2513641466 288
46 iso_pu_bacteria 2593339198 2595316128 288
47 3300031239 Ga0265328_10036213 Ga0265328_100362132 289
48 3300031240 Ga0265320_10070181 Ga0265320_100701811 289
49 3300048924 Ga0496121_0187494 Ga0496121_0187494_566_1438 290
50 iso_pu_bacteria 2585428059 2587737654 290
51 iso_pu_bacteria 2643221676 2644423258 290
52 iso_pu_bacteria 2791355222 2793185479 290
53 iso_pu_bacteria 2818991459 2819670665 290
54 iso_pu_bacteria 2864997549 2865000619 290
55 iso_pu_bacteria 2904113452 2904115525 290
56 iso_pu_bacteria 2904755435 2904759953 290
57 iso_pu_bacteria 2919425241 2919429232 290
58 iso_pu_bacteria 2980125574 2980126155 290
59 iso_pu_bacteria 3006969106 3006971405 290
60 iso_pu_bacteria 8005658619 8005661175 290
61 3300005539 Ga0068853_100131600 Ga0068853_1001316002 291
62 3300007788 Ga0099795_10045681 Ga0099795_100456811 291
63 3300026041 Ga0207639_10383083 Ga0207639_103830832 291
64 3300049571 Ga0501034_0055346 Ga0501034_0055346_1549_2424 291
65 iso_pu_bacteria 2511231027 2511391066 291
66 iso_pu_bacteria 2513237351 2514587952 291
67 iso_pu_bacteria 2857453340 2857454712 291
68 iso_pu_bacteria 2971410472 2971413126 291
69 iso_pu_bacteria 2980182181 2980185150 291
70 iso_pu_bacteria 8056533031 8056538254 291
71 3300005985 Ga0081539_10002139 Ga0081539_100021399 292
72 3300037312 Ga0395899_0033153 Ga0395899_0033153_2771_3667 292
73 3300037312 Ga0395899_0071224 Ga0395899_0071224_891_1787 292
74 3300041999 Ga0439433_0003847 Ga0439433_0003847_1133_2032 292
75 3300042007 Ga0439449_0000030 Ga0439449_0000030_26536_27435 292
76 3300042015 Ga0439462_0000211 Ga0439462_0000211_2635_3534 292
77 3300044656 Ga0466969_0015324 Ga0466969_0015324_63_962 292
78 iso_pu_bacteria 2515154155 2515857267 292
79 iso_pu_bacteria 2593339198 2595318716 292
80 iso_pu_bacteria 2857453340 2857458960 292
81 iso_pu_bacteria 2971410472 2971414273 292
82 iso_pu_bacteria 2984527788 2984532597 292
83 iso_pu_bacteria 2984532647 2984533854 292
84 iso_pu_bacteria 8056533031 8056535505 292
85 3300003751 Ga0055538_1000546 Ga0055538_10005462 293
86 3300025224 Ga0209784_100078 Ga0209784_10007823 293
87 3300048919 Ga0496116_0008774 Ga0496116_0008774_533_1432 293
88 3300048928 Ga0496125_0049918 Ga0496125_0049918_1653_2570 293
89 iso_pu_bacteria 2585428059 2587745177 293
90 iso_pu_bacteria 2864733723 2864737734 293
91 iso_pu_bacteria 3006988479 3006991278 293
92 3300048919 Ga0496116_0015457 Ga0496116_0015457_4669_5571 294
93 3300048925 Ga0496122_0000006 Ga0496122_0000006_607847_608752 294
94 3300048925 Ga0496122_0005964 Ga0496122_0005964_5522_6424 294
95 3300048926 Ga0496123_0007011 Ga0496123_0007011_7836_8738 294
96 3300048926 Ga0496123_0016819 Ga0496123_0016819_4921_5826 294
97 3300048927 Ga0496124_0013952 Ga0496124_0013952_3561_4463 294
98 3300048928 Ga0496125_0012248 Ga0496125_0012248_3710_4612 294
99 3300048929 Ga0496126_0000016 Ga0496126_0000016_607847_608752 294
100 iso_pu_bacteria 2512564039 2512731944 294
101 iso_pu_bacteria 2585428059 2587742403 294
102 iso_pu_bacteria 2593339198 2595318937 294
103 iso_pu_bacteria 2643221676 2644427208 294
104 iso_pu_bacteria 2818991459 2819673572 294
105 iso_pu_bacteria 2904755435 2904757091 294
106 3300025304 Ga0209257_1004297 Ga0209257_10042977 295
107 3300044765 Ga0466970_0174421 Ga0466970_0174421_190_1077 295
108 3300048925 Ga0496122_0130891 Ga0496122_0130891_654_1541 295
109 3300048925 Ga0496122_0154459 Ga0496122_0154459_54_941 295
110 3300048929 Ga0496126_0189926 Ga0496126_0189926_797_1684 295
111 3300049570 Ga0501033_0003769 Ga0501033_0003769_8401_9399 295
112 3300049571 Ga0501034_0094033 Ga0501034_0094033_334_1332 295
113 3300049572 Ga0501036_0073083 Ga0501036_0073083_1689_2687 295
114 3300053139 Ga0500568_0004136 Ga0500568_0004136_2340_3290 295
115 3300053161 Ga0500634_0000016 Ga0500634_0000016_67257_68156 295
116 3300053731 Ga0500609_004423 Ga0500609_004423_521_1471 295
117 iso_pu_bacteria 2519899620 2520378319 295
118 iso_pu_bacteria 2838022645 2838028209 295
119 iso_pu_bacteria 2838686498 2838689957 295
120 iso_pu_bacteria 2842198810 2842204363 295
121 iso_pu_bacteria 2842205361 2842208780 295
122 iso_pu_bacteria 2842243621 2842245737 295
123 iso_pu_bacteria 2842257432 2842260115 295
124 iso_pu_bacteria 2842271015 2842273559 295
125 iso_pu_bacteria 2842278818 2842282530 295
126 iso_pu_bacteria 2844533157 2844537565 295
127 3300002987 JGI25159J45721_1005637 JGI25159J45721_10056373 296
128 3300003187 JGI25151J46595_10000387 JGI25151J46595_1000038711 296
129 3300003203 JGI25406J46586_10024954 JGI25406J46586_100249542 296
130 3300003354 JGI25160J50197_1004618 JGI25160J50197_10046184 296
131 3300005985 Ga0081539_10012392 Ga0081539_100123927 296
132 3300025284 Ga0209130_1000252 Ga0209130_10002528 296
133 3300025294 Ga0209025_1000908 Ga0209025_100090831 296
134 3300025297 Ga0209758_1002227 Ga0209758_10022274 296
135 3300025302 Ga0207426_1000098 Ga0207426_1000098173 296
136 3300046512 Ga0495610_0050685 Ga0495610_0050685_461_1381 296
137 3300048927 Ga0496124_0134733 Ga0496124_0134733_707_1621 296
138 3300045836 Ga0466958_0199331 Ga0466958_0199331_123_1112 297
139 iso_pu_bacteria 2643221629 2644168390 297
140 iso_pu_bacteria 2643221662 2644349924 297
141 iso_pu_bacteria 2842871566 2842874210 297
142 3300003214 JGI25165J46597_1004993 JGI25165J46597_10049932 298
143 3300025231 Ga0207427_103104 Ga0207427_1031042 298
144 3300025261 Ga0209233_1000290 Ga0209233_100029040 298
145 3300031911 Ga0307412_10015156 Ga0307412_100151564 298
146 3300032002 Ga0307416_100096972 Ga0307416_1000969723 298
147 3300032004 Ga0307414_10430791 Ga0307414_104307912 298
148 3300033179 Ga0307507_10000031 Ga0307507_1000003199 298
149 3300037068 Ga0373925_0242447 Ga0373925_0242447_277_1311 298
150 3300049581 Ga0501047_0031860 Ga0501047_0031860_1200_2159 298
151 3300006186 Ga0075369_10062541 Ga0075369_100625412 299
152 3300041459 Ga0451800_0474694 Ga0451800_0474694_25_924 299
153 iso_pu_bacteria 2841760612 2841765113 299
154 iso_pu_bacteria 2844104063 2844106723 299
155 iso_pu_bacteria 2851182111 2851187719 299
156 iso_pu_bacteria 2851246043 2851248763 299
157 3300025933 Ga0207706_10213667 Ga0207706_102136672 300
158 iso_pu_bacteria 8054795415 8054802513 300
159 3300021388 Ga0213875_10123936 Ga0213875_101239362 301
160 3300025294 Ga0209025_1006010 Ga0209025_10060106 301
161 3300048923 Ga0496120_0004721 Ga0496120_0004721_1917_2849 301
162 3300049571 Ga0501034_0009157 Ga0501034_0009157_310_1242 301
163 iso_pu_bacteria 8054795415 8054803513 301
164 3300003203 JGI25406J46586_10029934 JGI25406J46586_100299342 302
165 3300005985 Ga0081539_10001783 Ga0081539_1000178310 302
166 3300025297 Ga0209758_1029811 Ga0209758_10298112 302
167 3300039438 Ga0436360_1222189 Ga0436360_1222189_379_1314 302
168 3300046453 Ga0495627_048861 Ga0495627_048861_99_1085 302
169 iso_pu_bacteria 2838016132 2838020792 302
170 iso_pu_bacteria 2838042994 2838044972 302
171 iso_pu_bacteria 2838048938 2838053065 302
172 iso_pu_bacteria 2838068647 2838070369 302
173 iso_pu_bacteria 2838668709 2838672658 302
174 iso_pu_bacteria 2838680041 2838685464 302
175 iso_pu_bacteria 2838694306 2838696080 302
176 iso_pu_bacteria 2838701080 2838705019 302
177 iso_pu_bacteria 2838707686 2838713479 302
178 iso_pu_bacteria 2841851746 2841852828 302
179 iso_pu_bacteria 2841864319 2841870344 302
180 iso_pu_bacteria 2842077413 2842082713 302
181 iso_pu_bacteria 2842118031 2842123728 302
182 iso_pu_bacteria 2842146304 2842150013 302
183 iso_pu_bacteria 2842156927 2842160155 302
184 iso_pu_bacteria 2842163707 2842165866 302
185 iso_pu_bacteria 2842180545 2842184179 302
186 iso_pu_bacteria 2842192696 2842196491 302
187 iso_pu_bacteria 2842229732 2842231761 302
188 iso_pu_bacteria 2842237096 2842242783 302
189 iso_pu_bacteria 2842250916 2842254700 302
190 iso_pu_bacteria 2842285085 2842289924 302
191 iso_pu_bacteria 2842291075 2842296856 302
192 iso_pu_bacteria 2842304105 2842308589 302
193 iso_pu_bacteria 2842311132 2842312101 302
194 iso_pu_bacteria 2842317721 2842321659 302
195 iso_pu_bacteria 2842341865 2842348228 302
196 iso_pu_bacteria 2842370503 2842376151 302
197 iso_pu_bacteria 2842377471 2842383360 302
198 iso_pu_bacteria 2842384541 2842390493 302
199 iso_pu_bacteria 2842395702 2842397994 302
200 iso_pu_bacteria 2842402390 2842407533 302
201 iso_pu_bacteria 2842409023 2842414164 302
202 iso_pu_bacteria 2842415677 2842420976 302
203 iso_pu_bacteria 2842422224 2842423983 302
204 iso_pu_bacteria 2842489311 2842493982 302
205 iso_pu_bacteria 2844454524 2844456705 302
206 iso_pu_bacteria 2857516855 2857521006 302
207 iso_pu_bacteria 2919100787 2919101984 302
208 iso_pu_bacteria 2926754445 2926760221 302
209 3300009093 Ga0105240_10018416 Ga0105240_100184167 303
210 3300009545 Ga0105237_10451609 Ga0105237_104516092 303
211 3300031548 Ga0307408_100039293 Ga0307408_1000392933 303
212 3300031911 Ga0307412_10057088 Ga0307412_100570883 303
213 3300032004 Ga0307414_10011787 Ga0307414_100117875 303
214 3300053730 Ga0500645_009307 Ga0500645_009307_2061_3041 303
215 iso_pu_bacteria 2582581283 2585167301 303
216 iso_pu_bacteria 2585428059 2587743767 303
217 iso_pu_bacteria 2643221618 2644105947 303
218 iso_pu_bacteria 2643221626 2644147088 303
219 iso_pu_bacteria 2643221655 2644310559 303
220 iso_pu_bacteria 2643221659 2644334656 303
221 iso_pu_bacteria 2643221698 2644545149 303
222 iso_pu_bacteria 2643221712 2644612661 303
223 iso_pu_bacteria 2844163670 2844165647 303
224 3300006038 Ga0075365_10032251 Ga0075365_100322512 304
225 3300006042 Ga0075368_10051207 Ga0075368_100512072 304
226 3300027866 Ga0209813_10027957 Ga0209813_100279572 304
227 3300028800 Ga0265338_10128710 Ga0265338_101287102 304
228 3300031240 Ga0265320_10077447 Ga0265320_100774472 304
229 3300049569 Ga0501032_0018412 Ga0501032_0018412_354_1331 304
230 3300049571 Ga0501034_0262567 Ga0501034_0262567_510_1487 304
231 3300049574 Ga0501038_0006334 Ga0501038_0006334_2911_3888 304
232 3300050492 nmdc:mga0yw44_26417_c1 nmdc:mga0yw44_26417_c1_942_1916 304
233 3300050495 nmdc:mga04h51_21632_c1 nmdc:mga04h51_21632_c1_486_1460 304
234 iso_pu_bacteria 2548877040 2550904936 304
235 iso_pu_bacteria 2571042143 2571530388 304
236 iso_pu_bacteria 2728368933 2728532564 304
237 iso_pu_bacteria 2841911363 2841914355 304
238 iso_pu_bacteria 2841917233 2841919807 304
239 iso_pu_bacteria 2920822456 2920827531 304
240 iso_pu_bacteria 2937822353 2937827153 304
241 iso_pu_bacteria 2938649242 2938649751 304
242 iso_pu_bacteria 2968558590 2968563975 304
243 iso_pu_bacteria 2988225383 2988229315 304
244 iso_pu_bacteria 2996632988 2996639090 304
245 iso_pu_bacteria 8054465665 8054467993 304
246 3300028380 Ga0268265_10163308 Ga0268265_101633082 305
247 3300028794 Ga0307515_10004240 Ga0307515_100042404 305
248 3300031616 Ga0307508_10017913 Ga0307508_100179133 305
249 3300031649 Ga0307514_10023355 Ga0307514_100233553 305
250 3300033179 Ga0307507_10027619 Ga0307507_100276195 305
251 3300049823 Ga0501044_0089190 Ga0501044_0089190_908_1825 305
252 3300053125 Ga0500618_001007 Ga0500618_001007_527_1477 305
253 iso_pu_bacteria 2585428157 2588107829 305
254 iso_pu_bacteria 2857453340 2857453512 305
255 iso_pu_bacteria 2971410472 2971415403 305
256 iso_pu_bacteria 8054795415 8054800560 305
257 3300044656 Ga0466969_0009201 Ga0466969_0009201_2278_3240 306
258 3300046472 Ga0495580_0003246 Ga0495580_0003246_6445_7383 306
259 3300049571 Ga0501034_0162302 Ga0501034_0162302_1048_1995 306
260 iso_pu_bacteria 2821443989 2821445655 306
261 iso_pu_bacteria 2844533157 2844533832 306
262 iso_pu_bacteria 2909042592 2909045130 306
263 iso_pu_bacteria 2919425241 2919426441 306
264 iso_pu_bacteria 3006321560 3006328362 306
265 3300005262 Ga0065165_1001369 Ga0065165_100136926 307
266 3300006038 Ga0075365_10002567 Ga0075365_100025674 307
267 3300025937 Ga0207669_10062514 Ga0207669_100625142 307
268 iso_pu_bacteria 2508501050 2508727107 307
269 iso_pu_bacteria 2508501114 2509074856 307
270 iso_pu_bacteria 2643221736 2644744367 307
271 iso_pu_bacteria 2775506901 2776262738 307
272 iso_pu_bacteria 2835312727 2835318610 307
273 iso_pu_bacteria 2888578766 2888580062 307
274 iso_pu_bacteria 2889049205 2889051336 307
275 iso_pu_bacteria 2889914905 2889914915 307
276 iso_pu_bacteria 2894232714 2894241244 307
277 iso_pu_bacteria 2904113452 2904115423 307
278 3300003781 Ga0055536_1009179 Ga0055536_10091793 308
279 3300009147 Ga0114129_10790522 Ga0114129_107905222 308
280 3300013105 Ga0157369_10064646 Ga0157369_100646462 308
281 3300025292 Ga0209676_1000097 Ga0209676_1000097235 308
282 3300027907 Ga0207428_10132694 Ga0207428_101326942 308
283 3300031911 Ga0307412_10115653 Ga0307412_101156531 308
284 3300037312 Ga0395899_0048208 Ga0395899_0048208_1428_2381 308
285 3300037418 Ga0395900_0021722 Ga0395900_0021722_5408_6361 308
286 3300038443 Ga0395901_0101100 Ga0395901_0101100_1023_1976 308
287 3300042436 Ga0439435_0008601 Ga0439435_0008601_428_1360 308
288 3300048922 Ga0496119_0185140 Ga0496119_0185140_103_1056 308
289 iso_pu_bacteria 2643221557 2643809550 308
290 iso_pu_bacteria 2643221668 2644375890 308
291 3300005347 Ga0070668_100023500 Ga0070668_1000235004 309
292 3300005844 Ga0068862_100040706 Ga0068862_1000407063 309
293 3300006038 Ga0075365_10026065 Ga0075365_100260653 309
294 3300006042 Ga0075368_10015660 Ga0075368_100156602 309
295 3300006048 Ga0075363_100003108 Ga0075363_1000031083 309
296 3300006048 Ga0075363_100018367 Ga0075363_1000183672 309
297 3300006051 Ga0075364_10019248 Ga0075364_100192484 309
298 3300006178 Ga0075367_10002193 Ga0075367_100021932 309
299 3300006178 Ga0075367_10101282 Ga0075367_101012822 309
300 3300006195 Ga0075366_10060071 Ga0075366_100600712 309
301 3300006353 Ga0075370_10012225 Ga0075370_100122252 309
302 3300009553 Ga0105249_10180725 Ga0105249_101807252 309
303 3300027866 Ga0209813_10001001 Ga0209813_100010013 309
304 3300028380 Ga0268265_10122312 Ga0268265_101223122 309
305 3300038443 Ga0395901_0043533 Ga0395901_0043533_1061_2014 309
306 3300039438 Ga0436360_0070791 Ga0436360_0070791_71_1006 309
307 3300048919 Ga0496116_0019715 Ga0496116_0019715_494_1423 309
308 3300048920 Ga0496117_0000036 Ga0496117_0000036_237796_238725 309
309 3300048921 Ga0496118_0019730 Ga0496118_0019730_515_1444 309
310 3300048928 Ga0496125_0000157 Ga0496125_0000157_16215_17222 309
311 3300050489 nmdc:mga03683_170205_c1 nmdc:mga03683_170205_c1_12_947 309
312 3300050492 nmdc:mga0yw44_337590_c1 nmdc:mga0yw44_337590_c1_44_979 309
313 3300050492 nmdc:mga0yw44_57140_c1 nmdc:mga0yw44_57140_c1_1372_2319 309
314 3300050492 nmdc:mga0yw44_972_c1 nmdc:mga0yw44_972_c1_5003_5995 309
315 3300050493 nmdc:mga0k408_52776_c1 nmdc:mga0k408_52776_c1_1175_2110 309
316 3300050493 nmdc:mga0k408_58554_c1 nmdc:mga0k408_58554_c1_1207_2136 309
317 3300050494 nmdc:mga06z11_2365_c1 nmdc:mga06z11_2365_c1_4891_5838 309
318 3300050495 nmdc:mga04h51_2124_c1 nmdc:mga04h51_2124_c1_2969_3916 309
319 3300050496 nmdc:mga07m45_48111_c1 nmdc:mga07m45_48111_c1_253_1188 309
320 iso_pu_bacteria 2643221543 2643738247 309
321 3300003187 JGI25151J46595_10000714 JGI25151J46595_100007141 310
322 3300003911 JGI25405J52794_10002814 JGI25405J52794_100028143 310
323 3300005937 Ga0081455_10000482 Ga0081455_1000048220 310
324 3300005983 Ga0081540_1040509 Ga0081540_10405092 310
325 3300025284 Ga0209130_1000830 Ga0209130_10008305 310
326 3300025294 Ga0209025_1001024 Ga0209025_100102427 310
327 3300025297 Ga0209758_1001464 Ga0209758_100146427 310
328 3300025302 Ga0207426_1000287 Ga0207426_100028790 310
329 3300042438 Ga0439459_0012984 Ga0439459_0012984_392_1324 310
330 3300046454 Ga0495592_0015000 Ga0495592_0015000_1417_2421 310
331 3300046691 Ga0495670_0102610 Ga0495670_0102610_356_1312 310
332 3300048924 Ga0496121_0000759 Ga0496121_0000759_27864_28802 310
333 3300048925 Ga0496122_0016734 Ga0496122_0016734_5438_6370 310
334 3300053153 Ga0500616_0000027 Ga0500616_0000027_369804_370760 310
335 3300053730 Ga0500645_003845 Ga0500645_003845_3821_4777 310
336 iso_pu_bacteria 2643221591 2643965927 310
337 iso_pu_bacteria 2775506901 2776262897 310
338 iso_pu_bacteria 2816332139 2816503938 310
339 iso_pu_bacteria 2844315083 2844320828 310
340 iso_pu_bacteria 2891048133 2891048938 310
341 iso_pu_bacteria 2894232714 2894236170 310
342 iso_pu_bacteria 2903727486 2903728102 310
343 iso_pu_bacteria 2906602504 2906608111 310
344 iso_pu_bacteria 3005445848 3005450606 310
345 iso_pu_bacteria 8005301065 8005301678 310
346 iso_pu_bacteria 8018127388 8018128485 310
347 iso_pu_bacteria 8056967851 8056969205 310
348 3300005331 Ga0070670_100134421 Ga0070670_1001344212 311
349 3300005347 Ga0070668_100046535 Ga0070668_1000465353 311
350 3300005353 Ga0070669_100036316 Ga0070669_1000363162 311
351 3300005367 Ga0070667_100052255 Ga0070667_1000522554 311
352 3300005456 Ga0070678_100388583 Ga0070678_1003885832 311
353 3300005577 Ga0068857_100074796 Ga0068857_1000747963 311
354 3300005841 Ga0068863_100171095 Ga0068863_1001710952 311
355 3300005842 Ga0068858_100113296 Ga0068858_1001132962 311
356 3300005844 Ga0068862_100035487 Ga0068862_1000354873 311
357 3300006048 Ga0075363_100020501 Ga0075363_1000205013 311
358 3300006177 Ga0075362_10024045 Ga0075362_100240452 311
359 3300006178 Ga0075367_10081821 Ga0075367_100818212 311
360 3300006195 Ga0075366_10021217 Ga0075366_100212172 311
361 3300006353 Ga0075370_10034470 Ga0075370_100344703 311
362 3300006844 Ga0075428_100070600 Ga0075428_1000706003 311
363 3300006881 Ga0068865_100324855 Ga0068865_1003248551 311
364 3300009093 Ga0105240_10139857 Ga0105240_101398573 311
365 3300009094 Ga0111539_10417531 Ga0111539_104175311 311
366 3300009101 Ga0105247_10009605 Ga0105247_100096053 311
367 3300009148 Ga0105243_10028578 Ga0105243_100285783 311
368 3300009174 Ga0105241_10049194 Ga0105241_100491942 311
369 3300009177 Ga0105248_10081859 Ga0105248_100818592 311
370 3300009545 Ga0105237_10016814 Ga0105237_100168143 311
371 3300009553 Ga0105249_10082542 Ga0105249_100825423 311
372 3300010375 Ga0105239_10123270 Ga0105239_101232703 311
373 3300011119 Ga0105246_10080022 Ga0105246_100800222 311
374 3300013306 Ga0163162_10068227 Ga0163162_100682272 311
375 3300013308 Ga0157375_10339005 Ga0157375_103390052 311
376 3300013308 Ga0157375_10410050 Ga0157375_104100502 311
377 3300014325 Ga0163163_10028230 Ga0163163_100282304 311
378 3300014326 Ga0157380_10017440 Ga0157380_100174404 311
379 3300017792 Ga0163161_10182099 Ga0163161_101820992 311
380 3300025900 Ga0207710_10046785 Ga0207710_100467852 311
381 3300025901 Ga0207688_10010706 Ga0207688_100107062 311
382 3300025901 Ga0207688_10045465 Ga0207688_100454652 311
383 3300025913 Ga0207695_10307984 Ga0207695_103079842 311
384 3300025937 Ga0207669_10389146 Ga0207669_103891461 311
385 3300025940 Ga0207691_10168156 Ga0207691_101681562 311
386 3300025972 Ga0207668_10035197 Ga0207668_100351973 311
387 3300025972 Ga0207668_10190996 Ga0207668_101909962 311
388 3300026035 Ga0207703_10048242 Ga0207703_100482422 311
389 3300026041 Ga0207639_10159493 Ga0207639_101594932 311
390 3300026075 Ga0207708_10124796 Ga0207708_101247962 311
391 3300026078 Ga0207702_10073450 Ga0207702_100734502 311
392 3300026116 Ga0207674_10052495 Ga0207674_100524952 311
393 3300028380 Ga0268265_10199821 Ga0268265_101998212 311
394 3300028381 Ga0268264_10125499 Ga0268264_101254993 311
395 3300031824 Ga0307413_10030735 Ga0307413_100307352 311
396 3300031852 Ga0307410_10147885 Ga0307410_101478852 311
397 3300031911 Ga0307412_10298340 Ga0307412_102983402 311
398 3300031995 Ga0307409_100051405 Ga0307409_1000514052 311
399 3300031995 Ga0307409_100064948 Ga0307409_1000649482 311
400 3300032005 Ga0307411_10037459 Ga0307411_100374592 311
401 3300032126 Ga0307415_100034769 Ga0307415_1000347692 311
402 3300046474 Ga0495605_0123267 Ga0495605_0123267_86_1021 311
403 3300046507 Ga0495606_0101858 Ga0495606_0101858_447_1382 311
404 3300046513 Ga0495616_0052731 Ga0495616_0052731_730_1665 311
405 3300046522 Ga0495643_0010669 Ga0495643_0010669_306_1241 311
406 3300046524 Ga0495648_0152277 Ga0495648_0152277_116_1051 311
407 3300046616 Ga0495668_0034453 Ga0495668_0034453_456_1391 311
408 3300047323 Ga0495683_0094314 Ga0495683_0094314_210_1145 311
409 3300047443 Ga0495687_011064 Ga0495687_011064_153_1088 311
410 3300048907 Ga0496104_0041056 Ga0496104_0041056_1824_2759 311
411 3300048909 Ga0496106_0000825 Ga0496106_0000825_5011_5952 311
412 3300048913 Ga0496110_0147742 Ga0496110_0147742_794_1729 311
413 3300048915 Ga0496112_0319663 Ga0496112_0319663_498_1433 311
414 3300048921 Ga0496118_0083178 Ga0496118_0083178_915_1850 311
415 3300049661 Ga0501217_011460 Ga0501217_011460_325_1284 311
416 3300049661 Ga0501217_050909 Ga0501217_050909_121_1062 311
417 3300049668 Ga0501233_016079 Ga0501233_016079_497_1456 311
418 3300049708 Ga0501245_004493 Ga0501245_004493_181_1140 311
419 3300049767 Ga0501270_003511 Ga0501270_003511_54_1013 311
420 3300050491 nmdc:mga00v17_45003_c1 nmdc:mga00v17_45003_c1_1672_2607 311
421 3300050494 nmdc:mga06z11_261837_c1 nmdc:mga06z11_261837_c1_21_956 311
422 3300050496 nmdc:mga07m45_51046_c1 nmdc:mga07m45_51046_c1_83_1018 311
423 3300050511 nmdc:mga08y16_388677_c1 nmdc:mga08y16_388677_c1_413_1369 311
424 3300050516 nmdc:mga0sz30_19320_c1 nmdc:mga0sz30_19320_c1_281_1216 311
425 3300053136 Ga0500559_0000052 Ga0500559_0000052_41897_42892 311
426 iso_pu_bacteria 2510065057 2510307138 311
427 iso_pu_bacteria 2511231052 2511498715 311
428 iso_pu_bacteria 2512875026 2512973320 311
429 iso_pu_bacteria 2513237086 2513587035 311
430 iso_pu_bacteria 2513237089 2513603675 311
431 iso_pu_bacteria 2513237091 2513619443 311
432 iso_pu_bacteria 2513237140 2513886041 311
433 iso_pu_bacteria 2513237143 2513904379 311
434 iso_pu_bacteria 2513237156 2513983383 311
435 iso_pu_bacteria 2513237160 2514005915 311
436 iso_pu_bacteria 2516653046 2516894992 311
437 iso_pu_bacteria 2517487022 2517571677 311
438 iso_pu_bacteria 2551306084 2551675563 311
439 iso_pu_bacteria 2551306085 2551685322 311
440 iso_pu_bacteria 2551306086 2551693959 311
441 iso_pu_bacteria 2551306087 2551698092 311
442 iso_pu_bacteria 2551306089 2551713110 311
443 iso_pu_bacteria 2551306090 2551716948 311
444 iso_pu_bacteria 2551306091 2551728263 311
445 iso_pu_bacteria 2551306091 2551728572 311
446 iso_pu_bacteria 2551306092 2551733166 311
447 iso_pu_bacteria 2551306093 2551744594 311
448 iso_pu_bacteria 2643221580 2643910909 311
449 iso_pu_bacteria 2643221629 2644167349 311
450 iso_pu_bacteria 2643221662 2644349865 311
451 iso_pu_bacteria 2643221674 2644412157 311
452 iso_pu_bacteria 2802428858 2802721249 311
453 iso_pu_bacteria 2802428859 2802724562 311
454 iso_pu_bacteria 2802428860 2802729771 311
455 iso_pu_bacteria 2802428861 2802737117 311
456 iso_pu_bacteria 2802428862 2802746870 311
457 iso_pu_bacteria 2802428863 2802751734 311
458 iso_pu_bacteria 2838061910 2838064856 311
459 iso_pu_bacteria 2838074704 2838075793 311
460 iso_pu_bacteria 2842110456 2842112871 311
461 iso_pu_bacteria 2842264693 2842266996 311
462 iso_pu_bacteria 2842363717 2842367631 311
463 iso_pu_bacteria 2842428310 2842431308 311
464 iso_pu_bacteria 2842434925 2842437643 311
465 iso_pu_bacteria 2842441272 2842444458 311
466 iso_pu_bacteria 2842447887 2842451118 311
467 iso_pu_bacteria 2842462802 2842465451 311
468 iso_pu_bacteria 2842469257 2842472080 311
469 iso_pu_bacteria 2842495871 2842502109 311
470 iso_pu_bacteria 2850079185 2850079283 311
471 iso_pu_bacteria 2855825444 2855827627 311
472 iso_pu_bacteria 2855839649 2855843003 311
473 iso_pu_bacteria 2858800743 2858801958 311
474 iso_pu_bacteria 2874123672 2874128763 311
475 iso_pu_bacteria 2896384573 2896388242 311
476 iso_pu_bacteria 2915980308 2915983214 311
477 iso_pu_bacteria 2915986958 2915991695 311
478 iso_pu_bacteria 2915993759 2915998941 311
479 iso_pu_bacteria 2916000859 2916002892 311
480 iso_pu_bacteria 2916007675 2916011230 311
481 iso_pu_bacteria 2916014648 2916018750 311
482 iso_pu_bacteria 2916021584 2916025410 311
483 iso_pu_bacteria 2916028427 2916032220 311
484 iso_pu_bacteria 2916035215 2916038117 311
485 iso_pu_bacteria 2916041962 2916042357 311
486 iso_pu_bacteria 2916048683 2916050082 311
487 iso_pu_bacteria 2916055098 2916059014 311
488 iso_pu_bacteria 2916061851 2916063525 311
489 iso_pu_bacteria 2916068649 2916075084 311
490 iso_pu_bacteria 2916076590 2916078507 311
491 iso_pu_bacteria 2920760137 2920764351 311
492 iso_pu_bacteria 2921201388 2921206389 311
493 iso_pu_bacteria 2921208531 2921211241 311
494 iso_pu_bacteria 2921237296 2921241211 311
495 iso_pu_bacteria 2921244191 2921249359 311
496 iso_pu_bacteria 2921250672 2921256210 311
497 iso_pu_bacteria 2921257292 2921258745 311
498 iso_pu_bacteria 2921263974 2921268224 311
499 iso_pu_bacteria 2921282425 2921285261 311
500 iso_pu_bacteria 2921289301 2921293421 311
501 iso_pu_bacteria 2921296804 2921297978 311
502 iso_pu_bacteria 2924144063 2924147843 311
503 iso_pu_bacteria 2924150972 2924151906 311
504 iso_pu_bacteria 2924158325 2924163296 311
505 iso_pu_bacteria 2924165586 2924171099 311
506 iso_pu_bacteria 2924172951 2924178488 311
507 iso_pu_bacteria 2924179722 2924185003 311
508 iso_pu_bacteria 2924186466 2924192108 311
509 iso_pu_bacteria 2924193448 2924196285 311
510 iso_pu_bacteria 2924200457 2924203999 311
511 iso_pu_bacteria 2924207177 2924210665 311
512 iso_pu_bacteria 2924221636 2924225547 311
513 iso_pu_bacteria 2924228884 2924232395 311
514 iso_pu_bacteria 2937002841 2937007133 311
515 iso_pu_bacteria 2937009748 2937013265 311
516 iso_pu_bacteria 2937016420 2937019955 311
517 iso_pu_bacteria 2937023124 2937025551 311
518 iso_pu_bacteria 2937029754 2937032507 311
519 iso_pu_bacteria 2937036028 2937039170 311
520 iso_pu_bacteria 2937049772 2937053159 311
521 iso_pu_bacteria 2937056579 2937061975 311
522 iso_pu_bacteria 2937063883 2937065709 311
523 iso_pu_bacteria 2937071275 2937075756 311
524 iso_pu_bacteria 2937078374 2937084041 311
525 iso_pu_bacteria 2937084907 2937087346 311
526 iso_pu_bacteria 2937091812 2937097657 311
527 iso_pu_bacteria 2937098957 2937100245 311
528 iso_pu_bacteria 2937113482 2937115946 311
529 iso_pu_bacteria 2937119839 2937123510 311
530 iso_pu_bacteria 2937126314 2937129167 311
531 iso_pu_bacteria 2957375807 2957378135 311
532 iso_pu_bacteria 2957382221 2957386329 311
533 iso_pu_bacteria 2957388812 2957392680 311
534 iso_pu_bacteria 2957395598 2957401629 311
535 iso_pu_bacteria 2957402308 2957404964 311
536 iso_pu_bacteria 2957408893 2957411935 311
537 iso_pu_bacteria 2957415311 2957417143 311
538 iso_pu_bacteria 2957422303 2957427989 311
539 iso_pu_bacteria 2957430029 2957433001 311
540 iso_pu_bacteria 2957437181 2957439246 311
541 iso_pu_bacteria 2957443900 2957446580 311
542 iso_pu_bacteria 2957450854 2957455827 311
543 iso_pu_bacteria 2957457609 2957461205 311
544 iso_pu_bacteria 2957464669 2957467689 311
545 iso_pu_bacteria 2957471148 2957471792 311
546 iso_pu_bacteria 2957478035 2957483181 311
547 iso_pu_bacteria 2957484790 2957486982 311
548 iso_pu_bacteria 2957491536 2957493852 311
549 iso_pu_bacteria 2957498199 2957502332 311
550 iso_pu_bacteria 2957505466 2957506287 311
551 iso_pu_bacteria 2960584000 2960587203 311
552 iso_pu_bacteria 2960591022 2960593050 311
553 iso_pu_bacteria 2960597568 2960601181 311
554 iso_pu_bacteria 2960603979 2960608170 311
555 iso_pu_bacteria 2960610863 2960612270 311
556 iso_pu_bacteria 2960617483 2960620261 311
557 iso_pu_bacteria 2960624210 2960626010 311
558 iso_pu_bacteria 2960631154 2960635491 311
559 iso_pu_bacteria 2960637947 2960643895 311
560 iso_pu_bacteria 2960645483 2960651956 311
561 iso_pu_bacteria 2960660292 2960663091 311
562 iso_pu_bacteria 2960667422 2960671322 311
563 iso_pu_bacteria 2960680706 2960683820 311
564 iso_pu_bacteria 2960687367 2960689235 311
565 iso_pu_bacteria 2960693952 2960697054 311
566 iso_pu_bacteria 2964607997 2964613681 311
567 iso_pu_bacteria 2964615318 2964616377 311
568 iso_pu_bacteria 2964621998 2964625347 311
569 iso_pu_bacteria 2964628898 2964632051 311
570 iso_pu_bacteria 2964636051 2964640464 311
571 iso_pu_bacteria 2964643177 2964647372 311
572 iso_pu_bacteria 2964649959 2964653746 311
573 iso_pu_bacteria 2964656573 2964662409 311
574 iso_pu_bacteria 2964663802 2964667432 311
575 iso_pu_bacteria 2964678106 2964684972 311
576 iso_pu_bacteria 2964685014 2964687823 311
577 iso_pu_bacteria 2964691889 2964695718 311
578 iso_pu_bacteria 2964698721 2964702354 311
579 iso_pu_bacteria 2964705432 2964708148 311
580 iso_pu_bacteria 2964712639 2964717428 311
581 iso_pu_bacteria 2964719344 2964722584 311
582 iso_pu_bacteria 2967664464 2967669726 311
583 iso_pu_bacteria 2967671571 2967675224 311
584 iso_pu_bacteria 2967678726 2967684291 311
585 iso_pu_bacteria 2967686174 2967688335 311
586 iso_pu_bacteria 2967693043 2967695754 311
587 iso_pu_bacteria 2967699805 2967700215 311
588 iso_pu_bacteria 2967706974 2967711266 311
589 iso_pu_bacteria 2967714385 2967719509 311
590 iso_pu_bacteria 2967721400 2967727578 311
591 iso_pu_bacteria 2967728569 2967733932 311
592 iso_pu_bacteria 2967735183 2967738585 311
593 iso_pu_bacteria 2967742019 2967747577 311
594 iso_pu_bacteria 2967748971 2967752886 311
595 iso_pu_bacteria 2967755722 2967756435 311
596 iso_pu_bacteria 2967762386 2967765333 311
597 iso_pu_bacteria 2967769361 2967773033 311
598 iso_pu_bacteria 2967775926 2967781437 311
599 iso_pu_bacteria 2970019648 2970025353 311
600 iso_pu_bacteria 2970026789 2970028826 311
601 iso_pu_bacteria 2970033650 2970038100 311
602 iso_pu_bacteria 2970040964 2970044377 311
603 iso_pu_bacteria 2970047711 2970054284 311
604 iso_pu_bacteria 2970054988 2970059133 311
605 iso_pu_bacteria 2970061556 2970067968 311
606 iso_pu_bacteria 2970068827 2970074328 311
607 iso_pu_bacteria 2970076120 2970080245 311
608 iso_pu_bacteria 2970082768 2970087640 311
609 iso_pu_bacteria 2970088815 2970092135 311
610 iso_pu_bacteria 2970095765 2970097857 311
611 iso_pu_bacteria 2970102677 2970104376 311
612 iso_pu_bacteria 2970109326 2970111793 311
613 iso_pu_bacteria 2970116247 2970120830 311
614 iso_pu_bacteria 2970122695 2970122895 311
615 iso_pu_bacteria 2970129317 2970132270 311
616 iso_pu_bacteria 2970136068 2970137745 311
617 iso_pu_bacteria 2970143518 2970145420 311
618 iso_pu_bacteria 2970149975 2970153765 311
619 iso_pu_bacteria 2970156795 2970163865 311
620 iso_pu_bacteria 2970164137 2970168521 311
621 iso_pu_bacteria 2970170962 2970174557 311
622 iso_pu_bacteria 2970177841 2970184373 311
623 iso_pu_bacteria 2970184632 2970190353 311
624 iso_pu_bacteria 2970191845 2970195875 311
625 iso_pu_bacteria 2977516862 2977522225 311
626 iso_pu_bacteria 2977523885 2977525682 311
627 iso_pu_bacteria 2977530762 2977530783 311
628 iso_pu_bacteria 2977537788 2977540693 311
629 iso_pu_bacteria 2977544691 2977546810 311
630 iso_pu_bacteria 2977551784 2977557134 311
631 iso_pu_bacteria 2977558990 2977562076 311
632 iso_pu_bacteria 2977565890 2977568755 311
633 iso_pu_bacteria 2977572785 2977576785 311
634 iso_pu_bacteria 2977579622 2977582561 311
635 iso_pu_bacteria 648276728 648740450 311
636 iso_pu_bacteria 8003992118 8003995582 311
637 iso_pu_bacteria 8003999396 8004003349 311
638 3300006038 Ga0075365_10000641 Ga0075365_100006419 312
639 3300006048 Ga0075363_100001601 Ga0075363_1000016016 312
640 3300006051 Ga0075364_10012258 Ga0075364_100122584 312
641 3300006178 Ga0075367_10000605 Ga0075367_100006057 312
642 3300006186 Ga0075369_10064522 Ga0075369_100645221 312
643 3300006353 Ga0075370_10001831 Ga0075370_100018312 312
644 3300006914 Ga0075436_100038129 Ga0075436_1000381293 312
645 3300027866 Ga0209813_10002610 Ga0209813_100026102 312
646 3300035695 Ga0373927_0257806 Ga0373927_0257806_82_1020 312
647 3300039438 Ga0436360_1362121 Ga0436360_1362121_12_956 312
648 3300048091 Ga0495626_0039058 Ga0495626_0039058_792_1784 312
649 3300050490 nmdc:mga03n38_5252_c1 nmdc:mga03n38_5252_c1_2528_3481 312
650 3300050492 nmdc:mga0yw44_5426_c1 nmdc:mga0yw44_5426_c1_2178_3131 312
651 3300050494 nmdc:mga06z11_2817_c1 nmdc:mga06z11_2817_c1_2407_3360 312
652 3300050495 nmdc:mga04h51_4204_c1 nmdc:mga04h51_4204_c1_1836_2789 312
653 3300050496 nmdc:mga07m45_5763_c1 nmdc:mga07m45_5763_c1_183_1136 312
654 3300050514 nmdc:mga08x19_52150_c1 nmdc:mga08x19_52150_c1_212_1150 312
655 iso_pu_bacteria 2558860983 2561467605 312
656 iso_pu_bacteria 2821443989 2821447256 312
657 iso_pu_bacteria 2838035591 2838039613 312
658 iso_pu_bacteria 2838661181 2838663885 312
659 iso_pu_bacteria 2867346516 2867350202 312
660 3300005339 Ga0070660_100001762 Ga0070660_1000017627 313
661 3300005455 Ga0070663_100076567 Ga0070663_1000765671 313
662 3300005530 Ga0070679_100174329 Ga0070679_1001743291 313
663 3300005563 Ga0068855_100174184 Ga0068855_1001741842 313
664 3300025297 Ga0209758_1003392 Ga0209758_100339211 313
665 3300025909 Ga0207705_10002602 Ga0207705_100026028 313
666 3300025919 Ga0207657_10003030 Ga0207657_100030308 313
667 3300025921 Ga0207652_10322124 Ga0207652_103221241 313
668 3300025949 Ga0207667_10032885 Ga0207667_100328853 313
669 3300026067 Ga0207678_10105168 Ga0207678_101051683 313
670 3300031730 Ga0307516_10028576 Ga0307516_100285766 313
671 3300045976 Ga0466967_0365170 Ga0466967_0365170_364_1320 313
672 3300048918 Ga0496115_0073680 Ga0496115_0073680_276_1217 313
673 iso_pu_bacteria 2537561587 2537873469 313
674 iso_pu_bacteria 2554235003 2554245856 313
675 iso_pu_bacteria 2558860242 2559296378 313
676 iso_pu_bacteria 2599185210 2599605573 313
677 iso_pu_bacteria 2600255279 2601611768 313
678 iso_pu_bacteria 2600255308 2601749501 313
679 iso_pu_bacteria 2643221582 2643917657 313
680 iso_pu_bacteria 2643221693 2644522820 313
681 iso_pu_bacteria 2757320392 2757572241 313
682 iso_pu_bacteria 2808606368 2808884156 313
683 iso_pu_bacteria 2808606387 2808988596 313
684 iso_pu_bacteria 2818991439 2819557826 313
685 iso_pu_bacteria 2838675328 2838679776 313
686 iso_pu_bacteria 2838714209 2838717454 313
687 iso_pu_bacteria 2838719591 2838724345 313
688 iso_pu_bacteria 2838724970 2838729338 313
689 iso_pu_bacteria 2841846520 2841850765 313
690 iso_pu_bacteria 2841859092 2841864054 313
691 iso_pu_bacteria 2842124991 2842129570 313
692 iso_pu_bacteria 2842130223 2842134715 313
693 iso_pu_bacteria 2842152218 2842156767 313
694 iso_pu_bacteria 2842170452 2842173025 313
695 iso_pu_bacteria 2842175837 2842180385 313
696 iso_pu_bacteria 2842187318 2842191956 313
697 iso_pu_bacteria 2842211629 2842216272 313
698 iso_pu_bacteria 2842224351 2842228992 313
699 iso_pu_bacteria 2842515876 2842520836 313
700 iso_pu_bacteria 2899792073 2899793630 313
701 iso_pu_bacteria 2899845264 2899848723 313
702 iso_pu_bacteria 2917554339 2917555076 313
703 iso_pu_bacteria 2919114240 2919119208 313
704 iso_pu_bacteria 2926754445 2926759239 313
705 iso_pu_bacteria 2926760298 2926763324 313
706 iso_pu_bacteria 2929138655 2929142965 313
707 iso_pu_bacteria 2933006813 2933011372 313
708 iso_pu_bacteria 2933011516 2933016551 313
709 iso_pu_bacteria 2933594066 2933596056 313
710 iso_pu_bacteria 2979089926 2979091643 313
711 iso_pu_bacteria 2979095461 2979097164 313
712 iso_pu_bacteria 2979100975 2979102867 313
713 iso_pu_bacteria 2984509177 2984509244 313
714 iso_pu_bacteria 2984518228 2984520057 313
715 iso_pu_bacteria 2984537506 2984537573 313
716 iso_pu_bacteria 2984601300 2984604321 313
717 iso_pu_bacteria 650716007 650842771 313
718 iso_pu_bacteria 8003570095 8003574806 313
719 iso_pu_bacteria 8054460903 8054464675 313
720 3300003322 rootL2_10018043 rootL2_100180432 314
721 3300003762 Ga0055542_1014899 Ga0055542_10148992 314
722 3300004625 Ga0055543_1014478 Ga0055543_10144781 314
723 3300005262 Ga0065165_1001128 Ga0065165_100112815 314
724 3300005441 Ga0070700_100094362 Ga0070700_1000943622 314
725 3300005548 Ga0070665_100095279 Ga0070665_1000952792 314
726 3300005578 Ga0068854_100064409 Ga0068854_1000644093 314
727 3300005616 Ga0068852_100002107 Ga0068852_1000021078 314
728 3300009093 Ga0105240_10007818 Ga0105240_100078189 314
729 3300009148 Ga0105243_10056337 Ga0105243_100563371 314
730 3300009174 Ga0105241_10062149 Ga0105241_100621493 314
731 3300009545 Ga0105237_10000071 Ga0105237_10000071132 314
732 3300009545 Ga0105237_10002420 Ga0105237_100024209 314
733 3300009553 Ga0105249_10064625 Ga0105249_100646254 314
734 3300010375 Ga0105239_10001189 Ga0105239_100011895 314
735 3300011119 Ga0105246_10038060 Ga0105246_100380602 314
736 3300025254 Ga0209148_1000305 Ga0209148_100030533 314
737 3300025261 Ga0209233_1004820 Ga0209233_10048203 314
738 3300025913 Ga0207695_10000136 Ga0207695_10000136112 314
739 3300025914 Ga0207671_10000099 Ga0207671_1000009948 314
740 3300025935 Ga0207709_10021898 Ga0207709_100218983 314
741 3300025961 Ga0207712_10079253 Ga0207712_100792531 314
742 3300025981 Ga0207640_10050225 Ga0207640_100502252 314
743 3300026075 Ga0207708_10177328 Ga0207708_101773282 314
744 3300026121 Ga0207683_10206493 Ga0207683_102064932 314
745 3300028379 Ga0268266_10000391 Ga0268266_1000039153 314
746 3300031548 Ga0307408_100130609 Ga0307408_1001306092 314
747 3300031824 Ga0307413_10020232 Ga0307413_100202322 314
748 3300031903 Ga0307407_10188317 Ga0307407_101883172 314
749 3300031911 Ga0307412_10294173 Ga0307412_102941732 314
750 3300032002 Ga0307416_100266096 Ga0307416_1002660962 314
751 3300033180 Ga0307510_10081429 Ga0307510_100814293 314
752 3300044735 Ga0466968_0066731 Ga0466968_0066731_202_1146 314
753 3300046524 Ga0495648_0043505 Ga0495648_0043505_1297_2241 314
754 3300046529 Ga0495652_0134912 Ga0495652_0134912_213_1157 314
755 3300046543 Ga0495645_0018535 Ga0495645_0018535_2264_3217 314
756 3300046557 Ga0495622_0115960 Ga0495622_0115960_244_1188 314
757 3300046660 Ga0495625_0137960 Ga0495625_0137960_153_1097 314
758 3300047317 Ga0495604_0025521 Ga0495604_0025521_1544_2488 314
759 3300047472 Ga0495686_0017404 Ga0495686_0017404_3204_4148 314
760 3300048924 Ga0496121_0041492 Ga0496121_0041492_2453_3397 314
761 3300048928 Ga0496125_0000381 Ga0496125_0000381_42303_43247 314
762 3300049571 Ga0501034_0049658 Ga0501034_0049658_1838_2782 314
763 3300049675 Ga0501243_005207 Ga0501243_005207_442_1404 314
764 3300053111 Ga0500572_011801 Ga0500572_011801_520_1467 314
765 iso_pu_bacteria 2508501122 2509112218 314
766 iso_pu_bacteria 2509276019 2509379501 314
767 iso_pu_bacteria 2510917028 2511185269 314
768 iso_pu_bacteria 2512047086 2512534852 314
769 iso_pu_bacteria 2513237088 2513595667 314
770 iso_pu_bacteria 2513237138 2513865304 314
771 iso_pu_bacteria 2515154107 2515607155 314
772 iso_pu_bacteria 2516143018 2516208009 314
773 iso_pu_bacteria 2524023207 2524452594 314
774 iso_pu_bacteria 2558860100 2558867610 314
775 iso_pu_bacteria 2582581299 2585231003 314
776 iso_pu_bacteria 2582581867 2585399153 314
777 iso_pu_bacteria 2585427590 2585818698 314
778 iso_pu_bacteria 2643221634 2644191162 314
779 iso_pu_bacteria 2657244999 2657684930 314
780 iso_pu_bacteria 2690316117 2692319027 314
781 iso_pu_bacteria 2751185821 2753463608 314
782 iso_pu_bacteria 2791355091 2792621651 314
783 iso_pu_bacteria 2791355092 2792627664 314
784 iso_pu_bacteria 2791355094 2792640381 314
785 iso_pu_bacteria 2802429268 2804755715 314
786 iso_pu_bacteria 2847417321 2847422473 314
787 iso_pu_bacteria 2848992105 2848998118 314
788 iso_pu_bacteria 2855872281 2855875810 314
789 iso_pu_bacteria 2913295892 2913296235 314
790 iso_pu_bacteria 2923556063 2923556126 314
791 iso_pu_bacteria 2936996657 2936998858 314
792 iso_pu_bacteria 2937106411 2937111199 314
793 iso_pu_bacteria 2996887358 2996889686 314
794 iso_pu_bacteria 643692032 643823655 314
795 iso_pu_bacteria 8005258706 8005261534 314
796 iso_pu_bacteria 8005321885 8005324213 314
797 iso_pu_bacteria 8008485437 8008491367 314
798 iso_pu_bacteria 8025524527 8025530697 314
799 3300003320 rootH2_10045600 rootH2_100456006 315
800 3300005327 Ga0070658_10060193 Ga0070658_100601931 315
801 3300005327 Ga0070658_10061436 Ga0070658_100614362 315
802 3300005339 Ga0070660_100073319 Ga0070660_1000733192 315
803 3300005339 Ga0070660_100081504 Ga0070660_1000815043 315
804 3300005344 Ga0070661_100028790 Ga0070661_1000287904 315
805 3300005344 Ga0070661_100030184 Ga0070661_1000301844 315
806 3300005344 Ga0070661_100099812 Ga0070661_1000998122 315
807 3300005356 Ga0070674_100005304 Ga0070674_1000053042 315
808 3300005366 Ga0070659_100018201 Ga0070659_1000182014 315
809 3300005539 Ga0068853_100097958 Ga0068853_1000979582 315
810 3300005543 Ga0070672_100036888 Ga0070672_1000368882 315
811 3300005563 Ga0068855_100121017 Ga0068855_1001210172 315
812 3300005563 Ga0068855_100132489 Ga0068855_1001324892 315
813 3300005564 Ga0070664_100455725 Ga0070664_1004557252 315
814 3300005577 Ga0068857_100152029 Ga0068857_1001520293 315
815 3300005578 Ga0068854_100011307 Ga0068854_1000113073 315
816 3300005578 Ga0068854_100167266 Ga0068854_1001672662 315
817 3300005614 Ga0068856_100066245 Ga0068856_1000662452 315
818 3300005614 Ga0068856_100073534 Ga0068856_1000735342 315
819 3300005614 Ga0068856_100117479 Ga0068856_1001174793 315
820 3300005614 Ga0068856_100155283 Ga0068856_1001552832 315
821 3300005616 Ga0068852_100006927 Ga0068852_1000069272 315
822 3300005616 Ga0068852_100010073 Ga0068852_1000100734 315
823 3300005616 Ga0068852_100029002 Ga0068852_1000290023 315
824 3300005834 Ga0068851_10027371 Ga0068851_100273713 315
825 3300005981 Ga0081538_10032965 Ga0081538_100329652 315
826 3300006042 Ga0075368_10036305 Ga0075368_100363052 315
827 3300006051 Ga0075364_10103742 Ga0075364_101037422 315
828 3300006177 Ga0075362_10003917 Ga0075362_100039172 315
829 3300006178 Ga0075367_10010227 Ga0075367_100102273 315
830 3300006186 Ga0075369_10016168 Ga0075369_100161683 315
831 3300006195 Ga0075366_10049433 Ga0075366_100494331 315
832 3300006353 Ga0075370_10000790 Ga0075370_1000079013 315
833 3300006881 Ga0068865_100231903 Ga0068865_1002319032 315
834 3300006946 Ga0079104_1008652 Ga0079104_10086522 315
835 3300009098 Ga0105245_10249836 Ga0105245_102498362 315
836 3300009174 Ga0105241_10028242 Ga0105241_100282422 315
837 3300009174 Ga0105241_10042714 Ga0105241_100427142 315
838 3300009545 Ga0105237_10308890 Ga0105237_103088902 315
839 3300009551 Ga0105238_10018899 Ga0105238_100188992 315
840 3300009553 Ga0105249_10344701 Ga0105249_103447012 315
841 3300010375 Ga0105239_10028181 Ga0105239_100281815 315
842 3300010375 Ga0105239_10069958 Ga0105239_100699583 315
843 3300010375 Ga0105239_10078512 Ga0105239_100785124 315
844 3300013102 Ga0157371_10270803 Ga0157371_102708031 315
845 3300013104 Ga0157370_10060171 Ga0157370_100601712 315
846 3300013104 Ga0157370_10158271 Ga0157370_101582712 315
847 3300013105 Ga0157369_10002596 Ga0157369_1000259612 315
848 3300013250 Ga0171462_1067 Ga0171462_10677 315
849 3300013307 Ga0157372_10052860 Ga0157372_100528602 315
850 3300022739 Ga0228711_1000006 Ga0228711_1000006174 315
851 3300022740 Ga0228710_1000004 Ga0228710_1000004225 315
852 3300025909 Ga0207705_10018987 Ga0207705_100189872 315
853 3300025909 Ga0207705_10161161 Ga0207705_101611612 315
854 3300025913 Ga0207695_10029206 Ga0207695_100292064 315
855 3300025919 Ga0207657_10004936 Ga0207657_1000493618 315
856 3300025920 Ga0207649_10038059 Ga0207649_100380592 315
857 3300025920 Ga0207649_10047558 Ga0207649_100475583 315
858 3300025920 Ga0207649_10077321 Ga0207649_100773212 315
859 3300025920 Ga0207649_10094290 Ga0207649_100942902 315
860 3300025924 Ga0207694_10414682 Ga0207694_104146822 315
861 3300025927 Ga0207687_10348640 Ga0207687_103486401 315
862 3300025932 Ga0207690_10091750 Ga0207690_100917502 315
863 3300025937 Ga0207669_10022958 Ga0207669_100229584 315
864 3300025940 Ga0207691_10039264 Ga0207691_100392644 315
865 3300025945 Ga0207679_10188639 Ga0207679_101886392 315
866 3300025949 Ga0207667_10137137 Ga0207667_101371372 315
867 3300025960 Ga0207651_10009486 Ga0207651_100094863 315
868 3300026041 Ga0207639_10033504 Ga0207639_100335043 315
869 3300026078 Ga0207702_10017912 Ga0207702_100179123 315
870 3300026089 Ga0207648_10268943 Ga0207648_102689431 315
871 3300026121 Ga0207683_10027732 Ga0207683_100277323 315
872 3300026142 Ga0207698_10007021 Ga0207698_100070217 315
873 3300026142 Ga0207698_10168149 Ga0207698_101681492 315
874 3300027111 Ga0209281_1000102 Ga0209281_1000102157 315
875 3300027111 Ga0209281_1000563 Ga0209281_100056318 315
876 3300027666 Ga0209282_1000013 Ga0209282_1000013192 315
877 3300031456 Ga0307513_10018636 Ga0307513_100186362 315
878 3300031903 Ga0307407_10035282 Ga0307407_100352822 315
879 3300031967 Ga0315914_1000004 Ga0315914_1000004227 315
880 3300032004 Ga0307414_10224116 Ga0307414_102241162 315
881 3300033430 Ga0315913_1000055 Ga0315913_100005522 315
882 3300033464 Ga0315915_1000003 Ga0315915_1000003334 315
883 3300037418 Ga0395900_0436125 Ga0395900_0436125_78_1025 315
884 3300037466 Ga0395898_0160851 Ga0395898_0160851_12_959 315
885 3300038443 Ga0395901_0064452 Ga0395901_0064452_2250_3197 315
886 3300042436 Ga0439435_0000577 Ga0439435_0000577_2095_3066 315
887 3300044683 Ga0466965_0207935 Ga0466965_0207935_38_985 315
888 3300046690 Ga0495624_0166512 Ga0495624_0166512_60_1064 315
889 3300049571 Ga0501034_0027120 Ga0501034_0027120_2180_3133 315
890 3300049571 Ga0501034_0051191 Ga0501034_0051191_2517_3464 315
891 3300049571 Ga0501034_0053440 Ga0501034_0053440_487_1434 315
892 3300049571 Ga0501034_0106081 Ga0501034_0106081_991_1938 315
893 3300049571 Ga0501034_0194599 Ga0501034_0194599_41_988 315
894 3300050491 nmdc:mga00v17_90406_c1 nmdc:mga00v17_90406_c1_209_1213 315
895 3300050496 nmdc:mga07m45_10042_c1 nmdc:mga07m45_10042_c1_1325_2278 315
896 3300050516 nmdc:mga0sz30_14395_c1 nmdc:mga0sz30_14395_c1_218_1165 315
897 iso_pu_bacteria 2509276021 2509389143 315
898 iso_pu_bacteria 2509276033 2509444697 315
899 iso_pu_bacteria 2510065019 2510135518 315
900 iso_pu_bacteria 2510461076 2510896980 315
901 iso_pu_bacteria 2510917030 2511194385 315
902 iso_pu_bacteria 2513237084 2513570712 315
903 iso_pu_bacteria 2513237085 2513575069 315
904 iso_pu_bacteria 2513237093 2513633856 315
905 iso_pu_bacteria 2513237103 2513712995 315
906 iso_pu_bacteria 2513237162 2514023508 315
907 iso_pu_bacteria 2515075009 2515114708 315
908 iso_pu_bacteria 2515154113 2515636709 315
909 iso_pu_bacteria 2515154114 2515644878 315
910 iso_pu_bacteria 2515154116 2515661186 315
911 iso_pu_bacteria 2515154134 2515741295 315
912 iso_pu_bacteria 2516653077 2517038335 315
913 iso_pu_bacteria 2516653085 2517078613 315
914 iso_pu_bacteria 2517093000 2517097350 315
915 iso_pu_bacteria 2517287029 2517408803 315
916 iso_pu_bacteria 2529292951 2530648457 315
917 iso_pu_bacteria 2582581298 2585223139 315
918 iso_pu_bacteria 2585427526 2585524072 315
919 iso_pu_bacteria 2585427528 2585543570 315
920 iso_pu_bacteria 2585427529 2585546265 315
921 iso_pu_bacteria 2585427593 2585841998 315
922 iso_pu_bacteria 2615840624 2616294066 315
923 iso_pu_bacteria 2718217882 2719183222 315
924 iso_pu_bacteria 2718217927 2719387947 315
925 iso_pu_bacteria 2718217997 2719667564 315
926 iso_pu_bacteria 2718218009 2719733939 315
927 iso_pu_bacteria 2718218199 2720493984 315
928 iso_pu_bacteria 2718218232 2720615447 315
929 iso_pu_bacteria 2718218233 2720622231 315
930 iso_pu_bacteria 2718218235 2720633585 315
931 iso_pu_bacteria 2718218269 2720777285 315
932 iso_pu_bacteria 2718218363 2721149334 315
933 iso_pu_bacteria 2718218365 2721160736 315
934 iso_pu_bacteria 2718218366 2721166147 315
935 iso_pu_bacteria 2718218423 2721401580 315
936 iso_pu_bacteria 2721755514 2722842317 315
937 iso_pu_bacteria 2721755556 2723028883 315
938 iso_pu_bacteria 2721755684 2723562499 315
939 iso_pu_bacteria 2721755685 2723569192 315
940 iso_pu_bacteria 2721755809 2724040394 315
941 iso_pu_bacteria 2721755810 2724046695 315
942 iso_pu_bacteria 2721755819 2724091892 315
943 iso_pu_bacteria 2721755822 2724106457 315
944 iso_pu_bacteria 2721755823 2724112262 315
945 iso_pu_bacteria 2724679232 2725947220 315
946 iso_pu_bacteria 2728369352 2730109819 315
947 iso_pu_bacteria 2728369365 2730166457 315
948 iso_pu_bacteria 2728369397 2730300368 315
949 iso_pu_bacteria 2738541333 2739038819 315
950 iso_pu_bacteria 2765235942 2766067322 315
951 iso_pu_bacteria 2791355256 2793298345 315
952 iso_pu_bacteria 2791355259 2793315810 315
953 iso_pu_bacteria 2791355260 2793323595 315
954 iso_pu_bacteria 2791355261 2793330364 315
955 iso_pu_bacteria 2791355262 2793335529 315
956 iso_pu_bacteria 2791355263 2793340916 315
957 iso_pu_bacteria 2791355264 2793350901 315
958 iso_pu_bacteria 2791355265 2793354655 315
959 iso_pu_bacteria 2791355266 2793358649 315
960 iso_pu_bacteria 2791355267 2793369133 315
961 iso_pu_bacteria 2802429605 2805929028 315
962 iso_pu_bacteria 2802429606 2805934650 315
963 iso_pu_bacteria 2802429633 2806049229 315
964 iso_pu_bacteria 2802429634 2806056146 315
965 iso_pu_bacteria 2802429635 2806063154 315
966 iso_pu_bacteria 2802429636 2806070752 315
967 iso_pu_bacteria 2802429637 2806077613 315
968 iso_pu_bacteria 2842217011 2842219541 315
969 iso_pu_bacteria 2862705112 2862708550 315
970 iso_pu_bacteria 2894817345 2894818904 315
971 iso_pu_bacteria 2933570622 2933575037 315
972 iso_pu_bacteria 2933586486 2933588239 315
973 iso_pu_bacteria 2933599457 2933601173 315
974 iso_pu_bacteria 2935894831 2935900097 315
975 iso_pu_bacteria 2935901341 2935902208 315
976 iso_pu_bacteria 2936367885 2936369657 315
977 iso_pu_bacteria 2936375103 2936380395 315
978 iso_pu_bacteria 2936381700 2936385138 315
979 iso_pu_bacteria 2996893221 2996896242 315
980 iso_pu_bacteria 3005445848 3005449948 315
981 iso_pu_bacteria 639633055 639645956 315
982 iso_pu_bacteria 8005275841 8005278147 315
983 iso_pu_bacteria 8005282627 8005282825 315
984 iso_pu_bacteria 8005289223 8005291767 315
985 iso_pu_bacteria 8005301065 8005305366 315
986 iso_pu_bacteria 8005307578 8005310138 315
987 iso_pu_bacteria 8005376324 8005378214 315
988 iso_pu_bacteria 8005382845 8005384240 315
989 iso_pu_bacteria 8005395548 8005399484 315
990 iso_pu_bacteria 8005430974 8005432405 315
991 iso_pu_bacteria 8005460587 8005465403 315
992 iso_pu_bacteria 8005497431 8005497955 315
993 iso_pu_bacteria 8005556819 8005559852 315
994 iso_pu_bacteria 8005563573 8005564650 315
995 iso_pu_bacteria 8005570704 8005570982 315
996 iso_pu_bacteria 8005619151 8005619171 315
997 iso_pu_bacteria 8005626139 8005627734 315
998 iso_pu_bacteria 8005668836 8005669362 315
999 iso_pu_bacteria 8005688590 8005692881 315
1000 iso_pu_bacteria 8005695170 8005701620 315
1001 iso_pu_bacteria 8018127388 8018132428 315
1002 iso_pu_bacteria 8018163183 8018167112 315
1003 iso_pu_bacteria 8018176218 8018176764 315
1004 iso_pu_bacteria 8023680758 8023681386 315
1005 iso_pu_bacteria 8024479707 8024481781 315
1006 iso_pu_bacteria 8024501048 8024506214 315
1007 iso_pu_bacteria 8056375014 8056381337 315
1008 iso_pu_bacteria 8056382006 8056382794 315
1009 iso_pu_bacteria 8057874678 8057877238 315
1010 3300005539 Ga0068853_100000565 Ga0068853_1000005657 316
1011 3300006038 Ga0075365_10008876 Ga0075365_100088764 316
1012 3300006038 Ga0075365_10019507 Ga0075365_100195073 316
1013 3300013104 Ga0157370_10217126 Ga0157370_102171262 316
1014 3300013296 Ga0157374_10118195 Ga0157374_101181953 316
1015 3300026041 Ga0207639_10001011 Ga0207639_100010112 316
1016 3300033180 Ga0307510_10054575 Ga0307510_100545752 316
1017 3300037418 Ga0395900_0502445 Ga0395900_0502445_154_1107 316
1018 3300038443 Ga0395901_0345048 Ga0395901_0345048_445_1398 316
1019 3300046809 Ga0495600_0030281 Ga0495600_0030281_530_1489 316
1020 3300047322 Ga0495680_0070768 Ga0495680_0070768_1440_2399 316
1021 3300049568 Ga0501031_0143633 Ga0501031_0143633_44_994 316
1022 3300049568 Ga0501031_0158256 Ga0501031_0158256_221_1180 316
1023 3300049569 Ga0501032_0019351 Ga0501032_0019351_2474_3424 316
1024 3300049570 Ga0501033_0017798 Ga0501033_0017798_2049_3002 316
1025 3300049570 Ga0501033_0024093 Ga0501033_0024093_1602_2552 316
1026 3300049571 Ga0501034_0035747 Ga0501034_0035747_2631_3584 316
1027 3300049572 Ga0501036_0021649 Ga0501036_0021649_1908_2858 316
1028 3300049572 Ga0501036_0040760 Ga0501036_0040760_608_1561 316
1029 3300049573 Ga0501037_0007341 Ga0501037_0007341_4403_5353 316
1030 3300049573 Ga0501037_0049740 Ga0501037_0049740_473_1423 316
1031 3300049574 Ga0501038_0047708 Ga0501038_0047708_920_1870 316
1032 3300049574 Ga0501038_0073514 Ga0501038_0073514_1240_2193 316
1033 3300049574 Ga0501038_0172259 Ga0501038_0172259_414_1367 316
1034 3300049575 Ga0501039_0136324 Ga0501039_0136324_833_1783 316
1035 3300049580 Ga0501046_0022934 Ga0501046_0022934_3952_4905 316
1036 3300049581 Ga0501047_0032607 Ga0501047_0032607_2360_3310 316
1037 3300049586 Ga0501070_0019852 Ga0501070_0019852_2188_3138 316
1038 3300049586 Ga0501070_0030405 Ga0501070_0030405_1297_2250 316
1039 3300049589 Ga0501073_0190278 Ga0501073_0190278_133_1086 316
1040 3300049742 Ga0501080_0072761 Ga0501080_0072761_1842_2795 316
1041 3300049822 Ga0501035_0020784 Ga0501035_0020784_2474_3427 316
1042 3300049822 Ga0501035_0020842 Ga0501035_0020842_4557_5510 316
1043 3300049822 Ga0501035_0400769 Ga0501035_0400769_31_981 316
1044 3300049823 Ga0501044_0272994 Ga0501044_0272994_303_1256 316
1045 3300049823 Ga0501044_0288956 Ga0501044_0288956_163_1116 316
1046 3300053119 Ga0500595_000538 Ga0500595_000538_7975_8925 316
1047 3300053140 Ga0500573_0054464 Ga0500573_0054464_444_1409 316
1048 iso_pu_bacteria 2513237144 2513912566 316
1049 iso_pu_bacteria 2513237146 2513924189 316
1050 iso_pu_bacteria 2534681796 2535514518 316
1051 iso_pu_bacteria 2582581294 2585201346 316
1052 iso_pu_bacteria 2599185170 2599419858 316
1053 iso_pu_bacteria 2643221599 2644004281 316
1054 iso_pu_bacteria 2933016740 2933020584 316
1055 iso_pu_bacteria 3005409236 3005410514 316
1056 iso_pu_bacteria 3005452660 3005456281 316
1057 iso_pu_bacteria 8005542996 8005543171 316
1058 iso_pu_bacteria 8055431914 8055435339 316
1059 3300002773 JGI25152J39213_1002263 JGI25152J39213_10022634 317
1060 3300003187 JGI25151J46595_10004033 JGI25151J46595_100040333 317
1061 3300003771 Ga0055526_1013134 Ga0055526_10131342 317
1062 3300003775 Ga0055524_1003779 Ga0055524_10037794 317
1063 3300003790 Ga0055528_1017305 Ga0055528_10173052 317
1064 3300003856 Ga0058692_1002641 Ga0058692_10026411 317
1065 3300005347 Ga0070668_100013330 Ga0070668_1000133305 317
1066 3300005455 Ga0070663_100066828 Ga0070663_1000668282 317
1067 3300005455 Ga0070663_100094147 Ga0070663_1000941472 317
1068 3300005548 Ga0070665_100002585 Ga0070665_10000258523 317
1069 3300005578 Ga0068854_100244498 Ga0068854_1002444982 317
1070 3300006038 Ga0075365_10004465 Ga0075365_100044655 317
1071 3300006042 Ga0075368_10047512 Ga0075368_100475122 317
1072 3300006048 Ga0075363_100116753 Ga0075363_1001167532 317
1073 3300006051 Ga0075364_10023714 Ga0075364_100237143 317
1074 3300006051 Ga0075364_10030856 Ga0075364_100308562 317
1075 3300006178 Ga0075367_10052945 Ga0075367_100529453 317
1076 3300006186 Ga0075369_10005102 Ga0075369_100051022 317
1077 3300006186 Ga0075369_10021032 Ga0075369_100210323 317
1078 3300006195 Ga0075366_10142145 Ga0075366_101421452 317
1079 3300006948 Ga0099826_10000040 Ga0099826_1000004054 317
1080 3300006948 Ga0099826_10080445 Ga0099826_100804452 317
1081 3300009011 Ga0105251_10008485 Ga0105251_100084852 317
1082 3300009177 Ga0105248_10009144 Ga0105248_100091444 317
1083 3300009765 Ga0123341_1083945 Ga0123341_10839451 317
1084 3300009766 Ga0123342_1020788 Ga0123342_10207883 317
1085 3300011119 Ga0105246_10105769 Ga0105246_101057692 317
1086 3300013102 Ga0157371_10000042 Ga0157371_10000042121 317
1087 3300013104 Ga0157370_10000035 Ga0157370_1000003571 317
1088 3300025258 Ga0209129_1001779 Ga0209129_10017798 317
1089 3300025273 Ga0209673_1002508 Ga0209673_10025086 317
1090 3300025284 Ga0209130_1006186 Ga0209130_10061864 317
1091 3300025294 Ga0209025_1000374 Ga0209025_100037455 317
1092 3300025295 Ga0209564_1011645 Ga0209564_10116452 317
1093 3300025297 Ga0209758_1028154 Ga0209758_10281542 317
1094 3300025299 Ga0209256_1005354 Ga0209256_10053542 317
1095 3300025302 Ga0207426_1001778 Ga0207426_10017785 317
1096 3300025903 Ga0207680_10148648 Ga0207680_101486482 317
1097 3300025941 Ga0207711_10037909 Ga0207711_100379093 317
1098 3300025972 Ga0207668_10168681 Ga0207668_101686812 317
1099 3300026067 Ga0207678_10029480 Ga0207678_100294804 317
1100 3300026067 Ga0207678_10046776 Ga0207678_100467762 317
1101 3300027312 Ga0209371_1000003 Ga0209371_1000003146 317
1102 3300027312 Ga0209371_1000998 Ga0209371_10009987 317
1103 3300027666 Ga0209282_1000150 Ga0209282_100015039 317
1104 3300027666 Ga0209282_1080876 Ga0209282_10808762 317
1105 3300027866 Ga0209813_10005108 Ga0209813_100051081 317
1106 3300028379 Ga0268266_10002425 Ga0268266_100024255 317
1107 3300030500 Ga0268256_1000004 Ga0268256_1000004905 317
1108 3300030500 Ga0268256_1002297 Ga0268256_10022976 317
1109 3300031911 Ga0307412_10295612 Ga0307412_102956122 317
1110 3300031995 Ga0307409_100081884 Ga0307409_1000818842 317
1111 3300031995 Ga0307409_100179512 Ga0307409_1001795122 317
1112 3300032002 Ga0307416_100230775 Ga0307416_1002307752 317
1113 3300046519 Ga0495632_0004032 Ga0495632_0004032_8579_9541 317
1114 3300046558 Ga0495633_0033929 Ga0495633_0033929_1350_2303 317
1115 3300048920 Ga0496117_0012929 Ga0496117_0012929_1084_2037 317
1116 3300048921 Ga0496118_0027736 Ga0496118_0027736_424_1377 317
1117 3300048923 Ga0496120_0000036 Ga0496120_0000036_143535_144488 317
1118 3300048924 Ga0496121_0000005 Ga0496121_0000005_910582_911535 317
1119 3300048924 Ga0496121_0002070 Ga0496121_0002070_13025_13978 317
1120 3300048925 Ga0496122_0000002 Ga0496122_0000002_642617_643570 317
1121 3300048926 Ga0496123_0000002 Ga0496123_0000002_1168113_1169066 317
1122 3300048926 Ga0496123_0000002 Ga0496123_0000002_642617_643570 317
1123 3300048927 Ga0496124_0000080 Ga0496124_0000080_107117_108070 317
1124 3300048927 Ga0496124_0091559 Ga0496124_0091559_69_1022 317
1125 3300048928 Ga0496125_0000159 Ga0496125_0000159_34679_35632 317
1126 3300049570 Ga0501033_0087165 Ga0501033_0087165_1011_1967 317
1127 3300049572 Ga0501036_0089301 Ga0501036_0089301_615_1571 317
1128 3300049574 Ga0501038_0018372 Ga0501038_0018372_1109_2065 317
1129 3300049589 Ga0501073_0117499 Ga0501073_0117499_697_1653 317
1130 3300049822 Ga0501035_0174302 Ga0501035_0174302_835_1791 317
1131 3300050490 nmdc:mga03n38_181885_c1 nmdc:mga03n38_181885_c1_79_1032 317
1132 3300050491 nmdc:mga00v17_19_c1 nmdc:mga00v17_19_c1_83375_84328 317
1133 3300050491 nmdc:mga00v17_27140_c1 nmdc:mga00v17_27140_c1_839_1792 317
1134 3300050492 nmdc:mga0yw44_1027_c1 nmdc:mga0yw44_1027_c1_3339_4292 317
1135 3300050496 nmdc:mga07m45_81937_c1 nmdc:mga07m45_81937_c1_567_1520 317
1136 3300050516 nmdc:mga0sz30_1633_c1 nmdc:mga0sz30_1633_c1_5107_6060 317
1137 3300050516 nmdc:mga0sz30_48680_c1 nmdc:mga0sz30_48680_c1_201_1154 317
1138 3300053093 Ga0500651_0012275 Ga0500651_0012275_816_1769 317
1139 3300053107 Ga0500560_000204 Ga0500560_000204_5651_6604 317
1140 3300053107 Ga0500560_035782 Ga0500560_035782_543_1496 317
1141 3300053111 Ga0500572_001954 Ga0500572_001954_430_1383 317
1142 3300053130 Ga0500642_0028242 Ga0500642_0028242_91_1044 317
1143 3300053137 Ga0500561_0000036 Ga0500561_0000036_9222_10175 317
1144 3300053157 Ga0500624_001367 Ga0500624_001367_2640_3593 317
1145 3300053157 Ga0500624_004302 Ga0500624_004302_371_1324 317
1146 3300053161 Ga0500634_0000032 Ga0500634_0000032_12896_13849 317
1147 3300053161 Ga0500634_0000373 Ga0500634_0000373_542_1495 317
1148 3300053177 Ga0500636_0000011 Ga0500636_0000011_129669_130622 317
1149 3300053177 Ga0500636_0000283 Ga0500636_0000283_22149_23102 317
1150 3300059508 Ga0587088_016049 Ga0587088_016049_163_1116 317
1151 3300002739 JGI25158J39367_1000160 JGI25158J39367_100016012 318
1152 3300002773 JGI25152J39213_1001531 JGI25152J39213_10015316 318
1153 3300002987 JGI25159J45721_1000711 JGI25159J45721_10007118 318
1154 3300003187 JGI25151J46595_10000409 JGI25151J46595_1000040915 318
1155 3300003215 JGI25153J46596_10003661 JGI25153J46596_100036618 318
1156 3300003354 JGI25160J50197_1002301 JGI25160J50197_10023016 318
1157 3300003354 JGI25160J50197_1002712 JGI25160J50197_10027126 318
1158 3300003374 JGI25161J50226_1000206 JGI25161J50226_100020631 318
1159 3300003771 Ga0055526_1000489 Ga0055526_100048918 318
1160 3300003771 Ga0055526_1004307 Ga0055526_10043076 318
1161 3300003775 Ga0055524_1005189 Ga0055524_10051895 318
1162 3300003775 Ga0055524_1005277 Ga0055524_10052771 318
1163 3300003790 Ga0055528_1001760 Ga0055528_10017607 318
1164 3300003790 Ga0055528_1002389 Ga0055528_10023898 318
1165 3300003790 Ga0055528_1021586 Ga0055528_10215861 318
1166 3300003792 Ga0055540_1000320 Ga0055540_100032026 318
1167 3300003792 Ga0055540_1003981 Ga0055540_10039814 318
1168 3300003792 Ga0055540_1028718 Ga0055540_10287182 318
1169 3300004625 Ga0055543_1000248 Ga0055543_100024823 318
1170 3300004625 Ga0055543_1002104 Ga0055543_10021045 318
1171 3300005262 Ga0065165_1006963 Ga0065165_10069634 318
1172 3300005353 Ga0070669_100061720 Ga0070669_1000617202 318
1173 3300006038 Ga0075365_10001348 Ga0075365_100013488 318
1174 3300006042 Ga0075368_10066825 Ga0075368_100668251 318
1175 3300006177 Ga0075362_10010334 Ga0075362_100103342 318
1176 3300006178 Ga0075367_10031237 Ga0075367_100312373 318
1177 3300006186 Ga0075369_10009196 Ga0075369_100091962 318
1178 3300006195 Ga0075366_10001240 Ga0075366_1000124011 318
1179 3300009766 Ga0123342_1033145 Ga0123342_10331452 318
1180 3300012490 Ga0157322_1000363 Ga0157322_10003632 318
1181 3300021320 Ga0214544_1000771 Ga0214544_100077136 318
1182 3300021321 Ga0214542_1000032 Ga0214542_100003254 318
1183 3300021321 Ga0214542_1021618 Ga0214542_10216183 318
1184 3300021327 Ga0214543_1000016 Ga0214543_1000016224 318
1185 3300021327 Ga0214543_1009269 Ga0214543_100926910 318
1186 3300025208 Ga0209436_100127 Ga0209436_10012732 318
1187 3300025245 Ga0207425_1014088 Ga0207425_10140882 318
1188 3300025258 Ga0209129_1000312 Ga0209129_100031222 318
1189 3300025258 Ga0209129_1004734 Ga0209129_10047343 318
1190 3300025273 Ga0209673_1000584 Ga0209673_100058429 318
1191 3300025273 Ga0209673_1001948 Ga0209673_100194813 318
1192 3300025273 Ga0209673_1002261 Ga0209673_10022616 318
1193 3300025273 Ga0209673_1002576 Ga0209673_10025768 318
1194 3300025284 Ga0209130_1000002 Ga0209130_1000002698 318
1195 3300025294 Ga0209025_1000857 Ga0209025_100085724 318
1196 3300025294 Ga0209025_1015222 Ga0209025_10152225 318
1197 3300025295 Ga0209564_1000914 Ga0209564_100091425 318
1198 3300025295 Ga0209564_1001996 Ga0209564_100199613 318
1199 3300025297 Ga0209758_1001197 Ga0209758_100119723 318
1200 3300025297 Ga0209758_1001885 Ga0209758_100188512 318
1201 3300025297 Ga0209758_1002066 Ga0209758_100206618 318
1202 3300025297 Ga0209758_1026422 Ga0209758_10264222 318
1203 3300025299 Ga0209256_1000739 Ga0209256_100073925 318
1204 3300025299 Ga0209256_1007001 Ga0209256_10070014 318
1205 3300025302 Ga0207426_1000013 Ga0207426_1000013698 318
1206 3300025302 Ga0207426_1000812 Ga0207426_100081223 318
1207 3300025303 Ga0209051_1000195 Ga0209051_100019528 318
1208 3300025303 Ga0209051_1002486 Ga0209051_10024861 318
1209 3300025303 Ga0209051_1007413 Ga0209051_10074134 318
1210 3300025304 Ga0209257_1007822 Ga0209257_10078224 318
1211 3300028379 Ga0268266_10303773 Ga0268266_103037732 318
1212 3300031852 Ga0307410_10051199 Ga0307410_100511992 318
1213 3300041413 Ga0439465_0028012 Ga0439465_0028012_376_1335 318
1214 3300041453 Ga0451797_0381403 Ga0451797_0381403_1590_2549 318
1215 3300041458 Ga0451798_0043797 Ga0451798_0043797_164_1123 318
1216 3300041496 Ga0451839_0282160 Ga0451839_0282160_333_1292 318
1217 3300041498 Ga0451841_1056658 Ga0451841_1056658_268_1227 318
1218 3300041501 Ga0451845_0333885 Ga0451845_0333885_270_1229 318
1219 3300046500 Ga0495596_0038697 Ga0495596_0038697_689_1648 318
1220 3300046501 Ga0495607_0030405 Ga0495607_0030405_811_1770 318
1221 3300046507 Ga0495606_0017853 Ga0495606_0017853_3354_4313 318
1222 3300046507 Ga0495606_0162551 Ga0495606_0162551_178_1137 318
1223 3300046512 Ga0495610_0006514 Ga0495610_0006514_4899_5858 318
1224 3300046515 Ga0495620_0035733 Ga0495620_0035733_967_1926 318
1225 3300046522 Ga0495643_0049454 Ga0495643_0049454_292_1251 318
1226 3300046524 Ga0495648_0097122 Ga0495648_0097122_121_1080 318
1227 3300046558 Ga0495633_0033803 Ga0495633_0033803_698_1657 318
1228 3300046660 Ga0495625_0125786 Ga0495625_0125786_703_1662 318
1229 3300046660 Ga0495625_0143473 Ga0495625_0143473_73_1032 318
1230 3300046691 Ga0495670_0027101 Ga0495670_0027101_1610_2569 318
1231 3300046694 Ga0495649_0028640 Ga0495649_0028640_1554_2513 318
1232 3300046810 Ga0495660_0042753 Ga0495660_0042753_1252_2211 318
1233 3300047318 Ga0495636_0099378 Ga0495636_0099378_227_1186 318
1234 3300047323 Ga0495683_0032607 Ga0495683_0032607_439_1398 318
1235 3300047472 Ga0495686_0013754 Ga0495686_0013754_1522_2481 318
1236 3300048909 Ga0496106_0000490 Ga0496106_0000490_1401_2360 318
1237 3300048924 Ga0496121_0155643 Ga0496121_0155643_176_1135 318
1238 3300048925 Ga0496122_0008486 Ga0496122_0008486_5593_6552 318
1239 3300048926 Ga0496123_0011879 Ga0496123_0011879_5538_6497 318
1240 3300048927 Ga0496124_0213432 Ga0496124_0213432_346_1305 318
1241 3300048928 Ga0496125_0038894 Ga0496125_0038894_2015_2974 318
1242 3300050492 nmdc:mga0yw44_2126_c1 nmdc:mga0yw44_2126_c1_6241_7200 318
1243 3300050493 nmdc:mga0k408_45584_c1 nmdc:mga0k408_45584_c1_123_1082 318
1244 3300050494 nmdc:mga06z11_2714_c1 nmdc:mga06z11_2714_c1_4086_5045 318
1245 3300050496 nmdc:mga07m45_105104_c1 nmdc:mga07m45_105104_c1_572_1531 318
1246 3300053134 Ga0500658_0000083 Ga0500658_0000083_29901_30860 318
1247 3300053135 Ga0500659_0046074 Ga0500659_0046074_459_1418 318
1248 3300053156 Ga0500622_0000308 Ga0500622_0000308_12730_13689 318
1249 3300053156 Ga0500622_0061320 Ga0500622_0061320_944_1903 318
1250 iso_pu_bacteria 2510917022 2511133098 318
1251 iso_pu_bacteria 2524023209 2524458620 318
1252 iso_pu_bacteria 2582581307 2585271835 318
1253 iso_pu_bacteria 2582581308 2585279799 318
1254 iso_pu_bacteria 2582581315 2585326661 318
1255 iso_pu_bacteria 2582581316 2585333827 318
1256 iso_pu_bacteria 2585427527 2585531797 318
1257 iso_pu_bacteria 2585427530 2585551255 318
1258 iso_pu_bacteria 2585427531 2585563799 318
1259 iso_pu_bacteria 2585427608 2585897003 318
1260 iso_pu_bacteria 2585427609 2585907138 318
1261 iso_pu_bacteria 2585428125 2587982868 318
1262 iso_pu_bacteria 2615840626 2616306590 318
1263 iso_pu_bacteria 2615840698 2616551227 318
1264 iso_pu_bacteria 2617270742 2617382978 318
1265 iso_pu_bacteria 2667528174 2671113351 318
1266 iso_pu_bacteria 2775507266 2778179042 318
1267 iso_pu_bacteria 2818991448 2819611636 318
1268 iso_pu_bacteria 2818991453 2819638686 318
1269 iso_pu_bacteria 2838029111 2838031063 318
1270 iso_pu_bacteria 2842298080 2842300119 318
1271 iso_pu_bacteria 2842357229 2842359030 318
1272 iso_pu_bacteria 2842475841 2842477795 318
1273 iso_pu_bacteria 2842482326 2842485092 318
1274 iso_pu_bacteria 2842502639 2842504333 318
1275 iso_pu_bacteria 2842509118 2842511552 318
1276 iso_pu_bacteria 2852387548 2852391907 318
1277 iso_pu_bacteria 2899803654 2899804633 318
1278 iso_pu_bacteria 2919408235 2919411194 318
1279 iso_pu_bacteria 3005416602 3005421490 318
1280 iso_pu_bacteria 8005314921 8005319807 318
1281 iso_pu_bacteria 8005484373 8005490432 318
1282 iso_pu_bacteria 8005645114 8005647075 318
1283 iso_pu_bacteria 8005682033 8005687005 318
1284 iso_pu_bacteria 8046767195 8046767402 318
1285 iso_pu_bacteria 8057575449 8057578462 318
1286 3300002773 JGI25152J39213_1000861 JGI25152J39213_10008617 319
1287 3300002773 JGI25152J39213_1001207 JGI25152J39213_10012078 319
1288 3300003775 Ga0055524_1014466 Ga0055524_10144663 319
1289 3300003775 Ga0055524_1021523 Ga0055524_10215232 319
1290 3300003790 Ga0055528_1000478 Ga0055528_100047812 319
1291 3300003792 Ga0055540_1026234 Ga0055540_10262341 319
1292 3300005262 Ga0065165_1015821 Ga0065165_10158212 319
1293 3300025258 Ga0209129_1000357 Ga0209129_100035718 319
1294 3300025273 Ga0209673_1000890 Ga0209673_100089016 319
1295 3300025292 Ga0209676_1029891 Ga0209676_10298912 319
1296 3300025294 Ga0209025_1001822 Ga0209025_100182220 319
1297 3300025297 Ga0209758_1037090 Ga0209758_10370902 319
1298 3300025299 Ga0209256_1001817 Ga0209256_100181713 319
1299 3300025303 Ga0209051_1062767 Ga0209051_10627672 319
1300 3300031901 Ga0307406_10010585 Ga0307406_100105853 319
1301 3300048909 Ga0496106_0175938 Ga0496106_0175938_222_1184 319
1302 3300048925 Ga0496122_0128499 Ga0496122_0128499_115_1077 319
1303 3300048929 Ga0496126_0214915 Ga0496126_0214915_644_1606 319
1304 3300046507 Ga0495606_0001613 Ga0495606_0001613_15359_16324 321
1305 3300046524 Ga0495648_0049708 Ga0495648_0049708_44_1009 321
1306 iso_pu_bacteria 3000017691 3000021223 321
1307 3300001979 JGI24740J21852_10009206 JGI24740J21852_100092062 322
1308 3300002704 JGI25155J39150_1000004 JGI25155J39150_1000004127 322
1309 3300002705 JGI25156J39149_1000014 JGI25156J39149_100001453 322
1310 3300002705 JGI25156J39149_1000015 JGI25156J39149_100001543 322
1311 3300002737 JGI25162J39368_1001203 JGI25162J39368_100120312 322
1312 3300002737 JGI25162J39368_1002942 JGI25162J39368_10029422 322
1313 3300002738 JGI25154J39366_1000026 JGI25154J39366_100002655 322
1314 3300002741 JGI25157J39369_1000005 JGI25157J39369_1000005136 322
1315 3300002987 JGI25159J45721_1000242 JGI25159J45721_100024212 322
1316 3300003214 JGI25165J46597_1001246 JGI25165J46597_10012462 322
1317 3300003214 JGI25165J46597_1002528 JGI25165J46597_10025282 322
1318 3300003322 rootL2_10112950 rootL2_101129504 322
1319 3300003354 JGI25160J50197_1000022 JGI25160J50197_100002240 322
1320 3300003374 JGI25161J50226_1000024 JGI25161J50226_100002492 322
1321 3300004625 Ga0055543_1000025 Ga0055543_100002540 322
1322 3300005262 Ga0065165_1000200 Ga0065165_100020040 322
1323 3300005578 Ga0068854_100206798 Ga0068854_1002067982 322
1324 3300005614 Ga0068856_100008285 Ga0068856_1000082855 322
1325 3300005616 Ga0068852_100092772 Ga0068852_1000927722 322
1326 3300006353 Ga0075370_10010473 Ga0075370_100104734 322
1327 3300009093 Ga0105240_10000013 Ga0105240_10000013360 322
1328 3300009545 Ga0105237_10010647 Ga0105237_100106472 322
1329 3300010375 Ga0105239_10116563 Ga0105239_101165632 322
1330 3300013104 Ga0157370_10003431 Ga0157370_1000343114 322
1331 3300014497 Ga0182008_10022222 Ga0182008_100222223 322
1332 3300015265 Ga0182005_1001647 Ga0182005_10016475 322
1333 3300025206 Ga0209435_100009 Ga0209435_100009133 322
1334 3300025208 Ga0209436_109131 Ga0209436_1091311 322
1335 3300025228 Ga0209672_102531 Ga0209672_1025312 322
1336 3300025233 Ga0209437_100057 Ga0209437_100057340 322
1337 3300025233 Ga0209437_100772 Ga0209437_1007722 322
1338 3300025246 Ga0209646_1000018 Ga0209646_1000018133 322
1339 3300025250 Ga0209026_1000043 Ga0209026_1000043133 322
1340 3300025253 Ga0209677_100426 Ga0209677_1004267 322
1341 3300025256 Ga0209759_1000007 Ga0209759_1000007133 322
1342 3300025261 Ga0209233_1000130 Ga0209233_1000130142 322
1343 3300025261 Ga0209233_1000255 Ga0209233_100025523 322
1344 3300025261 Ga0209233_1000332 Ga0209233_100033239 322
1345 3300025284 Ga0209130_1000164 Ga0209130_100016453 322
1346 3300025302 Ga0207426_1000082 Ga0207426_100008253 322
1347 3300025913 Ga0207695_10000044 Ga0207695_10000044317 322
1348 3300025914 Ga0207671_10000043 Ga0207671_10000043171 322
1349 3300025981 Ga0207640_10053820 Ga0207640_100538202 322
1350 3300026078 Ga0207702_10006190 Ga0207702_100061905 322
1351 3300026142 Ga0207698_10157080 Ga0207698_101570802 322
1352 3300027312 Ga0209371_1001347 Ga0209371_10013476 322
1353 3300030500 Ga0268256_1001200 Ga0268256_100120010 322
1354 3300059640 Ga0587067_000714 Ga0587067_000714_505_1473 322
1355 3300059647 Ga0587079_006606 Ga0587079_006606_431_1399 322
1356 3300059652 Ga0587107_001655 Ga0587107_001655_553_1521 322

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00528

BPD_transp_1

Binding-protein-dependent transport system inner membrane component

106

339

0.8

Structural Annotation

Top 5 Hits

ID Description Score Start End
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9344 34 311
8hpl-assembly1.cif.gz_A lpqy-sugabc in state 1 0.9262 34 310
7cad-assembly1.cif.gz_A mycobacterium smegmatis sugabc complex 0.9117 34 311
8ja7-assembly1.cif.gz_A cryo-em structure of mycobacterium tuberculosis lpqy-sugabc in complex with trehalose 0.9037 32 317
8hps-assembly1.cif.gz_A lpqy-sugabc in state 5 0.9005 34 310
ID Description Score Start End Superfamily
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9574 75 315 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9555 75 319 1.10.3720.10
af_P71896_49_286_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9516 75 319 1.10.3720.10
af_O53484_49_294_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9347 75 315 1.10.3720.10
af_P0AFR7_53_289_1.10.3720.10 Mainly Alpha;Orthogonal Bundle;MetI-like fold;MetI-like 0.9287 75 315 1.10.3720.10
ID Description Score Start End GO Terms
AF-A0A7V4SPS8-F1-model_v4 Sugar ABC transporter permease 0.984 189 310 GO:0005886
GO:0055085
AF-A0A0U1QYT1-F1-model_v4 Oligogalacturonide ABC tansporter, permease protein 0.9815 34 321 GO:0005886
GO:0055085
AF-A0A1E4DXD2-F1-model_v4 deleted 0.9791 28 322
AF-A0A2S0UH26-F1-model_v4 ABC transporter permease 0.9768 37 321 GO:0005886
GO:0055085
AF-A0A359EGJ3-F1-model_v4 ABC transporter permease 0.9686 58 321 GO:0005886
GO:0055085

Feature Viewer

pLDDT pTM Quality
84.54 0.8 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map