F493279
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1355 | 389 | 2710 | 325 |
Family's Representative Sequence
| Representative Sequence | 3300038443|Ga0395901_0224625|Ga0395901_0224625_543_1562 |
| Length | 339 |
| Sequence | MAEQDRFEMPELSYREAVRDALSQAMRQDDEVFIMGEDIAEMGGSMGVTQGMLDEFGPERVRNTPISEMALVGTGIGAAMQGMRPVVEVMYEDFLTLACEQIVNQAAKHRYMSGGQLKVPLTIRTQGGAGWSPGAQHAQQLEAWFVHIPGLKVVFASTPTDVRGLLWSAIYDDNPIIFFEHRTLYGLKEDVPDELEPIPIGQARVHRQGEDVTVVATGRLVHEALAAAEQAEDEGVSVEVVDPRTLQPLDEQTIVDSVKKTNRAVVAHEAVTRMGYGAELAAVIQHQAFDWLDAPIERVGAKFVPLPFAPVMEEYVVPHQAEVYEAIMRTVGRNGGQDQ |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 2 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 3 | 3300003373 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 4 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 5 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 6 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 7 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 8 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 9 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 10 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 11 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 12 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 13 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005406 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG | Metagenome | Rhizosphere |
| 18 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 19 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 20 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 21 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 22 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 23 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 24 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 26 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 27 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 31 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 32 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 33 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 34 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 35 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 36 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 37 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 38 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 39 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 44 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 45 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 46 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 47 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 49 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 50 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 51 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 52 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 53 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 54 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 55 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 56 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 57 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 58 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 59 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 60 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 61 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 62 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 64 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 65 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 66 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 67 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 68 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 69 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 70 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 71 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 72 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 73 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 74 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 75 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 76 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 77 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 78 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 79 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 80 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 81 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 82 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 83 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 84 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 85 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 86 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 87 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 88 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 89 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 90 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 91 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 92 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 93 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 94 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 95 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 96 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 97 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 98 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 99 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 100 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 101 | 3300020069 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 102 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 103 | 3300020078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-5 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 104 | 3300020080 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 105 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 106 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 107 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 108 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 109 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 110 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 113 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 114 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 115 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 116 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 117 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 118 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 119 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 120 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 121 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 122 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 123 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 124 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 125 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 126 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 127 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 128 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 129 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 130 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 131 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 132 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 133 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 134 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 135 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 136 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 137 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 156 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 160 | 3300028573 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG | Metagenome | Rhizosphere |
| 161 | 3300028577 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-21 metaG | Metagenome | Rhizosphere |
| 162 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 163 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 164 | 3300029957 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-19 metaG | Metagenome | Rhizosphere |
| 165 | 3300031235 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG | Metagenome | Rhizosphere |
| 166 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 167 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 168 | 3300031240 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-27 metaG | Metagenome | Rhizosphere |
| 169 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 170 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 171 | 3300031250 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG | Metagenome | Rhizosphere |
| 172 | 3300031251 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG | Metagenome | Rhizosphere |
| 173 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 174 | 3300031548 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-3 | Metagenome | Rhizosphere |
| 175 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 176 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 177 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 178 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 179 | 3300031824 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 | Metagenome | Rhizosphere |
| 180 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 181 | 3300031901 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-2 | Metagenome | Rhizosphere |
| 182 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 183 | 3300031911 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-1 | Metagenome | Rhizosphere |
| 184 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 185 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 186 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 187 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 188 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 189 | 3300034957 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 | Metagenome | Rhizosphere |
| 190 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 191 | 3300035085 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 | Metagenome | Rhizosphere |
| 192 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 193 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 194 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 195 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 196 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 197 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 198 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 199 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 200 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 201 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 202 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 203 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 204 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 205 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 206 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 207 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 208 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 209 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 210 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 211 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 212 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 213 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 214 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 215 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 216 | 3300038996 | Genetically engineered switchgrass root microbial communities from Knoxville, USA - plot19 | Metagenome | Rhizosphere |
| 217 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 218 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 219 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 220 | 3300041404 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0216DE14Z070717_5272 | Metagenome | Rhizosphere |
| 221 | 3300041406 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503DE14Z070717_5284 | Metagenome | Rhizosphere |
| 222 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 223 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 224 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 225 | 3300041492 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_2 MetaG | Metagenome | Unclassified |
| 226 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 227 | 3300041498 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_5 MetaG | Metagenome | Unclassified |
| 228 | 3300041501 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_7 MetaG | Metagenome | Unclassified |
| 229 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 230 | 3300041999 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0821WE14Z070717_5297 | Metagenome | Rhizosphere |
| 231 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 232 | 3300042007 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0612DE14Z070717_5290 | Metagenome | Rhizosphere |
| 233 | 3300042012 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 | Metagenome | Rhizosphere |
| 234 | 3300042119 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0218L_E14_082316_1902 | Metagenome | Rhizosphere |
| 235 | 3300042125 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926W_E14_082716_2472 | Metagenome | Rhizosphere |
| 236 | 3300042146 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0714D_E14_080116_2979 | Metagenome | Rhizosphere |
| 237 | 3300042147 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627W_E14_080116_2618 | Metagenome | Rhizosphere |
| 238 | 3300042156 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 | Metagenome | Rhizosphere |
| 239 | 3300042157 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 | Metagenome | Rhizosphere |
| 240 | 3300042435 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0503WE14Z082817_5613 | Metagenome | Rhizosphere |
| 241 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 242 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 243 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 244 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 245 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 246 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 247 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 248 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 249 | 3300044735 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA1R | Metagenome | Rhizosphere |
| 250 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 251 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 252 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 253 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 254 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 255 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 256 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 257 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 258 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 259 | 3300046460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere | Metagenome | Rhizosphere |
| 260 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 261 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 262 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 263 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 264 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 265 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 266 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 267 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 268 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 269 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 270 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 271 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 272 | 3300046500 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 rhizosphere | Metagenome | Rhizosphere |
| 273 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 274 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046514 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046525 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046642 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046692 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046694 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-847-Co2_69_13 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046794 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300047320 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300047445 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 321 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 322 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 323 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 324 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 325 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 326 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 327 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 328 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 329 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 330 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 331 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 332 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 333 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 334 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 335 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 336 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 337 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 338 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 339 | 3300049571 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 340 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 341 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 342 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 343 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 344 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 345 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 346 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 349 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 350 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 351 | 3300049583 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 | Metagenome | Rhizosphere |
| 352 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 353 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 354 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 358 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 359 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 360 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 362 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 366 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049823 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 368 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 376 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 377 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 378 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 379 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 380 | 3300053083 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere | Metagenome | Rhizosphere |
| 381 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 382 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 383 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 384 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 385 | 3300059421 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 6_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 386 | 3300059424 | Rhizosphere soil microbial communities from sorghum plant in University of Arizona Maricopa Agricultural Center, AZ, USA - 10_0-15_MAC_RHIZO_20210810 | Metagenome | Rhizosphere |
| 387 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 388 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 389 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.67 |
| Metatranscriptomes | 1.33 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.15 |
| Nodule | 0 |
| Rhizoplane | 11.07 |
| Rhizosphere | 88.27 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 31.66 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0395901_0224625 | 3300038443 | Bacteria | 1962 |
| 2 | JGI25406J46586_10028809 | 3300003203 | Unclassified | 2111 |
| 3 | JGI25407J50210_10004664 | 3300003373 | Bacteria | 3340 |
| 4 | Ga0070658_10005491 | 3300005327 | Bacteria | 10287 |
| 5 | Ga0070658_10006866 | 3300005327 | Bacteria | 9202 |
| 6 | Ga0070658_10079282 | 3300005327 | Unclassified | 2696 |
| 7 | Ga0070683_100002028 | 3300005329 | Bacteria | 15924 |
| 8 | Ga0070683_100003692 | 3300005329 | Bacteria | 12489 |
| 9 | Ga0070683_100021176 | 3300005329 | Bacteria | 5798 |
| 10 | Ga0070683_100040458 | 3300005329 | Unclassified | 4286 |
| 11 | Ga0070683_100084527 | 3300005329 | Unclassified | 2973 |
| 12 | Ga0070683_100539190 | 3300005329 | Bacteria | 1115 |
| 13 | Ga0070680_100009405 | 3300005336 | Bacteria | 7508 |
| 14 | Ga0070680_100022032 | 3300005336 | Bacteria | 5068 |
| 15 | Ga0070680_100045884 | 3300005336 | Bacteria | 3554 |
| 16 | Ga0070680_100367668 | 3300005336 | Bacteria | 1223 |
| 17 | Ga0070682_100006692 | 3300005337 | Bacteria | 6462 |
| 18 | Ga0070682_100009325 | 3300005337 | Bacteria | 5556 |
| 19 | Ga0068868_100055779 | 3300005338 | Unclassified | 3119 |
| 20 | Ga0068868_100059770 | 3300005338 | Bacteria | 3016 |
| 21 | Ga0070660_100002902 | 3300005339 | Bacteria | 11796 |
| 22 | Ga0070660_100029562 | 3300005339 | Bacteria | 4108 |
| 23 | Ga0070660_100070010 | 3300005339 | Bacteria | 2737 |
| 24 | Ga0070689_100141962 | 3300005340 | Unclassified | 1932 |
| 25 | Ga0070661_100006815 | 3300005344 | Bacteria | 7875 |
| 26 | Ga0070661_100131683 | 3300005344 | Unclassified | 1879 |
| 27 | Ga0070692_10026631 | 3300005345 | Unclassified | 2860 |
| 28 | Ga0070668_100046895 | 3300005347 | Bacteria | 3321 |
| 29 | Ga0070671_100065036 | 3300005355 | Bacteria | 3037 |
| 30 | Ga0070674_100032683 | 3300005356 | Unclassified | 3456 |
| 31 | Ga0070674_100080141 | 3300005356 | Bacteria | 2331 |
| 32 | Ga0070674_100345137 | 3300005356 | Unclassified | 1201 |
| 33 | Ga0070659_100023166 | 3300005366 | Bacteria | 4748 |
| 34 | Ga0070659_100047111 | 3300005366 | Unclassified | 3380 |
| 35 | Ga0070659_100068564 | 3300005366 | Unclassified | 2814 |
| 36 | Ga0070703_10003153 | 3300005406 | Bacteria | 4711 |
| 37 | Ga0070709_10263320 | 3300005434 | Unclassified | 1246 |
| 38 | Ga0070714_100019202 | 3300005435 | Bacteria | 5563 |
| 39 | Ga0070714_100025597 | 3300005435 | Bacteria | 4870 |
| 40 | Ga0070714_100032558 | 3300005435 | Bacteria | 4353 |
| 41 | Ga0070714_100072047 | 3300005435 | Unclassified | 2990 |
| 42 | Ga0070714_100079606 | 3300005435 | Unclassified | 2849 |
| 43 | Ga0070714_100087201 | 3300005435 | Unclassified | 2729 |
| 44 | Ga0070714_100227650 | 3300005435 | Unclassified | 1716 |
| 45 | Ga0070713_100031822 | 3300005436 | Unclassified | 4206 |
| 46 | Ga0070710_10010142 | 3300005437 | Unclassified | 4623 |
| 47 | Ga0070710_10022046 | 3300005437 | Unclassified | 3327 |
| 48 | Ga0070710_10023678 | 3300005437 | Unclassified | 3230 |
| 49 | Ga0070710_10034698 | 3300005437 | Unclassified | 2746 |
| 50 | Ga0070701_10001044 | 3300005438 | Bacteria | 10106 |
| 51 | Ga0070701_10120712 | 3300005438 | Unclassified | 1476 |
| 52 | Ga0070711_100032439 | 3300005439 | Bacteria | 3473 |
| 53 | Ga0070711_100046025 | 3300005439 | Bacteria | 2970 |
| 54 | Ga0070711_100091587 | 3300005439 | Unclassified | 2192 |
| 55 | Ga0070711_100121841 | 3300005439 | Unclassified | 1930 |
| 56 | Ga0070705_100008024 | 3300005440 | Bacteria | 5219 |
| 57 | Ga0070705_100031784 | 3300005440 | Unclassified | 2926 |
| 58 | Ga0070700_100009552 | 3300005441 | Bacteria | 5332 |
| 59 | Ga0070694_100096826 | 3300005444 | Bacteria | 2081 |
| 60 | Ga0070694_100106475 | 3300005444 | Bacteria | 1991 |
| 61 | Ga0070694_100130213 | 3300005444 | Bacteria | 1817 |
| 62 | Ga0070708_100009352 | 3300005445 | Bacteria | 7900 |
| 63 | Ga0070708_100078602 | 3300005445 | Unclassified | 2982 |
| 64 | Ga0070708_100175721 | 3300005445 | Bacteria | 2001 |
| 65 | Ga0070678_100046159 | 3300005456 | Unclassified | 3122 |
| 66 | Ga0070662_100135120 | 3300005457 | Bacteria | 1906 |
| 67 | Ga0070681_10000616 | 3300005458 | Bacteria | 29195 |
| 68 | Ga0070681_10001900 | 3300005458 | Bacteria | 18852 |
| 69 | Ga0070681_10005995 | 3300005458 | Bacteria | 11779 |
| 70 | Ga0070681_10020763 | 3300005458 | Bacteria | 6580 |
| 71 | Ga0070681_10045315 | 3300005458 | Bacteria | 4401 |
| 72 | Ga0070681_10083838 | 3300005458 | Unclassified | 3140 |
| 73 | Ga0070681_10096894 | 3300005458 | Unclassified | 2897 |
| 74 | Ga0070681_10138064 | 3300005458 | Unclassified | 2367 |
| 75 | Ga0070681_10236251 | 3300005458 | Unclassified | 1742 |
| 76 | Ga0070681_10334238 | 3300005458 | Unclassified | 1424 |
| 77 | Ga0070681_10360665 | 3300005458 | Bacteria | 1364 |
| 78 | Ga0070681_10596637 | 3300005458 | Bacteria | 1019 |
| 79 | Ga0068867_100008488 | 3300005459 | Bacteria | 7251 |
| 80 | Ga0070685_10029915 | 3300005466 | Unclassified | 3029 |
| 81 | Ga0070707_100000275 | 3300005468 | Bacteria | 50555 |
| 82 | Ga0070707_100003029 | 3300005468 | Bacteria | 15935 |
| 83 | Ga0070707_100028647 | 3300005468 | Bacteria | 5300 |
| 84 | Ga0070698_100004541 | 3300005471 | Bacteria | 15252 |
| 85 | Ga0070698_100140279 | 3300005471 | Bacteria | 2369 |
| 86 | Ga0070698_100245436 | 3300005471 | Unclassified | 1723 |
| 87 | Ga0070679_100002700 | 3300005530 | Bacteria | 16150 |
| 88 | Ga0070679_100012530 | 3300005530 | Bacteria | 8109 |
| 89 | Ga0070679_100105984 | 3300005530 | Bacteria | 2797 |
| 90 | Ga0070679_100122923 | 3300005530 | Unclassified | 2579 |
| 91 | Ga0070679_100316705 | 3300005530 | Unclassified | 1510 |
| 92 | Ga0070679_100398703 | 3300005530 | Unclassified | 1322 |
| 93 | Ga0070679_100421920 | 3300005530 | Bacteria | 1279 |
| 94 | Ga0070679_100445498 | 3300005530 | Unclassified | 1240 |
| 95 | Ga0070684_100010614 | 3300005535 | Bacteria | 7305 |
| 96 | Ga0070684_100011191 | 3300005535 | Bacteria | 7142 |
| 97 | Ga0070684_100014749 | 3300005535 | Bacteria | 6341 |
| 98 | Ga0070684_100018945 | 3300005535 | Bacteria | 5683 |
| 99 | Ga0070684_100098480 | 3300005535 | Bacteria | 2609 |
| 100 | Ga0070686_100147224 | 3300005544 | Bacteria | 1645 |
| 101 | Ga0070695_100081335 | 3300005545 | Unclassified | 2143 |
| 102 | Ga0070696_100024272 | 3300005546 | Unclassified | 4120 |
| 103 | Ga0070696_100045589 | 3300005546 | Unclassified | 3038 |
| 104 | Ga0070696_100128818 | 3300005546 | Bacteria | 1839 |
| 105 | Ga0070693_100157787 | 3300005547 | Bacteria | 1442 |
| 106 | Ga0070665_100047376 | 3300005548 | Bacteria | 4315 |
| 107 | Ga0070704_100023177 | 3300005549 | Unclassified | 4049 |
| 108 | Ga0070704_100038451 | 3300005549 | Bacteria | 3279 |
| 109 | Ga0070704_100060691 | 3300005549 | Unclassified | 2702 |
| 110 | Ga0068855_100229631 | 3300005563 | Unclassified | 2079 |
| 111 | Ga0068855_100230999 | 3300005563 | Bacteria | 2071 |
| 112 | Ga0068857_100008075 | 3300005577 | Bacteria | 9080 |
| 113 | Ga0068857_100009831 | 3300005577 | Bacteria | 8309 |
| 114 | Ga0068857_100315976 | 3300005577 | Unclassified | 1442 |
| 115 | Ga0068857_100445905 | 3300005577 | Bacteria | 1209 |
| 116 | Ga0068854_100107201 | 3300005578 | Unclassified | 2103 |
| 117 | Ga0068856_100096391 | 3300005614 | Unclassified | 2947 |
| 118 | Ga0070702_100001212 | 3300005615 | Bacteria | 10439 |
| 119 | Ga0068852_100270309 | 3300005616 | Unclassified | 1636 |
| 120 | Ga0068859_100038040 | 3300005617 | Unclassified | 4829 |
| 121 | Ga0068866_10003462 | 3300005718 | Bacteria | 6463 |
| 122 | Ga0068866_10167266 | 3300005718 | Unclassified | 1288 |
| 123 | Ga0068861_100044911 | 3300005719 | Unclassified | 3324 |
| 124 | Ga0068861_100050347 | 3300005719 | Bacteria | 3159 |
| 125 | Ga0068861_100209609 | 3300005719 | Unclassified | 1641 |
| 126 | Ga0068858_100143785 | 3300005842 | Unclassified | 2240 |
| 127 | Ga0068860_100104005 | 3300005843 | Unclassified | 2711 |
| 128 | Ga0068862_100200362 | 3300005844 | Bacteria | 1800 |
| 129 | Ga0081455_10007511 | 3300005937 | Bacteria | 11466 |
| 130 | Ga0081455_10012069 | 3300005937 | Bacteria | 8641 |
| 131 | Ga0081455_10020700 | 3300005937 | Bacteria | 6186 |
| 132 | Ga0081455_10023070 | 3300005937 | Bacteria | 5797 |
| 133 | Ga0081455_10046168 | 3300005937 | Bacteria | 3782 |
| 134 | Ga0081455_10066557 | 3300005937 | Unclassified | 3008 |
| 135 | Ga0081455_10076887 | 3300005937 | Bacteria | 2748 |
| 136 | Ga0081455_10085572 | 3300005937 | Unclassified | 2571 |
| 137 | Ga0081455_10150864 | 3300005937 | Bacteria | 1792 |
| 138 | Ga0081455_10237473 | 3300005937 | Bacteria | 1341 |
| 139 | Ga0081538_10000081 | 3300005981 | Bacteria | 92176 |
| 140 | Ga0081538_10001520 | 3300005981 | Bacteria | 23798 |
| 141 | Ga0081538_10001954 | 3300005981 | Bacteria | 20648 |
| 142 | Ga0081538_10001983 | 3300005981 | Bacteria | 20439 |
| 143 | Ga0081538_10009602 | 3300005981 | Bacteria | 8050 |
| 144 | Ga0081538_10011592 | 3300005981 | Bacteria | 7131 |
| 145 | Ga0081538_10015038 | 3300005981 | Bacteria | 6019 |
| 146 | Ga0081538_10020089 | 3300005981 | Bacteria | 4934 |
| 147 | Ga0081538_10047927 | 3300005981 | Bacteria | 2614 |
| 148 | Ga0081538_10132060 | 3300005981 | Unclassified | 1171 |
| 149 | Ga0081540_1001698 | 3300005983 | Bacteria | 18681 |
| 150 | Ga0081540_1006573 | 3300005983 | Bacteria | 8436 |
| 151 | Ga0081539_10000030 | 3300005985 | Bacteria | 317236 |
| 152 | Ga0081539_10002638 | 3300005985 | Bacteria | 24507 |
| 153 | Ga0081539_10008967 | 3300005985 | Bacteria | 8513 |
| 154 | Ga0081539_10010159 | 3300005985 | Bacteria | 7716 |
| 155 | Ga0081539_10027467 | 3300005985 | Unclassified | 3604 |
| 156 | Ga0081539_10032423 | 3300005985 | Unclassified | 3200 |
| 157 | Ga0081539_10080928 | 3300005985 | Unclassified | 1707 |
| 158 | Ga0070717_10040450 | 3300006028 | Bacteria | 3797 |
| 159 | Ga0070717_10048662 | 3300006028 | Unclassified | 3478 |
| 160 | Ga0070717_10051942 | 3300006028 | Bacteria | 3375 |
| 161 | Ga0070717_10389995 | 3300006028 | Bacteria | 1250 |
| 162 | Ga0075365_10033550 | 3300006038 | Unclassified | 3309 |
| 163 | Ga0070715_10001432 | 3300006163 | Bacteria | 6907 |
| 164 | Ga0070716_100007454 | 3300006173 | Bacteria | 5389 |
| 165 | Ga0070716_100269294 | 3300006173 | Unclassified | 1169 |
| 166 | Ga0070712_100011911 | 3300006175 | Bacteria | 5526 |
| 167 | Ga0070712_100015454 | 3300006175 | Unclassified | 4919 |
| 168 | Ga0070712_100017694 | 3300006175 | Bacteria | 4617 |
| 169 | Ga0070712_100033450 | 3300006175 | Bacteria | 3479 |
| 170 | Ga0097621_100004581 | 3300006237 | Bacteria | 9646 |
| 171 | Ga0068871_100010878 | 3300006358 | Bacteria | 6662 |
| 172 | Ga0068871_100198551 | 3300006358 | Unclassified | 1731 |
| 173 | Ga0075428_100013380 | 3300006844 | Bacteria | 9127 |
| 174 | Ga0075428_100026425 | 3300006844 | Bacteria | 6426 |
| 175 | Ga0075428_100097188 | 3300006844 | Unclassified | 3211 |
| 176 | Ga0075428_100331495 | 3300006844 | Bacteria | 1634 |
| 177 | Ga0075430_100024112 | 3300006846 | Bacteria | 5180 |
| 178 | Ga0075430_100024840 | 3300006846 | Bacteria | 5097 |
| 179 | Ga0075430_100038596 | 3300006846 | Bacteria | 4044 |
| 180 | Ga0075430_100065471 | 3300006846 | Bacteria | 3053 |
| 181 | Ga0075430_100112818 | 3300006846 | Unclassified | 2266 |
| 182 | Ga0075431_100178226 | 3300006847 | Bacteria | 2182 |
| 183 | Ga0075433_10009587 | 3300006852 | Bacteria | 7746 |
| 184 | Ga0075434_100000729 | 3300006871 | Bacteria | 25799 |
| 185 | Ga0075434_100009715 | 3300006871 | Bacteria | 8989 |
| 186 | Ga0075434_100045049 | 3300006871 | Unclassified | 4376 |
| 187 | Ga0075434_100045839 | 3300006871 | Bacteria | 4338 |
| 188 | Ga0075434_100170920 | 3300006871 | Unclassified | 2193 |
| 189 | Ga0075429_100042708 | 3300006880 | Bacteria | 3945 |
| 190 | Ga0068865_100055840 | 3300006881 | Unclassified | 2749 |
| 191 | Ga0068865_100217869 | 3300006881 | Unclassified | 1491 |
| 192 | Ga0068865_100269277 | 3300006881 | Bacteria | 1352 |
| 193 | Ga0075436_100030875 | 3300006914 | Bacteria | 3688 |
| 194 | Ga0075436_100107098 | 3300006914 | Unclassified | 1950 |
| 195 | Ga0075436_100112213 | 3300006914 | Bacteria | 1903 |
| 196 | Ga0075436_100122023 | 3300006914 | Bacteria | 1824 |
| 197 | Ga0097620_100038042 | 3300006931 | Unclassified | 4829 |
| 198 | Ga0075435_100000976 | 3300007076 | Bacteria | 18093 |
| 199 | Ga0075435_100045409 | 3300007076 | Bacteria | 3521 |
| 200 | Ga0075435_100045559 | 3300007076 | Bacteria | 3516 |
| 201 | Ga0075435_100089777 | 3300007076 | Bacteria | 2534 |
| 202 | Ga0075435_100168120 | 3300007076 | Unclassified | 1849 |
| 203 | Ga0105240_10030156 | 3300009093 | Bacteria | 7054 |
| 204 | Ga0105240_10035032 | 3300009093 | Bacteria | 6472 |
| 205 | Ga0105240_10364592 | 3300009093 | Bacteria | 1635 |
| 206 | Ga0111539_10012237 | 3300009094 | Bacteria | 10760 |
| 207 | Ga0111539_10094954 | 3300009094 | Bacteria | 3503 |
| 208 | Ga0111539_10141256 | 3300009094 | Bacteria | 2819 |
| 209 | Ga0111539_10336792 | 3300009094 | Bacteria | 1756 |
| 210 | Ga0111539_10374000 | 3300009094 | Bacteria | 1659 |
| 211 | Ga0111539_10442962 | 3300009094 | Bacteria | 1512 |
| 212 | Ga0105245_10007926 | 3300009098 | Bacteria | 9289 |
| 213 | Ga0105245_10008291 | 3300009098 | Bacteria | 9079 |
| 214 | Ga0105245_10026991 | 3300009098 | Bacteria | 5057 |
| 215 | Ga0105245_10038598 | 3300009098 | Unclassified | 4249 |
| 216 | Ga0105245_10388629 | 3300009098 | Unclassified | 1391 |
| 217 | Ga0114129_10124430 | 3300009147 | Bacteria | 3546 |
| 218 | Ga0114129_10140093 | 3300009147 | Bacteria | 3316 |
| 219 | Ga0114129_10206005 | 3300009147 | Bacteria | 2661 |
| 220 | Ga0114129_10210978 | 3300009147 | Bacteria | 2625 |
| 221 | Ga0105243_10090565 | 3300009148 | Unclassified | 2517 |
| 222 | Ga0105243_10165568 | 3300009148 | Bacteria | 1910 |
| 223 | Ga0105243_10262632 | 3300009148 | Unclassified | 1546 |
| 224 | Ga0105243_10334959 | 3300009148 | Unclassified | 1384 |
| 225 | Ga0105243_10450026 | 3300009148 | Bacteria | 1208 |
| 226 | Ga0105242_10027683 | 3300009176 | Bacteria | 4504 |
| 227 | Ga0105248_10040999 | 3300009177 | Bacteria | 5191 |
| 228 | Ga0105248_10052503 | 3300009177 | Bacteria | 4574 |
| 229 | Ga0105248_10445480 | 3300009177 | Bacteria | 1459 |
| 230 | Ga0105248_10450810 | 3300009177 | Unclassified | 1450 |
| 231 | Ga0105237_10226159 | 3300009545 | Bacteria | 1871 |
| 232 | Ga0105237_10268629 | 3300009545 | Unclassified | 1709 |
| 233 | Ga0105237_10371074 | 3300009545 | Unclassified | 1436 |
| 234 | Ga0105238_10050648 | 3300009551 | Unclassified | 4180 |
| 235 | Ga0105238_10352210 | 3300009551 | Unclassified | 1461 |
| 236 | Ga0105249_10001940 | 3300009553 | Bacteria | 17962 |
| 237 | Ga0105249_10159499 | 3300009553 | Bacteria | 2178 |
| 238 | Ga0105239_10093255 | 3300010375 | Unclassified | 3324 |
| 239 | Ga0105239_10178925 | 3300010375 | Bacteria | 2372 |
| 240 | Ga0105239_10316800 | 3300010375 | Bacteria | 1758 |
| 241 | Ga0105246_10307014 | 3300011119 | Bacteria | 1283 |
| 242 | Ga0157373_10085233 | 3300013100 | Unclassified | 2227 |
| 243 | Ga0157370_10017998 | 3300013104 | Bacteria | 7111 |
| 244 | Ga0157370_10019185 | 3300013104 | Bacteria | 6873 |
| 245 | Ga0157370_10067245 | 3300013104 | Bacteria | 3387 |
| 246 | Ga0157370_10083141 | 3300013104 | Unclassified | 3011 |
| 247 | Ga0157370_10313418 | 3300013104 | Unclassified | 1447 |
| 248 | Ga0157369_10004273 | 3300013105 | Bacteria | 16886 |
| 249 | Ga0157369_10016108 | 3300013105 | Bacteria | 8412 |
| 250 | Ga0157369_10116667 | 3300013105 | Unclassified | 2834 |
| 251 | Ga0157369_10267887 | 3300013105 | Unclassified | 1781 |
| 252 | Ga0157374_10463315 | 3300013296 | Unclassified | 1269 |
| 253 | Ga0157378_10179450 | 3300013297 | Bacteria | 1991 |
| 254 | Ga0163162_10011361 | 3300013306 | Bacteria | 8681 |
| 255 | Ga0163162_10479924 | 3300013306 | Unclassified | 1375 |
| 256 | Ga0157372_10007666 | 3300013307 | Bacteria | 11479 |
| 257 | Ga0157372_10035919 | 3300013307 | Bacteria | 5457 |
| 258 | Ga0157372_10085735 | 3300013307 | Bacteria | 3573 |
| 259 | Ga0157375_10215041 | 3300013308 | Bacteria | 2080 |
| 260 | Ga0163163_10100218 | 3300014325 | Bacteria | 2919 |
| 261 | Ga0163163_10409392 | 3300014325 | Bacteria | 1415 |
| 262 | Ga0182008_10093412 | 3300014497 | Unclassified | 1484 |
| 263 | Ga0182008_10142343 | 3300014497 | Unclassified | 1200 |
| 264 | Ga0157377_10022058 | 3300014745 | Unclassified | 3358 |
| 265 | Ga0157376_10089796 | 3300014969 | Unclassified | 2657 |
| 266 | Ga0157376_10122395 | 3300014969 | Unclassified | 2308 |
| 267 | Ga0163161_10092494 | 3300017792 | Unclassified | 2239 |
| 268 | Ga0197907_10106361 | 3300020069 | Bacteria | 2775 |
| 269 | Ga0197907_10330051 | 3300020069 | Bacteria | 1625 |
| 270 | Ga0197907_10820005 | 3300020069 | Bacteria | 5897 |
| 271 | Ga0206356_10113963 | 3300020070 | Unclassified | 1826 |
| 272 | Ga0206356_10242924 | 3300020070 | Unclassified | 3049 |
| 273 | Ga0206356_10590513 | 3300020070 | Bacteria | 9780 |
| 274 | Ga0206352_10245129 | 3300020078 | Bacteria | 2065 |
| 275 | Ga0206352_11359820 | 3300020078 | Unclassified | 2247 |
| 276 | Ga0206350_11418746 | 3300020080 | Unclassified | 2735 |
| 277 | Ga0206354_10590308 | 3300020081 | Unclassified | 1200 |
| 278 | Ga0206354_11269992 | 3300020081 | Unclassified | 1734 |
| 279 | Ga0206353_10009509 | 3300020082 | Bacteria | 6204 |
| 280 | Ga0206353_10033590 | 3300020082 | Bacteria | 1507 |
| 281 | Ga0206353_10071829 | 3300020082 | Bacteria | 5815 |
| 282 | Ga0206353_10125552 | 3300020082 | Bacteria | 7745 |
| 283 | Ga0206353_10734720 | 3300020082 | Unclassified | 1982 |
| 284 | Ga0213876_10052220 | 3300021384 | Bacteria | 2161 |
| 285 | Ga0224712_10016708 | 3300022467 | Bacteria | 2417 |
| 286 | Ga0224712_10083862 | 3300022467 | Unclassified | 1321 |
| 287 | Ga0207653_10015876 | 3300025885 | Bacteria | 2363 |
| 288 | Ga0207653_10070340 | 3300025885 | Unclassified | 1195 |
| 289 | Ga0207692_10078372 | 3300025898 | Unclassified | 1760 |
| 290 | Ga0207688_10051689 | 3300025901 | Unclassified | 2302 |
| 291 | Ga0207688_10110421 | 3300025901 | Bacteria | 1596 |
| 292 | Ga0207685_10013181 | 3300025905 | Bacteria | 2549 |
| 293 | Ga0207685_10023299 | 3300025905 | Unclassified | 2106 |
| 294 | Ga0207699_10046711 | 3300025906 | Bacteria | 2534 |
| 295 | Ga0207645_10139088 | 3300025907 | Bacteria | 1582 |
| 296 | Ga0207643_10018169 | 3300025908 | Bacteria | 3851 |
| 297 | Ga0207705_10024856 | 3300025909 | Bacteria | 4275 |
| 298 | Ga0207705_10050418 | 3300025909 | Unclassified | 2996 |
| 299 | Ga0207705_10071992 | 3300025909 | Bacteria | 2506 |
| 300 | Ga0207654_10013679 | 3300025911 | Bacteria | 4178 |
| 301 | Ga0207707_10001844 | 3300025912 | Bacteria | 19420 |
| 302 | Ga0207707_10002240 | 3300025912 | Bacteria | 17485 |
| 303 | Ga0207707_10007327 | 3300025912 | Bacteria | 9610 |
| 304 | Ga0207707_10008429 | 3300025912 | Bacteria | 8940 |
| 305 | Ga0207707_10011363 | 3300025912 | Bacteria | 7753 |
| 306 | Ga0207707_10051859 | 3300025912 | Unclassified | 3573 |
| 307 | Ga0207707_10108566 | 3300025912 | Bacteria | 2426 |
| 308 | Ga0207707_10168799 | 3300025912 | Bacteria | 1912 |
| 309 | Ga0207707_10343834 | 3300025912 | Bacteria | 1286 |
| 310 | Ga0207695_10014102 | 3300025913 | Bacteria | 9489 |
| 311 | Ga0207695_10474365 | 3300025913 | Bacteria | 1133 |
| 312 | Ga0207671_10253055 | 3300025914 | Unclassified | 1385 |
| 313 | Ga0207693_10001413 | 3300025915 | Bacteria | 21296 |
| 314 | Ga0207693_10003121 | 3300025915 | Bacteria | 14264 |
| 315 | Ga0207693_10005575 | 3300025915 | Bacteria | 10476 |
| 316 | Ga0207693_10013689 | 3300025915 | Bacteria | 6535 |
| 317 | Ga0207693_10017496 | 3300025915 | Bacteria | 5716 |
| 318 | Ga0207693_10055006 | 3300025915 | Unclassified | 3122 |
| 319 | Ga0207693_10091537 | 3300025915 | Unclassified | 2384 |
| 320 | Ga0207693_10095486 | 3300025915 | Bacteria | 2331 |
| 321 | Ga0207693_10161147 | 3300025915 | Unclassified | 1765 |
| 322 | Ga0207663_10012436 | 3300025916 | Unclassified | 4602 |
| 323 | Ga0207663_10038622 | 3300025916 | Unclassified | 2887 |
| 324 | Ga0207663_10042383 | 3300025916 | Bacteria | 2780 |
| 325 | Ga0207663_10125436 | 3300025916 | Unclassified | 1765 |
| 326 | Ga0207660_10033106 | 3300025917 | Unclassified | 3572 |
| 327 | Ga0207660_10036022 | 3300025917 | Bacteria | 3438 |
| 328 | Ga0207660_10269555 | 3300025917 | Bacteria | 1348 |
| 329 | Ga0207657_10001894 | 3300025919 | Bacteria | 22600 |
| 330 | Ga0207657_10003027 | 3300025919 | Bacteria | 18001 |
| 331 | Ga0207657_10006053 | 3300025919 | Bacteria | 12579 |
| 332 | Ga0207649_10077574 | 3300025920 | Unclassified | 2141 |
| 333 | Ga0207649_10101293 | 3300025920 | Unclassified | 1907 |
| 334 | Ga0207652_10026187 | 3300025921 | Bacteria | 4854 |
| 335 | Ga0207652_10035205 | 3300025921 | Unclassified | 4224 |
| 336 | Ga0207652_10037841 | 3300025921 | Bacteria | 4085 |
| 337 | Ga0207652_10048430 | 3300025921 | Bacteria | 3633 |
| 338 | Ga0207652_10056783 | 3300025921 | Bacteria | 3370 |
| 339 | Ga0207652_10105719 | 3300025921 | Unclassified | 2491 |
| 340 | Ga0207652_10126683 | 3300025921 | Bacteria | 2275 |
| 341 | Ga0207652_10179377 | 3300025921 | Unclassified | 1903 |
| 342 | Ga0207652_10494532 | 3300025921 | Unclassified | 1101 |
| 343 | Ga0207646_10000523 | 3300025922 | Bacteria | 51093 |
| 344 | Ga0207646_10023032 | 3300025922 | Bacteria | 5727 |
| 345 | Ga0207646_10073322 | 3300025922 | Bacteria | 3058 |
| 346 | Ga0207687_10005471 | 3300025927 | Bacteria | 8397 |
| 347 | Ga0207687_10174665 | 3300025927 | Bacteria | 1660 |
| 348 | Ga0207687_10379483 | 3300025927 | Unclassified | 1158 |
| 349 | Ga0207700_10000004 | 3300025928 | Bacteria | 443409 |
| 350 | Ga0207664_10017800 | 3300025929 | Bacteria | 5220 |
| 351 | Ga0207664_10024516 | 3300025929 | Bacteria | 4534 |
| 352 | Ga0207664_10034516 | 3300025929 | Unclassified | 3896 |
| 353 | Ga0207664_10036721 | 3300025929 | Bacteria | 3787 |
| 354 | Ga0207664_10054523 | 3300025929 | Unclassified | 3168 |
| 355 | Ga0207664_10062133 | 3300025929 | Unclassified | 2982 |
| 356 | Ga0207644_10182549 | 3300025931 | Bacteria | 1645 |
| 357 | Ga0207706_10185370 | 3300025933 | Bacteria | 1828 |
| 358 | Ga0207686_10121051 | 3300025934 | Bacteria | 1782 |
| 359 | Ga0207686_10349680 | 3300025934 | Unclassified | 1112 |
| 360 | Ga0207709_10057598 | 3300025935 | Unclassified | 2410 |
| 361 | Ga0207709_10311664 | 3300025935 | Bacteria | 1174 |
| 362 | Ga0207670_10132248 | 3300025936 | Unclassified | 1830 |
| 363 | Ga0207669_10043630 | 3300025937 | Bacteria | 2628 |
| 364 | Ga0207704_10096790 | 3300025938 | Unclassified | 1955 |
| 365 | Ga0207665_10001593 | 3300025939 | Bacteria | 15278 |
| 366 | Ga0207665_10016651 | 3300025939 | Bacteria | 4828 |
| 367 | Ga0207665_10090565 | 3300025939 | Bacteria | 2120 |
| 368 | Ga0207691_10047074 | 3300025940 | Bacteria | 3960 |
| 369 | Ga0207711_10164193 | 3300025941 | Unclassified | 2012 |
| 370 | Ga0207711_10374339 | 3300025941 | Unclassified | 1321 |
| 371 | Ga0207689_10056673 | 3300025942 | Bacteria | 3225 |
| 372 | Ga0207661_10000267 | 3300025944 | Bacteria | 33777 |
| 373 | Ga0207661_10017857 | 3300025944 | Bacteria | 5259 |
| 374 | Ga0207661_10053411 | 3300025944 | Unclassified | 3233 |
| 375 | Ga0207661_10128634 | 3300025944 | Bacteria | 2166 |
| 376 | Ga0207661_10182457 | 3300025944 | Unclassified | 1834 |
| 377 | Ga0207679_10160328 | 3300025945 | Unclassified | 1841 |
| 378 | Ga0207679_10355151 | 3300025945 | Unclassified | 1279 |
| 379 | Ga0207667_10034152 | 3300025949 | Bacteria | 5464 |
| 380 | Ga0207667_10123109 | 3300025949 | Bacteria | 2672 |
| 381 | Ga0207712_10008916 | 3300025961 | Bacteria | 6342 |
| 382 | Ga0207712_10129879 | 3300025961 | Bacteria | 1918 |
| 383 | Ga0207678_10095509 | 3300026067 | Unclassified | 2540 |
| 384 | Ga0207708_10006281 | 3300026075 | Bacteria | 8805 |
| 385 | Ga0207702_10023561 | 3300026078 | Bacteria | 5106 |
| 386 | Ga0207702_10129319 | 3300026078 | Unclassified | 2271 |
| 387 | Ga0207702_10143188 | 3300026078 | Bacteria | 2166 |
| 388 | Ga0207702_10239714 | 3300026078 | Unclassified | 1699 |
| 389 | Ga0207648_10012851 | 3300026089 | Bacteria | 7819 |
| 390 | Ga0207676_10184909 | 3300026095 | Bacteria | 1828 |
| 391 | Ga0207674_10008380 | 3300026116 | Bacteria | 11954 |
| 392 | Ga0207674_10025394 | 3300026116 | Bacteria | 6319 |
| 393 | Ga0207674_10029599 | 3300026116 | Bacteria | 5765 |
| 394 | Ga0207674_10272149 | 3300026116 | Bacteria | 1641 |
| 395 | Ga0207674_10275950 | 3300026116 | Unclassified | 1629 |
| 396 | Ga0207675_100055353 | 3300026118 | Bacteria | 3700 |
| 397 | Ga0207675_100064904 | 3300026118 | Unclassified | 3413 |
| 398 | Ga0207675_100142668 | 3300026118 | Bacteria | 2276 |
| 399 | Ga0207675_100199385 | 3300026118 | Unclassified | 1922 |
| 400 | Ga0207675_100337053 | 3300026118 | Unclassified | 1476 |
| 401 | Ga0207683_10066984 | 3300026121 | Unclassified | 3167 |
| 402 | Ga0207683_10227052 | 3300026121 | Bacteria | 1702 |
| 403 | Ga0207683_10399770 | 3300026121 | Bacteria | 1264 |
| 404 | Ga0207698_10057989 | 3300026142 | Bacteria | 2998 |
| 405 | Ga0207428_10005283 | 3300027907 | Bacteria | 12063 |
| 406 | Ga0207428_10035476 | 3300027907 | Unclassified | 4076 |
| 407 | Ga0207428_10049047 | 3300027907 | Bacteria | 3385 |
| 408 | Ga0207428_10121810 | 3300027907 | Bacteria | 2000 |
| 409 | Ga0268266_10181148 | 3300028379 | Bacteria | 1918 |
| 410 | Ga0268265_10155758 | 3300028380 | Unclassified | 1933 |
| 411 | Ga0268264_10031765 | 3300028381 | Unclassified | 4330 |
| 412 | Ga0265319_1003960 | 3300028563 | Bacteria | 7519 |
| 413 | Ga0265319_1035728 | 3300028563 | Unclassified | 1703 |
| 414 | Ga0265319_1054278 | 3300028563 | Unclassified | 1314 |
| 415 | Ga0265334_10005568 | 3300028573 | Bacteria | 5502 |
| 416 | Ga0265334_10010959 | 3300028573 | Unclassified | 3825 |
| 417 | Ga0265334_10063019 | 3300028573 | Bacteria | 1394 |
| 418 | Ga0265318_10000400 | 3300028577 | Bacteria | 33867 |
| 419 | Ga0265318_10010787 | 3300028577 | Bacteria | 3964 |
| 420 | Ga0265336_10000644 | 3300028666 | Bacteria | 19049 |
| 421 | Ga0265338_10002401 | 3300028800 | Bacteria | 28171 |
| 422 | Ga0265338_10003454 | 3300028800 | Bacteria | 22238 |
| 423 | Ga0265338_10003802 | 3300028800 | Bacteria | 20990 |
| 424 | Ga0265338_10017148 | 3300028800 | Bacteria | 7824 |
| 425 | Ga0265338_10020068 | 3300028800 | Bacteria | 7048 |
| 426 | Ga0265338_10027944 | 3300028800 | Bacteria | 5644 |
| 427 | Ga0265338_10028585 | 3300028800 | Bacteria | 5556 |
| 428 | Ga0265338_10053100 | 3300028800 | Bacteria | 3629 |
| 429 | Ga0265338_10335101 | 3300028800 | Unclassified | 1091 |
| 430 | Ga0265324_10033189 | 3300029957 | Unclassified | 1802 |
| 431 | Ga0265330_10001899 | 3300031235 | Bacteria | 11622 |
| 432 | Ga0265332_10003587 | 3300031238 | Bacteria | 7443 |
| 433 | Ga0265332_10119076 | 3300031238 | Unclassified | 1109 |
| 434 | Ga0265328_10007322 | 3300031239 | Unclassified | 4608 |
| 435 | Ga0265320_10024124 | 3300031240 | Bacteria | 3224 |
| 436 | Ga0265320_10072741 | 3300031240 | Bacteria | 1617 |
| 437 | Ga0265325_10004124 | 3300031241 | Bacteria | 9242 |
| 438 | Ga0265325_10024520 | 3300031241 | Unclassified | 3281 |
| 439 | Ga0265339_10019835 | 3300031249 | Unclassified | 3937 |
| 440 | Ga0265331_10016699 | 3300031250 | Unclassified | 3846 |
| 441 | Ga0265331_10035024 | 3300031250 | Unclassified | 2472 |
| 442 | Ga0265327_10007326 | 3300031251 | Bacteria | 8545 |
| 443 | Ga0265327_10035566 | 3300031251 | Unclassified | 2751 |
| 444 | Ga0265316_10013876 | 3300031344 | Bacteria | 7129 |
| 445 | Ga0307408_100017136 | 3300031548 | Bacteria | 4847 |
| 446 | Ga0307408_100035986 | 3300031548 | Bacteria | 3477 |
| 447 | Ga0265313_10022023 | 3300031595 | Bacteria | 3468 |
| 448 | Ga0265313_10028247 | 3300031595 | Unclassified | 2919 |
| 449 | Ga0265314_10045395 | 3300031711 | Unclassified | 3107 |
| 450 | Ga0265314_10066070 | 3300031711 | Bacteria | 2440 |
| 451 | Ga0316576_10228940 | 3300031727 | Unclassified | 1398 |
| 452 | Ga0307405_10030957 | 3300031731 | Bacteria | 3144 |
| 453 | Ga0307405_10038307 | 3300031731 | Unclassified | 2889 |
| 454 | Ga0307413_10001279 | 3300031824 | Bacteria | 9380 |
| 455 | Ga0307410_10009327 | 3300031852 | Bacteria | 5498 |
| 456 | Ga0307406_10013354 | 3300031901 | Bacteria | 4705 |
| 457 | Ga0307406_10015316 | 3300031901 | Bacteria | 4434 |
| 458 | Ga0307406_10117182 | 3300031901 | Unclassified | 1845 |
| 459 | Ga0307407_10004510 | 3300031903 | Bacteria | 5925 |
| 460 | Ga0307407_10017104 | 3300031903 | Bacteria | 3629 |
| 461 | Ga0307407_10216525 | 3300031903 | Bacteria | 1292 |
| 462 | Ga0307412_10182633 | 3300031911 | Unclassified | 1579 |
| 463 | Ga0307412_10202849 | 3300031911 | Unclassified | 1507 |
| 464 | Ga0307409_100007207 | 3300031995 | Bacteria | 6629 |
| 465 | Ga0307409_100021932 | 3300031995 | Bacteria | 4391 |
| 466 | Ga0307409_100022313 | 3300031995 | Unclassified | 4362 |
| 467 | Ga0307409_100105742 | 3300031995 | Bacteria | 2347 |
| 468 | Ga0307409_100255429 | 3300031995 | Unclassified | 1605 |
| 469 | Ga0307416_100000842 | 3300032002 | Bacteria | 16144 |
| 470 | Ga0307416_100021151 | 3300032002 | Bacteria | 4663 |
| 471 | Ga0307416_100032917 | 3300032002 | Bacteria | 3924 |
| 472 | Ga0307416_100047861 | 3300032002 | Bacteria | 3388 |
| 473 | Ga0307416_100245218 | 3300032002 | Bacteria | 1739 |
| 474 | Ga0307416_100308682 | 3300032002 | Bacteria | 1577 |
| 475 | Ga0307414_10344540 | 3300032004 | Bacteria | 1277 |
| 476 | Ga0307415_100002772 | 3300032126 | Bacteria | 8768 |
| 477 | Ga0307415_100006557 | 3300032126 | Bacteria | 6293 |
| 478 | Ga0307415_100025919 | 3300032126 | Bacteria | 3689 |
| 479 | Ga0307415_100094119 | 3300032126 | Bacteria | 2177 |
| 480 | Ga0373948_0001030 | 3300034817 | Bacteria | 3751 |
| 481 | Ga0373938_0024552 | 3300034957 | Unclassified | 1248 |
| 482 | Ga0373926_0013325 | 3300035083 | Bacteria | 2787 |
| 483 | Ga0373929_0030941 | 3300035085 | Bacteria | 1144 |
| 484 | Ga0373934_0069686 | 3300035086 | Unclassified | 1406 |
| 485 | Ga0373944_0004384 | 3300035089 | Bacteria | 3674 |
| 486 | Ga0373949_0016254 | 3300035090 | Bacteria | 1667 |
| 487 | Ga0373936_0008919 | 3300035113 | Bacteria | 3779 |
| 488 | Ga0373941_0028178 | 3300035115 | Unclassified | 1647 |
| 489 | Ga0373945_0024846 | 3300035116 | Bacteria | 2078 |
| 490 | Ga0373953_0029989 | 3300035117 | Unclassified | 2107 |
| 491 | Ga0373956_0090915 | 3300035119 | Unclassified | 1408 |
| 492 | Ga0373960_0000659 | 3300035121 | Bacteria | 7106 |
| 493 | Ga0373943_0003903 | 3300035170 | Bacteria | 6788 |
| 494 | Ga0373943_0004371 | 3300035170 | Bacteria | 6407 |
| 495 | Ga0373943_0005589 | 3300035170 | Bacteria | 5641 |
| 496 | Ga0373943_0038522 | 3300035170 | Bacteria | 2299 |
| 497 | Ga0373946_0010111 | 3300035171 | Bacteria | 3489 |
| 498 | Ga0373946_0022653 | 3300035171 | Bacteria | 2447 |
| 499 | Ga0373942_0043048 | 3300035207 | Unclassified | 1239 |
| 500 | Ga0373962_0016807 | 3300035242 | Bacteria | 1890 |
| 501 | Ga0373931_0008998 | 3300035691 | Bacteria | 4760 |
| 502 | Ga0373935_0014903 | 3300035692 | Bacteria | 4695 |
| 503 | Ga0373927_0141453 | 3300035695 | Unclassified | 1574 |
| 504 | Ga0373933_0065432 | 3300035724 | Unclassified | 2201 |
| 505 | Ga0373947_0000522 | 3300035725 | Bacteria | 22384 |
| 506 | Ga0373947_0008709 | 3300035725 | Bacteria | 5839 |
| 507 | Ga0373947_0137691 | 3300035725 | Unclassified | 1564 |
| 508 | Ga0373937_0000828 | 3300036401 | Bacteria | 26522 |
| 509 | Ga0373937_0112806 | 3300036401 | Unclassified | 2529 |
| 510 | Ga0373925_0052110 | 3300037068 | Bacteria | 3057 |
| 511 | Ga0395899_0001333 | 3300037312 | Bacteria | 21194 |
| 512 | Ga0395899_0002768 | 3300037312 | Bacteria | 14153 |
| 513 | Ga0395899_0007857 | 3300037312 | Bacteria | 8221 |
| 514 | Ga0395899_0007896 | 3300037312 | Bacteria | 8197 |
| 515 | Ga0395899_0010024 | 3300037312 | Bacteria | 7265 |
| 516 | Ga0395899_0017268 | 3300037312 | Bacteria | 5499 |
| 517 | Ga0395899_0026688 | 3300037312 | Bacteria | 4357 |
| 518 | Ga0395899_0032923 | 3300037312 | Bacteria | 3895 |
| 519 | Ga0395899_0035706 | 3300037312 | Bacteria | 3731 |
| 520 | Ga0395899_0040552 | 3300037312 | Unclassified | 3482 |
| 521 | Ga0395899_0089369 | 3300037312 | Archaea | 2234 |
| 522 | Ga0395899_0140947 | 3300037312 | Unclassified | 1715 |
| 523 | Ga0395899_0149001 | 3300037312 | Bacteria | 1659 |
| 524 | Ga0395900_0004816 | 3300037418 | Bacteria | 14214 |
| 525 | Ga0395900_0006109 | 3300037418 | Bacteria | 12558 |
| 526 | Ga0395900_0006406 | 3300037418 | Bacteria | 12268 |
| 527 | Ga0395900_0008028 | 3300037418 | Bacteria | 10863 |
| 528 | Ga0395900_0009640 | 3300037418 | Bacteria | 9904 |
| 529 | Ga0395900_0009837 | 3300037418 | Bacteria | 9794 |
| 530 | Ga0395900_0011359 | 3300037418 | Bacteria | 9110 |
| 531 | Ga0395900_0015535 | 3300037418 | Bacteria | 7759 |
| 532 | Ga0395900_0020954 | 3300037418 | Bacteria | 6681 |
| 533 | Ga0395900_0042274 | 3300037418 | Bacteria | 4695 |
| 534 | Ga0395900_0085043 | 3300037418 | Bacteria | 3251 |
| 535 | Ga0395900_0100399 | 3300037418 | Unclassified | 2973 |
| 536 | Ga0395900_0116173 | 3300037418 | Unclassified | 2745 |
| 537 | Ga0395900_0124688 | 3300037418 | Bacteria | 2641 |
| 538 | Ga0395900_0131455 | 3300037418 | Bacteria | 2565 |
| 539 | Ga0395900_0147695 | 3300037418 | Unclassified | 2403 |
| 540 | Ga0395900_0192888 | 3300037418 | Bacteria | 2065 |
| 541 | Ga0395900_0221031 | 3300037418 | Bacteria | 1909 |
| 542 | Ga0395900_0244589 | 3300037418 | Unclassified | 1798 |
| 543 | Ga0395900_0313142 | 3300037418 | Unclassified | 1552 |
| 544 | Ga0395900_0406998 | 3300037418 | Bacteria | 1323 |
| 545 | Ga0395900_0415665 | 3300037418 | Unclassified | 1306 |
| 546 | Ga0395898_0000635 | 3300037466 | Bacteria | 64060 |
| 547 | Ga0395898_0004222 | 3300037466 | Bacteria | 15747 |
| 548 | Ga0395898_0007862 | 3300037466 | Bacteria | 11313 |
| 549 | Ga0395898_0007894 | 3300037466 | Bacteria | 11292 |
| 550 | Ga0395898_0013333 | 3300037466 | Bacteria | 8464 |
| 551 | Ga0395898_0018206 | 3300037466 | Bacteria | 7165 |
| 552 | Ga0395898_0019228 | 3300037466 | Bacteria | 6953 |
| 553 | Ga0395898_0020975 | 3300037466 | Bacteria | 6628 |
| 554 | Ga0395898_0036211 | 3300037466 | Bacteria | 4901 |
| 555 | Ga0395898_0043838 | 3300037466 | Bacteria | 4407 |
| 556 | Ga0395898_0046900 | 3300037466 | Bacteria | 4243 |
| 557 | Ga0395898_0050402 | 3300037466 | Unclassified | 4074 |
| 558 | Ga0395898_0058150 | 3300037466 | Bacteria | 3765 |
| 559 | Ga0395898_0059548 | 3300037466 | Bacteria | 3714 |
| 560 | Ga0395898_0076862 | 3300037466 | Bacteria | 3223 |
| 561 | Ga0395898_0126208 | 3300037466 | Archaea | 2451 |
| 562 | Ga0395898_0128400 | 3300037466 | Bacteria | 2428 |
| 563 | Ga0395898_0171324 | 3300037466 | Unclassified | 2075 |
| 564 | Ga0395898_0253359 | 3300037466 | Bacteria | 1679 |
| 565 | Ga0395898_0259432 | 3300037466 | Bacteria | 1658 |
| 566 | Ga0395898_0267759 | 3300037466 | Unclassified | 1629 |
| 567 | Ga0395905_0004382 | 3300037471 | Bacteria | 14690 |
| 568 | Ga0395905_0004838 | 3300037471 | Bacteria | 13886 |
| 569 | Ga0395905_0006804 | 3300037471 | Bacteria | 11450 |
| 570 | Ga0395905_0009223 | 3300037471 | Bacteria | 9661 |
| 571 | Ga0395905_0010656 | 3300037471 | Bacteria | 8916 |
| 572 | Ga0395905_0011850 | 3300037471 | Bacteria | 8416 |
| 573 | Ga0395905_0019646 | 3300037471 | Bacteria | 6403 |
| 574 | Ga0395905_0024439 | 3300037471 | Bacteria | 5702 |
| 575 | Ga0395905_0025347 | 3300037471 | Bacteria | 5592 |
| 576 | Ga0395905_0029683 | 3300037471 | Bacteria | 5153 |
| 577 | Ga0395905_0029708 | 3300037471 | Bacteria | 5151 |
| 578 | Ga0395905_0032332 | 3300037471 | Bacteria | 4921 |
| 579 | Ga0395905_0054679 | 3300037471 | Unclassified | 3735 |
| 580 | Ga0395905_0103003 | 3300037471 | Bacteria | 2680 |
| 581 | Ga0395905_0103690 | 3300037471 | Unclassified | 2670 |
| 582 | Ga0395905_0145116 | 3300037471 | Bacteria | 2233 |
| 583 | Ga0395905_0219135 | 3300037471 | Bacteria | 1781 |
| 584 | Ga0395905_0258509 | 3300037471 | Unclassified | 1626 |
| 585 | Ga0395901_0002544 | 3300038443 | Bacteria | 18471 |
| 586 | Ga0395901_0003773 | 3300038443 | Bacteria | 15264 |
| 587 | Ga0395901_0006552 | 3300038443 | Bacteria | 11777 |
| 588 | Ga0395901_0007534 | 3300038443 | Bacteria | 10994 |
| 589 | Ga0395901_0008779 | 3300038443 | Bacteria | 10223 |
| 590 | Ga0395901_0010232 | 3300038443 | Bacteria | 9503 |
| 591 | Ga0395901_0014478 | 3300038443 | Bacteria | 8023 |
| 592 | Ga0395901_0016360 | 3300038443 | Bacteria | 7552 |
| 593 | Ga0395901_0016913 | 3300038443 | Bacteria | 7434 |
| 594 | Ga0395901_0018646 | 3300038443 | Bacteria | 7086 |
| 595 | Ga0395901_0053471 | 3300038443 | Unclassified | 4195 |
| 596 | Ga0395901_0061539 | 3300038443 | Bacteria | 3906 |
| 597 | Ga0395901_0070958 | 3300038443 | Unclassified | 3629 |
| 598 | Ga0395901_0085944 | 3300038443 | Bacteria | 3288 |
| 599 | Ga0395901_0098325 | 3300038443 | Bacteria | 3068 |
| 600 | Ga0395901_0120971 | 3300038443 | Bacteria | 2751 |
| 601 | Ga0395901_0151291 | 3300038443 | Archaea | 2438 |
| 602 | Ga0395901_0156328 | 3300038443 | Unclassified | 2395 |
| 603 | Ga0395901_0177266 | 3300038443 | Unclassified | 2235 |
| 604 | Ga0395901_0229590 | 3300038443 | Bacteria | 1938 |
| 605 | Ga0395901_0274654 | 3300038443 | Bacteria | 1752 |
| 606 | Ga0395901_0376731 | 3300038443 | Bacteria | 1461 |
| 607 | Ga0395901_0415373 | 3300038443 | Bacteria | 1380 |
| 608 | Ga0242420_023196 | 3300038996 | Unclassified | 1120 |
| 609 | Ga0436365_0226835 | 3300039437 | Bacteria | 3798 |
| 610 | Ga0436360_0592628 | 3300039438 | Unclassified | 2389 |
| 611 | Ga0436360_0683623 | 3300039438 | Unclassified | 1552 |
| 612 | Ga0436362_0162555 | 3300039453 | Bacteria | 2199 |
| 613 | Ga0439436_0027573 | 3300041404 | Unclassified | 1661 |
| 614 | Ga0439439_0002499 | 3300041406 | Bacteria | 3920 |
| 615 | Ga0451802_0263095 | 3300041460 | Bacteria | 2496 |
| 616 | Ga0451804_0309295 | 3300041463 | Unclassified | 1654 |
| 617 | Ga0451807_1633611 | 3300041486 | Unclassified | 1716 |
| 618 | Ga0451835_0664460 | 3300041492 | Bacteria | 1302 |
| 619 | Ga0451839_0289782 | 3300041496 | Bacteria | 2867 |
| 620 | Ga0451841_0135509 | 3300041498 | Bacteria | 1943 |
| 621 | Ga0451845_0605847 | 3300041501 | Bacteria | 1662 |
| 622 | Ga0451853_0865426 | 3300041512 | Bacteria | 1840 |
| 623 | Ga0439433_0007340 | 3300041999 | Unclassified | 2379 |
| 624 | Ga0439448_0035453 | 3300042005 | Bacteria | 1598 |
| 625 | Ga0439449_0138190 | 3300042007 | Unclassified | 906 |
| 626 | Ga0439455_0051446 | 3300042012 | Unclassified | 1077 |
| 627 | Ga0450915_000186 | 3300042119 | Unclassified | 1803 |
| 628 | Ga0450923_029494 | 3300042125 | Unclassified | 1112 |
| 629 | Ga0450907_007003 | 3300042146 | Bacteria | 1880 |
| 630 | Ga0450910_012957 | 3300042147 | Unclassified | 1209 |
| 631 | Ga0439446_0000956 | 3300042156 | Bacteria | 6266 |
| 632 | Ga0439458_0010755 | 3300042157 | Unclassified | 2042 |
| 633 | Ga0439434_0006978 | 3300042435 | Bacteria | 3299 |
| 634 | Ga0439434_0014035 | 3300042435 | Unclassified | 2382 |
| 635 | Ga0439460_0089660 | 3300042461 | Unclassified | 976 |
| 636 | Ga0451577_0240581 | 3300042876 | Unclassified | 1638 |
| 637 | Ga0466969_0001432 | 3300044656 | Bacteria | 12855 |
| 638 | Ga0466969_0085173 | 3300044656 | Unclassified | 1503 |
| 639 | Ga0466966_0015325 | 3300044684 | Bacteria | 5069 |
| 640 | Ga0466966_0023530 | 3300044684 | Bacteria | 4031 |
| 641 | Ga0466966_0038032 | 3300044684 | Unclassified | 3102 |
| 642 | Ga0466966_0045305 | 3300044684 | Bacteria | 2812 |
| 643 | Ga0466961_0003114 | 3300044693 | Bacteria | 10329 |
| 644 | Ga0466961_0003820 | 3300044693 | Bacteria | 9424 |
| 645 | Ga0466961_0032498 | 3300044693 | Bacteria | 3353 |
| 646 | Ga0466961_0096945 | 3300044693 | Unclassified | 1859 |
| 647 | Ga0466963_0000091 | 3300044694 | Bacteria | 31677 |
| 648 | Ga0466963_0000956 | 3300044694 | Bacteria | 14836 |
| 649 | Ga0466963_0001618 | 3300044694 | Bacteria | 12249 |
| 650 | Ga0466963_0003857 | 3300044694 | Bacteria | 8652 |
| 651 | Ga0466963_0004917 | 3300044694 | Bacteria | 7792 |
| 652 | Ga0466963_0007740 | 3300044694 | Bacteria | 6419 |
| 653 | Ga0466963_0008393 | 3300044694 | Bacteria | 6188 |
| 654 | Ga0466963_0008551 | 3300044694 | Bacteria | 6142 |
| 655 | Ga0466963_0013611 | 3300044694 | Unclassified | 4999 |
| 656 | Ga0466963_0013983 | 3300044694 | Unclassified | 4942 |
| 657 | Ga0466963_0040829 | 3300044694 | Unclassified | 3041 |
| 658 | Ga0466963_0042845 | 3300044694 | Unclassified | 2973 |
| 659 | Ga0466963_0048028 | 3300044694 | Unclassified | 2818 |
| 660 | Ga0466963_0051123 | 3300044694 | Bacteria | 2738 |
| 661 | Ga0466963_0056483 | 3300044694 | Bacteria | 2612 |
| 662 | Ga0466963_0064208 | 3300044694 | Bacteria | 2459 |
| 663 | Ga0466963_0094110 | 3300044694 | Unclassified | 2043 |
| 664 | Ga0466963_0123269 | 3300044694 | Bacteria | 1785 |
| 665 | Ga0466963_0149476 | 3300044694 | Unclassified | 1621 |
| 666 | Ga0466963_0184447 | 3300044694 | Unclassified | 1457 |
| 667 | Ga0466964_0001993 | 3300044706 | Bacteria | 7169 |
| 668 | Ga0466964_0002141 | 3300044706 | Bacteria | 6966 |
| 669 | Ga0466964_0003081 | 3300044706 | Bacteria | 6060 |
| 670 | Ga0466964_0010924 | 3300044706 | Bacteria | 3431 |
| 671 | Ga0466964_0022748 | 3300044706 | Unclassified | 2433 |
| 672 | Ga0466964_0035744 | 3300044706 | Unclassified | 1988 |
| 673 | Ga0466964_0062268 | 3300044706 | Bacteria | 1555 |
| 674 | Ga0466964_0076339 | 3300044706 | Unclassified | 1428 |
| 675 | Ga0466964_0083956 | 3300044706 | Unclassified | 1372 |
| 676 | Ga0466964_0112203 | 3300044706 | Unclassified | 1217 |
| 677 | Ga0466964_0120639 | 3300044706 | Unclassified | 1181 |
| 678 | Ga0466964_0125432 | 3300044706 | Unclassified | 1162 |
| 679 | Ga0466971_0003251 | 3300044719 | Bacteria | 6932 |
| 680 | Ga0466971_0018134 | 3300044719 | Unclassified | 3117 |
| 681 | Ga0466971_0039329 | 3300044719 | Unclassified | 2123 |
| 682 | Ga0466971_0050586 | 3300044719 | Unclassified | 1870 |
| 683 | Ga0466971_0062594 | 3300044719 | Unclassified | 1683 |
| 684 | Ga0466971_0115990 | 3300044719 | Unclassified | 1238 |
| 685 | Ga0466968_0029630 | 3300044735 | Unclassified | 2264 |
| 686 | Ga0466968_0052956 | 3300044735 | Unclassified | 1737 |
| 687 | Ga0466968_0075132 | 3300044735 | Bacteria | 1477 |
| 688 | Ga0466968_0137454 | 3300044735 | Unclassified | 1115 |
| 689 | Ga0466957_0002379 | 3300044842 | Bacteria | 10101 |
| 690 | Ga0466957_0002604 | 3300044842 | Bacteria | 9719 |
| 691 | Ga0466957_0030250 | 3300044842 | Unclassified | 3232 |
| 692 | Ga0466957_0080542 | 3300044842 | Unclassified | 2027 |
| 693 | Ga0466957_0110128 | 3300044842 | Unclassified | 1745 |
| 694 | Ga0466957_0111622 | 3300044842 | Unclassified | 1734 |
| 695 | Ga0466957_0135267 | 3300044842 | Unclassified | 1583 |
| 696 | Ga0466960_0048756 | 3300044901 | Unclassified | 2036 |
| 697 | Ga0466960_0126162 | 3300044901 | Bacteria | 1345 |
| 698 | Ga0466960_0229336 | 3300044901 | Unclassified | 1025 |
| 699 | Ga0466959_0007686 | 3300045049 | Bacteria | 7578 |
| 700 | Ga0466959_0009031 | 3300045049 | Bacteria | 7071 |
| 701 | Ga0466959_0009090 | 3300045049 | Bacteria | 7053 |
| 702 | Ga0466959_0012573 | 3300045049 | Bacteria | 6121 |
| 703 | Ga0466959_0036621 | 3300045049 | Bacteria | 3625 |
| 704 | Ga0466959_0049369 | 3300045049 | Bacteria | 3091 |
| 705 | Ga0466959_0082613 | 3300045049 | Unclassified | 2314 |
| 706 | Ga0451576_0013374 | 3300045051 | Bacteria | 9184 |
| 707 | Ga0451576_0343679 | 3300045051 | Bacteria | 1562 |
| 708 | Ga0466958_0011854 | 3300045836 | Unclassified | 4922 |
| 709 | Ga0466958_0025604 | 3300045836 | Unclassified | 3480 |
| 710 | Ga0466958_0035386 | 3300045836 | Unclassified | 2983 |
| 711 | Ga0466958_0067654 | 3300045836 | Bacteria | 2182 |
| 712 | Ga0466958_0076725 | 3300045836 | Unclassified | 2052 |
| 713 | Ga0466958_0077754 | 3300045836 | Unclassified | 2038 |
| 714 | Ga0466958_0094707 | 3300045836 | Bacteria | 1850 |
| 715 | Ga0466967_0000550 | 3300045976 | Bacteria | 18250 |
| 716 | Ga0466967_0000889 | 3300045976 | Bacteria | 15953 |
| 717 | Ga0466967_0002096 | 3300045976 | Bacteria | 12225 |
| 718 | Ga0466967_0002982 | 3300045976 | Bacteria | 10836 |
| 719 | Ga0466967_0005694 | 3300045976 | Bacteria | 8687 |
| 720 | Ga0466967_0006942 | 3300045976 | Bacteria | 8099 |
| 721 | Ga0466967_0008122 | 3300045976 | Bacteria | 7658 |
| 722 | Ga0466967_0010641 | 3300045976 | Bacteria | 6913 |
| 723 | Ga0466967_0011943 | 3300045976 | Bacteria | 6617 |
| 724 | Ga0466967_0014028 | 3300045976 | Bacteria | 6222 |
| 725 | Ga0466967_0018282 | 3300045976 | Bacteria | 5597 |
| 726 | Ga0466967_0018998 | 3300045976 | Bacteria | 5514 |
| 727 | Ga0466967_0021907 | 3300045976 | Bacteria | 5201 |
| 728 | Ga0466967_0026623 | 3300045976 | Bacteria | 4793 |
| 729 | Ga0466967_0027322 | 3300045976 | Bacteria | 4745 |
| 730 | Ga0466967_0028833 | 3300045976 | Bacteria | 4639 |
| 731 | Ga0466967_0029954 | 3300045976 | Unclassified | 4561 |
| 732 | Ga0466967_0033835 | 3300045976 | Bacteria | 4331 |
| 733 | Ga0466967_0041559 | 3300045976 | Unclassified | 3965 |
| 734 | Ga0466967_0042770 | 3300045976 | Unclassified | 3917 |
| 735 | Ga0466967_0061505 | 3300045976 | Bacteria | 3331 |
| 736 | Ga0466967_0100364 | 3300045976 | Unclassified | 2644 |
| 737 | Ga0466967_0101802 | 3300045976 | Unclassified | 2626 |
| 738 | Ga0466967_0115116 | 3300045976 | Unclassified | 2476 |
| 739 | Ga0466967_0143127 | 3300045976 | Unclassified | 2228 |
| 740 | Ga0466967_0191583 | 3300045976 | Unclassified | 1932 |
| 741 | Ga0466967_0201015 | 3300045976 | Unclassified | 1887 |
| 742 | Ga0466967_0203556 | 3300045976 | Bacteria | 1875 |
| 743 | Ga0466967_0306652 | 3300045976 | Unclassified | 1528 |
| 744 | Ga0466967_0471048 | 3300045976 | Unclassified | 1229 |
| 745 | Ga0495592_0000984 | 3300046454 | Bacteria | 19789 |
| 746 | Ga0495592_0027682 | 3300046454 | Unclassified | 4294 |
| 747 | Ga0495592_0081761 | 3300046454 | Unclassified | 2335 |
| 748 | Ga0495592_0131775 | 3300046454 | Unclassified | 1748 |
| 749 | Ga0495603_0002920 | 3300046455 | Bacteria | 10104 |
| 750 | Ga0495603_0015814 | 3300046455 | Bacteria | 4561 |
| 751 | Ga0495603_0128052 | 3300046455 | Bacteria | 1479 |
| 752 | Ga0495629_0007788 | 3300046459 | Bacteria | 7883 |
| 753 | Ga0495629_0209748 | 3300046459 | Unclassified | 1346 |
| 754 | Ga0495638_0019400 | 3300046460 | Bacteria | 4500 |
| 755 | Ga0495641_0001074 | 3300046461 | Bacteria | 23533 |
| 756 | Ga0495641_0005367 | 3300046461 | Bacteria | 8685 |
| 757 | Ga0495641_0120971 | 3300046461 | Bacteria | 1168 |
| 758 | Ga0495651_0000001 | 3300046462 | Bacteria | 210544 |
| 759 | Ga0495651_0019622 | 3300046462 | Bacteria | 5242 |
| 760 | Ga0495651_0092379 | 3300046462 | Unclassified | 2267 |
| 761 | Ga0495651_0277571 | 3300046462 | Bacteria | 1133 |
| 762 | Ga0495653_0002159 | 3300046463 | Bacteria | 15536 |
| 763 | Ga0495653_0050159 | 3300046463 | Bacteria | 3211 |
| 764 | Ga0495580_0067760 | 3300046472 | Bacteria | 2497 |
| 765 | Ga0495582_0000737 | 3300046473 | Bacteria | 18068 |
| 766 | Ga0495582_0015449 | 3300046473 | Unclassified | 4193 |
| 767 | Ga0495582_0034526 | 3300046473 | Bacteria | 2780 |
| 768 | Ga0495605_0106756 | 3300046474 | Unclassified | 1281 |
| 769 | Ga0495605_0126692 | 3300046474 | Unclassified | 1154 |
| 770 | Ga0495639_0001650 | 3300046475 | Bacteria | 9935 |
| 771 | Ga0495662_0025604 | 3300046476 | Bacteria | 2849 |
| 772 | Ga0495662_0071005 | 3300046476 | Unclassified | 1687 |
| 773 | Ga0495664_0008762 | 3300046477 | Bacteria | 5651 |
| 774 | Ga0495664_0055572 | 3300046477 | Unclassified | 2355 |
| 775 | Ga0495664_0145127 | 3300046477 | Unclassified | 1439 |
| 776 | Ga0495584_0042895 | 3300046491 | Unclassified | 2283 |
| 777 | Ga0495584_0114002 | 3300046491 | Unclassified | 1368 |
| 778 | Ga0495585_0024017 | 3300046492 | Unclassified | 3497 |
| 779 | Ga0495594_0001738 | 3300046499 | Bacteria | 11292 |
| 780 | Ga0495594_0137653 | 3300046499 | Unclassified | 1384 |
| 781 | Ga0495594_0143292 | 3300046499 | Unclassified | 1356 |
| 782 | Ga0495596_0091862 | 3300046500 | Unclassified | 1178 |
| 783 | Ga0495596_0102986 | 3300046500 | Bacteria | 1109 |
| 784 | Ga0495607_0039716 | 3300046501 | Unclassified | 2809 |
| 785 | Ga0495607_0121907 | 3300046501 | Bacteria | 1367 |
| 786 | Ga0495608_0019014 | 3300046511 | Unclassified | 4734 |
| 787 | Ga0495608_0034934 | 3300046511 | Unclassified | 3393 |
| 788 | Ga0495608_0094411 | 3300046511 | Unclassified | 1932 |
| 789 | Ga0495608_0107673 | 3300046511 | Bacteria | 1793 |
| 790 | Ga0495618_0078861 | 3300046514 | Unclassified | 2099 |
| 791 | Ga0495618_0080501 | 3300046514 | Unclassified | 2078 |
| 792 | Ga0495618_0103461 | 3300046514 | Bacteria | 1823 |
| 793 | Ga0495628_0000721 | 3300046516 | Bacteria | 30671 |
| 794 | Ga0495628_0025927 | 3300046516 | Unclassified | 4786 |
| 795 | Ga0495628_0031234 | 3300046516 | Unclassified | 4308 |
| 796 | Ga0495628_0104477 | 3300046516 | Bacteria | 2183 |
| 797 | Ga0495628_0423063 | 3300046516 | Unclassified | 970 |
| 798 | Ga0495630_0023700 | 3300046517 | Unclassified | 4537 |
| 799 | Ga0495630_0026983 | 3300046517 | Unclassified | 4257 |
| 800 | Ga0495630_0036451 | 3300046517 | Bacteria | 3677 |
| 801 | Ga0495630_0068393 | 3300046517 | Bacteria | 2670 |
| 802 | Ga0495630_0079782 | 3300046517 | Bacteria | 2469 |
| 803 | Ga0495630_0101615 | 3300046517 | Unclassified | 2175 |
| 804 | Ga0495630_0255799 | 3300046517 | Unclassified | 1338 |
| 805 | Ga0495630_0368031 | 3300046517 | Unclassified | 1101 |
| 806 | Ga0495644_0043060 | 3300046523 | Unclassified | 1699 |
| 807 | Ga0495644_0043650 | 3300046523 | Unclassified | 1687 |
| 808 | Ga0495663_0044557 | 3300046525 | Unclassified | 1358 |
| 809 | Ga0495663_0059286 | 3300046525 | Bacteria | 1201 |
| 810 | Ga0495666_0042183 | 3300046526 | Unclassified | 2207 |
| 811 | Ga0495666_0048761 | 3300046526 | Bacteria | 2039 |
| 812 | Ga0495652_0000015 | 3300046529 | Bacteria | 222624 |
| 813 | Ga0495652_0111029 | 3300046529 | Unclassified | 2205 |
| 814 | Ga0495652_0217906 | 3300046529 | Bacteria | 1436 |
| 815 | Ga0495665_0005972 | 3300046531 | Bacteria | 6561 |
| 816 | Ga0495640_0009339 | 3300046533 | Bacteria | 7637 |
| 817 | Ga0495640_0011233 | 3300046533 | Bacteria | 6895 |
| 818 | Ga0495640_0104703 | 3300046533 | Bacteria | 1854 |
| 819 | Ga0495640_0197517 | 3300046533 | Bacteria | 1276 |
| 820 | Ga0495586_0004938 | 3300046535 | Bacteria | 7135 |
| 821 | Ga0495586_0045552 | 3300046535 | Bacteria | 2364 |
| 822 | Ga0495586_0169737 | 3300046535 | Bacteria | 1233 |
| 823 | Ga0495587_0000051 | 3300046536 | Bacteria | 101923 |
| 824 | Ga0495597_0068959 | 3300046542 | Unclassified | 1527 |
| 825 | Ga0495597_0131206 | 3300046542 | Bacteria | 1039 |
| 826 | Ga0495645_0000036 | 3300046543 | Bacteria | 100735 |
| 827 | Ga0495667_0115086 | 3300046559 | Bacteria | 1737 |
| 828 | Ga0495656_0022363 | 3300046615 | Unclassified | 2475 |
| 829 | Ga0495656_0034363 | 3300046615 | Unclassified | 2075 |
| 830 | Ga0495656_0072512 | 3300046615 | Unclassified | 1533 |
| 831 | Ga0495656_0109812 | 3300046615 | Bacteria | 1288 |
| 832 | Ga0495634_0080490 | 3300046642 | Unclassified | 2131 |
| 833 | Ga0495634_0086827 | 3300046642 | Bacteria | 2037 |
| 834 | Ga0495635_0026838 | 3300046663 | Unclassified | 4006 |
| 835 | Ga0495635_0032986 | 3300046663 | Bacteria | 3592 |
| 836 | Ga0495659_0053838 | 3300046664 | Unclassified | 1471 |
| 837 | Ga0495659_0081830 | 3300046664 | Bacteria | 1226 |
| 838 | Ga0495588_0000390 | 3300046674 | Bacteria | 24919 |
| 839 | Ga0495657_0117544 | 3300046675 | Unclassified | 1678 |
| 840 | Ga0495657_0157189 | 3300046675 | Unclassified | 1408 |
| 841 | Ga0495599_0000049 | 3300046678 | Bacteria | 84569 |
| 842 | Ga0495599_0011708 | 3300046678 | Bacteria | 5392 |
| 843 | Ga0495599_0038430 | 3300046678 | Unclassified | 3007 |
| 844 | Ga0495599_0159962 | 3300046678 | Bacteria | 1392 |
| 845 | Ga0495623_0000011 | 3300046679 | Bacteria | 120974 |
| 846 | Ga0495623_0049472 | 3300046679 | Unclassified | 2664 |
| 847 | Ga0495646_0006020 | 3300046680 | Bacteria | 7689 |
| 848 | Ga0495646_0023570 | 3300046680 | Unclassified | 3874 |
| 849 | Ga0495646_0079248 | 3300046680 | Bacteria | 1918 |
| 850 | Ga0495646_0088771 | 3300046680 | Unclassified | 1790 |
| 851 | Ga0495647_0002880 | 3300046681 | Bacteria | 5462 |
| 852 | Ga0495658_0001783 | 3300046683 | Bacteria | 11111 |
| 853 | Ga0495658_0065074 | 3300046683 | Bacteria | 2102 |
| 854 | Ga0495613_0007078 | 3300046689 | Bacteria | 8350 |
| 855 | Ga0495613_0065035 | 3300046689 | Bacteria | 2666 |
| 856 | Ga0495613_0080452 | 3300046689 | Unclassified | 2368 |
| 857 | Ga0495613_0128220 | 3300046689 | Unclassified | 1818 |
| 858 | Ga0495613_0246439 | 3300046689 | Unclassified | 1248 |
| 859 | Ga0495624_0025286 | 3300046690 | Bacteria | 3899 |
| 860 | Ga0495670_0027318 | 3300046691 | Bacteria | 2827 |
| 861 | Ga0495671_0036061 | 3300046692 | Unclassified | 2508 |
| 862 | Ga0495649_0125997 | 3300046694 | Unclassified | 1353 |
| 863 | Ga0495589_0040977 | 3300046794 | Bacteria | 2311 |
| 864 | Ga0495589_0087394 | 3300046794 | Unclassified | 1514 |
| 865 | Ga0495589_0090816 | 3300046794 | Unclassified | 1483 |
| 866 | Ga0495589_0115133 | 3300046794 | Unclassified | 1296 |
| 867 | Ga0495600_0005373 | 3300046809 | Bacteria | 7726 |
| 868 | Ga0495600_0120718 | 3300046809 | Unclassified | 1705 |
| 869 | Ga0495600_0121518 | 3300046809 | Unclassified | 1698 |
| 870 | Ga0495600_0183396 | 3300046809 | Bacteria | 1348 |
| 871 | Ga0495600_0250149 | 3300046809 | Unclassified | 1127 |
| 872 | Ga0495581_0000672 | 3300047315 | Bacteria | 17975 |
| 873 | Ga0495581_0019774 | 3300047315 | Bacteria | 3910 |
| 874 | Ga0495581_0160895 | 3300047315 | Bacteria | 1312 |
| 875 | Ga0495604_0000004 | 3300047317 | Bacteria | 456385 |
| 876 | Ga0495604_0012720 | 3300047317 | Bacteria | 6697 |
| 877 | Ga0495636_0073997 | 3300047318 | Unclassified | 1459 |
| 878 | Ga0495674_0019090 | 3300047319 | Bacteria | 6371 |
| 879 | Ga0495674_0145573 | 3300047319 | Unclassified | 1989 |
| 880 | Ga0495674_0152436 | 3300047319 | Unclassified | 1937 |
| 881 | Ga0495672_0019583 | 3300047320 | Bacteria | 4461 |
| 882 | Ga0495672_0021050 | 3300047320 | Bacteria | 4259 |
| 883 | Ga0495676_0000419 | 3300047321 | Bacteria | 34533 |
| 884 | Ga0495676_0001935 | 3300047321 | Bacteria | 18176 |
| 885 | Ga0495676_0064466 | 3300047321 | Bacteria | 2849 |
| 886 | Ga0495676_0069997 | 3300047321 | Unclassified | 2705 |
| 887 | Ga0495676_0168164 | 3300047321 | Unclassified | 1545 |
| 888 | Ga0495680_0012689 | 3300047322 | Bacteria | 7398 |
| 889 | Ga0495680_0013654 | 3300047322 | Bacteria | 7076 |
| 890 | Ga0495680_0019652 | 3300047322 | Bacteria | 5699 |
| 891 | Ga0495680_0051547 | 3300047322 | Unclassified | 3212 |
| 892 | Ga0495680_0180399 | 3300047322 | Unclassified | 1524 |
| 893 | Ga0495680_0234547 | 3300047322 | Unclassified | 1305 |
| 894 | Ga0495675_0000018 | 3300047444 | Bacteria | 115435 |
| 895 | Ga0495677_0041063 | 3300047445 | Unclassified | 1692 |
| 896 | Ga0495684_0007044 | 3300047471 | Bacteria | 8732 |
| 897 | Ga0495684_0013514 | 3300047471 | Bacteria | 6283 |
| 898 | Ga0495684_0081591 | 3300047471 | Unclassified | 2454 |
| 899 | Ga0495684_0098950 | 3300047471 | Bacteria | 2205 |
| 900 | Ga0495684_0114605 | 3300047471 | Bacteria | 2032 |
| 901 | Ga0495593_0000839 | 3300047673 | Bacteria | 17853 |
| 902 | Ga0495602_0002551 | 3300048088 | Bacteria | 18558 |
| 903 | Ga0495602_0052146 | 3300048088 | Unclassified | 3636 |
| 904 | Ga0495602_0092449 | 3300048088 | Bacteria | 2506 |
| 905 | Ga0495602_0134778 | 3300048088 | Unclassified | 1964 |
| 906 | Ga0495602_0177695 | 3300048088 | Unclassified | 1645 |
| 907 | Ga0495614_0105893 | 3300048089 | Bacteria | 1232 |
| 908 | Ga0496100_0015858 | 3300048903 | Unclassified | 4410 |
| 909 | Ga0496100_0034881 | 3300048903 | Bacteria | 3161 |
| 910 | Ga0496100_0058127 | 3300048903 | Bacteria | 2536 |
| 911 | Ga0496100_0084358 | 3300048903 | Unclassified | 2153 |
| 912 | Ga0496100_0104202 | 3300048903 | Bacteria | 1960 |
| 913 | Ga0496100_0200060 | 3300048903 | Bacteria | 1455 |
| 914 | Ga0496100_0253333 | 3300048903 | Unclassified | 1303 |
| 915 | Ga0496101_0002949 | 3300048904 | Bacteria | 10462 |
| 916 | Ga0496101_0006797 | 3300048904 | Bacteria | 7377 |
| 917 | Ga0496101_0012171 | 3300048904 | Bacteria | 5735 |
| 918 | Ga0496101_0013258 | 3300048904 | Bacteria | 5521 |
| 919 | Ga0496101_0013410 | 3300048904 | Bacteria | 5489 |
| 920 | Ga0496101_0033962 | 3300048904 | Bacteria | 3601 |
| 921 | Ga0496101_0039823 | 3300048904 | Bacteria | 3344 |
| 922 | Ga0496101_0173028 | 3300048904 | Unclassified | 1660 |
| 923 | Ga0496102_0020913 | 3300048905 | Bacteria | 5785 |
| 924 | Ga0496102_0040012 | 3300048905 | Bacteria | 4239 |
| 925 | Ga0496102_0041827 | 3300048905 | Bacteria | 4152 |
| 926 | Ga0496102_0055437 | 3300048905 | Bacteria | 3614 |
| 927 | Ga0496102_0061476 | 3300048905 | Bacteria | 3437 |
| 928 | Ga0496102_0093296 | 3300048905 | Unclassified | 2789 |
| 929 | Ga0496102_0214463 | 3300048905 | Bacteria | 1814 |
| 930 | Ga0496103_0004888 | 3300048906 | Bacteria | 8090 |
| 931 | Ga0496103_0009082 | 3300048906 | Bacteria | 5886 |
| 932 | Ga0496103_0012903 | 3300048906 | Bacteria | 4955 |
| 933 | Ga0496103_0013322 | 3300048906 | Bacteria | 4874 |
| 934 | Ga0496103_0089534 | 3300048906 | Bacteria | 1941 |
| 935 | Ga0496104_0002003 | 3300048907 | Bacteria | 17677 |
| 936 | Ga0496104_0002189 | 3300048907 | Bacteria | 16918 |
| 937 | Ga0496104_0036474 | 3300048907 | Unclassified | 4597 |
| 938 | Ga0496104_0037634 | 3300048907 | Bacteria | 4524 |
| 939 | Ga0496104_0046244 | 3300048907 | Bacteria | 4098 |
| 940 | Ga0496104_0104019 | 3300048907 | Bacteria | 2720 |
| 941 | Ga0496104_0152274 | 3300048907 | Unclassified | 2219 |
| 942 | Ga0496104_0265660 | 3300048907 | Bacteria | 1628 |
| 943 | Ga0496104_0280202 | 3300048907 | Bacteria | 1580 |
| 944 | Ga0496104_0511798 | 3300048907 | Unclassified | 1112 |
| 945 | Ga0496105_0003606 | 3300048908 | Bacteria | 11495 |
| 946 | Ga0496105_0006296 | 3300048908 | Bacteria | 9114 |
| 947 | Ga0496105_0008207 | 3300048908 | Bacteria | 8117 |
| 948 | Ga0496105_0028284 | 3300048908 | Unclassified | 4585 |
| 949 | Ga0496105_0047338 | 3300048908 | Bacteria | 3549 |
| 950 | Ga0496105_0051178 | 3300048908 | Bacteria | 3413 |
| 951 | Ga0496105_0060377 | 3300048908 | Bacteria | 3128 |
| 952 | Ga0496105_0132254 | 3300048908 | Unclassified | 2056 |
| 953 | Ga0496105_0133356 | 3300048908 | Unclassified | 2046 |
| 954 | Ga0496105_0179392 | 3300048908 | Bacteria | 1734 |
| 955 | Ga0496105_0237953 | 3300048908 | Unclassified | 1478 |
| 956 | Ga0496105_0286066 | 3300048908 | Unclassified | 1328 |
| 957 | Ga0496105_0398273 | 3300048908 | Unclassified | 1093 |
| 958 | Ga0496106_0006102 | 3300048909 | Bacteria | 8915 |
| 959 | Ga0496106_0037614 | 3300048909 | Bacteria | 3621 |
| 960 | Ga0496106_0043319 | 3300048909 | Bacteria | 3377 |
| 961 | Ga0496106_0071135 | 3300048909 | Bacteria | 2658 |
| 962 | Ga0496106_0236610 | 3300048909 | Bacteria | 1459 |
| 963 | Ga0496106_0368231 | 3300048909 | Bacteria | 1154 |
| 964 | Ga0496107_0007225 | 3300048910 | Bacteria | 7651 |
| 965 | Ga0496107_0025415 | 3300048910 | Bacteria | 4193 |
| 966 | Ga0496107_0032087 | 3300048910 | Bacteria | 3752 |
| 967 | Ga0496107_0042595 | 3300048910 | Bacteria | 3260 |
| 968 | Ga0496107_0062677 | 3300048910 | Unclassified | 2694 |
| 969 | Ga0496107_0110666 | 3300048910 | Unclassified | 2018 |
| 970 | Ga0496107_0118861 | 3300048910 | Unclassified | 1946 |
| 971 | Ga0496107_0166395 | 3300048910 | Unclassified | 1635 |
| 972 | Ga0496107_0219653 | 3300048910 | Bacteria | 1414 |
| 973 | Ga0496107_0275373 | 3300048910 | Unclassified | 1252 |
| 974 | Ga0496108_0002606 | 3300048911 | Bacteria | 14446 |
| 975 | Ga0496108_0005212 | 3300048911 | Bacteria | 10498 |
| 976 | Ga0496108_0041810 | 3300048911 | Unclassified | 3827 |
| 977 | Ga0496108_0066258 | 3300048911 | Bacteria | 3045 |
| 978 | Ga0496108_0076809 | 3300048911 | Bacteria | 2823 |
| 979 | Ga0496108_0082703 | 3300048911 | Bacteria | 2723 |
| 980 | Ga0496108_0116939 | 3300048911 | Bacteria | 2284 |
| 981 | Ga0496108_0160681 | 3300048911 | Bacteria | 1941 |
| 982 | Ga0496108_0184730 | 3300048911 | Unclassified | 1806 |
| 983 | Ga0496108_0322998 | 3300048911 | Bacteria | 1346 |
| 984 | Ga0496108_0344951 | 3300048911 | Unclassified | 1299 |
| 985 | Ga0496109_0002745 | 3300048912 | Bacteria | 14769 |
| 986 | Ga0496109_0006403 | 3300048912 | Bacteria | 9911 |
| 987 | Ga0496109_0011174 | 3300048912 | Bacteria | 7704 |
| 988 | Ga0496109_0024220 | 3300048912 | Bacteria | 5394 |
| 989 | Ga0496109_0035106 | 3300048912 | Bacteria | 4521 |
| 990 | Ga0496109_0042309 | 3300048912 | Bacteria | 4125 |
| 991 | Ga0496109_0072484 | 3300048912 | Bacteria | 3164 |
| 992 | Ga0496109_0105611 | 3300048912 | Unclassified | 2616 |
| 993 | Ga0496109_0119584 | 3300048912 | Bacteria | 2453 |
| 994 | Ga0496109_0134087 | 3300048912 | Bacteria | 2313 |
| 995 | Ga0496109_0178213 | 3300048912 | Bacteria | 1995 |
| 996 | Ga0496109_0196293 | 3300048912 | Unclassified | 1897 |
| 997 | Ga0496109_0225572 | 3300048912 | Unclassified | 1762 |
| 998 | Ga0496109_0342680 | 3300048912 | Unclassified | 1411 |
| 999 | Ga0496110_0000076 | 3300048913 | Bacteria | 51020 |
| 1000 | Ga0496110_0000628 | 3300048913 | Bacteria | 24128 |
| 1001 | Ga0496110_0015356 | 3300048913 | Bacteria | 6371 |
| 1002 | Ga0496110_0017593 | 3300048913 | Bacteria | 5977 |
| 1003 | Ga0496110_0027775 | 3300048913 | Bacteria | 4854 |
| 1004 | Ga0496110_0063464 | 3300048913 | Bacteria | 3264 |
| 1005 | Ga0496110_0072818 | 3300048913 | Bacteria | 3049 |
| 1006 | Ga0496110_0095121 | 3300048913 | Bacteria | 2668 |
| 1007 | Ga0496110_0280791 | 3300048913 | Unclassified | 1516 |
| 1008 | Ga0496110_0310720 | 3300048913 | Unclassified | 1436 |
| 1009 | Ga0496111_0003638 | 3300048914 | Bacteria | 9563 |
| 1010 | Ga0496111_0008257 | 3300048914 | Bacteria | 6884 |
| 1011 | Ga0496111_0043950 | 3300048914 | Bacteria | 3212 |
| 1012 | Ga0496111_0062788 | 3300048914 | Unclassified | 2694 |
| 1013 | Ga0496111_0072412 | 3300048914 | Bacteria | 2508 |
| 1014 | Ga0496111_0132015 | 3300048914 | Bacteria | 1848 |
| 1015 | Ga0496112_0002231 | 3300048915 | Bacteria | 15467 |
| 1016 | Ga0496112_0004088 | 3300048915 | Bacteria | 12255 |
| 1017 | Ga0496112_0018834 | 3300048915 | Bacteria | 6505 |
| 1018 | Ga0496112_0019773 | 3300048915 | Bacteria | 6367 |
| 1019 | Ga0496112_0021382 | 3300048915 | Bacteria | 6152 |
| 1020 | Ga0496112_0029991 | 3300048915 | Bacteria | 5263 |
| 1021 | Ga0496112_0032741 | 3300048915 | Bacteria | 5047 |
| 1022 | Ga0496112_0058983 | 3300048915 | Bacteria | 3781 |
| 1023 | Ga0496112_0062285 | 3300048915 | Unclassified | 3679 |
| 1024 | Ga0496112_0078401 | 3300048915 | Bacteria | 3267 |
| 1025 | Ga0496112_0085273 | 3300048915 | Unclassified | 3125 |
| 1026 | Ga0496112_0172656 | 3300048915 | Unclassified | 2127 |
| 1027 | Ga0496112_0333997 | 3300048915 | Unclassified | 1459 |
| 1028 | Ga0496113_0230914 | 3300048916 | Unclassified | 1475 |
| 1029 | Ga0496113_0233567 | 3300048916 | Unclassified | 1466 |
| 1030 | Ga0496113_0293707 | 3300048916 | Unclassified | 1301 |
| 1031 | Ga0496114_0002506 | 3300048917 | Bacteria | 14021 |
| 1032 | Ga0496114_0005854 | 3300048917 | Bacteria | 9655 |
| 1033 | Ga0496114_0017341 | 3300048917 | Bacteria | 5811 |
| 1034 | Ga0496114_0025523 | 3300048917 | Bacteria | 4830 |
| 1035 | Ga0496114_0036768 | 3300048917 | Bacteria | 4048 |
| 1036 | Ga0496114_0044155 | 3300048917 | Bacteria | 3697 |
| 1037 | Ga0496114_0056446 | 3300048917 | Bacteria | 3277 |
| 1038 | Ga0496114_0064643 | 3300048917 | Unclassified | 3064 |
| 1039 | Ga0496114_0073802 | 3300048917 | Bacteria | 2871 |
| 1040 | Ga0496114_0104579 | 3300048917 | Unclassified | 2421 |
| 1041 | Ga0496114_0150606 | 3300048917 | Unclassified | 2018 |
| 1042 | Ga0496114_0155059 | 3300048917 | Bacteria | 1988 |
| 1043 | Ga0496114_0274703 | 3300048917 | Unclassified | 1485 |
| 1044 | Ga0496115_0003848 | 3300048918 | Bacteria | 10819 |
| 1045 | Ga0496115_0019061 | 3300048918 | Bacteria | 5275 |
| 1046 | Ga0496115_0019187 | 3300048918 | Bacteria | 5260 |
| 1047 | Ga0496115_0020862 | 3300048918 | Bacteria | 5057 |
| 1048 | Ga0496115_0043002 | 3300048918 | Bacteria | 3601 |
| 1049 | Ga0496115_0097294 | 3300048918 | Unclassified | 2410 |
| 1050 | Ga0496115_0128677 | 3300048918 | Unclassified | 2086 |
| 1051 | Ga0496115_0165896 | 3300048918 | Unclassified | 1826 |
| 1052 | Ga0496115_0193929 | 3300048918 | Bacteria | 1678 |
| 1053 | Ga0496115_0226154 | 3300048918 | Unclassified | 1543 |
| 1054 | Ga0496115_0232009 | 3300048918 | Unclassified | 1522 |
| 1055 | Ga0501031_0000263 | 3300049568 | Bacteria | 29643 |
| 1056 | Ga0501031_0002190 | 3300049568 | Bacteria | 12342 |
| 1057 | Ga0501031_0002872 | 3300049568 | Bacteria | 11016 |
| 1058 | Ga0501031_0011109 | 3300049568 | Bacteria | 5867 |
| 1059 | Ga0501031_0083133 | 3300049568 | Bacteria | 2087 |
| 1060 | Ga0501031_0117780 | 3300049568 | Unclassified | 1735 |
| 1061 | Ga0501032_0004898 | 3300049569 | Bacteria | 10020 |
| 1062 | Ga0501032_0006915 | 3300049569 | Bacteria | 8318 |
| 1063 | Ga0501032_0019318 | 3300049569 | Bacteria | 4769 |
| 1064 | Ga0501032_0068055 | 3300049569 | Bacteria | 2378 |
| 1065 | Ga0501032_0087214 | 3300049569 | Bacteria | 2073 |
| 1066 | Ga0501033_0001076 | 3300049570 | Bacteria | 24805 |
| 1067 | Ga0501033_0009606 | 3300049570 | Bacteria | 7443 |
| 1068 | Ga0501034_0009184 | 3300049571 | Bacteria | 10373 |
| 1069 | Ga0501034_0059163 | 3300049571 | Bacteria | 3849 |
| 1070 | Ga0501034_0083547 | 3300049571 | Bacteria | 3195 |
| 1071 | Ga0501034_0162811 | 3300049571 | Bacteria | 2201 |
| 1072 | Ga0501034_0413769 | 3300049571 | Unclassified | 1270 |
| 1073 | Ga0501036_0010592 | 3300049572 | Bacteria | 7619 |
| 1074 | Ga0501036_0026642 | 3300049572 | Bacteria | 4882 |
| 1075 | Ga0501036_0049375 | 3300049572 | Bacteria | 3563 |
| 1076 | Ga0501036_0096496 | 3300049572 | Bacteria | 2499 |
| 1077 | Ga0501036_0110116 | 3300049572 | Bacteria | 2327 |
| 1078 | Ga0501036_0194462 | 3300049572 | Bacteria | 1706 |
| 1079 | Ga0501037_0002779 | 3300049573 | Bacteria | 12672 |
| 1080 | Ga0501037_0012755 | 3300049573 | Bacteria | 6190 |
| 1081 | Ga0501037_0013984 | 3300049573 | Bacteria | 5914 |
| 1082 | Ga0501037_0015269 | 3300049573 | Bacteria | 5650 |
| 1083 | Ga0501037_0133054 | 3300049573 | Unclassified | 1782 |
| 1084 | Ga0501037_0167475 | 3300049573 | Bacteria | 1564 |
| 1085 | Ga0501038_0004175 | 3300049574 | Bacteria | 13433 |
| 1086 | Ga0501038_0005409 | 3300049574 | Bacteria | 11871 |
| 1087 | Ga0501038_0006451 | 3300049574 | Bacteria | 10859 |
| 1088 | Ga0501038_0019242 | 3300049574 | Bacteria | 6158 |
| 1089 | Ga0501038_0072233 | 3300049574 | Bacteria | 2924 |
| 1090 | Ga0501038_0099921 | 3300049574 | Bacteria | 2418 |
| 1091 | Ga0501038_0138595 | 3300049574 | Bacteria | 1992 |
| 1092 | Ga0501038_0140699 | 3300049574 | Bacteria | 1974 |
| 1093 | Ga0501038_0417474 | 3300049574 | Bacteria | 1036 |
| 1094 | Ga0501039_0001803 | 3300049575 | Bacteria | 15832 |
| 1095 | Ga0501039_0003246 | 3300049575 | Bacteria | 12164 |
| 1096 | Ga0501039_0023267 | 3300049575 | Bacteria | 4755 |
| 1097 | Ga0501039_0042091 | 3300049575 | Bacteria | 3529 |
| 1098 | Ga0501039_0083481 | 3300049575 | Bacteria | 2488 |
| 1099 | Ga0501039_0090000 | 3300049575 | Bacteria | 2392 |
| 1100 | Ga0501040_0000129 | 3300049576 | Bacteria | 40070 |
| 1101 | Ga0501040_0000457 | 3300049576 | Bacteria | 24248 |
| 1102 | Ga0501040_0001040 | 3300049576 | Bacteria | 17560 |
| 1103 | Ga0501040_0003831 | 3300049576 | Bacteria | 9761 |
| 1104 | Ga0501040_0028853 | 3300049576 | Bacteria | 3742 |
| 1105 | Ga0501040_0045540 | 3300049576 | Bacteria | 2993 |
| 1106 | Ga0501040_0081494 | 3300049576 | Bacteria | 2242 |
| 1107 | Ga0501041_0001521 | 3300049577 | Bacteria | 12870 |
| 1108 | Ga0501041_0002023 | 3300049577 | Bacteria | 11403 |
| 1109 | Ga0501041_0007035 | 3300049577 | Bacteria | 6602 |
| 1110 | Ga0501041_0012819 | 3300049577 | Bacteria | 4966 |
| 1111 | Ga0501041_0023268 | 3300049577 | Bacteria | 3715 |
| 1112 | Ga0501041_0034923 | 3300049577 | Bacteria | 3045 |
| 1113 | Ga0501041_0085430 | 3300049577 | Bacteria | 1945 |
| 1114 | Ga0501041_0088578 | 3300049577 | Bacteria | 1910 |
| 1115 | Ga0501041_0089272 | 3300049577 | Unclassified | 1903 |
| 1116 | Ga0501042_0000679 | 3300049578 | Bacteria | 18374 |
| 1117 | Ga0501042_0004192 | 3300049578 | Bacteria | 9169 |
| 1118 | Ga0501042_0011790 | 3300049578 | Bacteria | 5906 |
| 1119 | Ga0501042_0020129 | 3300049578 | Bacteria | 4640 |
| 1120 | Ga0501042_0023550 | 3300049578 | Bacteria | 4310 |
| 1121 | Ga0501042_0140926 | 3300049578 | Bacteria | 1739 |
| 1122 | Ga0501042_0154078 | 3300049578 | Bacteria | 1657 |
| 1123 | Ga0501042_0274232 | 3300049578 | Unclassified | 1218 |
| 1124 | Ga0501043_0063310 | 3300049579 | Bacteria | 2904 |
| 1125 | Ga0501043_0137936 | 3300049579 | Bacteria | 1910 |
| 1126 | Ga0501046_0006948 | 3300049580 | Bacteria | 9975 |
| 1127 | Ga0501046_0007888 | 3300049580 | Bacteria | 9327 |
| 1128 | Ga0501046_0050367 | 3300049580 | Bacteria | 3290 |
| 1129 | Ga0501046_0054458 | 3300049580 | Bacteria | 3146 |
| 1130 | Ga0501046_0085412 | 3300049580 | Bacteria | 2433 |
| 1131 | Ga0501047_0001330 | 3300049581 | Bacteria | 24244 |
| 1132 | Ga0501047_0037367 | 3300049581 | Bacteria | 4696 |
| 1133 | Ga0501047_0191141 | 3300049581 | Bacteria | 1910 |
| 1134 | Ga0501048_0003151 | 3300049582 | Bacteria | 12578 |
| 1135 | Ga0501048_0003226 | 3300049582 | Bacteria | 12428 |
| 1136 | Ga0501048_0003260 | 3300049582 | Bacteria | 12363 |
| 1137 | Ga0501048_0003679 | 3300049582 | Bacteria | 11688 |
| 1138 | Ga0501048_0015676 | 3300049582 | Bacteria | 5592 |
| 1139 | Ga0501048_0023855 | 3300049582 | Bacteria | 4468 |
| 1140 | Ga0501048_0043831 | 3300049582 | Bacteria | 3201 |
| 1141 | Ga0501048_0065743 | 3300049582 | Bacteria | 2564 |
| 1142 | Ga0501067_0000626 | 3300049583 | Bacteria | 19059 |
| 1143 | Ga0501067_0002416 | 3300049583 | Bacteria | 10320 |
| 1144 | Ga0501067_0006050 | 3300049583 | Bacteria | 6708 |
| 1145 | Ga0501067_0039188 | 3300049583 | Unclassified | 2631 |
| 1146 | Ga0501068_0000612 | 3300049584 | Bacteria | 18155 |
| 1147 | Ga0501068_0002114 | 3300049584 | Bacteria | 10596 |
| 1148 | Ga0501068_0114694 | 3300049584 | Bacteria | 1677 |
| 1149 | Ga0501068_0157459 | 3300049584 | Bacteria | 1430 |
| 1150 | Ga0501068_0212540 | 3300049584 | Bacteria | 1229 |
| 1151 | Ga0501069_0001580 | 3300049585 | Bacteria | 11263 |
| 1152 | Ga0501069_0001655 | 3300049585 | Bacteria | 11073 |
| 1153 | Ga0501069_0003857 | 3300049585 | Bacteria | 7725 |
| 1154 | Ga0501069_0007343 | 3300049585 | Bacteria | 5784 |
| 1155 | Ga0501069_0018312 | 3300049585 | Bacteria | 3778 |
| 1156 | Ga0501069_0029556 | 3300049585 | Bacteria | 3007 |
| 1157 | Ga0501069_0076715 | 3300049585 | Bacteria | 1879 |
| 1158 | Ga0501070_0001263 | 3300049586 | Bacteria | 22706 |
| 1159 | Ga0501070_0002844 | 3300049586 | Bacteria | 15107 |
| 1160 | Ga0501070_0006169 | 3300049586 | Bacteria | 10215 |
| 1161 | Ga0501070_0013996 | 3300049586 | Bacteria | 6753 |
| 1162 | Ga0501070_0033638 | 3300049586 | Bacteria | 4290 |
| 1163 | Ga0501070_0118296 | 3300049586 | Bacteria | 2190 |
| 1164 | Ga0501071_0000429 | 3300049587 | Bacteria | 20989 |
| 1165 | Ga0501071_0032790 | 3300049587 | Bacteria | 3690 |
| 1166 | Ga0501071_0065124 | 3300049587 | Bacteria | 2645 |
| 1167 | Ga0501071_0089222 | 3300049587 | Bacteria | 2262 |
| 1168 | Ga0501071_0138449 | 3300049587 | Bacteria | 1812 |
| 1169 | Ga0501071_0164891 | 3300049587 | Bacteria | 1657 |
| 1170 | Ga0501071_0224728 | 3300049587 | Bacteria | 1413 |
| 1171 | Ga0501072_0000838 | 3300049588 | Bacteria | 22612 |
| 1172 | Ga0501072_0004430 | 3300049588 | Bacteria | 10672 |
| 1173 | Ga0501072_0005569 | 3300049588 | Bacteria | 9579 |
| 1174 | Ga0501072_0005829 | 3300049588 | Bacteria | 9385 |
| 1175 | Ga0501072_0030188 | 3300049588 | Bacteria | 4237 |
| 1176 | Ga0501072_0041304 | 3300049588 | Bacteria | 3622 |
| 1177 | Ga0501072_0045158 | 3300049588 | Bacteria | 3464 |
| 1178 | Ga0501072_0055058 | 3300049588 | Unclassified | 3135 |
| 1179 | Ga0501072_0076791 | 3300049588 | Unclassified | 2643 |
| 1180 | Ga0501072_0142588 | 3300049588 | Bacteria | 1910 |
| 1181 | Ga0501073_0003677 | 3300049589 | Bacteria | 11526 |
| 1182 | Ga0501073_0007422 | 3300049589 | Bacteria | 8148 |
| 1183 | Ga0501073_0058241 | 3300049589 | Unclassified | 2700 |
| 1184 | Ga0501074_0010551 | 3300049590 | Bacteria | 6704 |
| 1185 | Ga0501074_0011837 | 3300049590 | Bacteria | 6343 |
| 1186 | Ga0501074_0012982 | 3300049590 | Bacteria | 6055 |
| 1187 | Ga0501074_0019521 | 3300049590 | Bacteria | 4921 |
| 1188 | Ga0501074_0046257 | 3300049590 | Bacteria | 3146 |
| 1189 | Ga0501074_0077630 | 3300049590 | Unclassified | 2383 |
| 1190 | Ga0501074_0147658 | 3300049590 | Unclassified | 1682 |
| 1191 | Ga0501075_0001091 | 3300049591 | Bacteria | 17469 |
| 1192 | Ga0501075_0001197 | 3300049591 | Bacteria | 16787 |
| 1193 | Ga0501075_0006056 | 3300049591 | Bacteria | 8296 |
| 1194 | Ga0501075_0010691 | 3300049591 | Bacteria | 6459 |
| 1195 | Ga0501075_0026212 | 3300049591 | Bacteria | 4289 |
| 1196 | Ga0501075_0036674 | 3300049591 | Bacteria | 3660 |
| 1197 | Ga0501075_0045840 | 3300049591 | Bacteria | 3282 |
| 1198 | Ga0501075_0051937 | 3300049591 | Bacteria | 3082 |
| 1199 | Ga0501075_0178737 | 3300049591 | Bacteria | 1619 |
| 1200 | Ga0501076_0000783 | 3300049592 | Bacteria | 20500 |
| 1201 | Ga0501076_0001047 | 3300049592 | Bacteria | 18162 |
| 1202 | Ga0501076_0008580 | 3300049592 | Bacteria | 7496 |
| 1203 | Ga0501076_0012858 | 3300049592 | Bacteria | 6263 |
| 1204 | Ga0501076_0024503 | 3300049592 | Bacteria | 4664 |
| 1205 | Ga0501076_0026371 | 3300049592 | Bacteria | 4500 |
| 1206 | Ga0501076_0048453 | 3300049592 | Bacteria | 3359 |
| 1207 | Ga0501076_0052277 | 3300049592 | Unclassified | 3236 |
| 1208 | Ga0501076_0072446 | 3300049592 | Bacteria | 2757 |
| 1209 | Ga0501076_0122207 | 3300049592 | Bacteria | 2108 |
| 1210 | Ga0501076_0349960 | 3300049592 | Unclassified | 1213 |
| 1211 | Ga0501076_0515607 | 3300049592 | Unclassified | 985 |
| 1212 | Ga0501077_0001338 | 3300049593 | Bacteria | 14869 |
| 1213 | Ga0501077_0002132 | 3300049593 | Bacteria | 11940 |
| 1214 | Ga0501077_0003928 | 3300049593 | Bacteria | 8955 |
| 1215 | Ga0501077_0020326 | 3300049593 | Bacteria | 4202 |
| 1216 | Ga0501077_0037645 | 3300049593 | Bacteria | 3080 |
| 1217 | Ga0501077_0050547 | 3300049593 | Bacteria | 2642 |
| 1218 | Ga0501077_0082745 | 3300049593 | Unclassified | 2034 |
| 1219 | Ga0501077_0105576 | 3300049593 | Bacteria | 1785 |
| 1220 | Ga0501079_0000086 | 3300049741 | Bacteria | 44783 |
| 1221 | Ga0501079_0000168 | 3300049741 | Bacteria | 36484 |
| 1222 | Ga0501079_0001798 | 3300049741 | Bacteria | 15315 |
| 1223 | Ga0501079_0006486 | 3300049741 | Bacteria | 8791 |
| 1224 | Ga0501079_0030117 | 3300049741 | Bacteria | 4170 |
| 1225 | Ga0501079_0031802 | 3300049741 | Unclassified | 4055 |
| 1226 | Ga0501079_0034220 | 3300049741 | Bacteria | 3910 |
| 1227 | Ga0501079_0053944 | 3300049741 | Bacteria | 3101 |
| 1228 | Ga0501079_0146948 | 3300049741 | Bacteria | 1837 |
| 1229 | Ga0501079_0247290 | 3300049741 | Unclassified | 1393 |
| 1230 | Ga0501080_0002699 | 3300049742 | Bacteria | 15551 |
| 1231 | Ga0501080_0008065 | 3300049742 | Bacteria | 9545 |
| 1232 | Ga0501080_0010114 | 3300049742 | Bacteria | 8626 |
| 1233 | Ga0501080_0040485 | 3300049742 | Bacteria | 4346 |
| 1234 | Ga0501080_0182896 | 3300049742 | Bacteria | 1928 |
| 1235 | Ga0501081_0000251 | 3300049743 | Bacteria | 27657 |
| 1236 | Ga0501081_0000452 | 3300049743 | Bacteria | 22680 |
| 1237 | Ga0501081_0016928 | 3300049743 | Bacteria | 4819 |
| 1238 | Ga0501081_0058143 | 3300049743 | Bacteria | 2675 |
| 1239 | Ga0501081_0062424 | 3300049743 | Bacteria | 2584 |
| 1240 | Ga0501081_0089781 | 3300049743 | Bacteria | 2159 |
| 1241 | Ga0501081_0247619 | 3300049743 | Bacteria | 1300 |
| 1242 | Ga0501081_0406438 | 3300049743 | Unclassified | 1008 |
| 1243 | Ga0501083_0001056 | 3300049744 | Bacteria | 18370 |
| 1244 | Ga0501083_0002884 | 3300049744 | Bacteria | 11890 |
| 1245 | Ga0501083_0004863 | 3300049744 | Bacteria | 9498 |
| 1246 | Ga0501083_0049375 | 3300049744 | Bacteria | 2836 |
| 1247 | Ga0501035_0005964 | 3300049822 | Bacteria | 11469 |
| 1248 | Ga0501035_0008590 | 3300049822 | Bacteria | 9503 |
| 1249 | Ga0501035_0049702 | 3300049822 | Bacteria | 3757 |
| 1250 | Ga0501035_0171479 | 3300049822 | Unclassified | 1874 |
| 1251 | Ga0501035_0248919 | 3300049822 | Bacteria | 1510 |
| 1252 | Ga0501044_0078170 | 3300049823 | Bacteria | 3353 |
| 1253 | Ga0501044_0326796 | 3300049823 | Bacteria | 1457 |
| 1254 | Ga0501045_0000378 | 3300049824 | Bacteria | 26772 |
| 1255 | Ga0501045_0001809 | 3300049824 | Bacteria | 14452 |
| 1256 | Ga0501045_0006327 | 3300049824 | Bacteria | 8189 |
| 1257 | Ga0501045_0015693 | 3300049824 | Bacteria | 5373 |
| 1258 | Ga0501045_0021270 | 3300049824 | Bacteria | 4639 |
| 1259 | Ga0501045_0027515 | 3300049824 | Bacteria | 4098 |
| 1260 | Ga0501045_0047040 | 3300049824 | Bacteria | 3142 |
| 1261 | Ga0501045_0050744 | 3300049824 | Bacteria | 3027 |
| 1262 | nmdc:mga05p37_170511_c1 | 3300050507 | Bacteria | 2654 |
| 1263 | nmdc:mga05p37_258997_c1 | 3300050507 | Unclassified | 2083 |
| 1264 | nmdc:mga05p37_273415_c1 | 3300050507 | Bacteria | 2018 |
| 1265 | nmdc:mga05p37_390795_c1 | 3300050507 | Bacteria | 1627 |
| 1266 | nmdc:mga05p37_41140_c1 | 3300050507 | Bacteria | 5675 |
| 1267 | nmdc:mga05p37_41342_c1 | 3300050507 | Bacteria | 5660 |
| 1268 | nmdc:mga05p37_476976_c1 | 3300050507 | Unclassified | 1438 |
| 1269 | nmdc:mga09592_16216_c1 | 3300050508 | Bacteria | 6090 |
| 1270 | nmdc:mga09592_90212_c1 | 3300050508 | Bacteria | 2618 |
| 1271 | nmdc:mga0qj67_135552_c1 | 3300050509 | Bacteria | 1995 |
| 1272 | nmdc:mga0qj67_138371_c1 | 3300050509 | Unclassified | 1974 |
| 1273 | nmdc:mga0qj67_27093_c1 | 3300050509 | Bacteria | 4440 |
| 1274 | nmdc:mga0qj67_31578_c1 | 3300050509 | Bacteria | 4126 |
| 1275 | nmdc:mga0qj67_91253_c1 | 3300050509 | Bacteria | 2448 |
| 1276 | nmdc:mga06r32_132149_c1 | 3300050510 | Unclassified | 2469 |
| 1277 | nmdc:mga06r32_140027_c1 | 3300050510 | Bacteria | 2395 |
| 1278 | nmdc:mga06r32_372534_c1 | 3300050510 | Unclassified | 1411 |
| 1279 | nmdc:mga08y16_10972_c1 | 3300050511 | Bacteria | 9514 |
| 1280 | nmdc:mga08y16_112483_c1 | 3300050511 | Bacteria | 2834 |
| 1281 | nmdc:mga08y16_13168_c1 | 3300050511 | Bacteria | 8699 |
| 1282 | nmdc:mga08y16_374384_c1 | 3300050511 | Bacteria | 1460 |
| 1283 | nmdc:mga08y16_41430_c1 | 3300050511 | Bacteria | 4824 |
| 1284 | nmdc:mga08y16_448837_c1 | 3300050511 | Unclassified | 1315 |
| 1285 | nmdc:mga08y16_75343_c1 | 3300050511 | Bacteria | 3518 |
| 1286 | nmdc:mga0n895_104144_c1 | 3300050512 | Bacteria | 2850 |
| 1287 | nmdc:mga0n895_122340_c1 | 3300050512 | Bacteria | 2624 |
| 1288 | nmdc:mga0n895_160825_c1 | 3300050512 | Bacteria | 2277 |
| 1289 | nmdc:mga0n895_24324_c1 | 3300050512 | Bacteria | 5707 |
| 1290 | nmdc:mga0n895_278678_c1 | 3300050512 | Bacteria | 1696 |
| 1291 | nmdc:mga0n895_34321_c1 | 3300050512 | Bacteria | 4882 |
| 1292 | nmdc:mga0n895_413738_c1 | 3300050512 | Bacteria | 1363 |
| 1293 | nmdc:mga0n895_50868_c1 | 3300050512 | Unclassified | 4064 |
| 1294 | nmdc:mga0rr50_17553_c1 | 3300050513 | Bacteria | 4781 |
| 1295 | nmdc:mga0rr50_18715_c1 | 3300050513 | Bacteria | 4659 |
| 1296 | nmdc:mga0rr50_30612_c1 | 3300050513 | Bacteria | 3812 |
| 1297 | nmdc:mga0rr50_311830_c1 | 3300050513 | Bacteria | 1318 |
| 1298 | nmdc:mga0rr50_32927_c1 | 3300050513 | Bacteria | 3699 |
| 1299 | nmdc:mga0rr50_42428_c1 | 3300050513 | Bacteria | 3322 |
| 1300 | nmdc:mga0rr50_64163_c1 | 3300050513 | Unclassified | 2777 |
| 1301 | nmdc:mga08x19_126917_c1 | 3300050514 | Unclassified | 1714 |
| 1302 | nmdc:mga08x19_74709_c1 | 3300050514 | Bacteria | 2215 |
| 1303 | nmdc:mga08x19_74799_c1 | 3300050514 | Bacteria | 2214 |
| 1304 | nmdc:mga0a205_13455_c1 | 3300050515 | Bacteria | 7619 |
| 1305 | nmdc:mga0a205_161914_c1 | 3300050515 | Unclassified | 2134 |
| 1306 | Ga0495601_0000076 | 3300053077 | Bacteria | 54429 |
| 1307 | Ga0495601_0011378 | 3300053077 | Bacteria | 5320 |
| 1308 | Ga0495601_0032607 | 3300053077 | Unclassified | 3243 |
| 1309 | Ga0495601_0043001 | 3300053077 | Bacteria | 2837 |
| 1310 | Ga0495601_0054657 | 3300053077 | Unclassified | 2526 |
| 1311 | Ga0495601_0092167 | 3300053077 | Unclassified | 1951 |
| 1312 | Ga0495601_0115795 | 3300053077 | Unclassified | 1738 |
| 1313 | Ga0495612_0005415 | 3300053078 | Bacteria | 5275 |
| 1314 | Ga0495612_0065820 | 3300053078 | Unclassified | 1505 |
| 1315 | Ga0495655_0003537 | 3300053083 | Bacteria | 2585 |
| 1316 | Ga0495595_0002925 | 3300053084 | Bacteria | 6742 |
| 1317 | Ga0495595_0022775 | 3300053084 | Unclassified | 2753 |
| 1318 | Ga0495595_0048412 | 3300053084 | Unclassified | 1962 |
| 1319 | Ga0495595_0075246 | 3300053084 | Unclassified | 1601 |
| 1320 | Ga0495619_0001491 | 3300053085 | Bacteria | 15423 |
| 1321 | Ga0495619_0007215 | 3300053085 | Bacteria | 7041 |
| 1322 | Ga0495619_0017016 | 3300053085 | Unclassified | 4608 |
| 1323 | Ga0495619_0389489 | 3300053085 | Unclassified | 963 |
| 1324 | Ga0500616_0012449 | 3300053153 | Bacteria | 4976 |
| 1325 | Ga0501084_0000325 | 3300054114 | Bacteria | 36436 |
| 1326 | Ga0501084_0001414 | 3300054114 | Bacteria | 19012 |
| 1327 | Ga0501084_0001555 | 3300054114 | Bacteria | 18225 |
| 1328 | Ga0501084_0002654 | 3300054114 | Bacteria | 14410 |
| 1329 | Ga0501084_0043602 | 3300054114 | Bacteria | 3752 |
| 1330 | Ga0501084_0045883 | 3300054114 | Bacteria | 3658 |
| 1331 | Ga0501084_0282565 | 3300054114 | Bacteria | 1401 |
| 1332 | Ga0501084_0287923 | 3300054114 | Bacteria | 1387 |
| 1333 | Ga0590071_008255 | 3300059421 | Bacteria | 2454 |
| 1334 | Ga0590075_016205 | 3300059424 | Unclassified | 1832 |
| 1335 | Ga0501082_0001639 | 3300060353 | Bacteria | 19733 |
| 1336 | Ga0501082_0004230 | 3300060353 | Bacteria | 12538 |
| 1337 | Ga0501082_0011930 | 3300060353 | Bacteria | 7472 |
| 1338 | Ga0501082_0022222 | 3300060353 | Bacteria | 5466 |
| 1339 | Ga0501082_0027578 | 3300060353 | Bacteria | 4889 |
| 1340 | Ga0501082_0068730 | 3300060353 | Bacteria | 3050 |
| 1341 | Ga0501082_0072202 | 3300060353 | Bacteria | 2973 |
| 1342 | Ga0501082_0120753 | 3300060353 | Bacteria | 2271 |
| 1343 | Ga0501082_0276516 | 3300060353 | Unclassified | 1462 |
| 1344 | Ga0501082_0389171 | 3300060353 | Bacteria | 1217 |
| 1345 | Ga0466962_0001952 | 3300061719 | Bacteria | 9717 |
| 1346 | Ga0466962_0036345 | 3300061719 | Unclassified | 2357 |
| 1347 | Ga0466962_0048503 | 3300061719 | Unclassified | 2029 |
| 1348 | Ga0466962_0095885 | 3300061719 | Unclassified | 1422 |
| 1349 | Ga0530510_0000291 | 3300061734 | Bacteria | 31825 |
| 1350 | Ga0530510_0001901 | 3300061734 | Bacteria | 14271 |
| 1351 | Ga0530510_0008782 | 3300061734 | Bacteria | 7068 |
| 1352 | Ga0530510_0012213 | 3300061734 | Bacteria | 6029 |
| 1353 | Ga0530510_0015756 | 3300061734 | Bacteria | 5344 |
| 1354 | Ga0530510_0071840 | 3300061734 | Bacteria | 2512 |
| 1355 | Ga0530510_0216531 | 3300061734 | Bacteria | 1423 |
| 1356 | Ga0395901_0224625 | |||
| 1357 | JGI25406J46586_10028809 | |||
| 1358 | JGI25407J50210_10004664 | |||
| 1359 | Ga0070658_10005491 | |||
| 1360 | Ga0070658_10006866 | |||
| 1361 | Ga0070658_10079282 | |||
| 1362 | Ga0070683_100002028 | |||
| 1363 | Ga0070683_100003692 | |||
| 1364 | Ga0070683_100021176 | |||
| 1365 | Ga0070683_100040458 | |||
| 1366 | Ga0070683_100084527 | |||
| 1367 | Ga0070683_100539190 | |||
| 1368 | Ga0070680_100009405 | |||
| 1369 | Ga0070680_100022032 | |||
| 1370 | Ga0070680_100045884 | |||
| 1371 | Ga0070680_100367668 | |||
| 1372 | Ga0070682_100006692 | |||
| 1373 | Ga0070682_100009325 | |||
| 1374 | Ga0068868_100055779 | |||
| 1375 | Ga0068868_100059770 | |||
| 1376 | Ga0070660_100002902 | |||
| 1377 | Ga0070660_100029562 | |||
| 1378 | Ga0070660_100070010 | |||
| 1379 | Ga0070689_100141962 | |||
| 1380 | Ga0070661_100006815 | |||
| 1381 | Ga0070661_100131683 | |||
| 1382 | Ga0070692_10026631 | |||
| 1383 | Ga0070668_100046895 | |||
| 1384 | Ga0070671_100065036 | |||
| 1385 | Ga0070674_100032683 | |||
| 1386 | Ga0070674_100080141 | |||
| 1387 | Ga0070674_100345137 | |||
| 1388 | Ga0070659_100023166 | |||
| 1389 | Ga0070659_100047111 | |||
| 1390 | Ga0070659_100068564 | |||
| 1391 | Ga0070703_10003153 | |||
| 1392 | Ga0070709_10263320 | |||
| 1393 | Ga0070714_100019202 | |||
| 1394 | Ga0070714_100025597 | |||
| 1395 | Ga0070714_100032558 | |||
| 1396 | Ga0070714_100072047 | |||
| 1397 | Ga0070714_100079606 | |||
| 1398 | Ga0070714_100087201 | |||
| 1399 | Ga0070714_100227650 | |||
| 1400 | Ga0070713_100031822 | |||
| 1401 | Ga0070710_10010142 | |||
| 1402 | Ga0070710_10022046 | |||
| 1403 | Ga0070710_10023678 | |||
| 1404 | Ga0070710_10034698 | |||
| 1405 | Ga0070701_10001044 | |||
| 1406 | Ga0070701_10120712 | |||
| 1407 | Ga0070711_100032439 | |||
| 1408 | Ga0070711_100046025 | |||
| 1409 | Ga0070711_100091587 | |||
| 1410 | Ga0070711_100121841 | |||
| 1411 | Ga0070705_100008024 | |||
| 1412 | Ga0070705_100031784 | |||
| 1413 | Ga0070700_100009552 | |||
| 1414 | Ga0070694_100096826 | |||
| 1415 | Ga0070694_100106475 | |||
| 1416 | Ga0070694_100130213 | |||
| 1417 | Ga0070708_100009352 | |||
| 1418 | Ga0070708_100078602 | |||
| 1419 | Ga0070708_100175721 | |||
| 1420 | Ga0070678_100046159 | |||
| 1421 | Ga0070662_100135120 | |||
| 1422 | Ga0070681_10000616 | |||
| 1423 | Ga0070681_10001900 | |||
| 1424 | Ga0070681_10005995 | |||
| 1425 | Ga0070681_10020763 | |||
| 1426 | Ga0070681_10045315 | |||
| 1427 | Ga0070681_10083838 | |||
| 1428 | Ga0070681_10096894 | |||
| 1429 | Ga0070681_10138064 | |||
| 1430 | Ga0070681_10236251 | |||
| 1431 | Ga0070681_10334238 | |||
| 1432 | Ga0070681_10360665 | |||
| 1433 | Ga0070681_10596637 | |||
| 1434 | Ga0068867_100008488 | |||
| 1435 | Ga0070685_10029915 | |||
| 1436 | Ga0070707_100000275 | |||
| 1437 | Ga0070707_100003029 | |||
| 1438 | Ga0070707_100028647 | |||
| 1439 | Ga0070698_100004541 | |||
| 1440 | Ga0070698_100140279 | |||
| 1441 | Ga0070698_100245436 | |||
| 1442 | Ga0070679_100002700 | |||
| 1443 | Ga0070679_100012530 | |||
| 1444 | Ga0070679_100105984 | |||
| 1445 | Ga0070679_100122923 | |||
| 1446 | Ga0070679_100316705 | |||
| 1447 | Ga0070679_100398703 | |||
| 1448 | Ga0070679_100421920 | |||
| 1449 | Ga0070679_100445498 | |||
| 1450 | Ga0070684_100010614 | |||
| 1451 | Ga0070684_100011191 | |||
| 1452 | Ga0070684_100014749 | |||
| 1453 | Ga0070684_100018945 | |||
| 1454 | Ga0070684_100098480 | |||
| 1455 | Ga0070686_100147224 | |||
| 1456 | Ga0070695_100081335 | |||
| 1457 | Ga0070696_100024272 | |||
| 1458 | Ga0070696_100045589 | |||
| 1459 | Ga0070696_100128818 | |||
| 1460 | Ga0070693_100157787 | |||
| 1461 | Ga0070665_100047376 | |||
| 1462 | Ga0070704_100023177 | |||
| 1463 | Ga0070704_100038451 | |||
| 1464 | Ga0070704_100060691 | |||
| 1465 | Ga0068855_100229631 | |||
| 1466 | Ga0068855_100230999 | |||
| 1467 | Ga0068857_100008075 | |||
| 1468 | Ga0068857_100009831 | |||
| 1469 | Ga0068857_100315976 | |||
| 1470 | Ga0068857_100445905 | |||
| 1471 | Ga0068854_100107201 | |||
| 1472 | Ga0068856_100096391 | |||
| 1473 | Ga0070702_100001212 | |||
| 1474 | Ga0068852_100270309 | |||
| 1475 | Ga0068859_100038040 | |||
| 1476 | Ga0068866_10003462 | |||
| 1477 | Ga0068866_10167266 | |||
| 1478 | Ga0068861_100044911 | |||
| 1479 | Ga0068861_100050347 | |||
| 1480 | Ga0068861_100209609 | |||
| 1481 | Ga0068858_100143785 | |||
| 1482 | Ga0068860_100104005 | |||
| 1483 | Ga0068862_100200362 | |||
| 1484 | Ga0081455_10007511 | |||
| 1485 | Ga0081455_10012069 | |||
| 1486 | Ga0081455_10020700 | |||
| 1487 | Ga0081455_10023070 | |||
| 1488 | Ga0081455_10046168 | |||
| 1489 | Ga0081455_10066557 | |||
| 1490 | Ga0081455_10076887 | |||
| 1491 | Ga0081455_10085572 | |||
| 1492 | Ga0081455_10150864 | |||
| 1493 | Ga0081455_10237473 | |||
| 1494 | Ga0081538_10000081 | |||
| 1495 | Ga0081538_10001520 | |||
| 1496 | Ga0081538_10001954 | |||
| 1497 | Ga0081538_10001983 | |||
| 1498 | Ga0081538_10009602 | |||
| 1499 | Ga0081538_10011592 | |||
| 1500 | Ga0081538_10015038 | |||
| 1501 | Ga0081538_10020089 | |||
| 1502 | Ga0081538_10047927 | |||
| 1503 | Ga0081538_10132060 | |||
| 1504 | Ga0081540_1001698 | |||
| 1505 | Ga0081540_1006573 | |||
| 1506 | Ga0081539_10000030 | |||
| 1507 | Ga0081539_10002638 | |||
| 1508 | Ga0081539_10008967 | |||
| 1509 | Ga0081539_10010159 | |||
| 1510 | Ga0081539_10027467 | |||
| 1511 | Ga0081539_10032423 | |||
| 1512 | Ga0081539_10080928 | |||
| 1513 | Ga0070717_10040450 | |||
| 1514 | Ga0070717_10048662 | |||
| 1515 | Ga0070717_10051942 | |||
| 1516 | Ga0070717_10389995 | |||
| 1517 | Ga0075365_10033550 | |||
| 1518 | Ga0070715_10001432 | |||
| 1519 | Ga0070716_100007454 | |||
| 1520 | Ga0070716_100269294 | |||
| 1521 | Ga0070712_100011911 | |||
| 1522 | Ga0070712_100015454 | |||
| 1523 | Ga0070712_100017694 | |||
| 1524 | Ga0070712_100033450 | |||
| 1525 | Ga0097621_100004581 | |||
| 1526 | Ga0068871_100010878 | |||
| 1527 | Ga0068871_100198551 | |||
| 1528 | Ga0075428_100013380 | |||
| 1529 | Ga0075428_100026425 | |||
| 1530 | Ga0075428_100097188 | |||
| 1531 | Ga0075428_100331495 | |||
| 1532 | Ga0075430_100024112 | |||
| 1533 | Ga0075430_100024840 | |||
| 1534 | Ga0075430_100038596 | |||
| 1535 | Ga0075430_100065471 | |||
| 1536 | Ga0075430_100112818 | |||
| 1537 | Ga0075431_100178226 | |||
| 1538 | Ga0075433_10009587 | |||
| 1539 | Ga0075434_100000729 | |||
| 1540 | Ga0075434_100009715 | |||
| 1541 | Ga0075434_100045049 | |||
| 1542 | Ga0075434_100045839 | |||
| 1543 | Ga0075434_100170920 | |||
| 1544 | Ga0075429_100042708 | |||
| 1545 | Ga0068865_100055840 | |||
| 1546 | Ga0068865_100217869 | |||
| 1547 | Ga0068865_100269277 | |||
| 1548 | Ga0075436_100030875 | |||
| 1549 | Ga0075436_100107098 | |||
| 1550 | Ga0075436_100112213 | |||
| 1551 | Ga0075436_100122023 | |||
| 1552 | Ga0097620_100038042 | |||
| 1553 | Ga0075435_100000976 | |||
| 1554 | Ga0075435_100045409 | |||
| 1555 | Ga0075435_100045559 | |||
| 1556 | Ga0075435_100089777 | |||
| 1557 | Ga0075435_100168120 | |||
| 1558 | Ga0105240_10030156 | |||
| 1559 | Ga0105240_10035032 | |||
| 1560 | Ga0105240_10364592 | |||
| 1561 | Ga0111539_10012237 | |||
| 1562 | Ga0111539_10094954 | |||
| 1563 | Ga0111539_10141256 | |||
| 1564 | Ga0111539_10336792 | |||
| 1565 | Ga0111539_10374000 | |||
| 1566 | Ga0111539_10442962 | |||
| 1567 | Ga0105245_10007926 | |||
| 1568 | Ga0105245_10008291 | |||
| 1569 | Ga0105245_10026991 | |||
| 1570 | Ga0105245_10038598 | |||
| 1571 | Ga0105245_10388629 | |||
| 1572 | Ga0114129_10124430 | |||
| 1573 | Ga0114129_10140093 | |||
| 1574 | Ga0114129_10206005 | |||
| 1575 | Ga0114129_10210978 | |||
| 1576 | Ga0105243_10090565 | |||
| 1577 | Ga0105243_10165568 | |||
| 1578 | Ga0105243_10262632 | |||
| 1579 | Ga0105243_10334959 | |||
| 1580 | Ga0105243_10450026 | |||
| 1581 | Ga0105242_10027683 | |||
| 1582 | Ga0105248_10040999 | |||
| 1583 | Ga0105248_10052503 | |||
| 1584 | Ga0105248_10445480 | |||
| 1585 | Ga0105248_10450810 | |||
| 1586 | Ga0105237_10226159 | |||
| 1587 | Ga0105237_10268629 | |||
| 1588 | Ga0105237_10371074 | |||
| 1589 | Ga0105238_10050648 | |||
| 1590 | Ga0105238_10352210 | |||
| 1591 | Ga0105249_10001940 | |||
| 1592 | Ga0105249_10159499 | |||
| 1593 | Ga0105239_10093255 | |||
| 1594 | Ga0105239_10178925 | |||
| 1595 | Ga0105239_10316800 | |||
| 1596 | Ga0105246_10307014 | |||
| 1597 | Ga0157373_10085233 | |||
| 1598 | Ga0157370_10017998 | |||
| 1599 | Ga0157370_10019185 | |||
| 1600 | Ga0157370_10067245 | |||
| 1601 | Ga0157370_10083141 | |||
| 1602 | Ga0157370_10313418 | |||
| 1603 | Ga0157369_10004273 | |||
| 1604 | Ga0157369_10016108 | |||
| 1605 | Ga0157369_10116667 | |||
| 1606 | Ga0157369_10267887 | |||
| 1607 | Ga0157374_10463315 | |||
| 1608 | Ga0157378_10179450 | |||
| 1609 | Ga0163162_10011361 | |||
| 1610 | Ga0163162_10479924 | |||
| 1611 | Ga0157372_10007666 | |||
| 1612 | Ga0157372_10035919 | |||
| 1613 | Ga0157372_10085735 | |||
| 1614 | Ga0157375_10215041 | |||
| 1615 | Ga0163163_10100218 | |||
| 1616 | Ga0163163_10409392 | |||
| 1617 | Ga0182008_10093412 | |||
| 1618 | Ga0182008_10142343 | |||
| 1619 | Ga0157377_10022058 | |||
| 1620 | Ga0157376_10089796 | |||
| 1621 | Ga0157376_10122395 | |||
| 1622 | Ga0163161_10092494 | |||
| 1623 | Ga0197907_10106361 | |||
| 1624 | Ga0197907_10330051 | |||
| 1625 | Ga0197907_10820005 | |||
| 1626 | Ga0206356_10113963 | |||
| 1627 | Ga0206356_10242924 | |||
| 1628 | Ga0206356_10590513 | |||
| 1629 | Ga0206352_10245129 | |||
| 1630 | Ga0206352_11359820 | |||
| 1631 | Ga0206350_11418746 | |||
| 1632 | Ga0206354_10590308 | |||
| 1633 | Ga0206354_11269992 | |||
| 1634 | Ga0206353_10009509 | |||
| 1635 | Ga0206353_10033590 | |||
| 1636 | Ga0206353_10071829 | |||
| 1637 | Ga0206353_10125552 | |||
| 1638 | Ga0206353_10734720 | |||
| 1639 | Ga0213876_10052220 | |||
| 1640 | Ga0224712_10016708 | |||
| 1641 | Ga0224712_10083862 | |||
| 1642 | Ga0207653_10015876 | |||
| 1643 | Ga0207653_10070340 | |||
| 1644 | Ga0207692_10078372 | |||
| 1645 | Ga0207688_10051689 | |||
| 1646 | Ga0207688_10110421 | |||
| 1647 | Ga0207685_10013181 | |||
| 1648 | Ga0207685_10023299 | |||
| 1649 | Ga0207699_10046711 | |||
| 1650 | Ga0207645_10139088 | |||
| 1651 | Ga0207643_10018169 | |||
| 1652 | Ga0207705_10024856 | |||
| 1653 | Ga0207705_10050418 | |||
| 1654 | Ga0207705_10071992 | |||
| 1655 | Ga0207654_10013679 | |||
| 1656 | Ga0207707_10001844 | |||
| 1657 | Ga0207707_10002240 | |||
| 1658 | Ga0207707_10007327 | |||
| 1659 | Ga0207707_10008429 | |||
| 1660 | Ga0207707_10011363 | |||
| 1661 | Ga0207707_10051859 | |||
| 1662 | Ga0207707_10108566 | |||
| 1663 | Ga0207707_10168799 | |||
| 1664 | Ga0207707_10343834 | |||
| 1665 | Ga0207695_10014102 | |||
| 1666 | Ga0207695_10474365 | |||
| 1667 | Ga0207671_10253055 | |||
| 1668 | Ga0207693_10001413 | |||
| 1669 | Ga0207693_10003121 | |||
| 1670 | Ga0207693_10005575 | |||
| 1671 | Ga0207693_10013689 | |||
| 1672 | Ga0207693_10017496 | |||
| 1673 | Ga0207693_10055006 | |||
| 1674 | Ga0207693_10091537 | |||
| 1675 | Ga0207693_10095486 | |||
| 1676 | Ga0207693_10161147 | |||
| 1677 | Ga0207663_10012436 | |||
| 1678 | Ga0207663_10038622 | |||
| 1679 | Ga0207663_10042383 | |||
| 1680 | Ga0207663_10125436 | |||
| 1681 | Ga0207660_10033106 | |||
| 1682 | Ga0207660_10036022 | |||
| 1683 | Ga0207660_10269555 | |||
| 1684 | Ga0207657_10001894 | |||
| 1685 | Ga0207657_10003027 | |||
| 1686 | Ga0207657_10006053 | |||
| 1687 | Ga0207649_10077574 | |||
| 1688 | Ga0207649_10101293 | |||
| 1689 | Ga0207652_10026187 | |||
| 1690 | Ga0207652_10035205 | |||
| 1691 | Ga0207652_10037841 | |||
| 1692 | Ga0207652_10048430 | |||
| 1693 | Ga0207652_10056783 | |||
| 1694 | Ga0207652_10105719 | |||
| 1695 | Ga0207652_10126683 | |||
| 1696 | Ga0207652_10179377 | |||
| 1697 | Ga0207652_10494532 | |||
| 1698 | Ga0207646_10000523 | |||
| 1699 | Ga0207646_10023032 | |||
| 1700 | Ga0207646_10073322 | |||
| 1701 | Ga0207687_10005471 | |||
| 1702 | Ga0207687_10174665 | |||
| 1703 | Ga0207687_10379483 | |||
| 1704 | Ga0207700_10000004 | |||
| 1705 | Ga0207664_10017800 | |||
| 1706 | Ga0207664_10024516 | |||
| 1707 | Ga0207664_10034516 | |||
| 1708 | Ga0207664_10036721 | |||
| 1709 | Ga0207664_10054523 | |||
| 1710 | Ga0207664_10062133 | |||
| 1711 | Ga0207644_10182549 | |||
| 1712 | Ga0207706_10185370 | |||
| 1713 | Ga0207686_10121051 | |||
| 1714 | Ga0207686_10349680 | |||
| 1715 | Ga0207709_10057598 | |||
| 1716 | Ga0207709_10311664 | |||
| 1717 | Ga0207670_10132248 | |||
| 1718 | Ga0207669_10043630 | |||
| 1719 | Ga0207704_10096790 | |||
| 1720 | Ga0207665_10001593 | |||
| 1721 | Ga0207665_10016651 | |||
| 1722 | Ga0207665_10090565 | |||
| 1723 | Ga0207691_10047074 | |||
| 1724 | Ga0207711_10164193 | |||
| 1725 | Ga0207711_10374339 | |||
| 1726 | Ga0207689_10056673 | |||
| 1727 | Ga0207661_10000267 | |||
| 1728 | Ga0207661_10017857 | |||
| 1729 | Ga0207661_10053411 | |||
| 1730 | Ga0207661_10128634 | |||
| 1731 | Ga0207661_10182457 | |||
| 1732 | Ga0207679_10160328 | |||
| 1733 | Ga0207679_10355151 | |||
| 1734 | Ga0207667_10034152 | |||
| 1735 | Ga0207667_10123109 | |||
| 1736 | Ga0207712_10008916 | |||
| 1737 | Ga0207712_10129879 | |||
| 1738 | Ga0207678_10095509 | |||
| 1739 | Ga0207708_10006281 | |||
| 1740 | Ga0207702_10023561 | |||
| 1741 | Ga0207702_10129319 | |||
| 1742 | Ga0207702_10143188 | |||
| 1743 | Ga0207702_10239714 | |||
| 1744 | Ga0207648_10012851 | |||
| 1745 | Ga0207676_10184909 | |||
| 1746 | Ga0207674_10008380 | |||
| 1747 | Ga0207674_10025394 | |||
| 1748 | Ga0207674_10029599 | |||
| 1749 | Ga0207674_10272149 | |||
| 1750 | Ga0207674_10275950 | |||
| 1751 | Ga0207675_100055353 | |||
| 1752 | Ga0207675_100064904 | |||
| 1753 | Ga0207675_100142668 | |||
| 1754 | Ga0207675_100199385 | |||
| 1755 | Ga0207675_100337053 | |||
| 1756 | Ga0207683_10066984 | |||
| 1757 | Ga0207683_10227052 | |||
| 1758 | Ga0207683_10399770 | |||
| 1759 | Ga0207698_10057989 | |||
| 1760 | Ga0207428_10005283 | |||
| 1761 | Ga0207428_10035476 | |||
| 1762 | Ga0207428_10049047 | |||
| 1763 | Ga0207428_10121810 | |||
| 1764 | Ga0268266_10181148 | |||
| 1765 | Ga0268265_10155758 | |||
| 1766 | Ga0268264_10031765 | |||
| 1767 | Ga0265319_1003960 | |||
| 1768 | Ga0265319_1035728 | |||
| 1769 | Ga0265319_1054278 | |||
| 1770 | Ga0265334_10005568 | |||
| 1771 | Ga0265334_10010959 | |||
| 1772 | Ga0265334_10063019 | |||
| 1773 | Ga0265318_10000400 | |||
| 1774 | Ga0265318_10010787 | |||
| 1775 | Ga0265336_10000644 | |||
| 1776 | Ga0265338_10002401 | |||
| 1777 | Ga0265338_10003454 | |||
| 1778 | Ga0265338_10003802 | |||
| 1779 | Ga0265338_10017148 | |||
| 1780 | Ga0265338_10020068 | |||
| 1781 | Ga0265338_10027944 | |||
| 1782 | Ga0265338_10028585 | |||
| 1783 | Ga0265338_10053100 | |||
| 1784 | Ga0265338_10335101 | |||
| 1785 | Ga0265324_10033189 | |||
| 1786 | Ga0265330_10001899 | |||
| 1787 | Ga0265332_10003587 | |||
| 1788 | Ga0265332_10119076 | |||
| 1789 | Ga0265328_10007322 | |||
| 1790 | Ga0265320_10024124 | |||
| 1791 | Ga0265320_10072741 | |||
| 1792 | Ga0265325_10004124 | |||
| 1793 | Ga0265325_10024520 | |||
| 1794 | Ga0265339_10019835 | |||
| 1795 | Ga0265331_10016699 | |||
| 1796 | Ga0265331_10035024 | |||
| 1797 | Ga0265327_10007326 | |||
| 1798 | Ga0265327_10035566 | |||
| 1799 | Ga0265316_10013876 | |||
| 1800 | Ga0307408_100017136 | |||
| 1801 | Ga0307408_100035986 | |||
| 1802 | Ga0265313_10022023 | |||
| 1803 | Ga0265313_10028247 | |||
| 1804 | Ga0265314_10045395 | |||
| 1805 | Ga0265314_10066070 | |||
| 1806 | Ga0316576_10228940 | |||
| 1807 | Ga0307405_10030957 | |||
| 1808 | Ga0307405_10038307 | |||
| 1809 | Ga0307413_10001279 | |||
| 1810 | Ga0307410_10009327 | |||
| 1811 | Ga0307406_10013354 | |||
| 1812 | Ga0307406_10015316 | |||
| 1813 | Ga0307406_10117182 | |||
| 1814 | Ga0307407_10004510 | |||
| 1815 | Ga0307407_10017104 | |||
| 1816 | Ga0307407_10216525 | |||
| 1817 | Ga0307412_10182633 | |||
| 1818 | Ga0307412_10202849 | |||
| 1819 | Ga0307409_100007207 | |||
| 1820 | Ga0307409_100021932 | |||
| 1821 | Ga0307409_100022313 | |||
| 1822 | Ga0307409_100105742 | |||
| 1823 | Ga0307409_100255429 | |||
| 1824 | Ga0307416_100000842 | |||
| 1825 | Ga0307416_100021151 | |||
| 1826 | Ga0307416_100032917 | |||
| 1827 | Ga0307416_100047861 | |||
| 1828 | Ga0307416_100245218 | |||
| 1829 | Ga0307416_100308682 | |||
| 1830 | Ga0307414_10344540 | |||
| 1831 | Ga0307415_100002772 | |||
| 1832 | Ga0307415_100006557 | |||
| 1833 | Ga0307415_100025919 | |||
| 1834 | Ga0307415_100094119 | |||
| 1835 | Ga0373948_0001030 | |||
| 1836 | Ga0373938_0024552 | |||
| 1837 | Ga0373926_0013325 | |||
| 1838 | Ga0373929_0030941 | |||
| 1839 | Ga0373934_0069686 | |||
| 1840 | Ga0373944_0004384 | |||
| 1841 | Ga0373949_0016254 | |||
| 1842 | Ga0373936_0008919 | |||
| 1843 | Ga0373941_0028178 | |||
| 1844 | Ga0373945_0024846 | |||
| 1845 | Ga0373953_0029989 | |||
| 1846 | Ga0373956_0090915 | |||
| 1847 | Ga0373960_0000659 | |||
| 1848 | Ga0373943_0003903 | |||
| 1849 | Ga0373943_0004371 | |||
| 1850 | Ga0373943_0005589 | |||
| 1851 | Ga0373943_0038522 | |||
| 1852 | Ga0373946_0010111 | |||
| 1853 | Ga0373946_0022653 | |||
| 1854 | Ga0373942_0043048 | |||
| 1855 | Ga0373962_0016807 | |||
| 1856 | Ga0373931_0008998 | |||
| 1857 | Ga0373935_0014903 | |||
| 1858 | Ga0373927_0141453 | |||
| 1859 | Ga0373933_0065432 | |||
| 1860 | Ga0373947_0000522 | |||
| 1861 | Ga0373947_0008709 | |||
| 1862 | Ga0373947_0137691 | |||
| 1863 | Ga0373937_0000828 | |||
| 1864 | Ga0373937_0112806 | |||
| 1865 | Ga0373925_0052110 | |||
| 1866 | Ga0395899_0001333 | |||
| 1867 | Ga0395899_0002768 | |||
| 1868 | Ga0395899_0007857 | |||
| 1869 | Ga0395899_0007896 | |||
| 1870 | Ga0395899_0010024 | |||
| 1871 | Ga0395899_0017268 | |||
| 1872 | Ga0395899_0026688 | |||
| 1873 | Ga0395899_0032923 | |||
| 1874 | Ga0395899_0035706 | |||
| 1875 | Ga0395899_0040552 | |||
| 1876 | Ga0395899_0089369 | |||
| 1877 | Ga0395899_0140947 | |||
| 1878 | Ga0395899_0149001 | |||
| 1879 | Ga0395900_0004816 | |||
| 1880 | Ga0395900_0006109 | |||
| 1881 | Ga0395900_0006406 | |||
| 1882 | Ga0395900_0008028 | |||
| 1883 | Ga0395900_0009640 | |||
| 1884 | Ga0395900_0009837 | |||
| 1885 | Ga0395900_0011359 | |||
| 1886 | Ga0395900_0015535 | |||
| 1887 | Ga0395900_0020954 | |||
| 1888 | Ga0395900_0042274 | |||
| 1889 | Ga0395900_0085043 | |||
| 1890 | Ga0395900_0100399 | |||
| 1891 | Ga0395900_0116173 | |||
| 1892 | Ga0395900_0124688 | |||
| 1893 | Ga0395900_0131455 | |||
| 1894 | Ga0395900_0147695 | |||
| 1895 | Ga0395900_0192888 | |||
| 1896 | Ga0395900_0221031 | |||
| 1897 | Ga0395900_0244589 | |||
| 1898 | Ga0395900_0313142 | |||
| 1899 | Ga0395900_0406998 | |||
| 1900 | Ga0395900_0415665 | |||
| 1901 | Ga0395898_0000635 | |||
| 1902 | Ga0395898_0004222 | |||
| 1903 | Ga0395898_0007862 | |||
| 1904 | Ga0395898_0007894 | |||
| 1905 | Ga0395898_0013333 | |||
| 1906 | Ga0395898_0018206 | |||
| 1907 | Ga0395898_0019228 | |||
| 1908 | Ga0395898_0020975 | |||
| 1909 | Ga0395898_0036211 | |||
| 1910 | Ga0395898_0043838 | |||
| 1911 | Ga0395898_0046900 | |||
| 1912 | Ga0395898_0050402 | |||
| 1913 | Ga0395898_0058150 | |||
| 1914 | Ga0395898_0059548 | |||
| 1915 | Ga0395898_0076862 | |||
| 1916 | Ga0395898_0126208 | |||
| 1917 | Ga0395898_0128400 | |||
| 1918 | Ga0395898_0171324 | |||
| 1919 | Ga0395898_0253359 | |||
| 1920 | Ga0395898_0259432 | |||
| 1921 | Ga0395898_0267759 | |||
| 1922 | Ga0395905_0004382 | |||
| 1923 | Ga0395905_0004838 | |||
| 1924 | Ga0395905_0006804 | |||
| 1925 | Ga0395905_0009223 | |||
| 1926 | Ga0395905_0010656 | |||
| 1927 | Ga0395905_0011850 | |||
| 1928 | Ga0395905_0019646 | |||
| 1929 | Ga0395905_0024439 | |||
| 1930 | Ga0395905_0025347 | |||
| 1931 | Ga0395905_0029683 | |||
| 1932 | Ga0395905_0029708 | |||
| 1933 | Ga0395905_0032332 | |||
| 1934 | Ga0395905_0054679 | |||
| 1935 | Ga0395905_0103003 | |||
| 1936 | Ga0395905_0103690 | |||
| 1937 | Ga0395905_0145116 | |||
| 1938 | Ga0395905_0219135 | |||
| 1939 | Ga0395905_0258509 | |||
| 1940 | Ga0395901_0002544 | |||
| 1941 | Ga0395901_0003773 | |||
| 1942 | Ga0395901_0006552 | |||
| 1943 | Ga0395901_0007534 | |||
| 1944 | Ga0395901_0008779 | |||
| 1945 | Ga0395901_0010232 | |||
| 1946 | Ga0395901_0014478 | |||
| 1947 | Ga0395901_0016360 | |||
| 1948 | Ga0395901_0016913 | |||
| 1949 | Ga0395901_0018646 | |||
| 1950 | Ga0395901_0053471 | |||
| 1951 | Ga0395901_0061539 | |||
| 1952 | Ga0395901_0070958 | |||
| 1953 | Ga0395901_0085944 | |||
| 1954 | Ga0395901_0098325 | |||
| 1955 | Ga0395901_0120971 | |||
| 1956 | Ga0395901_0151291 | |||
| 1957 | Ga0395901_0156328 | |||
| 1958 | Ga0395901_0177266 | |||
| 1959 | Ga0395901_0229590 | |||
| 1960 | Ga0395901_0274654 | |||
| 1961 | Ga0395901_0376731 | |||
| 1962 | Ga0395901_0415373 | |||
| 1963 | Ga0242420_023196 | |||
| 1964 | Ga0436365_0226835 | |||
| 1965 | Ga0436360_0592628 | |||
| 1966 | Ga0436360_0683623 | |||
| 1967 | Ga0436362_0162555 | |||
| 1968 | Ga0439436_0027573 | |||
| 1969 | Ga0439439_0002499 | |||
| 1970 | Ga0451802_0263095 | |||
| 1971 | Ga0451804_0309295 | |||
| 1972 | Ga0451807_1633611 | |||
| 1973 | Ga0451835_0664460 | |||
| 1974 | Ga0451839_0289782 | |||
| 1975 | Ga0451841_0135509 | |||
| 1976 | Ga0451845_0605847 | |||
| 1977 | Ga0451853_0865426 | |||
| 1978 | Ga0439433_0007340 | |||
| 1979 | Ga0439448_0035453 | |||
| 1980 | Ga0439449_0138190 | |||
| 1981 | Ga0439455_0051446 | |||
| 1982 | Ga0450915_000186 | |||
| 1983 | Ga0450923_029494 | |||
| 1984 | Ga0450907_007003 | |||
| 1985 | Ga0450910_012957 | |||
| 1986 | Ga0439446_0000956 | |||
| 1987 | Ga0439458_0010755 | |||
| 1988 | Ga0439434_0006978 | |||
| 1989 | Ga0439434_0014035 | |||
| 1990 | Ga0439460_0089660 | |||
| 1991 | Ga0451577_0240581 | |||
| 1992 | Ga0466969_0001432 | |||
| 1993 | Ga0466969_0085173 | |||
| 1994 | Ga0466966_0015325 | |||
| 1995 | Ga0466966_0023530 | |||
| 1996 | Ga0466966_0038032 | |||
| 1997 | Ga0466966_0045305 | |||
| 1998 | Ga0466961_0003114 | |||
| 1999 | Ga0466961_0003820 | |||
| 2000 | Ga0466961_0032498 | |||
| 2001 | Ga0466961_0096945 | |||
| 2002 | Ga0466963_0000091 | |||
| 2003 | Ga0466963_0000956 | |||
| 2004 | Ga0466963_0001618 | |||
| 2005 | Ga0466963_0003857 | |||
| 2006 | Ga0466963_0004917 | |||
| 2007 | Ga0466963_0007740 | |||
| 2008 | Ga0466963_0008393 | |||
| 2009 | Ga0466963_0008551 | |||
| 2010 | Ga0466963_0013611 | |||
| 2011 | Ga0466963_0013983 | |||
| 2012 | Ga0466963_0040829 | |||
| 2013 | Ga0466963_0042845 | |||
| 2014 | Ga0466963_0048028 | |||
| 2015 | Ga0466963_0051123 | |||
| 2016 | Ga0466963_0056483 | |||
| 2017 | Ga0466963_0064208 | |||
| 2018 | Ga0466963_0094110 | |||
| 2019 | Ga0466963_0123269 | |||
| 2020 | Ga0466963_0149476 | |||
| 2021 | Ga0466963_0184447 | |||
| 2022 | Ga0466964_0001993 | |||
| 2023 | Ga0466964_0002141 | |||
| 2024 | Ga0466964_0003081 | |||
| 2025 | Ga0466964_0010924 | |||
| 2026 | Ga0466964_0022748 | |||
| 2027 | Ga0466964_0035744 | |||
| 2028 | Ga0466964_0062268 | |||
| 2029 | Ga0466964_0076339 | |||
| 2030 | Ga0466964_0083956 | |||
| 2031 | Ga0466964_0112203 | |||
| 2032 | Ga0466964_0120639 | |||
| 2033 | Ga0466964_0125432 | |||
| 2034 | Ga0466971_0003251 | |||
| 2035 | Ga0466971_0018134 | |||
| 2036 | Ga0466971_0039329 | |||
| 2037 | Ga0466971_0050586 | |||
| 2038 | Ga0466971_0062594 | |||
| 2039 | Ga0466971_0115990 | |||
| 2040 | Ga0466968_0029630 | |||
| 2041 | Ga0466968_0052956 | |||
| 2042 | Ga0466968_0075132 | |||
| 2043 | Ga0466968_0137454 | |||
| 2044 | Ga0466957_0002379 | |||
| 2045 | Ga0466957_0002604 | |||
| 2046 | Ga0466957_0030250 | |||
| 2047 | Ga0466957_0080542 | |||
| 2048 | Ga0466957_0110128 | |||
| 2049 | Ga0466957_0111622 | |||
| 2050 | Ga0466957_0135267 | |||
| 2051 | Ga0466960_0048756 | |||
| 2052 | Ga0466960_0126162 | |||
| 2053 | Ga0466960_0229336 | |||
| 2054 | Ga0466959_0007686 | |||
| 2055 | Ga0466959_0009031 | |||
| 2056 | Ga0466959_0009090 | |||
| 2057 | Ga0466959_0012573 | |||
| 2058 | Ga0466959_0036621 | |||
| 2059 | Ga0466959_0049369 | |||
| 2060 | Ga0466959_0082613 | |||
| 2061 | Ga0451576_0013374 | |||
| 2062 | Ga0451576_0343679 | |||
| 2063 | Ga0466958_0011854 | |||
| 2064 | Ga0466958_0025604 | |||
| 2065 | Ga0466958_0035386 | |||
| 2066 | Ga0466958_0067654 | |||
| 2067 | Ga0466958_0076725 | |||
| 2068 | Ga0466958_0077754 | |||
| 2069 | Ga0466958_0094707 | |||
| 2070 | Ga0466967_0000550 | |||
| 2071 | Ga0466967_0000889 | |||
| 2072 | Ga0466967_0002096 | |||
| 2073 | Ga0466967_0002982 | |||
| 2074 | Ga0466967_0005694 | |||
| 2075 | Ga0466967_0006942 | |||
| 2076 | Ga0466967_0008122 | |||
| 2077 | Ga0466967_0010641 | |||
| 2078 | Ga0466967_0011943 | |||
| 2079 | Ga0466967_0014028 | |||
| 2080 | Ga0466967_0018282 | |||
| 2081 | Ga0466967_0018998 | |||
| 2082 | Ga0466967_0021907 | |||
| 2083 | Ga0466967_0026623 | |||
| 2084 | Ga0466967_0027322 | |||
| 2085 | Ga0466967_0028833 | |||
| 2086 | Ga0466967_0029954 | |||
| 2087 | Ga0466967_0033835 | |||
| 2088 | Ga0466967_0041559 | |||
| 2089 | Ga0466967_0042770 | |||
| 2090 | Ga0466967_0061505 | |||
| 2091 | Ga0466967_0100364 | |||
| 2092 | Ga0466967_0101802 | |||
| 2093 | Ga0466967_0115116 | |||
| 2094 | Ga0466967_0143127 | |||
| 2095 | Ga0466967_0191583 | |||
| 2096 | Ga0466967_0201015 | |||
| 2097 | Ga0466967_0203556 | |||
| 2098 | Ga0466967_0306652 | |||
| 2099 | Ga0466967_0471048 | |||
| 2100 | Ga0495592_0000984 | |||
| 2101 | Ga0495592_0027682 | |||
| 2102 | Ga0495592_0081761 | |||
| 2103 | Ga0495592_0131775 | |||
| 2104 | Ga0495603_0002920 | |||
| 2105 | Ga0495603_0015814 | |||
| 2106 | Ga0495603_0128052 | |||
| 2107 | Ga0495629_0007788 | |||
| 2108 | Ga0495629_0209748 | |||
| 2109 | Ga0495638_0019400 | |||
| 2110 | Ga0495641_0001074 | |||
| 2111 | Ga0495641_0005367 | |||
| 2112 | Ga0495641_0120971 | |||
| 2113 | Ga0495651_0000001 | |||
| 2114 | Ga0495651_0019622 | |||
| 2115 | Ga0495651_0092379 | |||
| 2116 | Ga0495651_0277571 | |||
| 2117 | Ga0495653_0002159 | |||
| 2118 | Ga0495653_0050159 | |||
| 2119 | Ga0495580_0067760 | |||
| 2120 | Ga0495582_0000737 | |||
| 2121 | Ga0495582_0015449 | |||
| 2122 | Ga0495582_0034526 | |||
| 2123 | Ga0495605_0106756 | |||
| 2124 | Ga0495605_0126692 | |||
| 2125 | Ga0495639_0001650 | |||
| 2126 | Ga0495662_0025604 | |||
| 2127 | Ga0495662_0071005 | |||
| 2128 | Ga0495664_0008762 | |||
| 2129 | Ga0495664_0055572 | |||
| 2130 | Ga0495664_0145127 | |||
| 2131 | Ga0495584_0042895 | |||
| 2132 | Ga0495584_0114002 | |||
| 2133 | Ga0495585_0024017 | |||
| 2134 | Ga0495594_0001738 | |||
| 2135 | Ga0495594_0137653 | |||
| 2136 | Ga0495594_0143292 | |||
| 2137 | Ga0495596_0091862 | |||
| 2138 | Ga0495596_0102986 | |||
| 2139 | Ga0495607_0039716 | |||
| 2140 | Ga0495607_0121907 | |||
| 2141 | Ga0495608_0019014 | |||
| 2142 | Ga0495608_0034934 | |||
| 2143 | Ga0495608_0094411 | |||
| 2144 | Ga0495608_0107673 | |||
| 2145 | Ga0495618_0078861 | |||
| 2146 | Ga0495618_0080501 | |||
| 2147 | Ga0495618_0103461 | |||
| 2148 | Ga0495628_0000721 | |||
| 2149 | Ga0495628_0025927 | |||
| 2150 | Ga0495628_0031234 | |||
| 2151 | Ga0495628_0104477 | |||
| 2152 | Ga0495628_0423063 | |||
| 2153 | Ga0495630_0023700 | |||
| 2154 | Ga0495630_0026983 | |||
| 2155 | Ga0495630_0036451 | |||
| 2156 | Ga0495630_0068393 | |||
| 2157 | Ga0495630_0079782 | |||
| 2158 | Ga0495630_0101615 | |||
| 2159 | Ga0495630_0255799 | |||
| 2160 | Ga0495630_0368031 | |||
| 2161 | Ga0495644_0043060 | |||
| 2162 | Ga0495644_0043650 | |||
| 2163 | Ga0495663_0044557 | |||
| 2164 | Ga0495663_0059286 | |||
| 2165 | Ga0495666_0042183 | |||
| 2166 | Ga0495666_0048761 | |||
| 2167 | Ga0495652_0000015 | |||
| 2168 | Ga0495652_0111029 | |||
| 2169 | Ga0495652_0217906 | |||
| 2170 | Ga0495665_0005972 | |||
| 2171 | Ga0495640_0009339 | |||
| 2172 | Ga0495640_0011233 | |||
| 2173 | Ga0495640_0104703 | |||
| 2174 | Ga0495640_0197517 | |||
| 2175 | Ga0495586_0004938 | |||
| 2176 | Ga0495586_0045552 | |||
| 2177 | Ga0495586_0169737 | |||
| 2178 | Ga0495587_0000051 | |||
| 2179 | Ga0495597_0068959 | |||
| 2180 | Ga0495597_0131206 | |||
| 2181 | Ga0495645_0000036 | |||
| 2182 | Ga0495667_0115086 | |||
| 2183 | Ga0495656_0022363 | |||
| 2184 | Ga0495656_0034363 | |||
| 2185 | Ga0495656_0072512 | |||
| 2186 | Ga0495656_0109812 | |||
| 2187 | Ga0495634_0080490 | |||
| 2188 | Ga0495634_0086827 | |||
| 2189 | Ga0495635_0026838 | |||
| 2190 | Ga0495635_0032986 | |||
| 2191 | Ga0495659_0053838 | |||
| 2192 | Ga0495659_0081830 | |||
| 2193 | Ga0495588_0000390 | |||
| 2194 | Ga0495657_0117544 | |||
| 2195 | Ga0495657_0157189 | |||
| 2196 | Ga0495599_0000049 | |||
| 2197 | Ga0495599_0011708 | |||
| 2198 | Ga0495599_0038430 | |||
| 2199 | Ga0495599_0159962 | |||
| 2200 | Ga0495623_0000011 | |||
| 2201 | Ga0495623_0049472 | |||
| 2202 | Ga0495646_0006020 | |||
| 2203 | Ga0495646_0023570 | |||
| 2204 | Ga0495646_0079248 | |||
| 2205 | Ga0495646_0088771 | |||
| 2206 | Ga0495647_0002880 | |||
| 2207 | Ga0495658_0001783 | |||
| 2208 | Ga0495658_0065074 | |||
| 2209 | Ga0495613_0007078 | |||
| 2210 | Ga0495613_0065035 | |||
| 2211 | Ga0495613_0080452 | |||
| 2212 | Ga0495613_0128220 | |||
| 2213 | Ga0495613_0246439 | |||
| 2214 | Ga0495624_0025286 | |||
| 2215 | Ga0495670_0027318 | |||
| 2216 | Ga0495671_0036061 | |||
| 2217 | Ga0495649_0125997 | |||
| 2218 | Ga0495589_0040977 | |||
| 2219 | Ga0495589_0087394 | |||
| 2220 | Ga0495589_0090816 | |||
| 2221 | Ga0495589_0115133 | |||
| 2222 | Ga0495600_0005373 | |||
| 2223 | Ga0495600_0120718 | |||
| 2224 | Ga0495600_0121518 | |||
| 2225 | Ga0495600_0183396 | |||
| 2226 | Ga0495600_0250149 | |||
| 2227 | Ga0495581_0000672 | |||
| 2228 | Ga0495581_0019774 | |||
| 2229 | Ga0495581_0160895 | |||
| 2230 | Ga0495604_0000004 | |||
| 2231 | Ga0495604_0012720 | |||
| 2232 | Ga0495636_0073997 | |||
| 2233 | Ga0495674_0019090 | |||
| 2234 | Ga0495674_0145573 | |||
| 2235 | Ga0495674_0152436 | |||
| 2236 | Ga0495672_0019583 | |||
| 2237 | Ga0495672_0021050 | |||
| 2238 | Ga0495676_0000419 | |||
| 2239 | Ga0495676_0001935 | |||
| 2240 | Ga0495676_0064466 | |||
| 2241 | Ga0495676_0069997 | |||
| 2242 | Ga0495676_0168164 | |||
| 2243 | Ga0495680_0012689 | |||
| 2244 | Ga0495680_0013654 | |||
| 2245 | Ga0495680_0019652 | |||
| 2246 | Ga0495680_0051547 | |||
| 2247 | Ga0495680_0180399 | |||
| 2248 | Ga0495680_0234547 | |||
| 2249 | Ga0495675_0000018 | |||
| 2250 | Ga0495677_0041063 | |||
| 2251 | Ga0495684_0007044 | |||
| 2252 | Ga0495684_0013514 | |||
| 2253 | Ga0495684_0081591 | |||
| 2254 | Ga0495684_0098950 | |||
| 2255 | Ga0495684_0114605 | |||
| 2256 | Ga0495593_0000839 | |||
| 2257 | Ga0495602_0002551 | |||
| 2258 | Ga0495602_0052146 | |||
| 2259 | Ga0495602_0092449 | |||
| 2260 | Ga0495602_0134778 | |||
| 2261 | Ga0495602_0177695 | |||
| 2262 | Ga0495614_0105893 | |||
| 2263 | Ga0496100_0015858 | |||
| 2264 | Ga0496100_0034881 | |||
| 2265 | Ga0496100_0058127 | |||
| 2266 | Ga0496100_0084358 | |||
| 2267 | Ga0496100_0104202 | |||
| 2268 | Ga0496100_0200060 | |||
| 2269 | Ga0496100_0253333 | |||
| 2270 | Ga0496101_0002949 | |||
| 2271 | Ga0496101_0006797 | |||
| 2272 | Ga0496101_0012171 | |||
| 2273 | Ga0496101_0013258 | |||
| 2274 | Ga0496101_0013410 | |||
| 2275 | Ga0496101_0033962 | |||
| 2276 | Ga0496101_0039823 | |||
| 2277 | Ga0496101_0173028 | |||
| 2278 | Ga0496102_0020913 | |||
| 2279 | Ga0496102_0040012 | |||
| 2280 | Ga0496102_0041827 | |||
| 2281 | Ga0496102_0055437 | |||
| 2282 | Ga0496102_0061476 | |||
| 2283 | Ga0496102_0093296 | |||
| 2284 | Ga0496102_0214463 | |||
| 2285 | Ga0496103_0004888 | |||
| 2286 | Ga0496103_0009082 | |||
| 2287 | Ga0496103_0012903 | |||
| 2288 | Ga0496103_0013322 | |||
| 2289 | Ga0496103_0089534 | |||
| 2290 | Ga0496104_0002003 | |||
| 2291 | Ga0496104_0002189 | |||
| 2292 | Ga0496104_0036474 | |||
| 2293 | Ga0496104_0037634 | |||
| 2294 | Ga0496104_0046244 | |||
| 2295 | Ga0496104_0104019 | |||
| 2296 | Ga0496104_0152274 | |||
| 2297 | Ga0496104_0265660 | |||
| 2298 | Ga0496104_0280202 | |||
| 2299 | Ga0496104_0511798 | |||
| 2300 | Ga0496105_0003606 | |||
| 2301 | Ga0496105_0006296 | |||
| 2302 | Ga0496105_0008207 | |||
| 2303 | Ga0496105_0028284 | |||
| 2304 | Ga0496105_0047338 | |||
| 2305 | Ga0496105_0051178 | |||
| 2306 | Ga0496105_0060377 | |||
| 2307 | Ga0496105_0132254 | |||
| 2308 | Ga0496105_0133356 | |||
| 2309 | Ga0496105_0179392 | |||
| 2310 | Ga0496105_0237953 | |||
| 2311 | Ga0496105_0286066 | |||
| 2312 | Ga0496105_0398273 | |||
| 2313 | Ga0496106_0006102 | |||
| 2314 | Ga0496106_0037614 | |||
| 2315 | Ga0496106_0043319 | |||
| 2316 | Ga0496106_0071135 | |||
| 2317 | Ga0496106_0236610 | |||
| 2318 | Ga0496106_0368231 | |||
| 2319 | Ga0496107_0007225 | |||
| 2320 | Ga0496107_0025415 | |||
| 2321 | Ga0496107_0032087 | |||
| 2322 | Ga0496107_0042595 | |||
| 2323 | Ga0496107_0062677 | |||
| 2324 | Ga0496107_0110666 | |||
| 2325 | Ga0496107_0118861 | |||
| 2326 | Ga0496107_0166395 | |||
| 2327 | Ga0496107_0219653 | |||
| 2328 | Ga0496107_0275373 | |||
| 2329 | Ga0496108_0002606 | |||
| 2330 | Ga0496108_0005212 | |||
| 2331 | Ga0496108_0041810 | |||
| 2332 | Ga0496108_0066258 | |||
| 2333 | Ga0496108_0076809 | |||
| 2334 | Ga0496108_0082703 | |||
| 2335 | Ga0496108_0116939 | |||
| 2336 | Ga0496108_0160681 | |||
| 2337 | Ga0496108_0184730 | |||
| 2338 | Ga0496108_0322998 | |||
| 2339 | Ga0496108_0344951 | |||
| 2340 | Ga0496109_0002745 | |||
| 2341 | Ga0496109_0006403 | |||
| 2342 | Ga0496109_0011174 | |||
| 2343 | Ga0496109_0024220 | |||
| 2344 | Ga0496109_0035106 | |||
| 2345 | Ga0496109_0042309 | |||
| 2346 | Ga0496109_0072484 | |||
| 2347 | Ga0496109_0105611 | |||
| 2348 | Ga0496109_0119584 | |||
| 2349 | Ga0496109_0134087 | |||
| 2350 | Ga0496109_0178213 | |||
| 2351 | Ga0496109_0196293 | |||
| 2352 | Ga0496109_0225572 | |||
| 2353 | Ga0496109_0342680 | |||
| 2354 | Ga0496110_0000076 | |||
| 2355 | Ga0496110_0000628 | |||
| 2356 | Ga0496110_0015356 | |||
| 2357 | Ga0496110_0017593 | |||
| 2358 | Ga0496110_0027775 | |||
| 2359 | Ga0496110_0063464 | |||
| 2360 | Ga0496110_0072818 | |||
| 2361 | Ga0496110_0095121 | |||
| 2362 | Ga0496110_0280791 | |||
| 2363 | Ga0496110_0310720 | |||
| 2364 | Ga0496111_0003638 | |||
| 2365 | Ga0496111_0008257 | |||
| 2366 | Ga0496111_0043950 | |||
| 2367 | Ga0496111_0062788 | |||
| 2368 | Ga0496111_0072412 | |||
| 2369 | Ga0496111_0132015 | |||
| 2370 | Ga0496112_0002231 | |||
| 2371 | Ga0496112_0004088 | |||
| 2372 | Ga0496112_0018834 | |||
| 2373 | Ga0496112_0019773 | |||
| 2374 | Ga0496112_0021382 | |||
| 2375 | Ga0496112_0029991 | |||
| 2376 | Ga0496112_0032741 | |||
| 2377 | Ga0496112_0058983 | |||
| 2378 | Ga0496112_0062285 | |||
| 2379 | Ga0496112_0078401 | |||
| 2380 | Ga0496112_0085273 | |||
| 2381 | Ga0496112_0172656 | |||
| 2382 | Ga0496112_0333997 | |||
| 2383 | Ga0496113_0230914 | |||
| 2384 | Ga0496113_0233567 | |||
| 2385 | Ga0496113_0293707 | |||
| 2386 | Ga0496114_0002506 | |||
| 2387 | Ga0496114_0005854 | |||
| 2388 | Ga0496114_0017341 | |||
| 2389 | Ga0496114_0025523 | |||
| 2390 | Ga0496114_0036768 | |||
| 2391 | Ga0496114_0044155 | |||
| 2392 | Ga0496114_0056446 | |||
| 2393 | Ga0496114_0064643 | |||
| 2394 | Ga0496114_0073802 | |||
| 2395 | Ga0496114_0104579 | |||
| 2396 | Ga0496114_0150606 | |||
| 2397 | Ga0496114_0155059 | |||
| 2398 | Ga0496114_0274703 | |||
| 2399 | Ga0496115_0003848 | |||
| 2400 | Ga0496115_0019061 | |||
| 2401 | Ga0496115_0019187 | |||
| 2402 | Ga0496115_0020862 | |||
| 2403 | Ga0496115_0043002 | |||
| 2404 | Ga0496115_0097294 | |||
| 2405 | Ga0496115_0128677 | |||
| 2406 | Ga0496115_0165896 | |||
| 2407 | Ga0496115_0193929 | |||
| 2408 | Ga0496115_0226154 | |||
| 2409 | Ga0496115_0232009 | |||
| 2410 | Ga0501031_0000263 | |||
| 2411 | Ga0501031_0002190 | |||
| 2412 | Ga0501031_0002872 | |||
| 2413 | Ga0501031_0011109 | |||
| 2414 | Ga0501031_0083133 | |||
| 2415 | Ga0501031_0117780 | |||
| 2416 | Ga0501032_0004898 | |||
| 2417 | Ga0501032_0006915 | |||
| 2418 | Ga0501032_0019318 | |||
| 2419 | Ga0501032_0068055 | |||
| 2420 | Ga0501032_0087214 | |||
| 2421 | Ga0501033_0001076 | |||
| 2422 | Ga0501033_0009606 | |||
| 2423 | Ga0501034_0009184 | |||
| 2424 | Ga0501034_0059163 | |||
| 2425 | Ga0501034_0083547 | |||
| 2426 | Ga0501034_0162811 | |||
| 2427 | Ga0501034_0413769 | |||
| 2428 | Ga0501036_0010592 | |||
| 2429 | Ga0501036_0026642 | |||
| 2430 | Ga0501036_0049375 | |||
| 2431 | Ga0501036_0096496 | |||
| 2432 | Ga0501036_0110116 | |||
| 2433 | Ga0501036_0194462 | |||
| 2434 | Ga0501037_0002779 | |||
| 2435 | Ga0501037_0012755 | |||
| 2436 | Ga0501037_0013984 | |||
| 2437 | Ga0501037_0015269 | |||
| 2438 | Ga0501037_0133054 | |||
| 2439 | Ga0501037_0167475 | |||
| 2440 | Ga0501038_0004175 | |||
| 2441 | Ga0501038_0005409 | |||
| 2442 | Ga0501038_0006451 | |||
| 2443 | Ga0501038_0019242 | |||
| 2444 | Ga0501038_0072233 | |||
| 2445 | Ga0501038_0099921 | |||
| 2446 | Ga0501038_0138595 | |||
| 2447 | Ga0501038_0140699 | |||
| 2448 | Ga0501038_0417474 | |||
| 2449 | Ga0501039_0001803 | |||
| 2450 | Ga0501039_0003246 | |||
| 2451 | Ga0501039_0023267 | |||
| 2452 | Ga0501039_0042091 | |||
| 2453 | Ga0501039_0083481 | |||
| 2454 | Ga0501039_0090000 | |||
| 2455 | Ga0501040_0000129 | |||
| 2456 | Ga0501040_0000457 | |||
| 2457 | Ga0501040_0001040 | |||
| 2458 | Ga0501040_0003831 | |||
| 2459 | Ga0501040_0028853 | |||
| 2460 | Ga0501040_0045540 | |||
| 2461 | Ga0501040_0081494 | |||
| 2462 | Ga0501041_0001521 | |||
| 2463 | Ga0501041_0002023 | |||
| 2464 | Ga0501041_0007035 | |||
| 2465 | Ga0501041_0012819 | |||
| 2466 | Ga0501041_0023268 | |||
| 2467 | Ga0501041_0034923 | |||
| 2468 | Ga0501041_0085430 | |||
| 2469 | Ga0501041_0088578 | |||
| 2470 | Ga0501041_0089272 | |||
| 2471 | Ga0501042_0000679 | |||
| 2472 | Ga0501042_0004192 | |||
| 2473 | Ga0501042_0011790 | |||
| 2474 | Ga0501042_0020129 | |||
| 2475 | Ga0501042_0023550 | |||
| 2476 | Ga0501042_0140926 | |||
| 2477 | Ga0501042_0154078 | |||
| 2478 | Ga0501042_0274232 | |||
| 2479 | Ga0501043_0063310 | |||
| 2480 | Ga0501043_0137936 | |||
| 2481 | Ga0501046_0006948 | |||
| 2482 | Ga0501046_0007888 | |||
| 2483 | Ga0501046_0050367 | |||
| 2484 | Ga0501046_0054458 | |||
| 2485 | Ga0501046_0085412 | |||
| 2486 | Ga0501047_0001330 | |||
| 2487 | Ga0501047_0037367 | |||
| 2488 | Ga0501047_0191141 | |||
| 2489 | Ga0501048_0003151 | |||
| 2490 | Ga0501048_0003226 | |||
| 2491 | Ga0501048_0003260 | |||
| 2492 | Ga0501048_0003679 | |||
| 2493 | Ga0501048_0015676 | |||
| 2494 | Ga0501048_0023855 | |||
| 2495 | Ga0501048_0043831 | |||
| 2496 | Ga0501048_0065743 | |||
| 2497 | Ga0501067_0000626 | |||
| 2498 | Ga0501067_0002416 | |||
| 2499 | Ga0501067_0006050 | |||
| 2500 | Ga0501067_0039188 | |||
| 2501 | Ga0501068_0000612 | |||
| 2502 | Ga0501068_0002114 | |||
| 2503 | Ga0501068_0114694 | |||
| 2504 | Ga0501068_0157459 | |||
| 2505 | Ga0501068_0212540 | |||
| 2506 | Ga0501069_0001580 | |||
| 2507 | Ga0501069_0001655 | |||
| 2508 | Ga0501069_0003857 | |||
| 2509 | Ga0501069_0007343 | |||
| 2510 | Ga0501069_0018312 | |||
| 2511 | Ga0501069_0029556 | |||
| 2512 | Ga0501069_0076715 | |||
| 2513 | Ga0501070_0001263 | |||
| 2514 | Ga0501070_0002844 | |||
| 2515 | Ga0501070_0006169 | |||
| 2516 | Ga0501070_0013996 | |||
| 2517 | Ga0501070_0033638 | |||
| 2518 | Ga0501070_0118296 | |||
| 2519 | Ga0501071_0000429 | |||
| 2520 | Ga0501071_0032790 | |||
| 2521 | Ga0501071_0065124 | |||
| 2522 | Ga0501071_0089222 | |||
| 2523 | Ga0501071_0138449 | |||
| 2524 | Ga0501071_0164891 | |||
| 2525 | Ga0501071_0224728 | |||
| 2526 | Ga0501072_0000838 | |||
| 2527 | Ga0501072_0004430 | |||
| 2528 | Ga0501072_0005569 | |||
| 2529 | Ga0501072_0005829 | |||
| 2530 | Ga0501072_0030188 | |||
| 2531 | Ga0501072_0041304 | |||
| 2532 | Ga0501072_0045158 | |||
| 2533 | Ga0501072_0055058 | |||
| 2534 | Ga0501072_0076791 | |||
| 2535 | Ga0501072_0142588 | |||
| 2536 | Ga0501073_0003677 | |||
| 2537 | Ga0501073_0007422 | |||
| 2538 | Ga0501073_0058241 | |||
| 2539 | Ga0501074_0010551 | |||
| 2540 | Ga0501074_0011837 | |||
| 2541 | Ga0501074_0012982 | |||
| 2542 | Ga0501074_0019521 | |||
| 2543 | Ga0501074_0046257 | |||
| 2544 | Ga0501074_0077630 | |||
| 2545 | Ga0501074_0147658 | |||
| 2546 | Ga0501075_0001091 | |||
| 2547 | Ga0501075_0001197 | |||
| 2548 | Ga0501075_0006056 | |||
| 2549 | Ga0501075_0010691 | |||
| 2550 | Ga0501075_0026212 | |||
| 2551 | Ga0501075_0036674 | |||
| 2552 | Ga0501075_0045840 | |||
| 2553 | Ga0501075_0051937 | |||
| 2554 | Ga0501075_0178737 | |||
| 2555 | Ga0501076_0000783 | |||
| 2556 | Ga0501076_0001047 | |||
| 2557 | Ga0501076_0008580 | |||
| 2558 | Ga0501076_0012858 | |||
| 2559 | Ga0501076_0024503 | |||
| 2560 | Ga0501076_0026371 | |||
| 2561 | Ga0501076_0048453 | |||
| 2562 | Ga0501076_0052277 | |||
| 2563 | Ga0501076_0072446 | |||
| 2564 | Ga0501076_0122207 | |||
| 2565 | Ga0501076_0349960 | |||
| 2566 | Ga0501076_0515607 | |||
| 2567 | Ga0501077_0001338 | |||
| 2568 | Ga0501077_0002132 | |||
| 2569 | Ga0501077_0003928 | |||
| 2570 | Ga0501077_0020326 | |||
| 2571 | Ga0501077_0037645 | |||
| 2572 | Ga0501077_0050547 | |||
| 2573 | Ga0501077_0082745 | |||
| 2574 | Ga0501077_0105576 | |||
| 2575 | Ga0501079_0000086 | |||
| 2576 | Ga0501079_0000168 | |||
| 2577 | Ga0501079_0001798 | |||
| 2578 | Ga0501079_0006486 | |||
| 2579 | Ga0501079_0030117 | |||
| 2580 | Ga0501079_0031802 | |||
| 2581 | Ga0501079_0034220 | |||
| 2582 | Ga0501079_0053944 | |||
| 2583 | Ga0501079_0146948 | |||
| 2584 | Ga0501079_0247290 | |||
| 2585 | Ga0501080_0002699 | |||
| 2586 | Ga0501080_0008065 | |||
| 2587 | Ga0501080_0010114 | |||
| 2588 | Ga0501080_0040485 | |||
| 2589 | Ga0501080_0182896 | |||
| 2590 | Ga0501081_0000251 | |||
| 2591 | Ga0501081_0000452 | |||
| 2592 | Ga0501081_0016928 | |||
| 2593 | Ga0501081_0058143 | |||
| 2594 | Ga0501081_0062424 | |||
| 2595 | Ga0501081_0089781 | |||
| 2596 | Ga0501081_0247619 | |||
| 2597 | Ga0501081_0406438 | |||
| 2598 | Ga0501083_0001056 | |||
| 2599 | Ga0501083_0002884 | |||
| 2600 | Ga0501083_0004863 | |||
| 2601 | Ga0501083_0049375 | |||
| 2602 | Ga0501035_0005964 | |||
| 2603 | Ga0501035_0008590 | |||
| 2604 | Ga0501035_0049702 | |||
| 2605 | Ga0501035_0171479 | |||
| 2606 | Ga0501035_0248919 | |||
| 2607 | Ga0501044_0078170 | |||
| 2608 | Ga0501044_0326796 | |||
| 2609 | Ga0501045_0000378 | |||
| 2610 | Ga0501045_0001809 | |||
| 2611 | Ga0501045_0006327 | |||
| 2612 | Ga0501045_0015693 | |||
| 2613 | Ga0501045_0021270 | |||
| 2614 | Ga0501045_0027515 | |||
| 2615 | Ga0501045_0047040 | |||
| 2616 | Ga0501045_0050744 | |||
| 2617 | nmdc:mga05p37_170511_c1 | |||
| 2618 | nmdc:mga05p37_258997_c1 | |||
| 2619 | nmdc:mga05p37_273415_c1 | |||
| 2620 | nmdc:mga05p37_390795_c1 | |||
| 2621 | nmdc:mga05p37_41140_c1 | |||
| 2622 | nmdc:mga05p37_41342_c1 | |||
| 2623 | nmdc:mga05p37_476976_c1 | |||
| 2624 | nmdc:mga09592_16216_c1 | |||
| 2625 | nmdc:mga09592_90212_c1 | |||
| 2626 | nmdc:mga0qj67_135552_c1 | |||
| 2627 | nmdc:mga0qj67_138371_c1 | |||
| 2628 | nmdc:mga0qj67_27093_c1 | |||
| 2629 | nmdc:mga0qj67_31578_c1 | |||
| 2630 | nmdc:mga0qj67_91253_c1 | |||
| 2631 | nmdc:mga06r32_132149_c1 | |||
| 2632 | nmdc:mga06r32_140027_c1 | |||
| 2633 | nmdc:mga06r32_372534_c1 | |||
| 2634 | nmdc:mga08y16_10972_c1 | |||
| 2635 | nmdc:mga08y16_112483_c1 | |||
| 2636 | nmdc:mga08y16_13168_c1 | |||
| 2637 | nmdc:mga08y16_374384_c1 | |||
| 2638 | nmdc:mga08y16_41430_c1 | |||
| 2639 | nmdc:mga08y16_448837_c1 | |||
| 2640 | nmdc:mga08y16_75343_c1 | |||
| 2641 | nmdc:mga0n895_104144_c1 | |||
| 2642 | nmdc:mga0n895_122340_c1 | |||
| 2643 | nmdc:mga0n895_160825_c1 | |||
| 2644 | nmdc:mga0n895_24324_c1 | |||
| 2645 | nmdc:mga0n895_278678_c1 | |||
| 2646 | nmdc:mga0n895_34321_c1 | |||
| 2647 | nmdc:mga0n895_413738_c1 | |||
| 2648 | nmdc:mga0n895_50868_c1 | |||
| 2649 | nmdc:mga0rr50_17553_c1 | |||
| 2650 | nmdc:mga0rr50_18715_c1 | |||
| 2651 | nmdc:mga0rr50_30612_c1 | |||
| 2652 | nmdc:mga0rr50_311830_c1 | |||
| 2653 | nmdc:mga0rr50_32927_c1 | |||
| 2654 | nmdc:mga0rr50_42428_c1 | |||
| 2655 | nmdc:mga0rr50_64163_c1 | |||
| 2656 | nmdc:mga08x19_126917_c1 | |||
| 2657 | nmdc:mga08x19_74709_c1 | |||
| 2658 | nmdc:mga08x19_74799_c1 | |||
| 2659 | nmdc:mga0a205_13455_c1 | |||
| 2660 | nmdc:mga0a205_161914_c1 | |||
| 2661 | Ga0495601_0000076 | |||
| 2662 | Ga0495601_0011378 | |||
| 2663 | Ga0495601_0032607 | |||
| 2664 | Ga0495601_0043001 | |||
| 2665 | Ga0495601_0054657 | |||
| 2666 | Ga0495601_0092167 | |||
| 2667 | Ga0495601_0115795 | |||
| 2668 | Ga0495612_0005415 | |||
| 2669 | Ga0495612_0065820 | |||
| 2670 | Ga0495655_0003537 | |||
| 2671 | Ga0495595_0002925 | |||
| 2672 | Ga0495595_0022775 | |||
| 2673 | Ga0495595_0048412 | |||
| 2674 | Ga0495595_0075246 | |||
| 2675 | Ga0495619_0001491 | |||
| 2676 | Ga0495619_0007215 | |||
| 2677 | Ga0495619_0017016 | |||
| 2678 | Ga0495619_0389489 | |||
| 2679 | Ga0500616_0012449 | |||
| 2680 | Ga0501084_0000325 | |||
| 2681 | Ga0501084_0001414 | |||
| 2682 | Ga0501084_0001555 | |||
| 2683 | Ga0501084_0002654 | |||
| 2684 | Ga0501084_0043602 | |||
| 2685 | Ga0501084_0045883 | |||
| 2686 | Ga0501084_0282565 | |||
| 2687 | Ga0501084_0287923 | |||
| 2688 | Ga0590071_008255 | |||
| 2689 | Ga0590075_016205 | |||
| 2690 | Ga0501082_0001639 | |||
| 2691 | Ga0501082_0004230 | |||
| 2692 | Ga0501082_0011930 | |||
| 2693 | Ga0501082_0022222 | |||
| 2694 | Ga0501082_0027578 | |||
| 2695 | Ga0501082_0068730 | |||
| 2696 | Ga0501082_0072202 | |||
| 2697 | Ga0501082_0120753 | |||
| 2698 | Ga0501082_0276516 | |||
| 2699 | Ga0501082_0389171 | |||
| 2700 | Ga0466962_0001952 | |||
| 2701 | Ga0466962_0036345 | |||
| 2702 | Ga0466962_0048503 | |||
| 2703 | Ga0466962_0095885 | |||
| 2704 | Ga0530510_0000291 | |||
| 2705 | Ga0530510_0001901 | |||
| 2706 | Ga0530510_0008782 | |||
| 2707 | Ga0530510_0012213 | |||
| 2708 | Ga0530510_0015756 | |||
| 2709 | Ga0530510_0071840 | |||
| 2710 | Ga0530510_0216531 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 6cer-assembly1.cif.gz_D | human pyruvate dehydrogenase complex e1 component v138m mutation | 0.9646 | 2 | 325 |
| 1umd-assembly1.cif.gz_D | branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate | 0.9608 | 2 | 325 |
| 1w88-assembly2.cif.gz_F | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.9607 | 2 | 325 |
| 1w88-assembly2.cif.gz_H | the crystal structure of pyruvate dehydrogenase e1(d180n,e183q) bound to the peripheral subunit binding domain of e2 | 0.956 | 2 | 325 |
| 1umd-assembly1.cif.gz_D | branched-chain 2-oxo acid dehydrogenase (e1) from thermus thermophilus hb8 with 4-methyl-2-oxopentanoate as an intermediate | 0.9551 | 2 | 325 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 1w85B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9712 | 194 | 325 | 3.40.50.920 |
| af_B4FUC1_232_362_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9674 | 194 | 324 | 3.40.50.920 |
| 1qs0B02 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9624 | 191 | 323 | 3.40.50.920 |
| af_E5RPJ6_273_405_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9584 | 195 | 324 | 3.40.50.920 |
| af_Q09171_230_364_3.40.50.920 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold; | 0.9558 | 193 | 324 | 3.40.50.920 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2A5BMN0-F1-model_v4 | Pyruvate dehydrogenase E1 component subunit beta (EC 1.2.4.1) | 0.9921 | 1 | 92 |
GO:0004739
GO:0006086 |
| AF-A0A453JKX3-F1-model_v4 | pyruvate dehydrogenase (acetyl-transferring) (EC 1.2.4.1) | 0.9886 | 7 | 97 |
GO:0004739
|
| AF-A0A535KKS3-F1-model_v4 | Alpha-ketoacid dehydrogenase subunit beta | 0.9856 | 1 | 93 |
|
| AF-A0A833D4J7-F1-model_v4 | Transketolase-like pyrimidine-binding domain-containing protein | 0.9823 | 1 | 104 |
|
| AF-A0A6J6SDP6-F1-model_v4 | Unannotated protein | 0.9811 | 173 | 326 |
GO:0003824
|