F493210

General Info

Members Datasets Scaffolds Average Seq Length
1347 343 2694 221

Family's Representative Sequence

Representative Sequence 3300048907|Ga0496104_0178602|Ga0496104_0178602_1187_1957
Length 256
Sequence MYPAKEWAWAEVHDTFRSRAPFFAYNAQHHATVLEGVLMKAGASKRTIRIAVVESDPLRFIGLKSLFDTETDLELVSCSLAELGPRKDIDLVLLGTRAGQNLFDVMAGLKAARPDLRIIVTGSGADDETILKALAAGAKGYVDEAASPAEFIQAMRIVHAGSVWAPRRVLSIFIERVTSSPGRIFPAGRVTFTDREKEVLELLVVGRSNKEIGSVLGIEERTVKAHVAKLMRKVGVQNRIALSVHAITHSLVTSSK

Samples

Sample ID Description Type Environment
1 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
2 2162886011 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) Metagenome Rhizosphere
3 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
4 3300000546 Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled Metagenome Rhizosphere
5 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
6 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
7 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
8 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
9 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
10 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
12 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
14 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
15 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
16 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
17 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
18 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
19 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
20 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
21 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
22 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
23 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
24 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
25 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
26 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
27 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
28 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
29 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
30 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
31 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
32 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
33 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
34 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
35 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
36 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
37 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
38 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
39 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
40 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
41 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
42 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
43 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
44 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
45 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
46 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
47 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
48 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
49 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
50 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
51 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
52 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
53 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
54 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
55 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
56 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
57 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
58 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
59 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
60 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
61 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
62 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
63 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
64 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
65 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
66 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
67 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
68 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
69 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
70 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
71 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
72 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
73 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
74 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
75 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
76 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
77 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
78 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
79 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
80 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
81 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
82 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
83 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
84 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
85 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
86 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
87 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
88 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
89 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
90 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
91 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
92 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
93 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
94 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
95 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
96 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
97 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
98 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
99 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
100 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
101 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
102 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
103 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
104 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
105 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
106 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
107 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
108 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
109 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
110 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
111 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
112 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
113 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
114 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
115 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
116 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
117 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
118 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
119 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
120 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
121 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
122 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
123 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
124 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
125 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
126 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
127 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
128 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
129 3300020076 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) Metatranscriptome Rhizosphere
130 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
131 3300022467 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
132 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
133 3300022732 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 Metagenome Rhizosphere
134 3300022734 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 Metagenome Rhizosphere
135 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
136 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
137 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
138 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
139 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
140 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
141 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
143 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
203 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
204 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
205 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
206 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
208 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
209 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
210 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
211 3300030878 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
212 3300031018 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
213 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
214 3300031238 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG Metagenome Rhizosphere
215 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
216 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
217 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
218 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
219 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
220 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
221 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
222 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
223 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
224 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
225 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
226 3300033545 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 Metagenome Unclassified
227 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
228 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
229 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
230 3300035084 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 Metagenome Rhizosphere
231 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
232 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
233 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
234 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
235 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
236 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
237 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
238 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
239 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
240 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
241 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
242 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
243 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
244 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
245 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
246 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
247 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
248 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
249 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
250 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
251 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
252 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
253 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
254 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
255 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
256 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
257 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
258 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
259 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
260 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
261 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
262 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
263 3300044683 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R Metagenome Rhizosphere
264 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
265 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
266 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
267 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
268 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
269 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
270 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
271 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
272 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
273 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
274 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
275 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
276 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
277 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
278 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
279 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
280 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
281 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
282 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
283 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
284 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
285 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
286 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
287 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
288 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
289 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
290 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
291 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
292 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
293 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
294 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
295 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
296 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
297 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
298 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
299 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
300 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
301 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
302 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
303 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
304 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
305 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
306 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
307 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
308 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
309 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
310 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
311 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
312 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
313 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
314 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
315 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
316 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
317 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
318 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
319 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
320 3300049521 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought Metagenome Rhizosphere
321 3300049522 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control Metagenome Rhizosphere
322 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
323 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
324 3300049660 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control Metagenome Rhizosphere
325 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
326 3300049686 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control Metagenome Rhizosphere
327 3300049705 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought Metagenome Rhizosphere
328 3300049769 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought Metagenome Rhizosphere
329 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
330 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
331 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
332 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
333 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
334 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
335 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
336 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
337 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
338 3300059492 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
339 3300059493 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
340 3300059640 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
341 3300059647 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
342 3300060344 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
343 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.37
Metatranscriptomes 1.63
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0
Nodule 0
Rhizoplane 6.98
Rhizosphere 92.2
Stem 0
Stem Tuber 0
Unclassified 26.87

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0496104_0178602 3300048907 Bacteria 2033
2 MRS1b_contig_8406324 2162886011 Bacteria 1159
3 MBSR1b_contig_8347319 2162886012 Bacteria 1603
4 MBSR1b_contig_9753513 2162886012 Unclassified 853
5 LJNas_1000269 3300000546 Bacteria 8948
6 JGI24752J21851_1001182 3300001976 Bacteria 3541
7 JGI24034J26672_10000325 3300002239 Bacteria 6132
8 JGI24751J29686_10001201 3300002459 Bacteria 5493
9 Ga0058863_11372885 3300004799 Bacteria 925
10 Ga0058861_10063214 3300004800 Unclassified 1436
11 Ga0058861_11314449 3300004800 Bacteria 880
12 Ga0058862_12094930 3300004803 Bacteria 840
13 Ga0058862_12654815 3300004803 Unclassified 1032
14 Ga0065712_10003687 3300005290 Bacteria 4193
15 Ga0065712_10110694 3300005290 Bacteria 1831
16 Ga0065712_10136907 3300005290 Bacteria 1488
17 Ga0065715_10124725 3300005293 Bacteria 2134
18 Ga0065715_10175677 3300005293 Bacteria 1513
19 Ga0065707_10233012 3300005295 Unclassified 1182
20 Ga0070658_10054106 3300005327 Bacteria 3259
21 Ga0070658_10402397 3300005327 Bacteria 1176
22 Ga0070676_10013388 3300005328 Bacteria 4494
23 Ga0070676_10013895 3300005328 Bacteria 4417
24 Ga0070683_100015072 3300005329 Bacteria 6782
25 Ga0070683_100018817 3300005329 Bacteria 6125
26 Ga0070683_100020038 3300005329 Bacteria 5947
27 Ga0070683_100133144 3300005329 Bacteria 2353
28 Ga0070683_100224105 3300005329 Bacteria 1787
29 Ga0070683_100561238 3300005329 Unclassified 1092
30 Ga0070683_100607026 3300005329 Unclassified 1047
31 Ga0070690_100006967 3300005330 Bacteria 6438
32 Ga0070690_100010719 3300005330 Bacteria 5344
33 Ga0070670_100017644 3300005331 Bacteria 6125
34 Ga0070670_100052679 3300005331 Unclassified 3494
35 Ga0068869_100000365 3300005334 Bacteria 24415
36 Ga0068869_100004818 3300005334 Bacteria 8429
37 Ga0068869_100021779 3300005334 Bacteria 4411
38 Ga0068869_100025160 3300005334 Unclassified 4130
39 Ga0070666_10002671 3300005335 Bacteria 10753
40 Ga0070680_100009284 3300005336 Bacteria 7549
41 Ga0070680_100079684 3300005336 Bacteria 2700
42 Ga0070680_100095633 3300005336 Unclassified 2463
43 Ga0070680_100137886 3300005336 Bacteria 2045
44 Ga0070680_100157759 3300005336 Unclassified 1906
45 Ga0070680_100290587 3300005336 Bacteria 1385
46 Ga0070680_100357712 3300005336 Bacteria 1242
47 Ga0070682_100006008 3300005337 Bacteria 6795
48 Ga0070682_100094191 3300005337 Bacteria 1964
49 Ga0068868_100003230 3300005338 Bacteria 11338
50 Ga0068868_100016148 3300005338 Bacteria 5538
51 Ga0068868_100041316 3300005338 Bacteria 3592
52 Ga0068868_100079865 3300005338 Bacteria 2621
53 Ga0068868_100091928 3300005338 Bacteria 2445
54 Ga0068868_100112431 3300005338 Unclassified 2214
55 Ga0068868_100119023 3300005338 Bacteria 2153
56 Ga0068868_100467557 3300005338 Bacteria 1100
57 Ga0068868_100502168 3300005338 Unclassified 1062
58 Ga0068868_100974054 3300005338 Unclassified 774
59 Ga0070660_100022195 3300005339 Bacteria 4691
60 Ga0070660_100108602 3300005339 Bacteria 2205
61 Ga0070660_100206925 3300005339 Bacteria 1592
62 Ga0070660_100381384 3300005339 Bacteria 1164
63 Ga0070689_100050786 3300005340 Bacteria 3204
64 Ga0070689_100216712 3300005340 Bacteria 1569
65 Ga0070687_100060743 3300005343 Unclassified 1995
66 Ga0070687_100066136 3300005343 Unclassified 1925
67 Ga0070687_100383764 3300005343 Unclassified 916
68 Ga0070661_100003055 3300005344 Bacteria 11515
69 Ga0070661_100009617 3300005344 Bacteria 6699
70 Ga0070661_100014979 3300005344 Bacteria 5470
71 Ga0070661_100041762 3300005344 Unclassified 3346
72 Ga0070661_100174851 3300005344 Bacteria 1632
73 Ga0070692_10060948 3300005345 Bacteria 1988
74 Ga0070668_100044360 3300005347 Bacteria 3412
75 Ga0070668_100066847 3300005347 Bacteria 2791
76 Ga0070668_100677355 3300005347 Unclassified 908
77 Ga0070669_100023832 3300005353 Bacteria 4385
78 Ga0070669_100503023 3300005353 Bacteria 1005
79 Ga0070675_100140797 3300005354 Bacteria 2062
80 Ga0070675_100197438 3300005354 Bacteria 1745
81 Ga0070675_100514747 3300005354 Unclassified 1079
82 Ga0070671_100031332 3300005355 Unclassified 4392
83 Ga0070671_100062531 3300005355 Bacteria 3100
84 Ga0070671_100091869 3300005355 Unclassified 2543
85 Ga0070671_100386785 3300005355 Bacteria 1196
86 Ga0070674_100575452 3300005356 Unclassified 948
87 Ga0070673_100001773 3300005364 Bacteria 12856
88 Ga0070673_100025530 3300005364 Bacteria 4351
89 Ga0070673_100735921 3300005364 Unclassified 907
90 Ga0070688_100002766 3300005365 Bacteria 8912
91 Ga0070688_100591941 3300005365 Unclassified 848
92 Ga0070659_100009058 3300005366 Bacteria 7304
93 Ga0070659_100020284 3300005366 Bacteria 5047
94 Ga0070659_100181349 3300005366 Bacteria 1728
95 Ga0070667_100045480 3300005367 Bacteria 3691
96 Ga0070667_100115683 3300005367 Unclassified 2329
97 Ga0070667_100688413 3300005367 Unclassified 945
98 Ga0070709_10013312 3300005434 Bacteria 4621
99 Ga0070709_10019620 3300005434 Bacteria 3911
100 Ga0070709_10024439 3300005434 Unclassified 3556
101 Ga0070709_10027155 3300005434 Unclassified 3402
102 Ga0070709_10039113 3300005434 Bacteria 2909
103 Ga0070709_10042655 3300005434 Bacteria 2803
104 Ga0070709_10068926 3300005434 Bacteria 2276
105 Ga0070709_10104420 3300005434 Bacteria 1893
106 Ga0070709_10265257 3300005434 Bacteria 1242
107 Ga0070709_10303588 3300005434 Bacteria 1166
108 Ga0070714_100007036 3300005435 Bacteria 8719
109 Ga0070714_100008700 3300005435 Bacteria 7937
110 Ga0070714_100025376 3300005435 Unclassified 4891
111 Ga0070714_100044925 3300005435 Bacteria 3741
112 Ga0070714_100086557 3300005435 Bacteria 2738
113 Ga0070714_100107597 3300005435 Bacteria 2465
114 Ga0070714_100139303 3300005435 Bacteria 2176
115 Ga0070714_100285524 3300005435 Unclassified 1534
116 Ga0070714_100439135 3300005435 Bacteria 1238
117 Ga0070714_100636494 3300005435 Unclassified 1026
118 Ga0070713_100000073 3300005436 Bacteria 63264
119 Ga0070713_100000940 3300005436 Bacteria 18610
120 Ga0070713_100005524 3300005436 Bacteria 8657
121 Ga0070713_100013005 3300005436 Bacteria 6128
122 Ga0070713_100018529 3300005436 Bacteria 5290
123 Ga0070713_100049171 3300005436 Bacteria 3477
124 Ga0070713_100055645 3300005436 Bacteria 3288
125 Ga0070713_100057729 3300005436 Bacteria 3233
126 Ga0070713_100061416 3300005436 Bacteria 3144
127 Ga0070713_100070094 3300005436 Bacteria 2958
128 Ga0070713_100093717 3300005436 Bacteria 2588
129 Ga0070713_100143054 3300005436 Bacteria 2120
130 Ga0070713_100182969 3300005436 Bacteria 1884
131 Ga0070713_100185830 3300005436 Bacteria 1870
132 Ga0070713_100429813 3300005436 Unclassified 1237
133 Ga0070713_100584912 3300005436 Unclassified 1059
134 Ga0070713_100662733 3300005436 Unclassified 994
135 Ga0070713_100731779 3300005436 Bacteria 946
136 Ga0070713_100836640 3300005436 Unclassified 883
137 Ga0070710_10009992 3300005437 Bacteria 4653
138 Ga0070710_10014746 3300005437 Bacteria 3938
139 Ga0070710_10024508 3300005437 Bacteria 3184
140 Ga0070710_10041647 3300005437 Unclassified 2537
141 Ga0070710_10125030 3300005437 Bacteria 1562
142 Ga0070710_10128501 3300005437 Bacteria 1542
143 Ga0070710_10131999 3300005437 Unclassified 1524
144 Ga0070710_10140541 3300005437 Bacteria 1480
145 Ga0070710_10162049 3300005437 Unclassified 1388
146 Ga0070701_10363946 3300005438 Unclassified 907
147 Ga0070701_10528403 3300005438 Unclassified 770
148 Ga0070711_100000360 3300005439 Bacteria 23472
149 Ga0070711_100001169 3300005439 Bacteria 14108
150 Ga0070711_100001873 3300005439 Bacteria 11750
151 Ga0070711_100012010 3300005439 Bacteria 5396
152 Ga0070711_100066853 3300005439 Bacteria 2520
153 Ga0070711_100080156 3300005439 Unclassified 2324
154 Ga0070711_100149158 3300005439 Bacteria 1761
155 Ga0070711_100184980 3300005439 Bacteria 1597
156 Ga0070694_100476679 3300005444 Unclassified 989
157 Ga0070708_100000470 3300005445 Bacteria 30377
158 Ga0070708_100001120 3300005445 Bacteria 20506
159 Ga0070708_100002203 3300005445 Bacteria 15053
160 Ga0070708_100003678 3300005445 Bacteria 12036
161 Ga0070708_100008454 3300005445 Bacteria 8264
162 Ga0070708_100008675 3300005445 Bacteria 8168
163 Ga0070708_100010894 3300005445 Bacteria 7387
164 Ga0070708_100016315 3300005445 Bacteria 6160
165 Ga0070708_100022619 3300005445 Bacteria 5334
166 Ga0070708_100032064 3300005445 Bacteria 4554
167 Ga0070708_100076096 3300005445 Bacteria 3030
168 Ga0070708_100502630 3300005445 Unclassified 1144
169 Ga0070708_100631343 3300005445 Bacteria 1010
170 Ga0070663_100001680 3300005455 Bacteria 12273
171 Ga0070663_100077313 3300005455 Bacteria 2436
172 Ga0070678_100082081 3300005456 Bacteria 2446
173 Ga0070678_100743413 3300005456 Unclassified 887
174 Ga0070662_100007994 3300005457 Bacteria 6881
175 Ga0070662_100098792 3300005457 Unclassified 2205
176 Ga0070681_10001396 3300005458 Bacteria 21186
177 Ga0070681_10013650 3300005458 Bacteria 8085
178 Ga0070681_10036782 3300005458 Unclassified 4915
179 Ga0070681_10045099 3300005458 Bacteria 4412
180 Ga0070681_10045120 3300005458 Bacteria 4411
181 Ga0070681_10046045 3300005458 Unclassified 4362
182 Ga0070681_10064230 3300005458 Bacteria 3642
183 Ga0070681_10081283 3300005458 Bacteria 3196
184 Ga0070681_10267962 3300005458 Bacteria 1619
185 Ga0070681_10277058 3300005458 Unclassified 1588
186 Ga0070681_10392102 3300005458 Bacteria 1299
187 Ga0070681_10438884 3300005458 Bacteria 1217
188 Ga0068867_100048374 3300005459 Bacteria 3128
189 Ga0068867_100067550 3300005459 Unclassified 2666
190 Ga0068867_100270608 3300005459 Bacteria 1389
191 Ga0068867_100332474 3300005459 Bacteria 1262
192 Ga0068867_100768046 3300005459 Unclassified 857
193 Ga0070685_10009024 3300005466 Bacteria 5144
194 Ga0070685_10031814 3300005466 Bacteria 2950
195 Ga0070706_100001230 3300005467 Bacteria 27375
196 Ga0070706_100002235 3300005467 Bacteria 19682
197 Ga0070706_100013159 3300005467 Bacteria 7655
198 Ga0070706_100031003 3300005467 Unclassified 4930
199 Ga0070706_100055058 3300005467 Unclassified 3671
200 Ga0070706_100076896 3300005467 Unclassified 3089
201 Ga0070706_100119389 3300005467 Unclassified 2457
202 Ga0070706_100245804 3300005467 Bacteria 1671
203 Ga0070707_100001129 3300005468 Bacteria 26320
204 Ga0070707_100006316 3300005468 Bacteria 11021
205 Ga0070707_100010562 3300005468 Bacteria 8600
206 Ga0070707_100038485 3300005468 Unclassified 4568
207 Ga0070707_100098690 3300005468 Unclassified 2829
208 Ga0070707_100164833 3300005468 Unclassified 2160
209 Ga0070707_100572485 3300005468 Bacteria 1092
210 Ga0070698_100001238 3300005471 Bacteria 28442
211 Ga0070698_100021223 3300005471 Bacteria 6805
212 Ga0070698_100102352 3300005471 Bacteria 2835
213 Ga0070698_100897305 3300005471 Bacteria 832
214 Ga0070699_100001045 3300005518 Bacteria 25776
215 Ga0070699_100001170 3300005518 Bacteria 24337
216 Ga0070699_100013583 3300005518 Bacteria 7010
217 Ga0070699_100036584 3300005518 Unclassified 4247
218 Ga0070699_100307141 3300005518 Bacteria 1424
219 Ga0070699_100375577 3300005518 Unclassified 1283
220 Ga0070679_100018579 3300005530 Bacteria 6748
221 Ga0070679_100028624 3300005530 Bacteria 5494
222 Ga0070679_100041563 3300005530 Bacteria 4575
223 Ga0070679_100136812 3300005530 Unclassified 2431
224 Ga0070679_100147055 3300005530 Bacteria 2334
225 Ga0070679_100168909 3300005530 Bacteria 2160
226 Ga0070679_100178045 3300005530 Unclassified 2099
227 Ga0070679_100230747 3300005530 Unclassified 1810
228 Ga0070679_100281263 3300005530 Unclassified 1616
229 Ga0070684_100006676 3300005535 Bacteria 8945
230 Ga0070684_100067165 3300005535 Bacteria 3149
231 Ga0070684_100106741 3300005535 Bacteria 2507
232 Ga0070684_100119146 3300005535 Bacteria 2373
233 Ga0070684_100121214 3300005535 Bacteria 2353
234 Ga0070697_100000092 3300005536 Bacteria 75107
235 Ga0070697_100000390 3300005536 Bacteria 34089
236 Ga0070697_100000630 3300005536 Bacteria 26714
237 Ga0070697_100007135 3300005536 Bacteria 8692
238 Ga0070697_100007394 3300005536 Bacteria 8552
239 Ga0070697_100010927 3300005536 Bacteria 7091
240 Ga0070697_100014170 3300005536 Bacteria 6262
241 Ga0070697_100080714 3300005536 Bacteria 2680
242 Ga0070697_100083676 3300005536 Bacteria 2631
243 Ga0070697_100181013 3300005536 Bacteria 1786
244 Ga0068853_100008057 3300005539 Bacteria 8450
245 Ga0068853_100014016 3300005539 Bacteria 6560
246 Ga0068853_100029102 3300005539 Bacteria 4653
247 Ga0068853_100114017 3300005539 Unclassified 2404
248 Ga0068853_100126603 3300005539 Bacteria 2282
249 Ga0068853_100380501 3300005539 Unclassified 1318
250 Ga0070672_100006933 3300005543 Bacteria 7659
251 Ga0070686_100004713 3300005544 Bacteria 7519
252 Ga0070686_100064105 3300005544 Bacteria 2383
253 Ga0070695_100026588 3300005545 Bacteria 3582
254 Ga0070695_100161742 3300005545 Bacteria 1572
255 Ga0070695_100285990 3300005545 Bacteria 1213
256 Ga0070696_100034110 3300005546 Bacteria 3500
257 Ga0070696_100215466 3300005546 Bacteria 1439
258 Ga0070693_100015053 3300005547 Bacteria 3978
259 Ga0070693_100028622 3300005547 Bacteria 3031
260 Ga0070693_100051056 3300005547 Unclassified 2366
261 Ga0070693_100187278 3300005547 Bacteria 1336
262 Ga0070693_100282128 3300005547 Unclassified 1113
263 Ga0070693_100488828 3300005547 Bacteria 871
264 Ga0070665_100100285 3300005548 Bacteria 2900
265 Ga0070665_100255993 3300005548 Bacteria 1751
266 Ga0068855_100001369 3300005563 Bacteria 30177
267 Ga0068855_100006853 3300005563 Bacteria 13822
268 Ga0068855_100011661 3300005563 Bacteria 10623
269 Ga0068855_100058682 3300005563 Bacteria 4505
270 Ga0068855_100077403 3300005563 Bacteria 3859
271 Ga0068855_100088073 3300005563 Bacteria 3586
272 Ga0068855_100162121 3300005563 Bacteria 2537
273 Ga0068855_100344840 3300005563 Unclassified 1641
274 Ga0068855_100560888 3300005563 Unclassified 1235
275 Ga0068855_100575122 3300005563 Bacteria 1217
276 Ga0068855_100575951 3300005563 Bacteria 1216
277 Ga0070664_100000897 3300005564 Bacteria 23165
278 Ga0070664_100002745 3300005564 Bacteria 14212
279 Ga0070664_100116325 3300005564 Bacteria 2338
280 Ga0070664_100582324 3300005564 Unclassified 1037
281 Ga0068857_100003643 3300005577 Bacteria 12913
282 Ga0068857_100036791 3300005577 Bacteria 4337
283 Ga0068857_100042798 3300005577 Bacteria 4018
284 Ga0068857_100043637 3300005577 Unclassified 3977
285 Ga0068857_100055135 3300005577 Unclassified 3528
286 Ga0068857_100704569 3300005577 Bacteria 959
287 Ga0068857_100753642 3300005577 Unclassified 928
288 Ga0068854_100001461 3300005578 Bacteria 14306
289 Ga0068854_100008594 3300005578 Bacteria 6573
290 Ga0068854_100052238 3300005578 Bacteria 2930
291 Ga0068854_100081104 3300005578 Unclassified 2395
292 Ga0068854_100178857 3300005578 Unclassified 1656
293 Ga0068854_100671478 3300005578 Unclassified 892
294 Ga0068856_100000995 3300005614 Bacteria 30196
295 Ga0068856_100007891 3300005614 Bacteria 10395
296 Ga0068856_100009877 3300005614 Bacteria 9266
297 Ga0068856_100035248 3300005614 Bacteria 4903
298 Ga0068856_100053539 3300005614 Bacteria 3979
299 Ga0068856_100057899 3300005614 Unclassified 3826
300 Ga0068856_100082778 3300005614 Bacteria 3185
301 Ga0068856_100168296 3300005614 Bacteria 2203
302 Ga0068856_100175193 3300005614 Bacteria 2157
303 Ga0068856_100295483 3300005614 Bacteria 1637
304 Ga0068856_100301052 3300005614 Unclassified 1621
305 Ga0070702_100061318 3300005615 Bacteria 2190
306 Ga0070702_100418593 3300005615 Unclassified 963
307 Ga0068852_100004238 3300005616 Bacteria 10126
308 Ga0068852_100018595 3300005616 Bacteria 5476
309 Ga0068852_100047161 3300005616 Bacteria 3674
310 Ga0068852_100166064 3300005616 Bacteria 2065
311 Ga0068852_100307286 3300005616 Bacteria 1537
312 Ga0068852_100561500 3300005616 Bacteria 1143
313 Ga0068852_100687056 3300005616 Unclassified 1033
314 Ga0068852_101052688 3300005616 Bacteria 833
315 Ga0068852_101353859 3300005616 Unclassified 734
316 Ga0068859_100020260 3300005617 Bacteria 6676
317 Ga0068859_100076021 3300005617 Bacteria 3399
318 Ga0068859_100091071 3300005617 Unclassified 3100
319 Ga0068864_100003006 3300005618 Bacteria 13936
320 Ga0068864_100021497 3300005618 Bacteria 5405
321 Ga0068864_100030698 3300005618 Bacteria 4556
322 Ga0068864_100062311 3300005618 Unclassified 3231
323 Ga0068864_100259322 3300005618 Bacteria 1616
324 Ga0068866_10005181 3300005718 Bacteria 5370
325 Ga0068866_10018825 3300005718 Bacteria 3131
326 Ga0068866_10193835 3300005718 Bacteria 1209
327 Ga0068866_10208038 3300005718 Unclassified 1173
328 Ga0068861_100012876 3300005719 Bacteria 5840
329 Ga0068861_100080151 3300005719 Bacteria 2554
330 Ga0068861_100087408 3300005719 Bacteria 2453
331 Ga0068851_10008910 3300005834 Bacteria 4653
332 Ga0068851_10013151 3300005834 Bacteria 3915
333 Ga0068851_10029239 3300005834 Unclassified 2727
334 Ga0068851_10282003 3300005834 Unclassified 950
335 Ga0068870_10002902 3300005840 Bacteria 7224
336 Ga0068870_10085367 3300005840 Bacteria 1754
337 Ga0068863_100001977 3300005841 Bacteria 20384
338 Ga0068863_100071658 3300005841 Bacteria 3278
339 Ga0068863_100079746 3300005841 Bacteria 3100
340 Ga0068863_100110800 3300005841 Bacteria 2614
341 Ga0068863_100125098 3300005841 Unclassified 2452
342 Ga0068863_100275007 3300005841 Bacteria 1631
343 Ga0068858_100000404 3300005842 Bacteria 44997
344 Ga0068858_100001080 3300005842 Bacteria 28247
345 Ga0068858_100038173 3300005842 Unclassified 4454
346 Ga0068858_100062953 3300005842 Bacteria 3431
347 Ga0068858_100062973 3300005842 Bacteria 3431
348 Ga0068858_100081667 3300005842 Bacteria 3004
349 Ga0068858_100627525 3300005842 Bacteria 1043
350 Ga0068860_100010559 3300005843 Bacteria 9124
351 Ga0068860_100061035 3300005843 Unclassified 3582
352 Ga0068860_100061841 3300005843 Unclassified 3558
353 Ga0068860_100071618 3300005843 Unclassified 3293
354 Ga0068860_100184530 3300005843 Bacteria 2017
355 Ga0068860_100315994 3300005843 Bacteria 1532
356 Ga0068862_100005387 3300005844 Bacteria 10703
357 Ga0068862_100018991 3300005844 Bacteria 5731
358 Ga0068862_100150532 3300005844 Bacteria 2071
359 Ga0068862_100162770 3300005844 Unclassified 1993
360 Ga0081540_1074881 3300005983 Unclassified 1549
361 Ga0070717_10001111 3300006028 Bacteria 18150
362 Ga0070717_10004965 3300006028 Bacteria 9676
363 Ga0070717_10005101 3300006028 Bacteria 9577
364 Ga0070717_10006905 3300006028 Bacteria 8382
365 Ga0070717_10008773 3300006028 Bacteria 7569
366 Ga0070717_10025076 3300006028 Bacteria 4737
367 Ga0070717_10027759 3300006028 Bacteria 4526
368 Ga0070717_10049947 3300006028 Bacteria 3435
369 Ga0070717_10084239 3300006028 Unclassified 2674
370 Ga0070717_10092273 3300006028 Bacteria 2558
371 Ga0070717_10122352 3300006028 Unclassified 2230
372 Ga0070717_10159457 3300006028 Unclassified 1956
373 Ga0070717_10187485 3300006028 Bacteria 1806
374 Ga0070717_10190248 3300006028 Bacteria 1793
375 Ga0070717_10483566 3300006028 Unclassified 1118
376 Ga0070717_10652242 3300006028 Bacteria 955
377 Ga0070717_10958687 3300006028 Unclassified 779
378 Ga0070715_10036619 3300006163 Bacteria 2025
379 Ga0070715_10061081 3300006163 Unclassified 1654
380 Ga0070715_10237498 3300006163 Unclassified 946
381 Ga0070716_100000245 3300006173 Bacteria 21690
382 Ga0070716_100001067 3300006173 Bacteria 11999
383 Ga0070716_100003370 3300006173 Bacteria 7518
384 Ga0070716_100009779 3300006173 Bacteria 4792
385 Ga0070716_100024382 3300006173 Bacteria 3219
386 Ga0070716_100025014 3300006173 Bacteria 3180
387 Ga0070716_100036148 3300006173 Bacteria 2722
388 Ga0070716_100077776 3300006173 Bacteria 1970
389 Ga0070716_100082166 3300006173 Bacteria 1926
390 Ga0070716_100106187 3300006173 Bacteria 1731
391 Ga0070716_100120781 3300006173 Unclassified 1640
392 Ga0070716_100387439 3300006173 Bacteria 1001
393 Ga0070716_100402603 3300006173 Bacteria 984
394 Ga0070716_100670127 3300006173 Unclassified 789
395 Ga0070712_100000137 3300006175 Bacteria 38061
396 Ga0070712_100000160 3300006175 Bacteria 36252
397 Ga0070712_100003932 3300006175 Bacteria 9151
398 Ga0070712_100006526 3300006175 Bacteria 7242
399 Ga0070712_100025987 3300006175 Unclassified 3896
400 Ga0070712_100069905 3300006175 Bacteria 2506
401 Ga0070712_100098125 3300006175 Bacteria 2161
402 Ga0070712_100162254 3300006175 Bacteria 1727
403 Ga0070712_100235704 3300006175 Bacteria 1455
404 Ga0070712_100438380 3300006175 Unclassified 1086
405 Ga0097621_100000866 3300006237 Bacteria 21263
406 Ga0097621_100008142 3300006237 Bacteria 7539
407 Ga0097621_100012133 3300006237 Bacteria 6376
408 Ga0097621_100110307 3300006237 Bacteria 2324
409 Ga0097621_100120754 3300006237 Bacteria 2222
410 Ga0097621_100176521 3300006237 Unclassified 1844
411 Ga0097621_100385304 3300006237 Bacteria 1253
412 Ga0097621_100482653 3300006237 Bacteria 1120
413 Ga0068871_100000389 3300006358 Bacteria 30917
414 Ga0068871_100004381 3300006358 Bacteria 9812
415 Ga0068871_100013588 3300006358 Bacteria 6045
416 Ga0068871_100020430 3300006358 Bacteria 5073
417 Ga0068871_100061823 3300006358 Bacteria 3060
418 Ga0068871_100233209 3300006358 Bacteria 1598
419 Ga0068871_100233603 3300006358 Bacteria 1597
420 Ga0068871_100347086 3300006358 Bacteria 1312
421 Ga0068871_100624214 3300006358 Unclassified 982
422 Ga0075433_10025998 3300006852 Bacteria 4952
423 Ga0075434_100025649 3300006871 Bacteria 5768
424 Ga0075434_100043722 3300006871 Bacteria 4443
425 Ga0068865_100038271 3300006881 Unclassified 3245
426 Ga0068865_100057745 3300006881 Bacteria 2708
427 Ga0068865_100437395 3300006881 Unclassified 1079
428 Ga0075436_100000617 3300006914 Bacteria 23305
429 Ga0075436_100005379 3300006914 Bacteria 8811
430 Ga0075436_100008224 3300006914 Bacteria 7138
431 Ga0075436_100071120 3300006914 Unclassified 2405
432 Ga0075436_100100756 3300006914 Unclassified 2012
433 Ga0075436_100136394 3300006914 Bacteria 1723
434 Ga0075436_100343536 3300006914 Unclassified 1075
435 Ga0097620_100020260 3300006931 Bacteria 6676
436 Ga0097620_100076013 3300006931 Bacteria 3399
437 Ga0097620_100091067 3300006931 Unclassified 3100
438 Ga0075435_100006248 3300007076 Bacteria 8412
439 Ga0075435_100015023 3300007076 Bacteria 5811
440 Ga0075435_100018883 3300007076 Bacteria 5254
441 Ga0075435_100106884 3300007076 Bacteria 2324
442 Ga0075435_100695746 3300007076 Unclassified 883
443 Ga0099794_10040998 3300007265 Bacteria 2203
444 Ga0099795_10018617 3300007788 Unclassified 2234
445 Ga0105240_10012373 3300009093 Bacteria 11783
446 Ga0105240_10016937 3300009093 Archaea 9849
447 Ga0105240_10048990 3300009093 Bacteria 5336
448 Ga0105240_10057299 3300009093 Unclassified 4869
449 Ga0105240_10059796 3300009093 Unclassified 4753
450 Ga0105240_10155789 3300009093 Bacteria 2717
451 Ga0105240_10178379 3300009093 Bacteria 2509
452 Ga0105240_10300769 3300009093 Unclassified 1835
453 Ga0105240_10323692 3300009093 Bacteria 1756
454 Ga0105240_10423596 3300009093 Bacteria 1495
455 Ga0111539_10251988 3300009094 Unclassified 2056
456 Ga0105245_10002517 3300009098 Bacteria 16522
457 Ga0105245_10005508 3300009098 Bacteria 11118
458 Ga0105245_10005571 3300009098 Bacteria 11066
459 Ga0105245_10079867 3300009098 Unclassified 2988
460 Ga0105245_10204433 3300009098 Unclassified 1898
461 Ga0105245_10259778 3300009098 Bacteria 1690
462 Ga0105245_10474573 3300009098 Bacteria 1263
463 Ga0105247_10002780 3300009101 Bacteria 11715
464 Ga0105247_10013406 3300009101 Unclassified 4915
465 Ga0105247_10049016 3300009101 Bacteria 2596
466 Ga0105247_10263774 3300009101 Bacteria 1182
467 Ga0105247_10474945 3300009101 Unclassified 906
468 Ga0105243_10116675 3300009148 Bacteria 2243
469 Ga0105241_10015361 3300009174 Bacteria 5607
470 Ga0105241_10027756 3300009174 Bacteria 4214
471 Ga0105241_10035343 3300009174 Bacteria 3758
472 Ga0105241_10036363 3300009174 Bacteria 3705
473 Ga0105241_10118815 3300009174 Bacteria 2126
474 Ga0105241_10197038 3300009174 Bacteria 1680
475 Ga0105241_10233179 3300009174 Bacteria 1552
476 Ga0105241_10251502 3300009174 Bacteria 1498
477 Ga0105241_10361556 3300009174 Unclassified 1263
478 Ga0105241_10472177 3300009174 Unclassified 1113
479 Ga0105242_10003041 3300009176 Bacteria 13109
480 Ga0105242_10019959 3300009176 Bacteria 5250
481 Ga0105242_10062961 3300009176 Bacteria 3054
482 Ga0105242_10248530 3300009176 Bacteria 1602
483 Ga0105242_10253551 3300009176 Bacteria 1586
484 Ga0105248_10037033 3300009177 Bacteria 5455
485 Ga0105248_10047910 3300009177 Bacteria 4793
486 Ga0105248_10061302 3300009177 Bacteria 4223
487 Ga0105248_10140590 3300009177 Bacteria 2723
488 Ga0105248_10248648 3300009177 Bacteria 2002
489 Ga0105248_10258611 3300009177 Unclassified 1960
490 Ga0105248_10334378 3300009177 Bacteria 1706
491 Ga0105248_10336215 3300009177 Bacteria 1700
492 Ga0105237_10153239 3300009545 Unclassified 2301
493 Ga0105237_10221497 3300009545 Bacteria 1892
494 Ga0105237_10280979 3300009545 Bacteria 1667
495 Ga0105237_10299139 3300009545 Bacteria 1612
496 Ga0105237_10380467 3300009545 Bacteria 1416
497 Ga0105237_10523413 3300009545 Bacteria 1192
498 Ga0105237_10597693 3300009545 Unclassified 1110
499 Ga0105238_10000214 3300009551 Bacteria 64373
500 Ga0105238_10015383 3300009551 Bacteria 7745
501 Ga0105238_10064054 3300009551 Bacteria 3677
502 Ga0105238_10099757 3300009551 Bacteria 2887
503 Ga0105238_10110643 3300009551 Bacteria 2727
504 Ga0105238_10250616 3300009551 Bacteria 1749
505 Ga0105238_10811014 3300009551 Bacteria 952
506 Ga0105249_10002544 3300009553 Bacteria 15785
507 Ga0105249_10003055 3300009553 Bacteria 14445
508 Ga0105249_10508169 3300009553 Bacteria 1251
509 Ga0105249_11392457 3300009553 Unclassified 773
510 Ga0099796_10009269 3300010159 Bacteria 2658
511 Ga0099796_10018605 3300010159 Bacteria 2090
512 Ga0099796_10149114 3300010159 Bacteria 920
513 Ga0105239_10005155 3300010375 Bacteria 15426
514 Ga0105239_10009279 3300010375 Bacteria 11121
515 Ga0105239_10031699 3300010375 Bacteria 5809
516 Ga0105239_10122752 3300010375 Unclassified 2886
517 Ga0105239_10160101 3300010375 Bacteria 2514
518 Ga0105239_10225318 3300010375 Bacteria 2103
519 Ga0105239_10241550 3300010375 Bacteria 2027
520 Ga0105239_10429208 3300010375 Bacteria 1498
521 Ga0105246_10002563 3300011119 Bacteria 10988
522 Ga0105246_10057806 3300011119 Bacteria 2685
523 Ga0105246_10152473 3300011119 Bacteria 1751
524 Ga0105246_10402909 3300011119 Unclassified 1137
525 Ga0157373_10021339 3300013100 Bacteria 4704
526 Ga0157373_10046278 3300013100 Unclassified 3104
527 Ga0157373_10068830 3300013100 Unclassified 2502
528 Ga0157373_10087635 3300013100 Bacteria 2193
529 Ga0157373_10102141 3300013100 Unclassified 2017
530 Ga0157373_10156450 3300013100 Unclassified 1603
531 Ga0157371_10006751 3300013102 Bacteria 9382
532 Ga0157371_10019416 3300013102 Bacteria 5014
533 Ga0157371_10082689 3300013102 Bacteria 2273
534 Ga0157371_10120725 3300013102 Unclassified 1863
535 Ga0157370_10093091 3300013104 Bacteria 2828
536 Ga0157370_10249512 3300013104 Bacteria 1642
537 Ga0157369_10001356 3300013105 Bacteria 30251
538 Ga0157369_10001450 3300013105 Bacteria 29095
539 Ga0157369_10024189 3300013105 Bacteria 6760
540 Ga0157369_10030481 3300013105 Bacteria 5949
541 Ga0157369_10040105 3300013105 Bacteria 5114
542 Ga0157369_10073618 3300013105 Bacteria 3665
543 Ga0157369_10138669 3300013105 Bacteria 2574
544 Ga0157369_10219666 3300013105 Bacteria 1989
545 Ga0157369_10220534 3300013105 Bacteria 1985
546 Ga0157369_11181304 3300013105 Unclassified 781
547 Ga0157374_10000634 3300013296 Bacteria 30935
548 Ga0157374_10000933 3300013296 Bacteria 25457
549 Ga0157374_10012477 3300013296 Bacteria 7395
550 Ga0157374_10014623 3300013296 Bacteria 6868
551 Ga0157374_10021322 3300013296 Bacteria 5764
552 Ga0157374_10063078 3300013296 Unclassified 3475
553 Ga0157374_10090020 3300013296 Bacteria 2925
554 Ga0157374_10323651 3300013296 Bacteria 1528
555 Ga0157374_10783876 3300013296 Unclassified 969
556 Ga0157378_10000202 3300013297 Bacteria 58070
557 Ga0157378_10000725 3300013297 Bacteria 30797
558 Ga0157378_10001987 3300013297 Bacteria 18289
559 Ga0157378_10011031 3300013297 Bacteria 7908
560 Ga0157378_10015615 3300013297 Bacteria 6651
561 Ga0157378_10024355 3300013297 Bacteria 5324
562 Ga0157378_10026606 3300013297 Bacteria 5098
563 Ga0157378_10095627 3300013297 Bacteria 2706
564 Ga0157378_10241690 3300013297 Bacteria 1725
565 Ga0157378_10287912 3300013297 Bacteria 1586
566 Ga0163162_10012550 3300013306 Bacteria 8275
567 Ga0163162_10019094 3300013306 Bacteria 6723
568 Ga0163162_10043772 3300013306 Unclassified 4483
569 Ga0163162_10093677 3300013306 Bacteria 3089
570 Ga0163162_10176548 3300013306 Bacteria 2262
571 Ga0163162_10645872 3300013306 Unclassified 1182
572 Ga0157372_10001366 3300013307 Bacteria 26403
573 Ga0157372_10001445 3300013307 Bacteria 25697
574 Ga0157372_10004384 3300013307 Bacteria 15059
575 Ga0157372_10017432 3300013307 Bacteria 7708
576 Ga0157372_10033801 3300013307 Bacteria 5619
577 Ga0157372_10047456 3300013307 Bacteria 4773
578 Ga0157372_10105423 3300013307 Unclassified 3224
579 Ga0157372_10171357 3300013307 Bacteria 2511
580 Ga0157372_10234647 3300013307 Bacteria 2127
581 Ga0157372_10302565 3300013307 Bacteria 1860
582 Ga0157372_10501345 3300013307 Unclassified 1416
583 Ga0157372_10823502 3300013307 Bacteria 1078
584 Ga0157372_10861820 3300013307 Bacteria 1051
585 Ga0157375_10094229 3300013308 Unclassified 3062
586 Ga0157375_10238673 3300013308 Bacteria 1977
587 Ga0163163_10002855 3300014325 Bacteria 14601
588 Ga0163163_10016774 3300014325 Bacteria 6816
589 Ga0163163_10057910 3300014325 Unclassified 3831
590 Ga0163163_10074503 3300014325 Bacteria 3387
591 Ga0163163_10135298 3300014325 Bacteria 2506
592 Ga0163163_10307810 3300014325 Unclassified 1637
593 Ga0163163_10848926 3300014325 Unclassified 977
594 Ga0157380_10044873 3300014326 Bacteria 3466
595 Ga0157380_10356561 3300014326 Bacteria 1371
596 Ga0182008_10005873 3300014497 Bacteria 6933
597 Ga0182008_10006717 3300014497 Bacteria 6405
598 Ga0157377_10002769 3300014745 Bacteria 7809
599 Ga0157377_10187647 3300014745 Unclassified 1304
600 Ga0157379_10008575 3300014968 Bacteria 8895
601 Ga0157379_10091518 3300014968 Bacteria 2728
602 Ga0157379_10223549 3300014968 Bacteria 1706
603 Ga0157379_10439714 3300014968 Unclassified 1202
604 Ga0157379_10450281 3300014968 Unclassified 1188
605 Ga0157376_10041763 3300014969 Bacteria 3757
606 Ga0157376_10120230 3300014969 Bacteria 2327
607 Ga0157376_10151535 3300014969 Bacteria 2091
608 Ga0157376_10181851 3300014969 Bacteria 1922
609 Ga0157376_10187991 3300014969 Bacteria 1892
610 Ga0157376_10902401 3300014969 Bacteria 902
611 Ga0182007_10008222 3300015262 Bacteria 4299
612 Ga0182007_10015579 3300015262 Bacteria 2829
613 Ga0163161_10011329 3300017792 Bacteria 6181
614 Ga0206355_1443854 3300020076 Unclassified 1289
615 Ga0213874_10010643 3300021377 Bacteria 2308
616 Ga0213874_10155955 3300021377 Unclassified 799
617 Ga0224712_10023051 3300022467 Bacteria 2156
618 Ga0224570_100693 3300022730 Unclassified 2670
619 Ga0224569_100208 3300022732 Bacteria 4832
620 Ga0224571_100380 3300022734 Unclassified 2396
621 Ga0224572_1008493 3300024225 Unclassified 1900
622 Ga0224572_1011757 3300024225 Bacteria 1656
623 Ga0228598_1000444 3300024227 Bacteria 8427
624 Ga0228598_1001640 3300024227 Unclassified 4889
625 Ga0228598_1009745 3300024227 Unclassified 1920
626 Ga0228598_1043357 3300024227 Unclassified 889
627 Ga0207697_10005790 3300025315 Bacteria 5696
628 Ga0207656_10004119 3300025321 Bacteria 5050
629 Ga0207656_10025256 3300025321 Bacteria 2410
630 Ga0207656_10053100 3300025321 Unclassified 1757
631 Ga0207656_10127260 3300025321 Bacteria 1191
632 Ga0207682_10000826 3300025893 Bacteria 14304
633 Ga0207692_10002949 3300025898 Bacteria 6591
634 Ga0207692_10008329 3300025898 Unclassified 4288
635 Ga0207692_10043513 3300025898 Bacteria 2235
636 Ga0207692_10057058 3300025898 Unclassified 2006
637 Ga0207692_10058217 3300025898 Bacteria 1990
638 Ga0207692_10085800 3300025898 Bacteria 1695
639 Ga0207692_10092433 3300025898 Unclassified 1644
640 Ga0207692_10156211 3300025898 Bacteria 1311
641 Ga0207692_10211514 3300025898 Bacteria 1145
642 Ga0207692_10366318 3300025898 Unclassified 891
643 Ga0207692_10378490 3300025898 Unclassified 878
644 Ga0207642_10036653 3300025899 Bacteria 2107
645 Ga0207642_10085903 3300025899 Bacteria 1540
646 Ga0207642_10118802 3300025899 Bacteria 1360
647 Ga0207642_10158218 3300025899 Unclassified 1213
648 Ga0207642_10192767 3300025899 Bacteria 1120
649 Ga0207642_10241147 3300025899 Unclassified 1021
650 Ga0207710_10005993 3300025900 Bacteria 5211
651 Ga0207710_10090240 3300025900 Bacteria 1433
652 Ga0207710_10137062 3300025900 Bacteria 1179
653 Ga0207688_10022482 3300025901 Bacteria 3450
654 Ga0207680_10045858 3300025903 Bacteria 2581
655 Ga0207680_10170647 3300025903 Bacteria 1465
656 Ga0207647_10016942 3300025904 Bacteria 4961
657 Ga0207647_10033091 3300025904 Bacteria 3314
658 Ga0207647_10040863 3300025904 Bacteria 2919
659 Ga0207685_10012926 3300025905 Bacteria 2565
660 Ga0207685_10041434 3300025905 Unclassified 1723
661 Ga0207685_10111628 3300025905 Bacteria 1186
662 Ga0207685_10281829 3300025905 Bacteria 816
663 Ga0207699_10000500 3300025906 Bacteria 19622
664 Ga0207699_10004194 3300025906 Bacteria 6900
665 Ga0207699_10018669 3300025906 Bacteria 3680
666 Ga0207699_10046705 3300025906 Unclassified 2535
667 Ga0207699_10054546 3300025906 Bacteria 2375
668 Ga0207699_10088565 3300025906 Unclassified 1938
669 Ga0207699_10107418 3300025906 Unclassified 1783
670 Ga0207699_10114827 3300025906 Bacteria 1732
671 Ga0207699_10116432 3300025906 Bacteria 1721
672 Ga0207699_10139997 3300025906 Unclassified 1589
673 Ga0207699_10141170 3300025906 Bacteria 1583
674 Ga0207699_10153670 3300025906 Bacteria 1525
675 Ga0207699_10154767 3300025906 Unclassified 1520
676 Ga0207699_10184632 3300025906 Unclassified 1404
677 Ga0207699_10264616 3300025906 Bacteria 1189
678 Ga0207645_10000559 3300025907 Bacteria 30910
679 Ga0207645_10004273 3300025907 Bacteria 10603
680 Ga0207643_10001182 3300025908 Bacteria 15496
681 Ga0207643_10166663 3300025908 Bacteria 1328
682 Ga0207705_10307733 3300025909 Bacteria 1216
683 Ga0207705_10617399 3300025909 Unclassified 843
684 Ga0207684_10000447 3300025910 Bacteria 54429
685 Ga0207684_10003786 3300025910 Bacteria 14599
686 Ga0207684_10029173 3300025910 Bacteria 4699
687 Ga0207684_10049625 3300025910 Bacteria 3560
688 Ga0207684_10051528 3300025910 Bacteria 3493
689 Ga0207684_10080416 3300025910 Bacteria 2773
690 Ga0207684_10092510 3300025910 Bacteria 2577
691 Ga0207654_10025850 3300025911 Unclassified 3173
692 Ga0207654_10031513 3300025911 Bacteria 2921
693 Ga0207654_10095545 3300025911 Bacteria 1821
694 Ga0207654_10342241 3300025911 Unclassified 1028
695 Ga0207707_10007113 3300025912 Bacteria 9749
696 Ga0207707_10007719 3300025912 Bacteria 9366
697 Ga0207707_10024683 3300025912 Bacteria 5260
698 Ga0207707_10036015 3300025912 Unclassified 4327
699 Ga0207707_10057464 3300025912 Bacteria 3386
700 Ga0207707_10066212 3300025912 Bacteria 3146
701 Ga0207707_10156366 3300025912 Bacteria 1994
702 Ga0207707_10234807 3300025912 Unclassified 1595
703 Ga0207707_10297769 3300025912 Bacteria 1395
704 Ga0207695_10016663 3300025913 Bacteria 8587
705 Ga0207695_10021009 3300025913 Bacteria 7457
706 Ga0207695_10041339 3300025913 Bacteria 4935
707 Ga0207695_10049139 3300025913 Unclassified 4449
708 Ga0207695_10102997 3300025913 Bacteria 2847
709 Ga0207695_10121129 3300025913 Bacteria 2584
710 Ga0207695_10124888 3300025913 Unclassified 2537
711 Ga0207695_10154131 3300025913 Unclassified 2234
712 Ga0207695_10205401 3300025913 Bacteria 1883
713 Ga0207695_10247082 3300025913 Bacteria 1684
714 Ga0207695_10711240 3300025913 Bacteria 885
715 Ga0207671_10078351 3300025914 Bacteria 2475
716 Ga0207671_10089763 3300025914 Bacteria 2314
717 Ga0207671_10127506 3300025914 Bacteria 1951
718 Ga0207671_10567030 3300025914 Unclassified 905
719 Ga0207693_10000015 3300025915 Bacteria 147464
720 Ga0207693_10000271 3300025915 Bacteria 47827
721 Ga0207693_10000440 3300025915 Bacteria 37946
722 Ga0207693_10004290 3300025915 Bacteria 12084
723 Ga0207693_10024713 3300025915 Unclassified 4765
724 Ga0207693_10038411 3300025915 Bacteria 3771
725 Ga0207693_10115303 3300025915 Bacteria 2109
726 Ga0207693_10155648 3300025915 Bacteria 1797
727 Ga0207693_10155976 3300025915 Bacteria 1795
728 Ga0207693_10400660 3300025915 Unclassified 1073
729 Ga0207693_10412689 3300025915 Unclassified 1055
730 Ga0207693_10413818 3300025915 Unclassified 1054
731 Ga0207693_10583447 3300025915 Unclassified 871
732 Ga0207693_10702365 3300025915 Unclassified 783
733 Ga0207663_10001723 3300025916 Bacteria 10272
734 Ga0207663_10006828 3300025916 Bacteria 5874
735 Ga0207663_10009827 3300025916 Bacteria 5064
736 Ga0207663_10075107 3300025916 Bacteria 2192
737 Ga0207663_10170658 3300025916 Bacteria 1545
738 Ga0207663_10187486 3300025916 Unclassified 1483
739 Ga0207663_10301875 3300025916 Bacteria 1197
740 Ga0207663_10307800 3300025916 Unclassified 1186
741 Ga0207663_10324188 3300025916 Unclassified 1158
742 Ga0207663_10377198 3300025916 Bacteria 1080
743 Ga0207660_10015217 3300025917 Bacteria 5075
744 Ga0207660_10064752 3300025917 Bacteria 2639
745 Ga0207660_10086028 3300025917 Bacteria 2320
746 Ga0207660_10090299 3300025917 Bacteria 2269
747 Ga0207660_10200976 3300025917 Bacteria 1557
748 Ga0207660_10451090 3300025917 Unclassified 1040
749 Ga0207662_10002448 3300025918 Bacteria 9305
750 Ga0207662_10014408 3300025918 Unclassified 4437
751 Ga0207662_10127370 3300025918 Bacteria 1602
752 Ga0207662_10242781 3300025918 Bacteria 1180
753 Ga0207657_10000766 3300025919 Bacteria 34045
754 Ga0207657_10001795 3300025919 Bacteria 23148
755 Ga0207657_10003111 3300025919 Bacteria 17745
756 Ga0207649_10000344 3300025920 Bacteria 35179
757 Ga0207649_10025834 3300025920 Bacteria 3429
758 Ga0207649_10065227 3300025920 Bacteria 2304
759 Ga0207649_10086039 3300025920 Unclassified 2047
760 Ga0207649_10387069 3300025920 Bacteria 1043
761 Ga0207652_10030969 3300025921 Bacteria 4487
762 Ga0207652_10032508 3300025921 Bacteria 4387
763 Ga0207652_10062497 3300025921 Bacteria 3218
764 Ga0207652_10116861 3300025921 Bacteria 2370
765 Ga0207652_10132899 3300025921 Unclassified 2220
766 Ga0207652_10445541 3300025921 Unclassified 1167
767 Ga0207652_10466814 3300025921 Bacteria 1137
768 Ga0207652_10546977 3300025921 Unclassified 1041
769 Ga0207652_10626009 3300025921 Unclassified 963
770 Ga0207646_10000676 3300025922 Bacteria 44173
771 Ga0207646_10000939 3300025922 Bacteria 37488
772 Ga0207646_10067160 3300025922 Bacteria 3201
773 Ga0207646_10106211 3300025922 Unclassified 2518
774 Ga0207646_10231197 3300025922 Unclassified 1670
775 Ga0207646_10556048 3300025922 Unclassified 1031
776 Ga0207681_10015679 3300025923 Bacteria 4729
777 Ga0207681_10368025 3300025923 Bacteria 1154
778 Ga0207694_10002265 3300025924 Bacteria 15742
779 Ga0207694_10162233 3300025924 Bacteria 1806
780 Ga0207694_10170624 3300025924 Bacteria 1761
781 Ga0207694_10202650 3300025924 Bacteria 1615
782 Ga0207694_10582098 3300025924 Unclassified 941
783 Ga0207650_10000058 3300025925 Bacteria 153056
784 Ga0207659_10046383 3300025926 Bacteria 3068
785 Ga0207659_10425788 3300025926 Bacteria 1114
786 Ga0207687_10031371 3300025927 Bacteria 3590
787 Ga0207687_10050749 3300025927 Bacteria 2889
788 Ga0207687_10126800 3300025927 Bacteria 1918
789 Ga0207687_10130104 3300025927 Bacteria 1896
790 Ga0207687_10156294 3300025927 Bacteria 1745
791 Ga0207687_10207103 3300025927 Bacteria 1536
792 Ga0207687_10920984 3300025927 Bacteria 748
793 Ga0207700_10000095 3300025928 Bacteria 54191
794 Ga0207700_10000224 3300025928 Bacteria 33925
795 Ga0207700_10011823 3300025928 Bacteria 5589
796 Ga0207700_10032670 3300025928 Bacteria 3715
797 Ga0207700_10049855 3300025928 Bacteria 3116
798 Ga0207700_10056574 3300025928 Bacteria 2953
799 Ga0207700_10072527 3300025928 Bacteria 2656
800 Ga0207700_10110494 3300025928 Bacteria 2211
801 Ga0207700_10142878 3300025928 Unclassified 1968
802 Ga0207700_10169504 3300025928 Bacteria 1820
803 Ga0207700_10177684 3300025928 Bacteria 1780
804 Ga0207700_10200661 3300025928 Bacteria 1681
805 Ga0207700_10615083 3300025928 Bacteria 967
806 Ga0207700_10855998 3300025928 Unclassified 813
807 Ga0207664_10000265 3300025929 Bacteria 39382
808 Ga0207664_10013334 3300025929 Bacteria 5896
809 Ga0207664_10023325 3300025929 Bacteria 4634
810 Ga0207664_10035312 3300025929 Bacteria 3856
811 Ga0207664_10096721 3300025929 Bacteria 2431
812 Ga0207664_10127067 3300025929 Bacteria 2142
813 Ga0207664_10149849 3300025929 Bacteria 1981
814 Ga0207664_10279644 3300025929 Bacteria 1464
815 Ga0207664_10279866 3300025929 Unclassified 1464
816 Ga0207664_10458497 3300025929 Bacteria 1138
817 Ga0207664_10572533 3300025929 Unclassified 1014
818 Ga0207664_10877192 3300025929 Unclassified 806
819 Ga0207664_11037468 3300025929 Unclassified 734
820 Ga0207644_10053840 3300025931 Unclassified 2897
821 Ga0207644_10139235 3300025931 Bacteria 1867
822 Ga0207690_10045837 3300025932 Unclassified 2892
823 Ga0207690_10146131 3300025932 Bacteria 1748
824 Ga0207690_10217148 3300025932 Bacteria 1461
825 Ga0207706_10000732 3300025933 Bacteria 34191
826 Ga0207706_10000956 3300025933 Bacteria 29545
827 Ga0207686_10037996 3300025934 Bacteria 2909
828 Ga0207686_10086943 3300025934 Unclassified 2055
829 Ga0207686_10097718 3300025934 Bacteria 1953
830 Ga0207686_10306280 3300025934 Bacteria 1182
831 Ga0207709_10145090 3300025935 Bacteria 1637
832 Ga0207670_10004801 3300025936 Bacteria 7337
833 Ga0207704_10030050 3300025938 Bacteria 3041
834 Ga0207704_10040377 3300025938 Unclassified 2727
835 Ga0207704_10402581 3300025938 Unclassified 1080
836 Ga0207665_10000049 3300025939 Bacteria 76350
837 Ga0207665_10001658 3300025939 Bacteria 14980
838 Ga0207665_10004144 3300025939 Bacteria 9653
839 Ga0207665_10006523 3300025939 Bacteria 7738
840 Ga0207665_10014854 3300025939 Bacteria 5120
841 Ga0207665_10021191 3300025939 Unclassified 4272
842 Ga0207665_10063800 3300025939 Bacteria 2502
843 Ga0207665_10067114 3300025939 Bacteria 2442
844 Ga0207665_10086460 3300025939 Unclassified 2165
845 Ga0207665_10091299 3300025939 Bacteria 2111
846 Ga0207665_10121606 3300025939 Unclassified 1845
847 Ga0207665_10128813 3300025939 Bacteria 1794
848 Ga0207665_10134194 3300025939 Bacteria 1760
849 Ga0207665_10141989 3300025939 Bacteria 1713
850 Ga0207665_10148147 3300025939 Unclassified 1679
851 Ga0207665_10251247 3300025939 Bacteria 1307
852 Ga0207665_10463539 3300025939 Unclassified 974
853 Ga0207691_10002552 3300025940 Bacteria 17794
854 Ga0207711_10029133 3300025941 Bacteria 4653
855 Ga0207711_10167073 3300025941 Bacteria 1995
856 Ga0207711_10171699 3300025941 Bacteria 1968
857 Ga0207711_10196885 3300025941 Unclassified 1838
858 Ga0207711_10208013 3300025941 Bacteria 1787
859 Ga0207711_10310597 3300025941 Bacteria 1456
860 Ga0207711_10492921 3300025941 Bacteria 1142
861 Ga0207711_10630831 3300025941 Unclassified 1000
862 Ga0207689_10000512 3300025942 Bacteria 36765
863 Ga0207689_10001703 3300025942 Bacteria 20842
864 Ga0207689_10022953 3300025942 Bacteria 5241
865 Ga0207689_10036804 3300025942 Unclassified 4062
866 Ga0207689_10920582 3300025942 Unclassified 738
867 Ga0207661_10000328 3300025944 Bacteria 30179
868 Ga0207661_10041003 3300025944 Unclassified 3643
869 Ga0207661_10060196 3300025944 Bacteria 3063
870 Ga0207661_10440422 3300025944 Unclassified 1186
871 Ga0207661_10548139 3300025944 Unclassified 1059
872 Ga0207661_10625923 3300025944 Unclassified 989
873 Ga0207679_10000170 3300025945 Bacteria 53584
874 Ga0207679_10012413 3300025945 Bacteria 5555
875 Ga0207679_10037212 3300025945 Bacteria 3458
876 Ga0207679_10242360 3300025945 Bacteria 1528
877 Ga0207679_10379013 3300025945 Unclassified 1240
878 Ga0207679_11027818 3300025945 Unclassified 756
879 Ga0207667_10006788 3300025949 Bacteria 13823
880 Ga0207667_10031195 3300025949 Bacteria 5755
881 Ga0207667_10054117 3300025949 Bacteria 4221
882 Ga0207667_10067834 3300025949 Bacteria 3715
883 Ga0207667_10128087 3300025949 Unclassified 2615
884 Ga0207667_10204606 3300025949 Bacteria 2024
885 Ga0207667_10242732 3300025949 Bacteria 1843
886 Ga0207667_10291787 3300025949 Bacteria 1666
887 Ga0207667_10867515 3300025949 Unclassified 896
888 Ga0207651_10008651 3300025960 Bacteria 5513
889 Ga0207651_10436601 3300025960 Bacteria 1121
890 Ga0207712_10035640 3300025961 Bacteria 3383
891 Ga0207712_10928332 3300025961 Unclassified 770
892 Ga0207668_10162558 3300025972 Bacteria 1741
893 Ga0207668_10968346 3300025972 Unclassified 759
894 Ga0207640_10004443 3300025981 Bacteria 7606
895 Ga0207640_10118892 3300025981 Bacteria 1889
896 Ga0207640_10129664 3300025981 Unclassified 1821
897 Ga0207640_10146244 3300025981 Bacteria 1730
898 Ga0207640_10193978 3300025981 Bacteria 1533
899 Ga0207640_10537530 3300025981 Unclassified 980
900 Ga0207640_10560632 3300025981 Unclassified 961
901 Ga0207658_10160407 3300025986 Bacteria 1842
902 Ga0207658_10246020 3300025986 Bacteria 1517
903 Ga0207658_10625116 3300025986 Bacteria 969
904 Ga0207677_10009877 3300026023 Bacteria 5380
905 Ga0207677_10016958 3300026023 Unclassified 4328
906 Ga0207677_10034948 3300026023 Bacteria 3259
907 Ga0207677_10092488 3300026023 Bacteria 2202
908 Ga0207677_10100208 3300026023 Bacteria 2129
909 Ga0207677_10119496 3300026023 Bacteria 1979
910 Ga0207677_10291891 3300026023 Unclassified 1343
911 Ga0207677_10657725 3300026023 Bacteria 926
912 Ga0207677_10717955 3300026023 Unclassified 888
913 Ga0207703_10001237 3300026035 Bacteria 23917
914 Ga0207703_10003326 3300026035 Bacteria 13502
915 Ga0207703_10051504 3300026035 Bacteria 3337
916 Ga0207703_10070136 3300026035 Unclassified 2892
917 Ga0207703_10070460 3300026035 Bacteria 2886
918 Ga0207703_10162224 3300026035 Bacteria 1958
919 Ga0207639_10005167 3300026041 Bacteria 8804
920 Ga0207639_10005894 3300026041 Bacteria 8304
921 Ga0207639_10014708 3300026041 Bacteria 5511
922 Ga0207639_10071290 3300026041 Bacteria 2717
923 Ga0207639_10092463 3300026041 Unclassified 2424
924 Ga0207639_10102406 3300026041 Unclassified 2318
925 Ga0207639_10119152 3300026041 Bacteria 2166
926 Ga0207639_10200206 3300026041 Bacteria 1712
927 Ga0207678_10000887 3300026067 Bacteria 27526
928 Ga0207678_10001608 3300026067 Bacteria 20769
929 Ga0207702_10000415 3300026078 Bacteria 48713
930 Ga0207702_10000866 3300026078 Bacteria 31529
931 Ga0207702_10001193 3300026078 Bacteria 26376
932 Ga0207702_10026868 3300026078 Bacteria 4779
933 Ga0207702_10057298 3300026078 Bacteria 3311
934 Ga0207702_10082101 3300026078 Bacteria 2802
935 Ga0207702_10113285 3300026078 Bacteria 2415
936 Ga0207702_10150393 3300026078 Unclassified 2117
937 Ga0207702_10399113 3300026078 Bacteria 1326
938 Ga0207702_10621857 3300026078 Bacteria 1061
939 Ga0207641_10000323 3300026088 Bacteria 58693
940 Ga0207641_10010259 3300026088 Bacteria 7705
941 Ga0207641_10164887 3300026088 Unclassified 2017
942 Ga0207648_10000870 3300026089 Bacteria 34025
943 Ga0207648_10049697 3300026089 Bacteria 3668
944 Ga0207648_10078342 3300026089 Bacteria 2883
945 Ga0207676_10001412 3300026095 Bacteria 17835
946 Ga0207676_10001649 3300026095 Bacteria 16439
947 Ga0207676_10027339 3300026095 Unclassified 4248
948 Ga0207676_10035580 3300026095 Unclassified 3781
949 Ga0207676_10048872 3300026095 Bacteria 3287
950 Ga0207676_10067197 3300026095 Bacteria 2863
951 Ga0207676_10240306 3300026095 Bacteria 1624
952 Ga0207674_10000164 3300026116 Bacteria 79381
953 Ga0207674_10000269 3300026116 Bacteria 65505
954 Ga0207674_10009605 3300026116 Bacteria 11035
955 Ga0207674_10069953 3300026116 Unclassified 3528
956 Ga0207674_10083587 3300026116 Bacteria 3192
957 Ga0207674_10149144 3300026116 Bacteria 2296
958 Ga0207674_10185924 3300026116 Bacteria 2028
959 Ga0207675_100077714 3300026118 Bacteria 3110
960 Ga0207675_100112466 3300026118 Unclassified 2570
961 Ga0207675_100119688 3300026118 Bacteria 2491
962 Ga0207683_10000493 3300026121 Bacteria 36475
963 Ga0207683_10084329 3300026121 Bacteria 2824
964 Ga0207683_10084876 3300026121 Bacteria 2815
965 Ga0207698_10003243 3300026142 Bacteria 9769
966 Ga0207698_10202364 3300026142 Unclassified 1779
967 Ga0207698_10372421 3300026142 Bacteria 1356
968 Ga0207698_10899694 3300026142 Unclassified 892
969 Ga0207698_10983507 3300026142 Unclassified 854
970 Ga0265354_1003879 3300028016 Bacteria 1621
971 Ga0265356_1000796 3300028017 Bacteria 5269
972 Ga0265356_1003059 3300028017 Bacteria 2143
973 Ga0265355_1005336 3300028036 Bacteria 986
974 Ga0268266_10006414 3300028379 Bacteria 10777
975 Ga0268266_10057790 3300028379 Bacteria 3339
976 Ga0268266_10626178 3300028379 Bacteria 1034
977 Ga0268265_10002217 3300028380 Bacteria 14963
978 Ga0268265_10066425 3300028380 Bacteria 2788
979 Ga0268265_10104611 3300028380 Bacteria 2295
980 Ga0268265_10474619 3300028380 Unclassified 1173
981 Ga0268264_10007432 3300028381 Bacteria 9149
982 Ga0268264_10030585 3300028381 Bacteria 4413
983 Ga0268264_10031105 3300028381 Bacteria 4376
984 Ga0268264_10064813 3300028381 Unclassified 3076
985 Ga0268264_10133421 3300028381 Bacteria 2205
986 Ga0265336_10076755 3300028666 Bacteria 998
987 Ga0265338_10002180 3300028800 Bacteria 30032
988 Ga0265338_10004188 3300028800 Bacteria 19676
989 Ga0265338_10095093 3300028800 Bacteria 2449
990 Ga0265338_10401812 3300028800 Unclassified 977
991 Ga0265762_1001136 3300030760 Bacteria 4796
992 Ga0265762_1001663 3300030760 Unclassified 4058
993 Ga0265762_1002914 3300030760 Unclassified 3058
994 Ga0265770_1020524 3300030878 Bacteria 1044
995 Ga0265773_1009968 3300031018 Bacteria 793
996 Ga0265760_10000931 3300031090 Bacteria 8432
997 Ga0265760_10001483 3300031090 Bacteria 6912
998 Ga0265760_10002685 3300031090 Bacteria 5207
999 Ga0265760_10003511 3300031090 Bacteria 4547
1000 Ga0265332_10154024 3300031238 Unclassified 961
1001 Ga0265328_10051661 3300031239 Bacteria 1509
1002 Ga0265325_10076336 3300031241 Bacteria 1672
1003 Ga0265340_10074872 3300031247 Unclassified 1600
1004 Ga0265340_10218955 3300031247 Bacteria 853
1005 Ga0265339_10017636 3300031249 Unclassified 4223
1006 Ga0265339_10047578 3300031249 Bacteria 2354
1007 Ga0265339_10095739 3300031249 Bacteria 1550
1008 Ga0265339_10101923 3300031249 Bacteria 1493
1009 Ga0265339_10182021 3300031249 Unclassified 1046
1010 Ga0265316_10007573 3300031344 Bacteria 10213
1011 Ga0265314_10001626 3300031711 Bacteria 24596
1012 Ga0265314_10015261 3300031711 Bacteria 6100
1013 Ga0265314_10171917 3300031711 Unclassified 1307
1014 Ga0307407_10068623 3300031903 Bacteria 2101
1015 Ga0307409_100002346 3300031995 Bacteria 9841
1016 Ga0307409_100009366 3300031995 Bacteria 6013
1017 Ga0307416_100023736 3300032002 Bacteria 4459
1018 Ga0307411_10013959 3300032005 Unclassified 4454
1019 Ga0307415_100488840 3300032126 Unclassified 1073
1020 Ga0316214_1001064 3300033545 Unclassified 3071
1021 Ga0373930_0014593 3300034816 Bacteria 1465
1022 Ga0373950_0039636 3300034818 Bacteria 898
1023 Ga0373926_0003742 3300035083 Bacteria 4951
1024 Ga0373926_0025902 3300035083 Bacteria 2049
1025 Ga0373926_0084805 3300035083 Bacteria 1174
1026 Ga0373926_0132537 3300035083 Unclassified 944
1027 Ga0373928_0081321 3300035084 Bacteria 817
1028 Ga0373934_0027565 3300035086 Bacteria 2208
1029 Ga0373934_0057247 3300035086 Unclassified 1551
1030 Ga0373940_0133126 3300035088 Unclassified 780
1031 Ga0373944_0008880 3300035089 Bacteria 2718
1032 Ga0373944_0009947 3300035089 Unclassified 2586
1033 Ga0373949_0031524 3300035090 Bacteria 1265
1034 Ga0373932_0077753 3300035112 Bacteria 1042
1035 Ga0373936_0003050 3300035113 Bacteria 6264
1036 Ga0373936_0024901 3300035113 Bacteria 2339
1037 Ga0373936_0041474 3300035113 Bacteria 1846
1038 Ga0373936_0082450 3300035113 Bacteria 1340
1039 Ga0373941_0050711 3300035115 Bacteria 1318
1040 Ga0373945_0004158 3300035116 Bacteria 4592
1041 Ga0373945_0021455 3300035116 Bacteria 2219
1042 Ga0373953_0111255 3300035117 Unclassified 1158
1043 Ga0373953_0140048 3300035117 Bacteria 1034
1044 Ga0373956_0006358 3300035119 Bacteria 4731
1045 Ga0373957_0040791 3300035120 Bacteria 1746
1046 Ga0373943_0002936 3300035170 Bacteria 7741
1047 Ga0373943_0087919 3300035170 Unclassified 1605
1048 Ga0373946_0058962 3300035171 Bacteria 1628
1049 Ga0373955_0028626 3300035172 Bacteria 2890
1050 Ga0373955_0047391 3300035172 Unclassified 2327
1051 Ga0373961_0029302 3300035241 Bacteria 1524
1052 Ga0373962_0077031 3300035242 Bacteria 1006
1053 Ga0373924_0000405 3300035410 Bacteria 13237
1054 Ga0373924_0006530 3300035410 Bacteria 4182
1055 Ga0373924_0027003 3300035410 Unclassified 2281
1056 Ga0373924_0125528 3300035410 Unclassified 1115
1057 Ga0373924_0126742 3300035410 Bacteria 1110
1058 Ga0373924_0153332 3300035410 Unclassified 1008
1059 Ga0373931_0057852 3300035691 Bacteria 2080
1060 Ga0373931_0061266 3300035691 Bacteria 2028
1061 Ga0373931_0300403 3300035691 Unclassified 991
1062 Ga0373935_0005782 3300035692 Bacteria 7314
1063 Ga0373935_0011685 3300035692 Bacteria 5273
1064 Ga0373935_0016240 3300035692 Unclassified 4506
1065 Ga0373935_0119189 3300035692 Unclassified 1761
1066 Ga0373935_0242141 3300035692 Unclassified 1260
1067 Ga0373935_0304089 3300035692 Unclassified 1128
1068 Ga0373935_0605230 3300035692 Bacteria 802
1069 Ga0373935_0614905 3300035692 Bacteria 795
1070 Ga0373927_0000389 3300035695 Bacteria 34120
1071 Ga0373927_0017315 3300035695 Bacteria 4745
1072 Ga0373927_0044905 3300035695 Bacteria 2858
1073 Ga0373927_0126459 3300035695 Bacteria 1669
1074 Ga0373933_0029202 3300035724 Bacteria 3187
1075 Ga0373933_0267816 3300035724 Unclassified 1102
1076 Ga0373933_0268063 3300035724 Unclassified 1102
1077 Ga0373947_0000147 3300035725 Bacteria 36627
1078 Ga0373947_0006209 3300035725 Bacteria 6949
1079 Ga0373947_0014220 3300035725 Bacteria 4564
1080 Ga0373947_0014909 3300035725 Bacteria 4461
1081 Ga0373947_0370759 3300035725 Bacteria 963
1082 Ga0373947_0462063 3300035725 Unclassified 860
1083 Ga0373937_0000094 3300036401 Bacteria 82254
1084 Ga0373937_0008668 3300036401 Bacteria 8836
1085 Ga0373937_0147963 3300036401 Unclassified 2199
1086 Ga0373937_0208147 3300036401 Unclassified 1840
1087 Ga0373937_0423773 3300036401 Unclassified 1263
1088 Ga0373937_0564071 3300036401 Bacteria 1081
1089 Ga0373925_0000243 3300037068 Bacteria 57761
1090 Ga0373925_0003398 3300037068 Bacteria 12340
1091 Ga0373925_0005997 3300037068 Bacteria 9001
1092 Ga0373925_0016103 3300037068 Bacteria 5414
1093 Ga0373925_0021763 3300037068 Bacteria 4674
1094 Ga0373925_0081225 3300037068 Bacteria 2465
1095 Ga0373925_0161969 3300037068 Bacteria 1762
1096 Ga0373925_0221335 3300037068 Bacteria 1511
1097 Ga0373925_0274890 3300037068 Bacteria 1356
1098 Ga0373925_0279246 3300037068 Bacteria 1345
1099 Ga0373925_0520634 3300037068 Unclassified 977
1100 Ga0395898_0182252 3300037466 Bacteria 2007
1101 Ga0395898_0570543 3300037466 Bacteria 1074
1102 Ga0395905_0147920 3300037471 Bacteria 2210
1103 Ga0395905_0190557 3300037471 Unclassified 1923
1104 Ga0395905_0218816 3300037471 Bacteria 1783
1105 Ga0395905_0599568 3300037471 Bacteria 1003
1106 Ga0436364_0606406 3300037853 Unclassified 1196
1107 Ga0436365_1592604 3300039437 Unclassified 2606
1108 Ga0436365_1640734 3300039437 Bacteria 1406
1109 Ga0436360_1156664 3300039438 Unclassified 1061
1110 Ga0436363_0154653 3300039450 Bacteria 2053
1111 Ga0436363_0313774 3300039450 Bacteria 3723
1112 Ga0436363_0350881 3300039450 Unclassified 3785
1113 Ga0436363_0523760 3300039450 Bacteria 2459
1114 Ga0436363_0779725 3300039450 Unclassified 1461
1115 Ga0451577_0000760 3300042876 Bacteria 49191
1116 Ga0451577_0421755 3300042876 Bacteria 1212
1117 Ga0453683_0076861 3300044673 Unclassified 2091
1118 Ga0466965_0060932 3300044683 Unclassified 1886
1119 Ga0466966_0333952 3300044684 Bacteria 911
1120 Ga0466961_0089571 3300044693 Bacteria 1943
1121 Ga0466963_0004868 3300044694 Bacteria 7824
1122 Ga0466963_0027676 3300044694 Unclassified 3633
1123 Ga0466963_0054618 3300044694 Bacteria 2655
1124 Ga0466964_0100453 3300044706 Unclassified 1275
1125 Ga0466964_0246825 3300044706 Bacteria 878
1126 Ga0466964_0360755 3300044706 Unclassified 749
1127 Ga0453684_0000104 3300044712 Bacteria 365431
1128 Ga0453684_0778348 3300044712 Bacteria 1034
1129 Ga0466957_0000162 3300044842 Bacteria 29438
1130 Ga0466957_0065767 3300044842 Bacteria 2234
1131 Ga0466959_0004700 3300045049 Bacteria 9197
1132 Ga0466959_0363592 3300045049 Unclassified 986
1133 Ga0466959_0367344 3300045049 Bacteria 980
1134 Ga0451576_0014185 3300045051 Bacteria 8879
1135 Ga0451576_0014296 3300045051 Bacteria 8838
1136 Ga0451576_0153169 3300045051 Bacteria 2404
1137 Ga0466958_0033599 3300045836 Unclassified 3057
1138 Ga0466967_0002458 3300045976 Bacteria 11542
1139 Ga0466967_0021392 3300045976 Bacteria 5252
1140 Ga0466967_0076966 3300045976 Bacteria 3002
1141 Ga0466967_0140538 3300045976 Bacteria 2249
1142 Ga0466967_0150081 3300045976 Bacteria 2177
1143 Ga0466967_0332198 3300045976 Bacteria 1468
1144 Ga0466967_0394082 3300045976 Unclassified 1346
1145 Ga0466967_0727684 3300045976 Unclassified 983
1146 Ga0495603_0128482 3300046455 Unclassified 1476
1147 Ga0495629_0401346 3300046459 Unclassified 932
1148 Ga0495651_0156573 3300046462 Bacteria 1637
1149 Ga0495580_0000207 3300046472 Bacteria 45349
1150 Ga0495580_0000954 3300046472 Bacteria 25313
1151 Ga0495580_0001003 3300046472 Bacteria 24839
1152 Ga0495580_0010373 3300046472 Bacteria 7262
1153 Ga0495580_0010808 3300046472 Bacteria 7088
1154 Ga0495580_0020655 3300046472 Bacteria 4871
1155 Ga0495580_0028373 3300046472 Unclassified 4068
1156 Ga0495580_0070919 3300046472 Bacteria 2434
1157 Ga0495580_0113663 3300046472 Bacteria 1881
1158 Ga0495580_0120103 3300046472 Bacteria 1825
1159 Ga0495580_0148301 3300046472 Bacteria 1625
1160 Ga0495580_0155658 3300046472 Bacteria 1582
1161 Ga0495580_0168194 3300046472 Bacteria 1516
1162 Ga0495580_0195544 3300046472 Bacteria 1394
1163 Ga0495582_0001085 3300046473 Bacteria 15269
1164 Ga0495582_0022396 3300046473 Unclassified 3457
1165 Ga0495582_0099848 3300046473 Bacteria 1624
1166 Ga0495605_0132789 3300046474 Bacteria 1122
1167 Ga0495664_0245093 3300046477 Bacteria 1084
1168 Ga0495664_0252096 3300046477 Unclassified 1067
1169 Ga0495594_0025512 3300046499 Bacteria 3177
1170 Ga0495594_0055427 3300046499 Bacteria 2186
1171 Ga0495628_0303561 3300046516 Bacteria 1181
1172 Ga0495628_0386846 3300046516 Unclassified 1024
1173 Ga0495628_0480871 3300046516 Bacteria 899
1174 Ga0495630_0058826 3300046517 Bacteria 2882
1175 Ga0495630_0142593 3300046517 Bacteria 1822
1176 Ga0495630_0183514 3300046517 Bacteria 1596
1177 Ga0495666_0031598 3300046526 Bacteria 2594
1178 Ga0495665_0006832 3300046531 Bacteria 6155
1179 Ga0495665_0042263 3300046531 Bacteria 2426
1180 Ga0495665_0161590 3300046531 Bacteria 1167
1181 Ga0495586_0116406 3300046535 Unclassified 1491
1182 Ga0495645_0308814 3300046543 Unclassified 1031
1183 Ga0495667_0051260 3300046559 Bacteria 2723
1184 Ga0495667_0389623 3300046559 Unclassified 878
1185 Ga0495635_0145610 3300046663 Bacteria 1613
1186 Ga0495659_0026242 3300046664 Unclassified 2001
1187 Ga0495588_0136351 3300046674 Bacteria 1296
1188 Ga0495657_0094763 3300046675 Bacteria 1909
1189 Ga0495657_0405974 3300046675 Bacteria 801
1190 Ga0495623_0083996 3300046679 Bacteria 1966
1191 Ga0495623_0177865 3300046679 Bacteria 1238
1192 Ga0495646_0328929 3300046680 Bacteria 804
1193 Ga0495647_0187162 3300046681 Bacteria 903
1194 Ga0495658_0013868 3300046683 Bacteria 4108
1195 Ga0495658_0270365 3300046683 Bacteria 1071
1196 Ga0495669_0009520 3300046684 Bacteria 4099
1197 Ga0495669_0307451 3300046684 Bacteria 765
1198 Ga0495624_0132825 3300046690 Bacteria 1526
1199 Ga0495581_0169730 3300047315 Bacteria 1276
1200 Ga0495581_0473133 3300047315 Unclassified 729
1201 Ga0495604_0115648 3300047317 Bacteria 1949
1202 Ga0495604_0141991 3300047317 Unclassified 1715
1203 Ga0495604_0514267 3300047317 Unclassified 775
1204 Ga0495674_0010677 3300047319 Bacteria 8691
1205 Ga0495674_0012983 3300047319 Bacteria 7841
1206 Ga0495674_0189938 3300047319 Unclassified 1708
1207 Ga0495674_0230976 3300047319 Unclassified 1527
1208 Ga0495674_0785433 3300047319 Unclassified 742
1209 Ga0495684_0134004 3300047471 Bacteria 1859
1210 Ga0495684_0264760 3300047471 Bacteria 1246
1211 Ga0495593_0121341 3300047673 Bacteria 1330
1212 Ga0495602_0042046 3300048088 Unclassified 4167
1213 Ga0495602_0063358 3300048088 Unclassified 3204
1214 Ga0495602_0173348 3300048088 Bacteria 1672
1215 Ga0496100_0041074 3300048903 Unclassified 2946
1216 Ga0496100_0079201 3300048903 Bacteria 2213
1217 Ga0496100_0244587 3300048903 Bacteria 1325
1218 Ga0496101_0050583 3300048904 Bacteria 2992
1219 Ga0496101_0180335 3300048904 Bacteria 1626
1220 Ga0496102_0002115 3300048905 Bacteria 17082
1221 Ga0496102_0028941 3300048905 Bacteria 4952
1222 Ga0496102_0032555 3300048905 Bacteria 4683
1223 Ga0496102_0063173 3300048905 Unclassified 3390
1224 Ga0496102_0085192 3300048905 Bacteria 2917
1225 Ga0496102_0114753 3300048905 Unclassified 2513
1226 Ga0496102_0151951 3300048905 Unclassified 2176
1227 Ga0496102_0235804 3300048905 Bacteria 1725
1228 Ga0496102_0419890 3300048905 Bacteria 1256
1229 Ga0496102_1009024 3300048905 Unclassified 753
1230 Ga0496103_0007300 3300048906 Bacteria 6585
1231 Ga0496103_0098360 3300048906 Bacteria 1850
1232 Ga0496103_0168476 3300048906 Unclassified 1406
1233 Ga0496103_0284010 3300048906 Bacteria 1064
1234 Ga0496103_0316981 3300048906 Bacteria 1003
1235 Ga0496104_0027435 3300048907 Bacteria 5270
1236 Ga0496104_0030003 3300048907 Bacteria 5050
1237 Ga0496104_0040711 3300048907 Bacteria 4356
1238 Ga0496104_0067886 3300048907 Unclassified 3388
1239 Ga0496104_0082469 3300048907 Bacteria 3066
1240 Ga0496104_0086428 3300048907 Bacteria 2994
1241 Ga0496104_0149125 3300048907 Bacteria 2246
1242 Ga0496104_0153281 3300048907 Bacteria 2212
1243 Ga0496104_0153503 3300048907 Bacteria 2210
1244 Ga0496104_0155909 3300048907 Bacteria 2191
1245 Ga0496104_0186622 3300048907 Bacteria 1984
1246 Ga0496104_0314397 3300048907 Bacteria 1479
1247 Ga0496104_0465399 3300048907 Bacteria 1176
1248 Ga0496104_0660524 3300048907 Unclassified 954
1249 Ga0496104_0845381 3300048907 Unclassified 821
1250 Ga0496105_0067370 3300048908 Bacteria 2956
1251 Ga0496105_0073573 3300048908 Bacteria 2823
1252 Ga0496105_0076554 3300048908 Bacteria 2763
1253 Ga0496105_0106282 3300048908 Unclassified 2317
1254 Ga0496105_0236303 3300048908 Unclassified 1484
1255 Ga0496105_0302622 3300048908 Unclassified 1285
1256 Ga0496106_0099506 3300048909 Bacteria 2254
1257 Ga0496106_0118995 3300048909 Unclassified 2063
1258 Ga0496106_0428852 3300048909 Bacteria 1062
1259 Ga0496106_0434793 3300048909 Bacteria 1054
1260 Ga0496107_0033870 3300048910 Bacteria 3656
1261 Ga0496107_0171219 3300048910 Bacteria 1611
1262 Ga0496107_0193790 3300048910 Bacteria 1510
1263 Ga0496107_0350120 3300048910 Bacteria 1099
1264 Ga0496107_0416370 3300048910 Unclassified 999
1265 Ga0496108_0000444 3300048911 Bacteria 33175
1266 Ga0496108_0242908 3300048911 Bacteria 1566
1267 Ga0496108_0356470 3300048911 Bacteria 1276
1268 Ga0496109_0002079 3300048912 Bacteria 16632
1269 Ga0496109_0077503 3300048912 Unclassified 3059
1270 Ga0496109_0121542 3300048912 Bacteria 2433
1271 Ga0496109_0244716 3300048912 Bacteria 1688
1272 Ga0496109_0796650 3300048912 Unclassified 883
1273 Ga0496110_0009263 3300048913 Bacteria 7960
1274 Ga0496110_0010922 3300048913 Bacteria 7406
1275 Ga0496110_0012463 3300048913 Bacteria 6993
1276 Ga0496110_0055531 3300048913 Unclassified 3485
1277 Ga0496110_0920820 3300048913 Unclassified 780
1278 Ga0496111_0003547 3300048914 Bacteria 9660
1279 Ga0496111_0004197 3300048914 Bacteria 9069
1280 Ga0496111_0005860 3300048914 Bacteria 7924
1281 Ga0496111_0085473 3300048914 Bacteria 2307
1282 Ga0496112_0000060 3300048915 Bacteria 74795
1283 Ga0496112_0001326 3300048915 Bacteria 18793
1284 Ga0496112_0001636 3300048915 Bacteria 17362
1285 Ga0496112_0008785 3300048915 Bacteria 9067
1286 Ga0496112_0016574 3300048915 Bacteria 6909
1287 Ga0496112_0023715 3300048915 Bacteria 5869
1288 Ga0496112_0028527 3300048915 Bacteria 5388
1289 Ga0496112_0076772 3300048915 Unclassified 3304
1290 Ga0496112_0097306 3300048915 Bacteria 2913
1291 Ga0496112_0097765 3300048915 Bacteria 2906
1292 Ga0496112_0146479 3300048915 Bacteria 2330
1293 Ga0496112_0220059 3300048915 Bacteria 1855
1294 Ga0496112_0280261 3300048915 Bacteria 1614
1295 Ga0496112_0610930 3300048915 Unclassified 1022
1296 Ga0496112_0770343 3300048915 Unclassified 888
1297 Ga0496113_0002406 3300048916 Bacteria 10874
1298 Ga0496113_0019372 3300048916 Bacteria 4758
1299 Ga0496113_0043393 3300048916 Bacteria 3328
1300 Ga0496113_0074664 3300048916 Bacteria 2585
1301 Ga0496113_0326035 3300048916 Unclassified 1231
1302 Ga0496114_0125800 3300048917 Bacteria 2210
1303 Ga0496114_0143712 3300048917 Bacteria 2067
1304 Ga0496115_0006392 3300048918 Bacteria 8636
1305 Ga0496115_0009148 3300048918 Bacteria 7353
1306 Ga0496115_0525485 3300048918 Bacteria 948
1307 Ga0496115_0699200 3300048918 Unclassified 797
1308 Ga0501298_011412 3300049521 Unclassified 1543
1309 Ga0501299_012498 3300049522 Unclassified 1450
1310 Ga0501069_0271838 3300049585 Unclassified 991
1311 Ga0501073_0086975 3300049589 Bacteria 2174
1312 Ga0501216_028329 3300049660 Unclassified 1021
1313 Ga0501217_069987 3300049661 Unclassified 953
1314 Ga0501257_020950 3300049686 Unclassified 1539
1315 Ga0501257_056031 3300049686 Unclassified 990
1316 Ga0501225_0051551 3300049705 Bacteria 1146
1317 Ga0501272_015452 3300049769 Unclassified 889
1318 nmdc:mga08y16_658830_c1 3300050511 Bacteria 1050
1319 nmdc:mga0n895_110774_c1 3300050512 Unclassified 2761
1320 nmdc:mga0n895_152296_c1 3300050512 Bacteria 2343
1321 nmdc:mga0n895_423218_c1 3300050512 Bacteria 1346
1322 nmdc:mga0n895_560_c1 3300050512 Bacteria 25527
1323 nmdc:mga0n895_73080_c1 3300050512 Bacteria 3404
1324 nmdc:mga0rr50_207971_c1 3300050513 Unclassified 1611
1325 nmdc:mga0rr50_20917_c1 3300050513 Bacteria 4456
1326 nmdc:mga0rr50_417396_c1 3300050513 Unclassified 1135
1327 nmdc:mga0rr50_4515_c1 3300050513 Bacteria 8196
1328 nmdc:mga0rr50_843333_c1 3300050513 Unclassified 782
1329 nmdc:mga08x19_122466_c1 3300050514 Unclassified 1744
1330 nmdc:mga08x19_13875_c1 3300050514 Bacteria 4880
1331 nmdc:mga08x19_4249_c1 3300050514 Bacteria 8489
1332 nmdc:mga08x19_57371_c1 3300050514 Unclassified 2516
1333 nmdc:mga08x19_5779_c1 3300050514 Bacteria 7311
1334 nmdc:mga0a205_21929_c1 3300050515 Bacteria 6041
1335 nmdc:mga0a205_808600_c1 3300050515 Unclassified 785
1336 Ga0495601_0039537 3300053077 Bacteria 2954
1337 Ga0495601_0089406 3300053077 Unclassified 1980
1338 Ga0495612_0170469 3300053078 Bacteria 953
1339 Ga0495619_0236592 3300053085 Bacteria 1265
1340 Ga0501084_0659959 3300054114 Unclassified 883
1341 Ga0587073_0043795 3300059492 Unclassified 987
1342 Ga0587077_056091 3300059493 Unclassified 840
1343 Ga0587067_011688 3300059640 Bacteria 1357
1344 Ga0587079_017890 3300059647 Bacteria 1236
1345 Ga0587079_075628 3300059647 Unclassified 760
1346 Ga0587071_024732 3300060344 Unclassified 1123
1347 Ga0466962_0163198 3300061719 Unclassified 1083
1348 Ga0496104_0178602
1349 MRS1b_contig_8406324
1350 MBSR1b_contig_8347319
1351 MBSR1b_contig_9753513
1352 LJNas_1000269
1353 JGI24752J21851_1001182
1354 JGI24034J26672_10000325
1355 JGI24751J29686_10001201
1356 Ga0058863_11372885
1357 Ga0058861_10063214
1358 Ga0058861_11314449
1359 Ga0058862_12094930
1360 Ga0058862_12654815
1361 Ga0065712_10003687
1362 Ga0065712_10110694
1363 Ga0065712_10136907
1364 Ga0065715_10124725
1365 Ga0065715_10175677
1366 Ga0065707_10233012
1367 Ga0070658_10054106
1368 Ga0070658_10402397
1369 Ga0070676_10013388
1370 Ga0070676_10013895
1371 Ga0070683_100015072
1372 Ga0070683_100018817
1373 Ga0070683_100020038
1374 Ga0070683_100133144
1375 Ga0070683_100224105
1376 Ga0070683_100561238
1377 Ga0070683_100607026
1378 Ga0070690_100006967
1379 Ga0070690_100010719
1380 Ga0070670_100017644
1381 Ga0070670_100052679
1382 Ga0068869_100000365
1383 Ga0068869_100004818
1384 Ga0068869_100021779
1385 Ga0068869_100025160
1386 Ga0070666_10002671
1387 Ga0070680_100009284
1388 Ga0070680_100079684
1389 Ga0070680_100095633
1390 Ga0070680_100137886
1391 Ga0070680_100157759
1392 Ga0070680_100290587
1393 Ga0070680_100357712
1394 Ga0070682_100006008
1395 Ga0070682_100094191
1396 Ga0068868_100003230
1397 Ga0068868_100016148
1398 Ga0068868_100041316
1399 Ga0068868_100079865
1400 Ga0068868_100091928
1401 Ga0068868_100112431
1402 Ga0068868_100119023
1403 Ga0068868_100467557
1404 Ga0068868_100502168
1405 Ga0068868_100974054
1406 Ga0070660_100022195
1407 Ga0070660_100108602
1408 Ga0070660_100206925
1409 Ga0070660_100381384
1410 Ga0070689_100050786
1411 Ga0070689_100216712
1412 Ga0070687_100060743
1413 Ga0070687_100066136
1414 Ga0070687_100383764
1415 Ga0070661_100003055
1416 Ga0070661_100009617
1417 Ga0070661_100014979
1418 Ga0070661_100041762
1419 Ga0070661_100174851
1420 Ga0070692_10060948
1421 Ga0070668_100044360
1422 Ga0070668_100066847
1423 Ga0070668_100677355
1424 Ga0070669_100023832
1425 Ga0070669_100503023
1426 Ga0070675_100140797
1427 Ga0070675_100197438
1428 Ga0070675_100514747
1429 Ga0070671_100031332
1430 Ga0070671_100062531
1431 Ga0070671_100091869
1432 Ga0070671_100386785
1433 Ga0070674_100575452
1434 Ga0070673_100001773
1435 Ga0070673_100025530
1436 Ga0070673_100735921
1437 Ga0070688_100002766
1438 Ga0070688_100591941
1439 Ga0070659_100009058
1440 Ga0070659_100020284
1441 Ga0070659_100181349
1442 Ga0070667_100045480
1443 Ga0070667_100115683
1444 Ga0070667_100688413
1445 Ga0070709_10013312
1446 Ga0070709_10019620
1447 Ga0070709_10024439
1448 Ga0070709_10027155
1449 Ga0070709_10039113
1450 Ga0070709_10042655
1451 Ga0070709_10068926
1452 Ga0070709_10104420
1453 Ga0070709_10265257
1454 Ga0070709_10303588
1455 Ga0070714_100007036
1456 Ga0070714_100008700
1457 Ga0070714_100025376
1458 Ga0070714_100044925
1459 Ga0070714_100086557
1460 Ga0070714_100107597
1461 Ga0070714_100139303
1462 Ga0070714_100285524
1463 Ga0070714_100439135
1464 Ga0070714_100636494
1465 Ga0070713_100000073
1466 Ga0070713_100000940
1467 Ga0070713_100005524
1468 Ga0070713_100013005
1469 Ga0070713_100018529
1470 Ga0070713_100049171
1471 Ga0070713_100055645
1472 Ga0070713_100057729
1473 Ga0070713_100061416
1474 Ga0070713_100070094
1475 Ga0070713_100093717
1476 Ga0070713_100143054
1477 Ga0070713_100182969
1478 Ga0070713_100185830
1479 Ga0070713_100429813
1480 Ga0070713_100584912
1481 Ga0070713_100662733
1482 Ga0070713_100731779
1483 Ga0070713_100836640
1484 Ga0070710_10009992
1485 Ga0070710_10014746
1486 Ga0070710_10024508
1487 Ga0070710_10041647
1488 Ga0070710_10125030
1489 Ga0070710_10128501
1490 Ga0070710_10131999
1491 Ga0070710_10140541
1492 Ga0070710_10162049
1493 Ga0070701_10363946
1494 Ga0070701_10528403
1495 Ga0070711_100000360
1496 Ga0070711_100001169
1497 Ga0070711_100001873
1498 Ga0070711_100012010
1499 Ga0070711_100066853
1500 Ga0070711_100080156
1501 Ga0070711_100149158
1502 Ga0070711_100184980
1503 Ga0070694_100476679
1504 Ga0070708_100000470
1505 Ga0070708_100001120
1506 Ga0070708_100002203
1507 Ga0070708_100003678
1508 Ga0070708_100008454
1509 Ga0070708_100008675
1510 Ga0070708_100010894
1511 Ga0070708_100016315
1512 Ga0070708_100022619
1513 Ga0070708_100032064
1514 Ga0070708_100076096
1515 Ga0070708_100502630
1516 Ga0070708_100631343
1517 Ga0070663_100001680
1518 Ga0070663_100077313
1519 Ga0070678_100082081
1520 Ga0070678_100743413
1521 Ga0070662_100007994
1522 Ga0070662_100098792
1523 Ga0070681_10001396
1524 Ga0070681_10013650
1525 Ga0070681_10036782
1526 Ga0070681_10045099
1527 Ga0070681_10045120
1528 Ga0070681_10046045
1529 Ga0070681_10064230
1530 Ga0070681_10081283
1531 Ga0070681_10267962
1532 Ga0070681_10277058
1533 Ga0070681_10392102
1534 Ga0070681_10438884
1535 Ga0068867_100048374
1536 Ga0068867_100067550
1537 Ga0068867_100270608
1538 Ga0068867_100332474
1539 Ga0068867_100768046
1540 Ga0070685_10009024
1541 Ga0070685_10031814
1542 Ga0070706_100001230
1543 Ga0070706_100002235
1544 Ga0070706_100013159
1545 Ga0070706_100031003
1546 Ga0070706_100055058
1547 Ga0070706_100076896
1548 Ga0070706_100119389
1549 Ga0070706_100245804
1550 Ga0070707_100001129
1551 Ga0070707_100006316
1552 Ga0070707_100010562
1553 Ga0070707_100038485
1554 Ga0070707_100098690
1555 Ga0070707_100164833
1556 Ga0070707_100572485
1557 Ga0070698_100001238
1558 Ga0070698_100021223
1559 Ga0070698_100102352
1560 Ga0070698_100897305
1561 Ga0070699_100001045
1562 Ga0070699_100001170
1563 Ga0070699_100013583
1564 Ga0070699_100036584
1565 Ga0070699_100307141
1566 Ga0070699_100375577
1567 Ga0070679_100018579
1568 Ga0070679_100028624
1569 Ga0070679_100041563
1570 Ga0070679_100136812
1571 Ga0070679_100147055
1572 Ga0070679_100168909
1573 Ga0070679_100178045
1574 Ga0070679_100230747
1575 Ga0070679_100281263
1576 Ga0070684_100006676
1577 Ga0070684_100067165
1578 Ga0070684_100106741
1579 Ga0070684_100119146
1580 Ga0070684_100121214
1581 Ga0070697_100000092
1582 Ga0070697_100000390
1583 Ga0070697_100000630
1584 Ga0070697_100007135
1585 Ga0070697_100007394
1586 Ga0070697_100010927
1587 Ga0070697_100014170
1588 Ga0070697_100080714
1589 Ga0070697_100083676
1590 Ga0070697_100181013
1591 Ga0068853_100008057
1592 Ga0068853_100014016
1593 Ga0068853_100029102
1594 Ga0068853_100114017
1595 Ga0068853_100126603
1596 Ga0068853_100380501
1597 Ga0070672_100006933
1598 Ga0070686_100004713
1599 Ga0070686_100064105
1600 Ga0070695_100026588
1601 Ga0070695_100161742
1602 Ga0070695_100285990
1603 Ga0070696_100034110
1604 Ga0070696_100215466
1605 Ga0070693_100015053
1606 Ga0070693_100028622
1607 Ga0070693_100051056
1608 Ga0070693_100187278
1609 Ga0070693_100282128
1610 Ga0070693_100488828
1611 Ga0070665_100100285
1612 Ga0070665_100255993
1613 Ga0068855_100001369
1614 Ga0068855_100006853
1615 Ga0068855_100011661
1616 Ga0068855_100058682
1617 Ga0068855_100077403
1618 Ga0068855_100088073
1619 Ga0068855_100162121
1620 Ga0068855_100344840
1621 Ga0068855_100560888
1622 Ga0068855_100575122
1623 Ga0068855_100575951
1624 Ga0070664_100000897
1625 Ga0070664_100002745
1626 Ga0070664_100116325
1627 Ga0070664_100582324
1628 Ga0068857_100003643
1629 Ga0068857_100036791
1630 Ga0068857_100042798
1631 Ga0068857_100043637
1632 Ga0068857_100055135
1633 Ga0068857_100704569
1634 Ga0068857_100753642
1635 Ga0068854_100001461
1636 Ga0068854_100008594
1637 Ga0068854_100052238
1638 Ga0068854_100081104
1639 Ga0068854_100178857
1640 Ga0068854_100671478
1641 Ga0068856_100000995
1642 Ga0068856_100007891
1643 Ga0068856_100009877
1644 Ga0068856_100035248
1645 Ga0068856_100053539
1646 Ga0068856_100057899
1647 Ga0068856_100082778
1648 Ga0068856_100168296
1649 Ga0068856_100175193
1650 Ga0068856_100295483
1651 Ga0068856_100301052
1652 Ga0070702_100061318
1653 Ga0070702_100418593
1654 Ga0068852_100004238
1655 Ga0068852_100018595
1656 Ga0068852_100047161
1657 Ga0068852_100166064
1658 Ga0068852_100307286
1659 Ga0068852_100561500
1660 Ga0068852_100687056
1661 Ga0068852_101052688
1662 Ga0068852_101353859
1663 Ga0068859_100020260
1664 Ga0068859_100076021
1665 Ga0068859_100091071
1666 Ga0068864_100003006
1667 Ga0068864_100021497
1668 Ga0068864_100030698
1669 Ga0068864_100062311
1670 Ga0068864_100259322
1671 Ga0068866_10005181
1672 Ga0068866_10018825
1673 Ga0068866_10193835
1674 Ga0068866_10208038
1675 Ga0068861_100012876
1676 Ga0068861_100080151
1677 Ga0068861_100087408
1678 Ga0068851_10008910
1679 Ga0068851_10013151
1680 Ga0068851_10029239
1681 Ga0068851_10282003
1682 Ga0068870_10002902
1683 Ga0068870_10085367
1684 Ga0068863_100001977
1685 Ga0068863_100071658
1686 Ga0068863_100079746
1687 Ga0068863_100110800
1688 Ga0068863_100125098
1689 Ga0068863_100275007
1690 Ga0068858_100000404
1691 Ga0068858_100001080
1692 Ga0068858_100038173
1693 Ga0068858_100062953
1694 Ga0068858_100062973
1695 Ga0068858_100081667
1696 Ga0068858_100627525
1697 Ga0068860_100010559
1698 Ga0068860_100061035
1699 Ga0068860_100061841
1700 Ga0068860_100071618
1701 Ga0068860_100184530
1702 Ga0068860_100315994
1703 Ga0068862_100005387
1704 Ga0068862_100018991
1705 Ga0068862_100150532
1706 Ga0068862_100162770
1707 Ga0081540_1074881
1708 Ga0070717_10001111
1709 Ga0070717_10004965
1710 Ga0070717_10005101
1711 Ga0070717_10006905
1712 Ga0070717_10008773
1713 Ga0070717_10025076
1714 Ga0070717_10027759
1715 Ga0070717_10049947
1716 Ga0070717_10084239
1717 Ga0070717_10092273
1718 Ga0070717_10122352
1719 Ga0070717_10159457
1720 Ga0070717_10187485
1721 Ga0070717_10190248
1722 Ga0070717_10483566
1723 Ga0070717_10652242
1724 Ga0070717_10958687
1725 Ga0070715_10036619
1726 Ga0070715_10061081
1727 Ga0070715_10237498
1728 Ga0070716_100000245
1729 Ga0070716_100001067
1730 Ga0070716_100003370
1731 Ga0070716_100009779
1732 Ga0070716_100024382
1733 Ga0070716_100025014
1734 Ga0070716_100036148
1735 Ga0070716_100077776
1736 Ga0070716_100082166
1737 Ga0070716_100106187
1738 Ga0070716_100120781
1739 Ga0070716_100387439
1740 Ga0070716_100402603
1741 Ga0070716_100670127
1742 Ga0070712_100000137
1743 Ga0070712_100000160
1744 Ga0070712_100003932
1745 Ga0070712_100006526
1746 Ga0070712_100025987
1747 Ga0070712_100069905
1748 Ga0070712_100098125
1749 Ga0070712_100162254
1750 Ga0070712_100235704
1751 Ga0070712_100438380
1752 Ga0097621_100000866
1753 Ga0097621_100008142
1754 Ga0097621_100012133
1755 Ga0097621_100110307
1756 Ga0097621_100120754
1757 Ga0097621_100176521
1758 Ga0097621_100385304
1759 Ga0097621_100482653
1760 Ga0068871_100000389
1761 Ga0068871_100004381
1762 Ga0068871_100013588
1763 Ga0068871_100020430
1764 Ga0068871_100061823
1765 Ga0068871_100233209
1766 Ga0068871_100233603
1767 Ga0068871_100347086
1768 Ga0068871_100624214
1769 Ga0075433_10025998
1770 Ga0075434_100025649
1771 Ga0075434_100043722
1772 Ga0068865_100038271
1773 Ga0068865_100057745
1774 Ga0068865_100437395
1775 Ga0075436_100000617
1776 Ga0075436_100005379
1777 Ga0075436_100008224
1778 Ga0075436_100071120
1779 Ga0075436_100100756
1780 Ga0075436_100136394
1781 Ga0075436_100343536
1782 Ga0097620_100020260
1783 Ga0097620_100076013
1784 Ga0097620_100091067
1785 Ga0075435_100006248
1786 Ga0075435_100015023
1787 Ga0075435_100018883
1788 Ga0075435_100106884
1789 Ga0075435_100695746
1790 Ga0099794_10040998
1791 Ga0099795_10018617
1792 Ga0105240_10012373
1793 Ga0105240_10016937
1794 Ga0105240_10048990
1795 Ga0105240_10057299
1796 Ga0105240_10059796
1797 Ga0105240_10155789
1798 Ga0105240_10178379
1799 Ga0105240_10300769
1800 Ga0105240_10323692
1801 Ga0105240_10423596
1802 Ga0111539_10251988
1803 Ga0105245_10002517
1804 Ga0105245_10005508
1805 Ga0105245_10005571
1806 Ga0105245_10079867
1807 Ga0105245_10204433
1808 Ga0105245_10259778
1809 Ga0105245_10474573
1810 Ga0105247_10002780
1811 Ga0105247_10013406
1812 Ga0105247_10049016
1813 Ga0105247_10263774
1814 Ga0105247_10474945
1815 Ga0105243_10116675
1816 Ga0105241_10015361
1817 Ga0105241_10027756
1818 Ga0105241_10035343
1819 Ga0105241_10036363
1820 Ga0105241_10118815
1821 Ga0105241_10197038
1822 Ga0105241_10233179
1823 Ga0105241_10251502
1824 Ga0105241_10361556
1825 Ga0105241_10472177
1826 Ga0105242_10003041
1827 Ga0105242_10019959
1828 Ga0105242_10062961
1829 Ga0105242_10248530
1830 Ga0105242_10253551
1831 Ga0105248_10037033
1832 Ga0105248_10047910
1833 Ga0105248_10061302
1834 Ga0105248_10140590
1835 Ga0105248_10248648
1836 Ga0105248_10258611
1837 Ga0105248_10334378
1838 Ga0105248_10336215
1839 Ga0105237_10153239
1840 Ga0105237_10221497
1841 Ga0105237_10280979
1842 Ga0105237_10299139
1843 Ga0105237_10380467
1844 Ga0105237_10523413
1845 Ga0105237_10597693
1846 Ga0105238_10000214
1847 Ga0105238_10015383
1848 Ga0105238_10064054
1849 Ga0105238_10099757
1850 Ga0105238_10110643
1851 Ga0105238_10250616
1852 Ga0105238_10811014
1853 Ga0105249_10002544
1854 Ga0105249_10003055
1855 Ga0105249_10508169
1856 Ga0105249_11392457
1857 Ga0099796_10009269
1858 Ga0099796_10018605
1859 Ga0099796_10149114
1860 Ga0105239_10005155
1861 Ga0105239_10009279
1862 Ga0105239_10031699
1863 Ga0105239_10122752
1864 Ga0105239_10160101
1865 Ga0105239_10225318
1866 Ga0105239_10241550
1867 Ga0105239_10429208
1868 Ga0105246_10002563
1869 Ga0105246_10057806
1870 Ga0105246_10152473
1871 Ga0105246_10402909
1872 Ga0157373_10021339
1873 Ga0157373_10046278
1874 Ga0157373_10068830
1875 Ga0157373_10087635
1876 Ga0157373_10102141
1877 Ga0157373_10156450
1878 Ga0157371_10006751
1879 Ga0157371_10019416
1880 Ga0157371_10082689
1881 Ga0157371_10120725
1882 Ga0157370_10093091
1883 Ga0157370_10249512
1884 Ga0157369_10001356
1885 Ga0157369_10001450
1886 Ga0157369_10024189
1887 Ga0157369_10030481
1888 Ga0157369_10040105
1889 Ga0157369_10073618
1890 Ga0157369_10138669
1891 Ga0157369_10219666
1892 Ga0157369_10220534
1893 Ga0157369_11181304
1894 Ga0157374_10000634
1895 Ga0157374_10000933
1896 Ga0157374_10012477
1897 Ga0157374_10014623
1898 Ga0157374_10021322
1899 Ga0157374_10063078
1900 Ga0157374_10090020
1901 Ga0157374_10323651
1902 Ga0157374_10783876
1903 Ga0157378_10000202
1904 Ga0157378_10000725
1905 Ga0157378_10001987
1906 Ga0157378_10011031
1907 Ga0157378_10015615
1908 Ga0157378_10024355
1909 Ga0157378_10026606
1910 Ga0157378_10095627
1911 Ga0157378_10241690
1912 Ga0157378_10287912
1913 Ga0163162_10012550
1914 Ga0163162_10019094
1915 Ga0163162_10043772
1916 Ga0163162_10093677
1917 Ga0163162_10176548
1918 Ga0163162_10645872
1919 Ga0157372_10001366
1920 Ga0157372_10001445
1921 Ga0157372_10004384
1922 Ga0157372_10017432
1923 Ga0157372_10033801
1924 Ga0157372_10047456
1925 Ga0157372_10105423
1926 Ga0157372_10171357
1927 Ga0157372_10234647
1928 Ga0157372_10302565
1929 Ga0157372_10501345
1930 Ga0157372_10823502
1931 Ga0157372_10861820
1932 Ga0157375_10094229
1933 Ga0157375_10238673
1934 Ga0163163_10002855
1935 Ga0163163_10016774
1936 Ga0163163_10057910
1937 Ga0163163_10074503
1938 Ga0163163_10135298
1939 Ga0163163_10307810
1940 Ga0163163_10848926
1941 Ga0157380_10044873
1942 Ga0157380_10356561
1943 Ga0182008_10005873
1944 Ga0182008_10006717
1945 Ga0157377_10002769
1946 Ga0157377_10187647
1947 Ga0157379_10008575
1948 Ga0157379_10091518
1949 Ga0157379_10223549
1950 Ga0157379_10439714
1951 Ga0157379_10450281
1952 Ga0157376_10041763
1953 Ga0157376_10120230
1954 Ga0157376_10151535
1955 Ga0157376_10181851
1956 Ga0157376_10187991
1957 Ga0157376_10902401
1958 Ga0182007_10008222
1959 Ga0182007_10015579
1960 Ga0163161_10011329
1961 Ga0206355_1443854
1962 Ga0213874_10010643
1963 Ga0213874_10155955
1964 Ga0224712_10023051
1965 Ga0224570_100693
1966 Ga0224569_100208
1967 Ga0224571_100380
1968 Ga0224572_1008493
1969 Ga0224572_1011757
1970 Ga0228598_1000444
1971 Ga0228598_1001640
1972 Ga0228598_1009745
1973 Ga0228598_1043357
1974 Ga0207697_10005790
1975 Ga0207656_10004119
1976 Ga0207656_10025256
1977 Ga0207656_10053100
1978 Ga0207656_10127260
1979 Ga0207682_10000826
1980 Ga0207692_10002949
1981 Ga0207692_10008329
1982 Ga0207692_10043513
1983 Ga0207692_10057058
1984 Ga0207692_10058217
1985 Ga0207692_10085800
1986 Ga0207692_10092433
1987 Ga0207692_10156211
1988 Ga0207692_10211514
1989 Ga0207692_10366318
1990 Ga0207692_10378490
1991 Ga0207642_10036653
1992 Ga0207642_10085903
1993 Ga0207642_10118802
1994 Ga0207642_10158218
1995 Ga0207642_10192767
1996 Ga0207642_10241147
1997 Ga0207710_10005993
1998 Ga0207710_10090240
1999 Ga0207710_10137062
2000 Ga0207688_10022482
2001 Ga0207680_10045858
2002 Ga0207680_10170647
2003 Ga0207647_10016942
2004 Ga0207647_10033091
2005 Ga0207647_10040863
2006 Ga0207685_10012926
2007 Ga0207685_10041434
2008 Ga0207685_10111628
2009 Ga0207685_10281829
2010 Ga0207699_10000500
2011 Ga0207699_10004194
2012 Ga0207699_10018669
2013 Ga0207699_10046705
2014 Ga0207699_10054546
2015 Ga0207699_10088565
2016 Ga0207699_10107418
2017 Ga0207699_10114827
2018 Ga0207699_10116432
2019 Ga0207699_10139997
2020 Ga0207699_10141170
2021 Ga0207699_10153670
2022 Ga0207699_10154767
2023 Ga0207699_10184632
2024 Ga0207699_10264616
2025 Ga0207645_10000559
2026 Ga0207645_10004273
2027 Ga0207643_10001182
2028 Ga0207643_10166663
2029 Ga0207705_10307733
2030 Ga0207705_10617399
2031 Ga0207684_10000447
2032 Ga0207684_10003786
2033 Ga0207684_10029173
2034 Ga0207684_10049625
2035 Ga0207684_10051528
2036 Ga0207684_10080416
2037 Ga0207684_10092510
2038 Ga0207654_10025850
2039 Ga0207654_10031513
2040 Ga0207654_10095545
2041 Ga0207654_10342241
2042 Ga0207707_10007113
2043 Ga0207707_10007719
2044 Ga0207707_10024683
2045 Ga0207707_10036015
2046 Ga0207707_10057464
2047 Ga0207707_10066212
2048 Ga0207707_10156366
2049 Ga0207707_10234807
2050 Ga0207707_10297769
2051 Ga0207695_10016663
2052 Ga0207695_10021009
2053 Ga0207695_10041339
2054 Ga0207695_10049139
2055 Ga0207695_10102997
2056 Ga0207695_10121129
2057 Ga0207695_10124888
2058 Ga0207695_10154131
2059 Ga0207695_10205401
2060 Ga0207695_10247082
2061 Ga0207695_10711240
2062 Ga0207671_10078351
2063 Ga0207671_10089763
2064 Ga0207671_10127506
2065 Ga0207671_10567030
2066 Ga0207693_10000015
2067 Ga0207693_10000271
2068 Ga0207693_10000440
2069 Ga0207693_10004290
2070 Ga0207693_10024713
2071 Ga0207693_10038411
2072 Ga0207693_10115303
2073 Ga0207693_10155648
2074 Ga0207693_10155976
2075 Ga0207693_10400660
2076 Ga0207693_10412689
2077 Ga0207693_10413818
2078 Ga0207693_10583447
2079 Ga0207693_10702365
2080 Ga0207663_10001723
2081 Ga0207663_10006828
2082 Ga0207663_10009827
2083 Ga0207663_10075107
2084 Ga0207663_10170658
2085 Ga0207663_10187486
2086 Ga0207663_10301875
2087 Ga0207663_10307800
2088 Ga0207663_10324188
2089 Ga0207663_10377198
2090 Ga0207660_10015217
2091 Ga0207660_10064752
2092 Ga0207660_10086028
2093 Ga0207660_10090299
2094 Ga0207660_10200976
2095 Ga0207660_10451090
2096 Ga0207662_10002448
2097 Ga0207662_10014408
2098 Ga0207662_10127370
2099 Ga0207662_10242781
2100 Ga0207657_10000766
2101 Ga0207657_10001795
2102 Ga0207657_10003111
2103 Ga0207649_10000344
2104 Ga0207649_10025834
2105 Ga0207649_10065227
2106 Ga0207649_10086039
2107 Ga0207649_10387069
2108 Ga0207652_10030969
2109 Ga0207652_10032508
2110 Ga0207652_10062497
2111 Ga0207652_10116861
2112 Ga0207652_10132899
2113 Ga0207652_10445541
2114 Ga0207652_10466814
2115 Ga0207652_10546977
2116 Ga0207652_10626009
2117 Ga0207646_10000676
2118 Ga0207646_10000939
2119 Ga0207646_10067160
2120 Ga0207646_10106211
2121 Ga0207646_10231197
2122 Ga0207646_10556048
2123 Ga0207681_10015679
2124 Ga0207681_10368025
2125 Ga0207694_10002265
2126 Ga0207694_10162233
2127 Ga0207694_10170624
2128 Ga0207694_10202650
2129 Ga0207694_10582098
2130 Ga0207650_10000058
2131 Ga0207659_10046383
2132 Ga0207659_10425788
2133 Ga0207687_10031371
2134 Ga0207687_10050749
2135 Ga0207687_10126800
2136 Ga0207687_10130104
2137 Ga0207687_10156294
2138 Ga0207687_10207103
2139 Ga0207687_10920984
2140 Ga0207700_10000095
2141 Ga0207700_10000224
2142 Ga0207700_10011823
2143 Ga0207700_10032670
2144 Ga0207700_10049855
2145 Ga0207700_10056574
2146 Ga0207700_10072527
2147 Ga0207700_10110494
2148 Ga0207700_10142878
2149 Ga0207700_10169504
2150 Ga0207700_10177684
2151 Ga0207700_10200661
2152 Ga0207700_10615083
2153 Ga0207700_10855998
2154 Ga0207664_10000265
2155 Ga0207664_10013334
2156 Ga0207664_10023325
2157 Ga0207664_10035312
2158 Ga0207664_10096721
2159 Ga0207664_10127067
2160 Ga0207664_10149849
2161 Ga0207664_10279644
2162 Ga0207664_10279866
2163 Ga0207664_10458497
2164 Ga0207664_10572533
2165 Ga0207664_10877192
2166 Ga0207664_11037468
2167 Ga0207644_10053840
2168 Ga0207644_10139235
2169 Ga0207690_10045837
2170 Ga0207690_10146131
2171 Ga0207690_10217148
2172 Ga0207706_10000732
2173 Ga0207706_10000956
2174 Ga0207686_10037996
2175 Ga0207686_10086943
2176 Ga0207686_10097718
2177 Ga0207686_10306280
2178 Ga0207709_10145090
2179 Ga0207670_10004801
2180 Ga0207704_10030050
2181 Ga0207704_10040377
2182 Ga0207704_10402581
2183 Ga0207665_10000049
2184 Ga0207665_10001658
2185 Ga0207665_10004144
2186 Ga0207665_10006523
2187 Ga0207665_10014854
2188 Ga0207665_10021191
2189 Ga0207665_10063800
2190 Ga0207665_10067114
2191 Ga0207665_10086460
2192 Ga0207665_10091299
2193 Ga0207665_10121606
2194 Ga0207665_10128813
2195 Ga0207665_10134194
2196 Ga0207665_10141989
2197 Ga0207665_10148147
2198 Ga0207665_10251247
2199 Ga0207665_10463539
2200 Ga0207691_10002552
2201 Ga0207711_10029133
2202 Ga0207711_10167073
2203 Ga0207711_10171699
2204 Ga0207711_10196885
2205 Ga0207711_10208013
2206 Ga0207711_10310597
2207 Ga0207711_10492921
2208 Ga0207711_10630831
2209 Ga0207689_10000512
2210 Ga0207689_10001703
2211 Ga0207689_10022953
2212 Ga0207689_10036804
2213 Ga0207689_10920582
2214 Ga0207661_10000328
2215 Ga0207661_10041003
2216 Ga0207661_10060196
2217 Ga0207661_10440422
2218 Ga0207661_10548139
2219 Ga0207661_10625923
2220 Ga0207679_10000170
2221 Ga0207679_10012413
2222 Ga0207679_10037212
2223 Ga0207679_10242360
2224 Ga0207679_10379013
2225 Ga0207679_11027818
2226 Ga0207667_10006788
2227 Ga0207667_10031195
2228 Ga0207667_10054117
2229 Ga0207667_10067834
2230 Ga0207667_10128087
2231 Ga0207667_10204606
2232 Ga0207667_10242732
2233 Ga0207667_10291787
2234 Ga0207667_10867515
2235 Ga0207651_10008651
2236 Ga0207651_10436601
2237 Ga0207712_10035640
2238 Ga0207712_10928332
2239 Ga0207668_10162558
2240 Ga0207668_10968346
2241 Ga0207640_10004443
2242 Ga0207640_10118892
2243 Ga0207640_10129664
2244 Ga0207640_10146244
2245 Ga0207640_10193978
2246 Ga0207640_10537530
2247 Ga0207640_10560632
2248 Ga0207658_10160407
2249 Ga0207658_10246020
2250 Ga0207658_10625116
2251 Ga0207677_10009877
2252 Ga0207677_10016958
2253 Ga0207677_10034948
2254 Ga0207677_10092488
2255 Ga0207677_10100208
2256 Ga0207677_10119496
2257 Ga0207677_10291891
2258 Ga0207677_10657725
2259 Ga0207677_10717955
2260 Ga0207703_10001237
2261 Ga0207703_10003326
2262 Ga0207703_10051504
2263 Ga0207703_10070136
2264 Ga0207703_10070460
2265 Ga0207703_10162224
2266 Ga0207639_10005167
2267 Ga0207639_10005894
2268 Ga0207639_10014708
2269 Ga0207639_10071290
2270 Ga0207639_10092463
2271 Ga0207639_10102406
2272 Ga0207639_10119152
2273 Ga0207639_10200206
2274 Ga0207678_10000887
2275 Ga0207678_10001608
2276 Ga0207702_10000415
2277 Ga0207702_10000866
2278 Ga0207702_10001193
2279 Ga0207702_10026868
2280 Ga0207702_10057298
2281 Ga0207702_10082101
2282 Ga0207702_10113285
2283 Ga0207702_10150393
2284 Ga0207702_10399113
2285 Ga0207702_10621857
2286 Ga0207641_10000323
2287 Ga0207641_10010259
2288 Ga0207641_10164887
2289 Ga0207648_10000870
2290 Ga0207648_10049697
2291 Ga0207648_10078342
2292 Ga0207676_10001412
2293 Ga0207676_10001649
2294 Ga0207676_10027339
2295 Ga0207676_10035580
2296 Ga0207676_10048872
2297 Ga0207676_10067197
2298 Ga0207676_10240306
2299 Ga0207674_10000164
2300 Ga0207674_10000269
2301 Ga0207674_10009605
2302 Ga0207674_10069953
2303 Ga0207674_10083587
2304 Ga0207674_10149144
2305 Ga0207674_10185924
2306 Ga0207675_100077714
2307 Ga0207675_100112466
2308 Ga0207675_100119688
2309 Ga0207683_10000493
2310 Ga0207683_10084329
2311 Ga0207683_10084876
2312 Ga0207698_10003243
2313 Ga0207698_10202364
2314 Ga0207698_10372421
2315 Ga0207698_10899694
2316 Ga0207698_10983507
2317 Ga0265354_1003879
2318 Ga0265356_1000796
2319 Ga0265356_1003059
2320 Ga0265355_1005336
2321 Ga0268266_10006414
2322 Ga0268266_10057790
2323 Ga0268266_10626178
2324 Ga0268265_10002217
2325 Ga0268265_10066425
2326 Ga0268265_10104611
2327 Ga0268265_10474619
2328 Ga0268264_10007432
2329 Ga0268264_10030585
2330 Ga0268264_10031105
2331 Ga0268264_10064813
2332 Ga0268264_10133421
2333 Ga0265336_10076755
2334 Ga0265338_10002180
2335 Ga0265338_10004188
2336 Ga0265338_10095093
2337 Ga0265338_10401812
2338 Ga0265762_1001136
2339 Ga0265762_1001663
2340 Ga0265762_1002914
2341 Ga0265770_1020524
2342 Ga0265773_1009968
2343 Ga0265760_10000931
2344 Ga0265760_10001483
2345 Ga0265760_10002685
2346 Ga0265760_10003511
2347 Ga0265332_10154024
2348 Ga0265328_10051661
2349 Ga0265325_10076336
2350 Ga0265340_10074872
2351 Ga0265340_10218955
2352 Ga0265339_10017636
2353 Ga0265339_10047578
2354 Ga0265339_10095739
2355 Ga0265339_10101923
2356 Ga0265339_10182021
2357 Ga0265316_10007573
2358 Ga0265314_10001626
2359 Ga0265314_10015261
2360 Ga0265314_10171917
2361 Ga0307407_10068623
2362 Ga0307409_100002346
2363 Ga0307409_100009366
2364 Ga0307416_100023736
2365 Ga0307411_10013959
2366 Ga0307415_100488840
2367 Ga0316214_1001064
2368 Ga0373930_0014593
2369 Ga0373950_0039636
2370 Ga0373926_0003742
2371 Ga0373926_0025902
2372 Ga0373926_0084805
2373 Ga0373926_0132537
2374 Ga0373928_0081321
2375 Ga0373934_0027565
2376 Ga0373934_0057247
2377 Ga0373940_0133126
2378 Ga0373944_0008880
2379 Ga0373944_0009947
2380 Ga0373949_0031524
2381 Ga0373932_0077753
2382 Ga0373936_0003050
2383 Ga0373936_0024901
2384 Ga0373936_0041474
2385 Ga0373936_0082450
2386 Ga0373941_0050711
2387 Ga0373945_0004158
2388 Ga0373945_0021455
2389 Ga0373953_0111255
2390 Ga0373953_0140048
2391 Ga0373956_0006358
2392 Ga0373957_0040791
2393 Ga0373943_0002936
2394 Ga0373943_0087919
2395 Ga0373946_0058962
2396 Ga0373955_0028626
2397 Ga0373955_0047391
2398 Ga0373961_0029302
2399 Ga0373962_0077031
2400 Ga0373924_0000405
2401 Ga0373924_0006530
2402 Ga0373924_0027003
2403 Ga0373924_0125528
2404 Ga0373924_0126742
2405 Ga0373924_0153332
2406 Ga0373931_0057852
2407 Ga0373931_0061266
2408 Ga0373931_0300403
2409 Ga0373935_0005782
2410 Ga0373935_0011685
2411 Ga0373935_0016240
2412 Ga0373935_0119189
2413 Ga0373935_0242141
2414 Ga0373935_0304089
2415 Ga0373935_0605230
2416 Ga0373935_0614905
2417 Ga0373927_0000389
2418 Ga0373927_0017315
2419 Ga0373927_0044905
2420 Ga0373927_0126459
2421 Ga0373933_0029202
2422 Ga0373933_0267816
2423 Ga0373933_0268063
2424 Ga0373947_0000147
2425 Ga0373947_0006209
2426 Ga0373947_0014220
2427 Ga0373947_0014909
2428 Ga0373947_0370759
2429 Ga0373947_0462063
2430 Ga0373937_0000094
2431 Ga0373937_0008668
2432 Ga0373937_0147963
2433 Ga0373937_0208147
2434 Ga0373937_0423773
2435 Ga0373937_0564071
2436 Ga0373925_0000243
2437 Ga0373925_0003398
2438 Ga0373925_0005997
2439 Ga0373925_0016103
2440 Ga0373925_0021763
2441 Ga0373925_0081225
2442 Ga0373925_0161969
2443 Ga0373925_0221335
2444 Ga0373925_0274890
2445 Ga0373925_0279246
2446 Ga0373925_0520634
2447 Ga0395898_0182252
2448 Ga0395898_0570543
2449 Ga0395905_0147920
2450 Ga0395905_0190557
2451 Ga0395905_0218816
2452 Ga0395905_0599568
2453 Ga0436364_0606406
2454 Ga0436365_1592604
2455 Ga0436365_1640734
2456 Ga0436360_1156664
2457 Ga0436363_0154653
2458 Ga0436363_0313774
2459 Ga0436363_0350881
2460 Ga0436363_0523760
2461 Ga0436363_0779725
2462 Ga0451577_0000760
2463 Ga0451577_0421755
2464 Ga0453683_0076861
2465 Ga0466965_0060932
2466 Ga0466966_0333952
2467 Ga0466961_0089571
2468 Ga0466963_0004868
2469 Ga0466963_0027676
2470 Ga0466963_0054618
2471 Ga0466964_0100453
2472 Ga0466964_0246825
2473 Ga0466964_0360755
2474 Ga0453684_0000104
2475 Ga0453684_0778348
2476 Ga0466957_0000162
2477 Ga0466957_0065767
2478 Ga0466959_0004700
2479 Ga0466959_0363592
2480 Ga0466959_0367344
2481 Ga0451576_0014185
2482 Ga0451576_0014296
2483 Ga0451576_0153169
2484 Ga0466958_0033599
2485 Ga0466967_0002458
2486 Ga0466967_0021392
2487 Ga0466967_0076966
2488 Ga0466967_0140538
2489 Ga0466967_0150081
2490 Ga0466967_0332198
2491 Ga0466967_0394082
2492 Ga0466967_0727684
2493 Ga0495603_0128482
2494 Ga0495629_0401346
2495 Ga0495651_0156573
2496 Ga0495580_0000207
2497 Ga0495580_0000954
2498 Ga0495580_0001003
2499 Ga0495580_0010373
2500 Ga0495580_0010808
2501 Ga0495580_0020655
2502 Ga0495580_0028373
2503 Ga0495580_0070919
2504 Ga0495580_0113663
2505 Ga0495580_0120103
2506 Ga0495580_0148301
2507 Ga0495580_0155658
2508 Ga0495580_0168194
2509 Ga0495580_0195544
2510 Ga0495582_0001085
2511 Ga0495582_0022396
2512 Ga0495582_0099848
2513 Ga0495605_0132789
2514 Ga0495664_0245093
2515 Ga0495664_0252096
2516 Ga0495594_0025512
2517 Ga0495594_0055427
2518 Ga0495628_0303561
2519 Ga0495628_0386846
2520 Ga0495628_0480871
2521 Ga0495630_0058826
2522 Ga0495630_0142593
2523 Ga0495630_0183514
2524 Ga0495666_0031598
2525 Ga0495665_0006832
2526 Ga0495665_0042263
2527 Ga0495665_0161590
2528 Ga0495586_0116406
2529 Ga0495645_0308814
2530 Ga0495667_0051260
2531 Ga0495667_0389623
2532 Ga0495635_0145610
2533 Ga0495659_0026242
2534 Ga0495588_0136351
2535 Ga0495657_0094763
2536 Ga0495657_0405974
2537 Ga0495623_0083996
2538 Ga0495623_0177865
2539 Ga0495646_0328929
2540 Ga0495647_0187162
2541 Ga0495658_0013868
2542 Ga0495658_0270365
2543 Ga0495669_0009520
2544 Ga0495669_0307451
2545 Ga0495624_0132825
2546 Ga0495581_0169730
2547 Ga0495581_0473133
2548 Ga0495604_0115648
2549 Ga0495604_0141991
2550 Ga0495604_0514267
2551 Ga0495674_0010677
2552 Ga0495674_0012983
2553 Ga0495674_0189938
2554 Ga0495674_0230976
2555 Ga0495674_0785433
2556 Ga0495684_0134004
2557 Ga0495684_0264760
2558 Ga0495593_0121341
2559 Ga0495602_0042046
2560 Ga0495602_0063358
2561 Ga0495602_0173348
2562 Ga0496100_0041074
2563 Ga0496100_0079201
2564 Ga0496100_0244587
2565 Ga0496101_0050583
2566 Ga0496101_0180335
2567 Ga0496102_0002115
2568 Ga0496102_0028941
2569 Ga0496102_0032555
2570 Ga0496102_0063173
2571 Ga0496102_0085192
2572 Ga0496102_0114753
2573 Ga0496102_0151951
2574 Ga0496102_0235804
2575 Ga0496102_0419890
2576 Ga0496102_1009024
2577 Ga0496103_0007300
2578 Ga0496103_0098360
2579 Ga0496103_0168476
2580 Ga0496103_0284010
2581 Ga0496103_0316981
2582 Ga0496104_0027435
2583 Ga0496104_0030003
2584 Ga0496104_0040711
2585 Ga0496104_0067886
2586 Ga0496104_0082469
2587 Ga0496104_0086428
2588 Ga0496104_0149125
2589 Ga0496104_0153281
2590 Ga0496104_0153503
2591 Ga0496104_0155909
2592 Ga0496104_0186622
2593 Ga0496104_0314397
2594 Ga0496104_0465399
2595 Ga0496104_0660524
2596 Ga0496104_0845381
2597 Ga0496105_0067370
2598 Ga0496105_0073573
2599 Ga0496105_0076554
2600 Ga0496105_0106282
2601 Ga0496105_0236303
2602 Ga0496105_0302622
2603 Ga0496106_0099506
2604 Ga0496106_0118995
2605 Ga0496106_0428852
2606 Ga0496106_0434793
2607 Ga0496107_0033870
2608 Ga0496107_0171219
2609 Ga0496107_0193790
2610 Ga0496107_0350120
2611 Ga0496107_0416370
2612 Ga0496108_0000444
2613 Ga0496108_0242908
2614 Ga0496108_0356470
2615 Ga0496109_0002079
2616 Ga0496109_0077503
2617 Ga0496109_0121542
2618 Ga0496109_0244716
2619 Ga0496109_0796650
2620 Ga0496110_0009263
2621 Ga0496110_0010922
2622 Ga0496110_0012463
2623 Ga0496110_0055531
2624 Ga0496110_0920820
2625 Ga0496111_0003547
2626 Ga0496111_0004197
2627 Ga0496111_0005860
2628 Ga0496111_0085473
2629 Ga0496112_0000060
2630 Ga0496112_0001326
2631 Ga0496112_0001636
2632 Ga0496112_0008785
2633 Ga0496112_0016574
2634 Ga0496112_0023715
2635 Ga0496112_0028527
2636 Ga0496112_0076772
2637 Ga0496112_0097306
2638 Ga0496112_0097765
2639 Ga0496112_0146479
2640 Ga0496112_0220059
2641 Ga0496112_0280261
2642 Ga0496112_0610930
2643 Ga0496112_0770343
2644 Ga0496113_0002406
2645 Ga0496113_0019372
2646 Ga0496113_0043393
2647 Ga0496113_0074664
2648 Ga0496113_0326035
2649 Ga0496114_0125800
2650 Ga0496114_0143712
2651 Ga0496115_0006392
2652 Ga0496115_0009148
2653 Ga0496115_0525485
2654 Ga0496115_0699200
2655 Ga0501298_011412
2656 Ga0501299_012498
2657 Ga0501069_0271838
2658 Ga0501073_0086975
2659 Ga0501216_028329
2660 Ga0501217_069987
2661 Ga0501257_020950
2662 Ga0501257_056031
2663 Ga0501225_0051551
2664 Ga0501272_015452
2665 nmdc:mga08y16_658830_c1
2666 nmdc:mga0n895_110774_c1
2667 nmdc:mga0n895_152296_c1
2668 nmdc:mga0n895_423218_c1
2669 nmdc:mga0n895_560_c1
2670 nmdc:mga0n895_73080_c1
2671 nmdc:mga0rr50_207971_c1
2672 nmdc:mga0rr50_20917_c1
2673 nmdc:mga0rr50_417396_c1
2674 nmdc:mga0rr50_4515_c1
2675 nmdc:mga0rr50_843333_c1
2676 nmdc:mga08x19_122466_c1
2677 nmdc:mga08x19_13875_c1
2678 nmdc:mga08x19_4249_c1
2679 nmdc:mga08x19_57371_c1
2680 nmdc:mga08x19_5779_c1
2681 nmdc:mga0a205_21929_c1
2682 nmdc:mga0a205_808600_c1
2683 Ga0495601_0039537
2684 Ga0495601_0089406
2685 Ga0495612_0170469
2686 Ga0495619_0236592
2687 Ga0501084_0659959
2688 Ga0587073_0043795
2689 Ga0587077_056091
2690 Ga0587067_011688
2691 Ga0587079_017890
2692 Ga0587079_075628
2693 Ga0587071_024732
2694 Ga0466962_0163198

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00196

GerE

Bacterial regulatory proteins, luxR family

190

246

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
3jte-assembly1.cif.gz_A crystal structure of response regulator receiver domain protein from clostridium thermocellum 0.8838 10 119
2qxy-assembly1.cif.gz_A crystal structure of a response regulator from thermotoga maritima 0.8809 10 122
7od9-assembly1.cif.gz_B crystal structure of activated chey fused to the c-terminal domain of chef 0.88 10 122
4qpj-assembly2.cif.gz_C 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain 0.8693 10 123
7m0s-assembly1.cif.gz_B n-terminal domain of pmra from acinetobacter baumannii 0.8667 10 123
ID Description Score Start End Superfamily
3cloA02 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.9096 155 203 1.10.10.10
3jteA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8838 10 119 3.40.50.2300
af_P14375_1_129_3.40.50.2300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8837 11 122 3.40.50.2300
af_P77171_5_91_1.10.10.10 Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 0.8814 155 199 1.10.10.10
4d6yA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator 0.8712 13 123 3.40.50.2300
ID Description Score Start End GO Terms
AF-A0A2V9PM93-F1-model_v4 Response regulatory domain-containing protein 0.9468 1 116 GO:0000160
AF-A0A2V9PM93-F1-model_v4 Response regulatory domain-containing protein 0.939 1 116 GO:0000160
AF-A0A1Q7KQU5-F1-model_v4 Response regulatory domain-containing protein 0.8689 1 157 GO:0000160
AF-A0A3M1HPD4-F1-model_v4 DNA-binding response regulator 0.8443 9 143 GO:0000160
GO:0003677
AF-C9ZAU5-F1-model_v4 Sensory transduction protein RegX3 0.842 10 123 GO:0000156
GO:0000976
GO:0005829
GO:0006355
GO:0032993

Map