F493210
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1347 | 343 | 2694 | 221 |
Family's Representative Sequence
| Representative Sequence | 3300048907|Ga0496104_0178602|Ga0496104_0178602_1187_1957 |
| Length | 256 |
| Sequence | MYPAKEWAWAEVHDTFRSRAPFFAYNAQHHATVLEGVLMKAGASKRTIRIAVVESDPLRFIGLKSLFDTETDLELVSCSLAELGPRKDIDLVLLGTRAGQNLFDVMAGLKAARPDLRIIVTGSGADDETILKALAAGAKGYVDEAASPAEFIQAMRIVHAGSVWAPRRVLSIFIERVTSSPGRIFPAGRVTFTDREKEVLELLVVGRSNKEIGSVLGIEERTVKAHVAKLMRKVGVQNRIALSVHAITHSLVTSSK |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 2 | 2162886011 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 3 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 4 | 3300000546 | Quercus rhizosphere microbial communities from Sierra Nevada National Park, Granada, Spain - LJN_Illumina_Assembled | Metagenome | Rhizosphere |
| 5 | 3300001976 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 | Metagenome | Rhizosphere |
| 6 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 7 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 8 | 3300004799 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 9 | 3300004800 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 10 | 3300004803 | Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 11 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 12 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 15 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 16 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 17 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 18 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 20 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 21 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 22 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 23 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 24 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 26 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 28 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 29 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 36 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 39 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 40 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 43 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 46 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 50 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 51 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 52 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 53 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 54 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 56 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 57 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 60 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 61 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 62 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 63 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 64 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 67 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 68 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 69 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 70 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 71 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 73 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 74 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 75 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 76 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 77 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 78 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 79 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 80 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 81 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 82 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 83 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 84 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 85 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 86 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 87 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 88 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 89 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 90 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 91 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 92 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 93 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 94 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 95 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 96 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 97 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 98 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 99 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 100 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 101 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 102 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 103 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 104 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 105 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 106 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 110 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 113 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 114 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 115 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 116 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 117 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 118 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 119 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 120 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 121 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 124 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 128 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300020076 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-2 (Metagenome Metatranscriptome) (v3) (version 3) | Metatranscriptome | Rhizosphere |
| 130 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 131 | 3300022467 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-2 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 132 | 3300022730 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 | Metagenome | Rhizosphere |
| 133 | 3300022732 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU1 | Metagenome | Rhizosphere |
| 134 | 3300022734 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU3 | Metagenome | Rhizosphere |
| 135 | 3300024225 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 | Metagenome | Rhizosphere |
| 136 | 3300024227 | Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 | Metagenome | Rhizosphere |
| 137 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 138 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 139 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 140 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 141 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300028016 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 | Metagenome | Rhizosphere |
| 203 | 3300028017 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 | Metagenome | Rhizosphere |
| 204 | 3300028036 | Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 | Metagenome | Rhizosphere |
| 205 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 209 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 210 | 3300030760 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 211 | 3300030878 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 212 | 3300031018 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 213 | 3300031090 | Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 214 | 3300031238 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-26 metaG | Metagenome | Rhizosphere |
| 215 | 3300031239 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG | Metagenome | Rhizosphere |
| 216 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 217 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 218 | 3300031249 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG | Metagenome | Rhizosphere |
| 219 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300031711 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG | Metagenome | Rhizosphere |
| 221 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 222 | 3300031995 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 | Metagenome | Rhizosphere |
| 223 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 224 | 3300032005 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 | Metagenome | Rhizosphere |
| 225 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 226 | 3300033545 | Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE4 | Metagenome | Unclassified |
| 227 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 228 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 229 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 230 | 3300035084 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_1 | Metagenome | Rhizosphere |
| 231 | 3300035086 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 | Metagenome | Rhizosphere |
| 232 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 233 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 234 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 235 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 236 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 237 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 238 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 242 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 243 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 245 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 246 | 3300035242 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 | Metagenome | Rhizosphere |
| 247 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 248 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 249 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 250 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 251 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 252 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 253 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 254 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 255 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 256 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 257 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 258 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 259 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 260 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 261 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 262 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 263 | 3300044683 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA3R | Metagenome | Rhizosphere |
| 264 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 265 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 266 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 267 | 3300044706 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R | Metagenome | Rhizosphere |
| 268 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 269 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 270 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 271 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 272 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 273 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 274 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 275 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 276 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 277 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 278 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 279 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 306 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 307 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 308 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 309 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 310 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 311 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 312 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 313 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 314 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 315 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 316 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 317 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 318 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 319 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 320 | 3300049521 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E25_B_7_drought | Metagenome | Rhizosphere |
| 321 | 3300049522 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C24_B_7_control | Metagenome | Rhizosphere |
| 322 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 323 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 324 | 3300049660 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - D2_B_0_control | Metagenome | Rhizosphere |
| 325 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 326 | 3300049686 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I11_B_3_control | Metagenome | Rhizosphere |
| 327 | 3300049705 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C1_A_2_drought | Metagenome | Rhizosphere |
| 328 | 3300049769 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_B_4_drought | Metagenome | Rhizosphere |
| 329 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 330 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 331 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 332 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 333 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 334 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300053078 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 338 | 3300059492 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 14R_AD_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 339 | 3300059493 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 19R_SW_T1_R2 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 340 | 3300059640 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 8R_CD_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 341 | 3300059647 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 43R_SW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 342 | 3300060344 | Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 36R_AW_T1_R4 (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 343 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 98.37 |
| Metatranscriptomes | 1.63 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0 |
| Nodule | 0 |
| Rhizoplane | 6.98 |
| Rhizosphere | 92.2 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 26.87 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0496104_0178602 | 3300048907 | Bacteria | 2033 |
| 2 | MRS1b_contig_8406324 | 2162886011 | Bacteria | 1159 |
| 3 | MBSR1b_contig_8347319 | 2162886012 | Bacteria | 1603 |
| 4 | MBSR1b_contig_9753513 | 2162886012 | Unclassified | 853 |
| 5 | LJNas_1000269 | 3300000546 | Bacteria | 8948 |
| 6 | JGI24752J21851_1001182 | 3300001976 | Bacteria | 3541 |
| 7 | JGI24034J26672_10000325 | 3300002239 | Bacteria | 6132 |
| 8 | JGI24751J29686_10001201 | 3300002459 | Bacteria | 5493 |
| 9 | Ga0058863_11372885 | 3300004799 | Bacteria | 925 |
| 10 | Ga0058861_10063214 | 3300004800 | Unclassified | 1436 |
| 11 | Ga0058861_11314449 | 3300004800 | Bacteria | 880 |
| 12 | Ga0058862_12094930 | 3300004803 | Bacteria | 840 |
| 13 | Ga0058862_12654815 | 3300004803 | Unclassified | 1032 |
| 14 | Ga0065712_10003687 | 3300005290 | Bacteria | 4193 |
| 15 | Ga0065712_10110694 | 3300005290 | Bacteria | 1831 |
| 16 | Ga0065712_10136907 | 3300005290 | Bacteria | 1488 |
| 17 | Ga0065715_10124725 | 3300005293 | Bacteria | 2134 |
| 18 | Ga0065715_10175677 | 3300005293 | Bacteria | 1513 |
| 19 | Ga0065707_10233012 | 3300005295 | Unclassified | 1182 |
| 20 | Ga0070658_10054106 | 3300005327 | Bacteria | 3259 |
| 21 | Ga0070658_10402397 | 3300005327 | Bacteria | 1176 |
| 22 | Ga0070676_10013388 | 3300005328 | Bacteria | 4494 |
| 23 | Ga0070676_10013895 | 3300005328 | Bacteria | 4417 |
| 24 | Ga0070683_100015072 | 3300005329 | Bacteria | 6782 |
| 25 | Ga0070683_100018817 | 3300005329 | Bacteria | 6125 |
| 26 | Ga0070683_100020038 | 3300005329 | Bacteria | 5947 |
| 27 | Ga0070683_100133144 | 3300005329 | Bacteria | 2353 |
| 28 | Ga0070683_100224105 | 3300005329 | Bacteria | 1787 |
| 29 | Ga0070683_100561238 | 3300005329 | Unclassified | 1092 |
| 30 | Ga0070683_100607026 | 3300005329 | Unclassified | 1047 |
| 31 | Ga0070690_100006967 | 3300005330 | Bacteria | 6438 |
| 32 | Ga0070690_100010719 | 3300005330 | Bacteria | 5344 |
| 33 | Ga0070670_100017644 | 3300005331 | Bacteria | 6125 |
| 34 | Ga0070670_100052679 | 3300005331 | Unclassified | 3494 |
| 35 | Ga0068869_100000365 | 3300005334 | Bacteria | 24415 |
| 36 | Ga0068869_100004818 | 3300005334 | Bacteria | 8429 |
| 37 | Ga0068869_100021779 | 3300005334 | Bacteria | 4411 |
| 38 | Ga0068869_100025160 | 3300005334 | Unclassified | 4130 |
| 39 | Ga0070666_10002671 | 3300005335 | Bacteria | 10753 |
| 40 | Ga0070680_100009284 | 3300005336 | Bacteria | 7549 |
| 41 | Ga0070680_100079684 | 3300005336 | Bacteria | 2700 |
| 42 | Ga0070680_100095633 | 3300005336 | Unclassified | 2463 |
| 43 | Ga0070680_100137886 | 3300005336 | Bacteria | 2045 |
| 44 | Ga0070680_100157759 | 3300005336 | Unclassified | 1906 |
| 45 | Ga0070680_100290587 | 3300005336 | Bacteria | 1385 |
| 46 | Ga0070680_100357712 | 3300005336 | Bacteria | 1242 |
| 47 | Ga0070682_100006008 | 3300005337 | Bacteria | 6795 |
| 48 | Ga0070682_100094191 | 3300005337 | Bacteria | 1964 |
| 49 | Ga0068868_100003230 | 3300005338 | Bacteria | 11338 |
| 50 | Ga0068868_100016148 | 3300005338 | Bacteria | 5538 |
| 51 | Ga0068868_100041316 | 3300005338 | Bacteria | 3592 |
| 52 | Ga0068868_100079865 | 3300005338 | Bacteria | 2621 |
| 53 | Ga0068868_100091928 | 3300005338 | Bacteria | 2445 |
| 54 | Ga0068868_100112431 | 3300005338 | Unclassified | 2214 |
| 55 | Ga0068868_100119023 | 3300005338 | Bacteria | 2153 |
| 56 | Ga0068868_100467557 | 3300005338 | Bacteria | 1100 |
| 57 | Ga0068868_100502168 | 3300005338 | Unclassified | 1062 |
| 58 | Ga0068868_100974054 | 3300005338 | Unclassified | 774 |
| 59 | Ga0070660_100022195 | 3300005339 | Bacteria | 4691 |
| 60 | Ga0070660_100108602 | 3300005339 | Bacteria | 2205 |
| 61 | Ga0070660_100206925 | 3300005339 | Bacteria | 1592 |
| 62 | Ga0070660_100381384 | 3300005339 | Bacteria | 1164 |
| 63 | Ga0070689_100050786 | 3300005340 | Bacteria | 3204 |
| 64 | Ga0070689_100216712 | 3300005340 | Bacteria | 1569 |
| 65 | Ga0070687_100060743 | 3300005343 | Unclassified | 1995 |
| 66 | Ga0070687_100066136 | 3300005343 | Unclassified | 1925 |
| 67 | Ga0070687_100383764 | 3300005343 | Unclassified | 916 |
| 68 | Ga0070661_100003055 | 3300005344 | Bacteria | 11515 |
| 69 | Ga0070661_100009617 | 3300005344 | Bacteria | 6699 |
| 70 | Ga0070661_100014979 | 3300005344 | Bacteria | 5470 |
| 71 | Ga0070661_100041762 | 3300005344 | Unclassified | 3346 |
| 72 | Ga0070661_100174851 | 3300005344 | Bacteria | 1632 |
| 73 | Ga0070692_10060948 | 3300005345 | Bacteria | 1988 |
| 74 | Ga0070668_100044360 | 3300005347 | Bacteria | 3412 |
| 75 | Ga0070668_100066847 | 3300005347 | Bacteria | 2791 |
| 76 | Ga0070668_100677355 | 3300005347 | Unclassified | 908 |
| 77 | Ga0070669_100023832 | 3300005353 | Bacteria | 4385 |
| 78 | Ga0070669_100503023 | 3300005353 | Bacteria | 1005 |
| 79 | Ga0070675_100140797 | 3300005354 | Bacteria | 2062 |
| 80 | Ga0070675_100197438 | 3300005354 | Bacteria | 1745 |
| 81 | Ga0070675_100514747 | 3300005354 | Unclassified | 1079 |
| 82 | Ga0070671_100031332 | 3300005355 | Unclassified | 4392 |
| 83 | Ga0070671_100062531 | 3300005355 | Bacteria | 3100 |
| 84 | Ga0070671_100091869 | 3300005355 | Unclassified | 2543 |
| 85 | Ga0070671_100386785 | 3300005355 | Bacteria | 1196 |
| 86 | Ga0070674_100575452 | 3300005356 | Unclassified | 948 |
| 87 | Ga0070673_100001773 | 3300005364 | Bacteria | 12856 |
| 88 | Ga0070673_100025530 | 3300005364 | Bacteria | 4351 |
| 89 | Ga0070673_100735921 | 3300005364 | Unclassified | 907 |
| 90 | Ga0070688_100002766 | 3300005365 | Bacteria | 8912 |
| 91 | Ga0070688_100591941 | 3300005365 | Unclassified | 848 |
| 92 | Ga0070659_100009058 | 3300005366 | Bacteria | 7304 |
| 93 | Ga0070659_100020284 | 3300005366 | Bacteria | 5047 |
| 94 | Ga0070659_100181349 | 3300005366 | Bacteria | 1728 |
| 95 | Ga0070667_100045480 | 3300005367 | Bacteria | 3691 |
| 96 | Ga0070667_100115683 | 3300005367 | Unclassified | 2329 |
| 97 | Ga0070667_100688413 | 3300005367 | Unclassified | 945 |
| 98 | Ga0070709_10013312 | 3300005434 | Bacteria | 4621 |
| 99 | Ga0070709_10019620 | 3300005434 | Bacteria | 3911 |
| 100 | Ga0070709_10024439 | 3300005434 | Unclassified | 3556 |
| 101 | Ga0070709_10027155 | 3300005434 | Unclassified | 3402 |
| 102 | Ga0070709_10039113 | 3300005434 | Bacteria | 2909 |
| 103 | Ga0070709_10042655 | 3300005434 | Bacteria | 2803 |
| 104 | Ga0070709_10068926 | 3300005434 | Bacteria | 2276 |
| 105 | Ga0070709_10104420 | 3300005434 | Bacteria | 1893 |
| 106 | Ga0070709_10265257 | 3300005434 | Bacteria | 1242 |
| 107 | Ga0070709_10303588 | 3300005434 | Bacteria | 1166 |
| 108 | Ga0070714_100007036 | 3300005435 | Bacteria | 8719 |
| 109 | Ga0070714_100008700 | 3300005435 | Bacteria | 7937 |
| 110 | Ga0070714_100025376 | 3300005435 | Unclassified | 4891 |
| 111 | Ga0070714_100044925 | 3300005435 | Bacteria | 3741 |
| 112 | Ga0070714_100086557 | 3300005435 | Bacteria | 2738 |
| 113 | Ga0070714_100107597 | 3300005435 | Bacteria | 2465 |
| 114 | Ga0070714_100139303 | 3300005435 | Bacteria | 2176 |
| 115 | Ga0070714_100285524 | 3300005435 | Unclassified | 1534 |
| 116 | Ga0070714_100439135 | 3300005435 | Bacteria | 1238 |
| 117 | Ga0070714_100636494 | 3300005435 | Unclassified | 1026 |
| 118 | Ga0070713_100000073 | 3300005436 | Bacteria | 63264 |
| 119 | Ga0070713_100000940 | 3300005436 | Bacteria | 18610 |
| 120 | Ga0070713_100005524 | 3300005436 | Bacteria | 8657 |
| 121 | Ga0070713_100013005 | 3300005436 | Bacteria | 6128 |
| 122 | Ga0070713_100018529 | 3300005436 | Bacteria | 5290 |
| 123 | Ga0070713_100049171 | 3300005436 | Bacteria | 3477 |
| 124 | Ga0070713_100055645 | 3300005436 | Bacteria | 3288 |
| 125 | Ga0070713_100057729 | 3300005436 | Bacteria | 3233 |
| 126 | Ga0070713_100061416 | 3300005436 | Bacteria | 3144 |
| 127 | Ga0070713_100070094 | 3300005436 | Bacteria | 2958 |
| 128 | Ga0070713_100093717 | 3300005436 | Bacteria | 2588 |
| 129 | Ga0070713_100143054 | 3300005436 | Bacteria | 2120 |
| 130 | Ga0070713_100182969 | 3300005436 | Bacteria | 1884 |
| 131 | Ga0070713_100185830 | 3300005436 | Bacteria | 1870 |
| 132 | Ga0070713_100429813 | 3300005436 | Unclassified | 1237 |
| 133 | Ga0070713_100584912 | 3300005436 | Unclassified | 1059 |
| 134 | Ga0070713_100662733 | 3300005436 | Unclassified | 994 |
| 135 | Ga0070713_100731779 | 3300005436 | Bacteria | 946 |
| 136 | Ga0070713_100836640 | 3300005436 | Unclassified | 883 |
| 137 | Ga0070710_10009992 | 3300005437 | Bacteria | 4653 |
| 138 | Ga0070710_10014746 | 3300005437 | Bacteria | 3938 |
| 139 | Ga0070710_10024508 | 3300005437 | Bacteria | 3184 |
| 140 | Ga0070710_10041647 | 3300005437 | Unclassified | 2537 |
| 141 | Ga0070710_10125030 | 3300005437 | Bacteria | 1562 |
| 142 | Ga0070710_10128501 | 3300005437 | Bacteria | 1542 |
| 143 | Ga0070710_10131999 | 3300005437 | Unclassified | 1524 |
| 144 | Ga0070710_10140541 | 3300005437 | Bacteria | 1480 |
| 145 | Ga0070710_10162049 | 3300005437 | Unclassified | 1388 |
| 146 | Ga0070701_10363946 | 3300005438 | Unclassified | 907 |
| 147 | Ga0070701_10528403 | 3300005438 | Unclassified | 770 |
| 148 | Ga0070711_100000360 | 3300005439 | Bacteria | 23472 |
| 149 | Ga0070711_100001169 | 3300005439 | Bacteria | 14108 |
| 150 | Ga0070711_100001873 | 3300005439 | Bacteria | 11750 |
| 151 | Ga0070711_100012010 | 3300005439 | Bacteria | 5396 |
| 152 | Ga0070711_100066853 | 3300005439 | Bacteria | 2520 |
| 153 | Ga0070711_100080156 | 3300005439 | Unclassified | 2324 |
| 154 | Ga0070711_100149158 | 3300005439 | Bacteria | 1761 |
| 155 | Ga0070711_100184980 | 3300005439 | Bacteria | 1597 |
| 156 | Ga0070694_100476679 | 3300005444 | Unclassified | 989 |
| 157 | Ga0070708_100000470 | 3300005445 | Bacteria | 30377 |
| 158 | Ga0070708_100001120 | 3300005445 | Bacteria | 20506 |
| 159 | Ga0070708_100002203 | 3300005445 | Bacteria | 15053 |
| 160 | Ga0070708_100003678 | 3300005445 | Bacteria | 12036 |
| 161 | Ga0070708_100008454 | 3300005445 | Bacteria | 8264 |
| 162 | Ga0070708_100008675 | 3300005445 | Bacteria | 8168 |
| 163 | Ga0070708_100010894 | 3300005445 | Bacteria | 7387 |
| 164 | Ga0070708_100016315 | 3300005445 | Bacteria | 6160 |
| 165 | Ga0070708_100022619 | 3300005445 | Bacteria | 5334 |
| 166 | Ga0070708_100032064 | 3300005445 | Bacteria | 4554 |
| 167 | Ga0070708_100076096 | 3300005445 | Bacteria | 3030 |
| 168 | Ga0070708_100502630 | 3300005445 | Unclassified | 1144 |
| 169 | Ga0070708_100631343 | 3300005445 | Bacteria | 1010 |
| 170 | Ga0070663_100001680 | 3300005455 | Bacteria | 12273 |
| 171 | Ga0070663_100077313 | 3300005455 | Bacteria | 2436 |
| 172 | Ga0070678_100082081 | 3300005456 | Bacteria | 2446 |
| 173 | Ga0070678_100743413 | 3300005456 | Unclassified | 887 |
| 174 | Ga0070662_100007994 | 3300005457 | Bacteria | 6881 |
| 175 | Ga0070662_100098792 | 3300005457 | Unclassified | 2205 |
| 176 | Ga0070681_10001396 | 3300005458 | Bacteria | 21186 |
| 177 | Ga0070681_10013650 | 3300005458 | Bacteria | 8085 |
| 178 | Ga0070681_10036782 | 3300005458 | Unclassified | 4915 |
| 179 | Ga0070681_10045099 | 3300005458 | Bacteria | 4412 |
| 180 | Ga0070681_10045120 | 3300005458 | Bacteria | 4411 |
| 181 | Ga0070681_10046045 | 3300005458 | Unclassified | 4362 |
| 182 | Ga0070681_10064230 | 3300005458 | Bacteria | 3642 |
| 183 | Ga0070681_10081283 | 3300005458 | Bacteria | 3196 |
| 184 | Ga0070681_10267962 | 3300005458 | Bacteria | 1619 |
| 185 | Ga0070681_10277058 | 3300005458 | Unclassified | 1588 |
| 186 | Ga0070681_10392102 | 3300005458 | Bacteria | 1299 |
| 187 | Ga0070681_10438884 | 3300005458 | Bacteria | 1217 |
| 188 | Ga0068867_100048374 | 3300005459 | Bacteria | 3128 |
| 189 | Ga0068867_100067550 | 3300005459 | Unclassified | 2666 |
| 190 | Ga0068867_100270608 | 3300005459 | Bacteria | 1389 |
| 191 | Ga0068867_100332474 | 3300005459 | Bacteria | 1262 |
| 192 | Ga0068867_100768046 | 3300005459 | Unclassified | 857 |
| 193 | Ga0070685_10009024 | 3300005466 | Bacteria | 5144 |
| 194 | Ga0070685_10031814 | 3300005466 | Bacteria | 2950 |
| 195 | Ga0070706_100001230 | 3300005467 | Bacteria | 27375 |
| 196 | Ga0070706_100002235 | 3300005467 | Bacteria | 19682 |
| 197 | Ga0070706_100013159 | 3300005467 | Bacteria | 7655 |
| 198 | Ga0070706_100031003 | 3300005467 | Unclassified | 4930 |
| 199 | Ga0070706_100055058 | 3300005467 | Unclassified | 3671 |
| 200 | Ga0070706_100076896 | 3300005467 | Unclassified | 3089 |
| 201 | Ga0070706_100119389 | 3300005467 | Unclassified | 2457 |
| 202 | Ga0070706_100245804 | 3300005467 | Bacteria | 1671 |
| 203 | Ga0070707_100001129 | 3300005468 | Bacteria | 26320 |
| 204 | Ga0070707_100006316 | 3300005468 | Bacteria | 11021 |
| 205 | Ga0070707_100010562 | 3300005468 | Bacteria | 8600 |
| 206 | Ga0070707_100038485 | 3300005468 | Unclassified | 4568 |
| 207 | Ga0070707_100098690 | 3300005468 | Unclassified | 2829 |
| 208 | Ga0070707_100164833 | 3300005468 | Unclassified | 2160 |
| 209 | Ga0070707_100572485 | 3300005468 | Bacteria | 1092 |
| 210 | Ga0070698_100001238 | 3300005471 | Bacteria | 28442 |
| 211 | Ga0070698_100021223 | 3300005471 | Bacteria | 6805 |
| 212 | Ga0070698_100102352 | 3300005471 | Bacteria | 2835 |
| 213 | Ga0070698_100897305 | 3300005471 | Bacteria | 832 |
| 214 | Ga0070699_100001045 | 3300005518 | Bacteria | 25776 |
| 215 | Ga0070699_100001170 | 3300005518 | Bacteria | 24337 |
| 216 | Ga0070699_100013583 | 3300005518 | Bacteria | 7010 |
| 217 | Ga0070699_100036584 | 3300005518 | Unclassified | 4247 |
| 218 | Ga0070699_100307141 | 3300005518 | Bacteria | 1424 |
| 219 | Ga0070699_100375577 | 3300005518 | Unclassified | 1283 |
| 220 | Ga0070679_100018579 | 3300005530 | Bacteria | 6748 |
| 221 | Ga0070679_100028624 | 3300005530 | Bacteria | 5494 |
| 222 | Ga0070679_100041563 | 3300005530 | Bacteria | 4575 |
| 223 | Ga0070679_100136812 | 3300005530 | Unclassified | 2431 |
| 224 | Ga0070679_100147055 | 3300005530 | Bacteria | 2334 |
| 225 | Ga0070679_100168909 | 3300005530 | Bacteria | 2160 |
| 226 | Ga0070679_100178045 | 3300005530 | Unclassified | 2099 |
| 227 | Ga0070679_100230747 | 3300005530 | Unclassified | 1810 |
| 228 | Ga0070679_100281263 | 3300005530 | Unclassified | 1616 |
| 229 | Ga0070684_100006676 | 3300005535 | Bacteria | 8945 |
| 230 | Ga0070684_100067165 | 3300005535 | Bacteria | 3149 |
| 231 | Ga0070684_100106741 | 3300005535 | Bacteria | 2507 |
| 232 | Ga0070684_100119146 | 3300005535 | Bacteria | 2373 |
| 233 | Ga0070684_100121214 | 3300005535 | Bacteria | 2353 |
| 234 | Ga0070697_100000092 | 3300005536 | Bacteria | 75107 |
| 235 | Ga0070697_100000390 | 3300005536 | Bacteria | 34089 |
| 236 | Ga0070697_100000630 | 3300005536 | Bacteria | 26714 |
| 237 | Ga0070697_100007135 | 3300005536 | Bacteria | 8692 |
| 238 | Ga0070697_100007394 | 3300005536 | Bacteria | 8552 |
| 239 | Ga0070697_100010927 | 3300005536 | Bacteria | 7091 |
| 240 | Ga0070697_100014170 | 3300005536 | Bacteria | 6262 |
| 241 | Ga0070697_100080714 | 3300005536 | Bacteria | 2680 |
| 242 | Ga0070697_100083676 | 3300005536 | Bacteria | 2631 |
| 243 | Ga0070697_100181013 | 3300005536 | Bacteria | 1786 |
| 244 | Ga0068853_100008057 | 3300005539 | Bacteria | 8450 |
| 245 | Ga0068853_100014016 | 3300005539 | Bacteria | 6560 |
| 246 | Ga0068853_100029102 | 3300005539 | Bacteria | 4653 |
| 247 | Ga0068853_100114017 | 3300005539 | Unclassified | 2404 |
| 248 | Ga0068853_100126603 | 3300005539 | Bacteria | 2282 |
| 249 | Ga0068853_100380501 | 3300005539 | Unclassified | 1318 |
| 250 | Ga0070672_100006933 | 3300005543 | Bacteria | 7659 |
| 251 | Ga0070686_100004713 | 3300005544 | Bacteria | 7519 |
| 252 | Ga0070686_100064105 | 3300005544 | Bacteria | 2383 |
| 253 | Ga0070695_100026588 | 3300005545 | Bacteria | 3582 |
| 254 | Ga0070695_100161742 | 3300005545 | Bacteria | 1572 |
| 255 | Ga0070695_100285990 | 3300005545 | Bacteria | 1213 |
| 256 | Ga0070696_100034110 | 3300005546 | Bacteria | 3500 |
| 257 | Ga0070696_100215466 | 3300005546 | Bacteria | 1439 |
| 258 | Ga0070693_100015053 | 3300005547 | Bacteria | 3978 |
| 259 | Ga0070693_100028622 | 3300005547 | Bacteria | 3031 |
| 260 | Ga0070693_100051056 | 3300005547 | Unclassified | 2366 |
| 261 | Ga0070693_100187278 | 3300005547 | Bacteria | 1336 |
| 262 | Ga0070693_100282128 | 3300005547 | Unclassified | 1113 |
| 263 | Ga0070693_100488828 | 3300005547 | Bacteria | 871 |
| 264 | Ga0070665_100100285 | 3300005548 | Bacteria | 2900 |
| 265 | Ga0070665_100255993 | 3300005548 | Bacteria | 1751 |
| 266 | Ga0068855_100001369 | 3300005563 | Bacteria | 30177 |
| 267 | Ga0068855_100006853 | 3300005563 | Bacteria | 13822 |
| 268 | Ga0068855_100011661 | 3300005563 | Bacteria | 10623 |
| 269 | Ga0068855_100058682 | 3300005563 | Bacteria | 4505 |
| 270 | Ga0068855_100077403 | 3300005563 | Bacteria | 3859 |
| 271 | Ga0068855_100088073 | 3300005563 | Bacteria | 3586 |
| 272 | Ga0068855_100162121 | 3300005563 | Bacteria | 2537 |
| 273 | Ga0068855_100344840 | 3300005563 | Unclassified | 1641 |
| 274 | Ga0068855_100560888 | 3300005563 | Unclassified | 1235 |
| 275 | Ga0068855_100575122 | 3300005563 | Bacteria | 1217 |
| 276 | Ga0068855_100575951 | 3300005563 | Bacteria | 1216 |
| 277 | Ga0070664_100000897 | 3300005564 | Bacteria | 23165 |
| 278 | Ga0070664_100002745 | 3300005564 | Bacteria | 14212 |
| 279 | Ga0070664_100116325 | 3300005564 | Bacteria | 2338 |
| 280 | Ga0070664_100582324 | 3300005564 | Unclassified | 1037 |
| 281 | Ga0068857_100003643 | 3300005577 | Bacteria | 12913 |
| 282 | Ga0068857_100036791 | 3300005577 | Bacteria | 4337 |
| 283 | Ga0068857_100042798 | 3300005577 | Bacteria | 4018 |
| 284 | Ga0068857_100043637 | 3300005577 | Unclassified | 3977 |
| 285 | Ga0068857_100055135 | 3300005577 | Unclassified | 3528 |
| 286 | Ga0068857_100704569 | 3300005577 | Bacteria | 959 |
| 287 | Ga0068857_100753642 | 3300005577 | Unclassified | 928 |
| 288 | Ga0068854_100001461 | 3300005578 | Bacteria | 14306 |
| 289 | Ga0068854_100008594 | 3300005578 | Bacteria | 6573 |
| 290 | Ga0068854_100052238 | 3300005578 | Bacteria | 2930 |
| 291 | Ga0068854_100081104 | 3300005578 | Unclassified | 2395 |
| 292 | Ga0068854_100178857 | 3300005578 | Unclassified | 1656 |
| 293 | Ga0068854_100671478 | 3300005578 | Unclassified | 892 |
| 294 | Ga0068856_100000995 | 3300005614 | Bacteria | 30196 |
| 295 | Ga0068856_100007891 | 3300005614 | Bacteria | 10395 |
| 296 | Ga0068856_100009877 | 3300005614 | Bacteria | 9266 |
| 297 | Ga0068856_100035248 | 3300005614 | Bacteria | 4903 |
| 298 | Ga0068856_100053539 | 3300005614 | Bacteria | 3979 |
| 299 | Ga0068856_100057899 | 3300005614 | Unclassified | 3826 |
| 300 | Ga0068856_100082778 | 3300005614 | Bacteria | 3185 |
| 301 | Ga0068856_100168296 | 3300005614 | Bacteria | 2203 |
| 302 | Ga0068856_100175193 | 3300005614 | Bacteria | 2157 |
| 303 | Ga0068856_100295483 | 3300005614 | Bacteria | 1637 |
| 304 | Ga0068856_100301052 | 3300005614 | Unclassified | 1621 |
| 305 | Ga0070702_100061318 | 3300005615 | Bacteria | 2190 |
| 306 | Ga0070702_100418593 | 3300005615 | Unclassified | 963 |
| 307 | Ga0068852_100004238 | 3300005616 | Bacteria | 10126 |
| 308 | Ga0068852_100018595 | 3300005616 | Bacteria | 5476 |
| 309 | Ga0068852_100047161 | 3300005616 | Bacteria | 3674 |
| 310 | Ga0068852_100166064 | 3300005616 | Bacteria | 2065 |
| 311 | Ga0068852_100307286 | 3300005616 | Bacteria | 1537 |
| 312 | Ga0068852_100561500 | 3300005616 | Bacteria | 1143 |
| 313 | Ga0068852_100687056 | 3300005616 | Unclassified | 1033 |
| 314 | Ga0068852_101052688 | 3300005616 | Bacteria | 833 |
| 315 | Ga0068852_101353859 | 3300005616 | Unclassified | 734 |
| 316 | Ga0068859_100020260 | 3300005617 | Bacteria | 6676 |
| 317 | Ga0068859_100076021 | 3300005617 | Bacteria | 3399 |
| 318 | Ga0068859_100091071 | 3300005617 | Unclassified | 3100 |
| 319 | Ga0068864_100003006 | 3300005618 | Bacteria | 13936 |
| 320 | Ga0068864_100021497 | 3300005618 | Bacteria | 5405 |
| 321 | Ga0068864_100030698 | 3300005618 | Bacteria | 4556 |
| 322 | Ga0068864_100062311 | 3300005618 | Unclassified | 3231 |
| 323 | Ga0068864_100259322 | 3300005618 | Bacteria | 1616 |
| 324 | Ga0068866_10005181 | 3300005718 | Bacteria | 5370 |
| 325 | Ga0068866_10018825 | 3300005718 | Bacteria | 3131 |
| 326 | Ga0068866_10193835 | 3300005718 | Bacteria | 1209 |
| 327 | Ga0068866_10208038 | 3300005718 | Unclassified | 1173 |
| 328 | Ga0068861_100012876 | 3300005719 | Bacteria | 5840 |
| 329 | Ga0068861_100080151 | 3300005719 | Bacteria | 2554 |
| 330 | Ga0068861_100087408 | 3300005719 | Bacteria | 2453 |
| 331 | Ga0068851_10008910 | 3300005834 | Bacteria | 4653 |
| 332 | Ga0068851_10013151 | 3300005834 | Bacteria | 3915 |
| 333 | Ga0068851_10029239 | 3300005834 | Unclassified | 2727 |
| 334 | Ga0068851_10282003 | 3300005834 | Unclassified | 950 |
| 335 | Ga0068870_10002902 | 3300005840 | Bacteria | 7224 |
| 336 | Ga0068870_10085367 | 3300005840 | Bacteria | 1754 |
| 337 | Ga0068863_100001977 | 3300005841 | Bacteria | 20384 |
| 338 | Ga0068863_100071658 | 3300005841 | Bacteria | 3278 |
| 339 | Ga0068863_100079746 | 3300005841 | Bacteria | 3100 |
| 340 | Ga0068863_100110800 | 3300005841 | Bacteria | 2614 |
| 341 | Ga0068863_100125098 | 3300005841 | Unclassified | 2452 |
| 342 | Ga0068863_100275007 | 3300005841 | Bacteria | 1631 |
| 343 | Ga0068858_100000404 | 3300005842 | Bacteria | 44997 |
| 344 | Ga0068858_100001080 | 3300005842 | Bacteria | 28247 |
| 345 | Ga0068858_100038173 | 3300005842 | Unclassified | 4454 |
| 346 | Ga0068858_100062953 | 3300005842 | Bacteria | 3431 |
| 347 | Ga0068858_100062973 | 3300005842 | Bacteria | 3431 |
| 348 | Ga0068858_100081667 | 3300005842 | Bacteria | 3004 |
| 349 | Ga0068858_100627525 | 3300005842 | Bacteria | 1043 |
| 350 | Ga0068860_100010559 | 3300005843 | Bacteria | 9124 |
| 351 | Ga0068860_100061035 | 3300005843 | Unclassified | 3582 |
| 352 | Ga0068860_100061841 | 3300005843 | Unclassified | 3558 |
| 353 | Ga0068860_100071618 | 3300005843 | Unclassified | 3293 |
| 354 | Ga0068860_100184530 | 3300005843 | Bacteria | 2017 |
| 355 | Ga0068860_100315994 | 3300005843 | Bacteria | 1532 |
| 356 | Ga0068862_100005387 | 3300005844 | Bacteria | 10703 |
| 357 | Ga0068862_100018991 | 3300005844 | Bacteria | 5731 |
| 358 | Ga0068862_100150532 | 3300005844 | Bacteria | 2071 |
| 359 | Ga0068862_100162770 | 3300005844 | Unclassified | 1993 |
| 360 | Ga0081540_1074881 | 3300005983 | Unclassified | 1549 |
| 361 | Ga0070717_10001111 | 3300006028 | Bacteria | 18150 |
| 362 | Ga0070717_10004965 | 3300006028 | Bacteria | 9676 |
| 363 | Ga0070717_10005101 | 3300006028 | Bacteria | 9577 |
| 364 | Ga0070717_10006905 | 3300006028 | Bacteria | 8382 |
| 365 | Ga0070717_10008773 | 3300006028 | Bacteria | 7569 |
| 366 | Ga0070717_10025076 | 3300006028 | Bacteria | 4737 |
| 367 | Ga0070717_10027759 | 3300006028 | Bacteria | 4526 |
| 368 | Ga0070717_10049947 | 3300006028 | Bacteria | 3435 |
| 369 | Ga0070717_10084239 | 3300006028 | Unclassified | 2674 |
| 370 | Ga0070717_10092273 | 3300006028 | Bacteria | 2558 |
| 371 | Ga0070717_10122352 | 3300006028 | Unclassified | 2230 |
| 372 | Ga0070717_10159457 | 3300006028 | Unclassified | 1956 |
| 373 | Ga0070717_10187485 | 3300006028 | Bacteria | 1806 |
| 374 | Ga0070717_10190248 | 3300006028 | Bacteria | 1793 |
| 375 | Ga0070717_10483566 | 3300006028 | Unclassified | 1118 |
| 376 | Ga0070717_10652242 | 3300006028 | Bacteria | 955 |
| 377 | Ga0070717_10958687 | 3300006028 | Unclassified | 779 |
| 378 | Ga0070715_10036619 | 3300006163 | Bacteria | 2025 |
| 379 | Ga0070715_10061081 | 3300006163 | Unclassified | 1654 |
| 380 | Ga0070715_10237498 | 3300006163 | Unclassified | 946 |
| 381 | Ga0070716_100000245 | 3300006173 | Bacteria | 21690 |
| 382 | Ga0070716_100001067 | 3300006173 | Bacteria | 11999 |
| 383 | Ga0070716_100003370 | 3300006173 | Bacteria | 7518 |
| 384 | Ga0070716_100009779 | 3300006173 | Bacteria | 4792 |
| 385 | Ga0070716_100024382 | 3300006173 | Bacteria | 3219 |
| 386 | Ga0070716_100025014 | 3300006173 | Bacteria | 3180 |
| 387 | Ga0070716_100036148 | 3300006173 | Bacteria | 2722 |
| 388 | Ga0070716_100077776 | 3300006173 | Bacteria | 1970 |
| 389 | Ga0070716_100082166 | 3300006173 | Bacteria | 1926 |
| 390 | Ga0070716_100106187 | 3300006173 | Bacteria | 1731 |
| 391 | Ga0070716_100120781 | 3300006173 | Unclassified | 1640 |
| 392 | Ga0070716_100387439 | 3300006173 | Bacteria | 1001 |
| 393 | Ga0070716_100402603 | 3300006173 | Bacteria | 984 |
| 394 | Ga0070716_100670127 | 3300006173 | Unclassified | 789 |
| 395 | Ga0070712_100000137 | 3300006175 | Bacteria | 38061 |
| 396 | Ga0070712_100000160 | 3300006175 | Bacteria | 36252 |
| 397 | Ga0070712_100003932 | 3300006175 | Bacteria | 9151 |
| 398 | Ga0070712_100006526 | 3300006175 | Bacteria | 7242 |
| 399 | Ga0070712_100025987 | 3300006175 | Unclassified | 3896 |
| 400 | Ga0070712_100069905 | 3300006175 | Bacteria | 2506 |
| 401 | Ga0070712_100098125 | 3300006175 | Bacteria | 2161 |
| 402 | Ga0070712_100162254 | 3300006175 | Bacteria | 1727 |
| 403 | Ga0070712_100235704 | 3300006175 | Bacteria | 1455 |
| 404 | Ga0070712_100438380 | 3300006175 | Unclassified | 1086 |
| 405 | Ga0097621_100000866 | 3300006237 | Bacteria | 21263 |
| 406 | Ga0097621_100008142 | 3300006237 | Bacteria | 7539 |
| 407 | Ga0097621_100012133 | 3300006237 | Bacteria | 6376 |
| 408 | Ga0097621_100110307 | 3300006237 | Bacteria | 2324 |
| 409 | Ga0097621_100120754 | 3300006237 | Bacteria | 2222 |
| 410 | Ga0097621_100176521 | 3300006237 | Unclassified | 1844 |
| 411 | Ga0097621_100385304 | 3300006237 | Bacteria | 1253 |
| 412 | Ga0097621_100482653 | 3300006237 | Bacteria | 1120 |
| 413 | Ga0068871_100000389 | 3300006358 | Bacteria | 30917 |
| 414 | Ga0068871_100004381 | 3300006358 | Bacteria | 9812 |
| 415 | Ga0068871_100013588 | 3300006358 | Bacteria | 6045 |
| 416 | Ga0068871_100020430 | 3300006358 | Bacteria | 5073 |
| 417 | Ga0068871_100061823 | 3300006358 | Bacteria | 3060 |
| 418 | Ga0068871_100233209 | 3300006358 | Bacteria | 1598 |
| 419 | Ga0068871_100233603 | 3300006358 | Bacteria | 1597 |
| 420 | Ga0068871_100347086 | 3300006358 | Bacteria | 1312 |
| 421 | Ga0068871_100624214 | 3300006358 | Unclassified | 982 |
| 422 | Ga0075433_10025998 | 3300006852 | Bacteria | 4952 |
| 423 | Ga0075434_100025649 | 3300006871 | Bacteria | 5768 |
| 424 | Ga0075434_100043722 | 3300006871 | Bacteria | 4443 |
| 425 | Ga0068865_100038271 | 3300006881 | Unclassified | 3245 |
| 426 | Ga0068865_100057745 | 3300006881 | Bacteria | 2708 |
| 427 | Ga0068865_100437395 | 3300006881 | Unclassified | 1079 |
| 428 | Ga0075436_100000617 | 3300006914 | Bacteria | 23305 |
| 429 | Ga0075436_100005379 | 3300006914 | Bacteria | 8811 |
| 430 | Ga0075436_100008224 | 3300006914 | Bacteria | 7138 |
| 431 | Ga0075436_100071120 | 3300006914 | Unclassified | 2405 |
| 432 | Ga0075436_100100756 | 3300006914 | Unclassified | 2012 |
| 433 | Ga0075436_100136394 | 3300006914 | Bacteria | 1723 |
| 434 | Ga0075436_100343536 | 3300006914 | Unclassified | 1075 |
| 435 | Ga0097620_100020260 | 3300006931 | Bacteria | 6676 |
| 436 | Ga0097620_100076013 | 3300006931 | Bacteria | 3399 |
| 437 | Ga0097620_100091067 | 3300006931 | Unclassified | 3100 |
| 438 | Ga0075435_100006248 | 3300007076 | Bacteria | 8412 |
| 439 | Ga0075435_100015023 | 3300007076 | Bacteria | 5811 |
| 440 | Ga0075435_100018883 | 3300007076 | Bacteria | 5254 |
| 441 | Ga0075435_100106884 | 3300007076 | Bacteria | 2324 |
| 442 | Ga0075435_100695746 | 3300007076 | Unclassified | 883 |
| 443 | Ga0099794_10040998 | 3300007265 | Bacteria | 2203 |
| 444 | Ga0099795_10018617 | 3300007788 | Unclassified | 2234 |
| 445 | Ga0105240_10012373 | 3300009093 | Bacteria | 11783 |
| 446 | Ga0105240_10016937 | 3300009093 | Archaea | 9849 |
| 447 | Ga0105240_10048990 | 3300009093 | Bacteria | 5336 |
| 448 | Ga0105240_10057299 | 3300009093 | Unclassified | 4869 |
| 449 | Ga0105240_10059796 | 3300009093 | Unclassified | 4753 |
| 450 | Ga0105240_10155789 | 3300009093 | Bacteria | 2717 |
| 451 | Ga0105240_10178379 | 3300009093 | Bacteria | 2509 |
| 452 | Ga0105240_10300769 | 3300009093 | Unclassified | 1835 |
| 453 | Ga0105240_10323692 | 3300009093 | Bacteria | 1756 |
| 454 | Ga0105240_10423596 | 3300009093 | Bacteria | 1495 |
| 455 | Ga0111539_10251988 | 3300009094 | Unclassified | 2056 |
| 456 | Ga0105245_10002517 | 3300009098 | Bacteria | 16522 |
| 457 | Ga0105245_10005508 | 3300009098 | Bacteria | 11118 |
| 458 | Ga0105245_10005571 | 3300009098 | Bacteria | 11066 |
| 459 | Ga0105245_10079867 | 3300009098 | Unclassified | 2988 |
| 460 | Ga0105245_10204433 | 3300009098 | Unclassified | 1898 |
| 461 | Ga0105245_10259778 | 3300009098 | Bacteria | 1690 |
| 462 | Ga0105245_10474573 | 3300009098 | Bacteria | 1263 |
| 463 | Ga0105247_10002780 | 3300009101 | Bacteria | 11715 |
| 464 | Ga0105247_10013406 | 3300009101 | Unclassified | 4915 |
| 465 | Ga0105247_10049016 | 3300009101 | Bacteria | 2596 |
| 466 | Ga0105247_10263774 | 3300009101 | Bacteria | 1182 |
| 467 | Ga0105247_10474945 | 3300009101 | Unclassified | 906 |
| 468 | Ga0105243_10116675 | 3300009148 | Bacteria | 2243 |
| 469 | Ga0105241_10015361 | 3300009174 | Bacteria | 5607 |
| 470 | Ga0105241_10027756 | 3300009174 | Bacteria | 4214 |
| 471 | Ga0105241_10035343 | 3300009174 | Bacteria | 3758 |
| 472 | Ga0105241_10036363 | 3300009174 | Bacteria | 3705 |
| 473 | Ga0105241_10118815 | 3300009174 | Bacteria | 2126 |
| 474 | Ga0105241_10197038 | 3300009174 | Bacteria | 1680 |
| 475 | Ga0105241_10233179 | 3300009174 | Bacteria | 1552 |
| 476 | Ga0105241_10251502 | 3300009174 | Bacteria | 1498 |
| 477 | Ga0105241_10361556 | 3300009174 | Unclassified | 1263 |
| 478 | Ga0105241_10472177 | 3300009174 | Unclassified | 1113 |
| 479 | Ga0105242_10003041 | 3300009176 | Bacteria | 13109 |
| 480 | Ga0105242_10019959 | 3300009176 | Bacteria | 5250 |
| 481 | Ga0105242_10062961 | 3300009176 | Bacteria | 3054 |
| 482 | Ga0105242_10248530 | 3300009176 | Bacteria | 1602 |
| 483 | Ga0105242_10253551 | 3300009176 | Bacteria | 1586 |
| 484 | Ga0105248_10037033 | 3300009177 | Bacteria | 5455 |
| 485 | Ga0105248_10047910 | 3300009177 | Bacteria | 4793 |
| 486 | Ga0105248_10061302 | 3300009177 | Bacteria | 4223 |
| 487 | Ga0105248_10140590 | 3300009177 | Bacteria | 2723 |
| 488 | Ga0105248_10248648 | 3300009177 | Bacteria | 2002 |
| 489 | Ga0105248_10258611 | 3300009177 | Unclassified | 1960 |
| 490 | Ga0105248_10334378 | 3300009177 | Bacteria | 1706 |
| 491 | Ga0105248_10336215 | 3300009177 | Bacteria | 1700 |
| 492 | Ga0105237_10153239 | 3300009545 | Unclassified | 2301 |
| 493 | Ga0105237_10221497 | 3300009545 | Bacteria | 1892 |
| 494 | Ga0105237_10280979 | 3300009545 | Bacteria | 1667 |
| 495 | Ga0105237_10299139 | 3300009545 | Bacteria | 1612 |
| 496 | Ga0105237_10380467 | 3300009545 | Bacteria | 1416 |
| 497 | Ga0105237_10523413 | 3300009545 | Bacteria | 1192 |
| 498 | Ga0105237_10597693 | 3300009545 | Unclassified | 1110 |
| 499 | Ga0105238_10000214 | 3300009551 | Bacteria | 64373 |
| 500 | Ga0105238_10015383 | 3300009551 | Bacteria | 7745 |
| 501 | Ga0105238_10064054 | 3300009551 | Bacteria | 3677 |
| 502 | Ga0105238_10099757 | 3300009551 | Bacteria | 2887 |
| 503 | Ga0105238_10110643 | 3300009551 | Bacteria | 2727 |
| 504 | Ga0105238_10250616 | 3300009551 | Bacteria | 1749 |
| 505 | Ga0105238_10811014 | 3300009551 | Bacteria | 952 |
| 506 | Ga0105249_10002544 | 3300009553 | Bacteria | 15785 |
| 507 | Ga0105249_10003055 | 3300009553 | Bacteria | 14445 |
| 508 | Ga0105249_10508169 | 3300009553 | Bacteria | 1251 |
| 509 | Ga0105249_11392457 | 3300009553 | Unclassified | 773 |
| 510 | Ga0099796_10009269 | 3300010159 | Bacteria | 2658 |
| 511 | Ga0099796_10018605 | 3300010159 | Bacteria | 2090 |
| 512 | Ga0099796_10149114 | 3300010159 | Bacteria | 920 |
| 513 | Ga0105239_10005155 | 3300010375 | Bacteria | 15426 |
| 514 | Ga0105239_10009279 | 3300010375 | Bacteria | 11121 |
| 515 | Ga0105239_10031699 | 3300010375 | Bacteria | 5809 |
| 516 | Ga0105239_10122752 | 3300010375 | Unclassified | 2886 |
| 517 | Ga0105239_10160101 | 3300010375 | Bacteria | 2514 |
| 518 | Ga0105239_10225318 | 3300010375 | Bacteria | 2103 |
| 519 | Ga0105239_10241550 | 3300010375 | Bacteria | 2027 |
| 520 | Ga0105239_10429208 | 3300010375 | Bacteria | 1498 |
| 521 | Ga0105246_10002563 | 3300011119 | Bacteria | 10988 |
| 522 | Ga0105246_10057806 | 3300011119 | Bacteria | 2685 |
| 523 | Ga0105246_10152473 | 3300011119 | Bacteria | 1751 |
| 524 | Ga0105246_10402909 | 3300011119 | Unclassified | 1137 |
| 525 | Ga0157373_10021339 | 3300013100 | Bacteria | 4704 |
| 526 | Ga0157373_10046278 | 3300013100 | Unclassified | 3104 |
| 527 | Ga0157373_10068830 | 3300013100 | Unclassified | 2502 |
| 528 | Ga0157373_10087635 | 3300013100 | Bacteria | 2193 |
| 529 | Ga0157373_10102141 | 3300013100 | Unclassified | 2017 |
| 530 | Ga0157373_10156450 | 3300013100 | Unclassified | 1603 |
| 531 | Ga0157371_10006751 | 3300013102 | Bacteria | 9382 |
| 532 | Ga0157371_10019416 | 3300013102 | Bacteria | 5014 |
| 533 | Ga0157371_10082689 | 3300013102 | Bacteria | 2273 |
| 534 | Ga0157371_10120725 | 3300013102 | Unclassified | 1863 |
| 535 | Ga0157370_10093091 | 3300013104 | Bacteria | 2828 |
| 536 | Ga0157370_10249512 | 3300013104 | Bacteria | 1642 |
| 537 | Ga0157369_10001356 | 3300013105 | Bacteria | 30251 |
| 538 | Ga0157369_10001450 | 3300013105 | Bacteria | 29095 |
| 539 | Ga0157369_10024189 | 3300013105 | Bacteria | 6760 |
| 540 | Ga0157369_10030481 | 3300013105 | Bacteria | 5949 |
| 541 | Ga0157369_10040105 | 3300013105 | Bacteria | 5114 |
| 542 | Ga0157369_10073618 | 3300013105 | Bacteria | 3665 |
| 543 | Ga0157369_10138669 | 3300013105 | Bacteria | 2574 |
| 544 | Ga0157369_10219666 | 3300013105 | Bacteria | 1989 |
| 545 | Ga0157369_10220534 | 3300013105 | Bacteria | 1985 |
| 546 | Ga0157369_11181304 | 3300013105 | Unclassified | 781 |
| 547 | Ga0157374_10000634 | 3300013296 | Bacteria | 30935 |
| 548 | Ga0157374_10000933 | 3300013296 | Bacteria | 25457 |
| 549 | Ga0157374_10012477 | 3300013296 | Bacteria | 7395 |
| 550 | Ga0157374_10014623 | 3300013296 | Bacteria | 6868 |
| 551 | Ga0157374_10021322 | 3300013296 | Bacteria | 5764 |
| 552 | Ga0157374_10063078 | 3300013296 | Unclassified | 3475 |
| 553 | Ga0157374_10090020 | 3300013296 | Bacteria | 2925 |
| 554 | Ga0157374_10323651 | 3300013296 | Bacteria | 1528 |
| 555 | Ga0157374_10783876 | 3300013296 | Unclassified | 969 |
| 556 | Ga0157378_10000202 | 3300013297 | Bacteria | 58070 |
| 557 | Ga0157378_10000725 | 3300013297 | Bacteria | 30797 |
| 558 | Ga0157378_10001987 | 3300013297 | Bacteria | 18289 |
| 559 | Ga0157378_10011031 | 3300013297 | Bacteria | 7908 |
| 560 | Ga0157378_10015615 | 3300013297 | Bacteria | 6651 |
| 561 | Ga0157378_10024355 | 3300013297 | Bacteria | 5324 |
| 562 | Ga0157378_10026606 | 3300013297 | Bacteria | 5098 |
| 563 | Ga0157378_10095627 | 3300013297 | Bacteria | 2706 |
| 564 | Ga0157378_10241690 | 3300013297 | Bacteria | 1725 |
| 565 | Ga0157378_10287912 | 3300013297 | Bacteria | 1586 |
| 566 | Ga0163162_10012550 | 3300013306 | Bacteria | 8275 |
| 567 | Ga0163162_10019094 | 3300013306 | Bacteria | 6723 |
| 568 | Ga0163162_10043772 | 3300013306 | Unclassified | 4483 |
| 569 | Ga0163162_10093677 | 3300013306 | Bacteria | 3089 |
| 570 | Ga0163162_10176548 | 3300013306 | Bacteria | 2262 |
| 571 | Ga0163162_10645872 | 3300013306 | Unclassified | 1182 |
| 572 | Ga0157372_10001366 | 3300013307 | Bacteria | 26403 |
| 573 | Ga0157372_10001445 | 3300013307 | Bacteria | 25697 |
| 574 | Ga0157372_10004384 | 3300013307 | Bacteria | 15059 |
| 575 | Ga0157372_10017432 | 3300013307 | Bacteria | 7708 |
| 576 | Ga0157372_10033801 | 3300013307 | Bacteria | 5619 |
| 577 | Ga0157372_10047456 | 3300013307 | Bacteria | 4773 |
| 578 | Ga0157372_10105423 | 3300013307 | Unclassified | 3224 |
| 579 | Ga0157372_10171357 | 3300013307 | Bacteria | 2511 |
| 580 | Ga0157372_10234647 | 3300013307 | Bacteria | 2127 |
| 581 | Ga0157372_10302565 | 3300013307 | Bacteria | 1860 |
| 582 | Ga0157372_10501345 | 3300013307 | Unclassified | 1416 |
| 583 | Ga0157372_10823502 | 3300013307 | Bacteria | 1078 |
| 584 | Ga0157372_10861820 | 3300013307 | Bacteria | 1051 |
| 585 | Ga0157375_10094229 | 3300013308 | Unclassified | 3062 |
| 586 | Ga0157375_10238673 | 3300013308 | Bacteria | 1977 |
| 587 | Ga0163163_10002855 | 3300014325 | Bacteria | 14601 |
| 588 | Ga0163163_10016774 | 3300014325 | Bacteria | 6816 |
| 589 | Ga0163163_10057910 | 3300014325 | Unclassified | 3831 |
| 590 | Ga0163163_10074503 | 3300014325 | Bacteria | 3387 |
| 591 | Ga0163163_10135298 | 3300014325 | Bacteria | 2506 |
| 592 | Ga0163163_10307810 | 3300014325 | Unclassified | 1637 |
| 593 | Ga0163163_10848926 | 3300014325 | Unclassified | 977 |
| 594 | Ga0157380_10044873 | 3300014326 | Bacteria | 3466 |
| 595 | Ga0157380_10356561 | 3300014326 | Bacteria | 1371 |
| 596 | Ga0182008_10005873 | 3300014497 | Bacteria | 6933 |
| 597 | Ga0182008_10006717 | 3300014497 | Bacteria | 6405 |
| 598 | Ga0157377_10002769 | 3300014745 | Bacteria | 7809 |
| 599 | Ga0157377_10187647 | 3300014745 | Unclassified | 1304 |
| 600 | Ga0157379_10008575 | 3300014968 | Bacteria | 8895 |
| 601 | Ga0157379_10091518 | 3300014968 | Bacteria | 2728 |
| 602 | Ga0157379_10223549 | 3300014968 | Bacteria | 1706 |
| 603 | Ga0157379_10439714 | 3300014968 | Unclassified | 1202 |
| 604 | Ga0157379_10450281 | 3300014968 | Unclassified | 1188 |
| 605 | Ga0157376_10041763 | 3300014969 | Bacteria | 3757 |
| 606 | Ga0157376_10120230 | 3300014969 | Bacteria | 2327 |
| 607 | Ga0157376_10151535 | 3300014969 | Bacteria | 2091 |
| 608 | Ga0157376_10181851 | 3300014969 | Bacteria | 1922 |
| 609 | Ga0157376_10187991 | 3300014969 | Bacteria | 1892 |
| 610 | Ga0157376_10902401 | 3300014969 | Bacteria | 902 |
| 611 | Ga0182007_10008222 | 3300015262 | Bacteria | 4299 |
| 612 | Ga0182007_10015579 | 3300015262 | Bacteria | 2829 |
| 613 | Ga0163161_10011329 | 3300017792 | Bacteria | 6181 |
| 614 | Ga0206355_1443854 | 3300020076 | Unclassified | 1289 |
| 615 | Ga0213874_10010643 | 3300021377 | Bacteria | 2308 |
| 616 | Ga0213874_10155955 | 3300021377 | Unclassified | 799 |
| 617 | Ga0224712_10023051 | 3300022467 | Bacteria | 2156 |
| 618 | Ga0224570_100693 | 3300022730 | Unclassified | 2670 |
| 619 | Ga0224569_100208 | 3300022732 | Bacteria | 4832 |
| 620 | Ga0224571_100380 | 3300022734 | Unclassified | 2396 |
| 621 | Ga0224572_1008493 | 3300024225 | Unclassified | 1900 |
| 622 | Ga0224572_1011757 | 3300024225 | Bacteria | 1656 |
| 623 | Ga0228598_1000444 | 3300024227 | Bacteria | 8427 |
| 624 | Ga0228598_1001640 | 3300024227 | Unclassified | 4889 |
| 625 | Ga0228598_1009745 | 3300024227 | Unclassified | 1920 |
| 626 | Ga0228598_1043357 | 3300024227 | Unclassified | 889 |
| 627 | Ga0207697_10005790 | 3300025315 | Bacteria | 5696 |
| 628 | Ga0207656_10004119 | 3300025321 | Bacteria | 5050 |
| 629 | Ga0207656_10025256 | 3300025321 | Bacteria | 2410 |
| 630 | Ga0207656_10053100 | 3300025321 | Unclassified | 1757 |
| 631 | Ga0207656_10127260 | 3300025321 | Bacteria | 1191 |
| 632 | Ga0207682_10000826 | 3300025893 | Bacteria | 14304 |
| 633 | Ga0207692_10002949 | 3300025898 | Bacteria | 6591 |
| 634 | Ga0207692_10008329 | 3300025898 | Unclassified | 4288 |
| 635 | Ga0207692_10043513 | 3300025898 | Bacteria | 2235 |
| 636 | Ga0207692_10057058 | 3300025898 | Unclassified | 2006 |
| 637 | Ga0207692_10058217 | 3300025898 | Bacteria | 1990 |
| 638 | Ga0207692_10085800 | 3300025898 | Bacteria | 1695 |
| 639 | Ga0207692_10092433 | 3300025898 | Unclassified | 1644 |
| 640 | Ga0207692_10156211 | 3300025898 | Bacteria | 1311 |
| 641 | Ga0207692_10211514 | 3300025898 | Bacteria | 1145 |
| 642 | Ga0207692_10366318 | 3300025898 | Unclassified | 891 |
| 643 | Ga0207692_10378490 | 3300025898 | Unclassified | 878 |
| 644 | Ga0207642_10036653 | 3300025899 | Bacteria | 2107 |
| 645 | Ga0207642_10085903 | 3300025899 | Bacteria | 1540 |
| 646 | Ga0207642_10118802 | 3300025899 | Bacteria | 1360 |
| 647 | Ga0207642_10158218 | 3300025899 | Unclassified | 1213 |
| 648 | Ga0207642_10192767 | 3300025899 | Bacteria | 1120 |
| 649 | Ga0207642_10241147 | 3300025899 | Unclassified | 1021 |
| 650 | Ga0207710_10005993 | 3300025900 | Bacteria | 5211 |
| 651 | Ga0207710_10090240 | 3300025900 | Bacteria | 1433 |
| 652 | Ga0207710_10137062 | 3300025900 | Bacteria | 1179 |
| 653 | Ga0207688_10022482 | 3300025901 | Bacteria | 3450 |
| 654 | Ga0207680_10045858 | 3300025903 | Bacteria | 2581 |
| 655 | Ga0207680_10170647 | 3300025903 | Bacteria | 1465 |
| 656 | Ga0207647_10016942 | 3300025904 | Bacteria | 4961 |
| 657 | Ga0207647_10033091 | 3300025904 | Bacteria | 3314 |
| 658 | Ga0207647_10040863 | 3300025904 | Bacteria | 2919 |
| 659 | Ga0207685_10012926 | 3300025905 | Bacteria | 2565 |
| 660 | Ga0207685_10041434 | 3300025905 | Unclassified | 1723 |
| 661 | Ga0207685_10111628 | 3300025905 | Bacteria | 1186 |
| 662 | Ga0207685_10281829 | 3300025905 | Bacteria | 816 |
| 663 | Ga0207699_10000500 | 3300025906 | Bacteria | 19622 |
| 664 | Ga0207699_10004194 | 3300025906 | Bacteria | 6900 |
| 665 | Ga0207699_10018669 | 3300025906 | Bacteria | 3680 |
| 666 | Ga0207699_10046705 | 3300025906 | Unclassified | 2535 |
| 667 | Ga0207699_10054546 | 3300025906 | Bacteria | 2375 |
| 668 | Ga0207699_10088565 | 3300025906 | Unclassified | 1938 |
| 669 | Ga0207699_10107418 | 3300025906 | Unclassified | 1783 |
| 670 | Ga0207699_10114827 | 3300025906 | Bacteria | 1732 |
| 671 | Ga0207699_10116432 | 3300025906 | Bacteria | 1721 |
| 672 | Ga0207699_10139997 | 3300025906 | Unclassified | 1589 |
| 673 | Ga0207699_10141170 | 3300025906 | Bacteria | 1583 |
| 674 | Ga0207699_10153670 | 3300025906 | Bacteria | 1525 |
| 675 | Ga0207699_10154767 | 3300025906 | Unclassified | 1520 |
| 676 | Ga0207699_10184632 | 3300025906 | Unclassified | 1404 |
| 677 | Ga0207699_10264616 | 3300025906 | Bacteria | 1189 |
| 678 | Ga0207645_10000559 | 3300025907 | Bacteria | 30910 |
| 679 | Ga0207645_10004273 | 3300025907 | Bacteria | 10603 |
| 680 | Ga0207643_10001182 | 3300025908 | Bacteria | 15496 |
| 681 | Ga0207643_10166663 | 3300025908 | Bacteria | 1328 |
| 682 | Ga0207705_10307733 | 3300025909 | Bacteria | 1216 |
| 683 | Ga0207705_10617399 | 3300025909 | Unclassified | 843 |
| 684 | Ga0207684_10000447 | 3300025910 | Bacteria | 54429 |
| 685 | Ga0207684_10003786 | 3300025910 | Bacteria | 14599 |
| 686 | Ga0207684_10029173 | 3300025910 | Bacteria | 4699 |
| 687 | Ga0207684_10049625 | 3300025910 | Bacteria | 3560 |
| 688 | Ga0207684_10051528 | 3300025910 | Bacteria | 3493 |
| 689 | Ga0207684_10080416 | 3300025910 | Bacteria | 2773 |
| 690 | Ga0207684_10092510 | 3300025910 | Bacteria | 2577 |
| 691 | Ga0207654_10025850 | 3300025911 | Unclassified | 3173 |
| 692 | Ga0207654_10031513 | 3300025911 | Bacteria | 2921 |
| 693 | Ga0207654_10095545 | 3300025911 | Bacteria | 1821 |
| 694 | Ga0207654_10342241 | 3300025911 | Unclassified | 1028 |
| 695 | Ga0207707_10007113 | 3300025912 | Bacteria | 9749 |
| 696 | Ga0207707_10007719 | 3300025912 | Bacteria | 9366 |
| 697 | Ga0207707_10024683 | 3300025912 | Bacteria | 5260 |
| 698 | Ga0207707_10036015 | 3300025912 | Unclassified | 4327 |
| 699 | Ga0207707_10057464 | 3300025912 | Bacteria | 3386 |
| 700 | Ga0207707_10066212 | 3300025912 | Bacteria | 3146 |
| 701 | Ga0207707_10156366 | 3300025912 | Bacteria | 1994 |
| 702 | Ga0207707_10234807 | 3300025912 | Unclassified | 1595 |
| 703 | Ga0207707_10297769 | 3300025912 | Bacteria | 1395 |
| 704 | Ga0207695_10016663 | 3300025913 | Bacteria | 8587 |
| 705 | Ga0207695_10021009 | 3300025913 | Bacteria | 7457 |
| 706 | Ga0207695_10041339 | 3300025913 | Bacteria | 4935 |
| 707 | Ga0207695_10049139 | 3300025913 | Unclassified | 4449 |
| 708 | Ga0207695_10102997 | 3300025913 | Bacteria | 2847 |
| 709 | Ga0207695_10121129 | 3300025913 | Bacteria | 2584 |
| 710 | Ga0207695_10124888 | 3300025913 | Unclassified | 2537 |
| 711 | Ga0207695_10154131 | 3300025913 | Unclassified | 2234 |
| 712 | Ga0207695_10205401 | 3300025913 | Bacteria | 1883 |
| 713 | Ga0207695_10247082 | 3300025913 | Bacteria | 1684 |
| 714 | Ga0207695_10711240 | 3300025913 | Bacteria | 885 |
| 715 | Ga0207671_10078351 | 3300025914 | Bacteria | 2475 |
| 716 | Ga0207671_10089763 | 3300025914 | Bacteria | 2314 |
| 717 | Ga0207671_10127506 | 3300025914 | Bacteria | 1951 |
| 718 | Ga0207671_10567030 | 3300025914 | Unclassified | 905 |
| 719 | Ga0207693_10000015 | 3300025915 | Bacteria | 147464 |
| 720 | Ga0207693_10000271 | 3300025915 | Bacteria | 47827 |
| 721 | Ga0207693_10000440 | 3300025915 | Bacteria | 37946 |
| 722 | Ga0207693_10004290 | 3300025915 | Bacteria | 12084 |
| 723 | Ga0207693_10024713 | 3300025915 | Unclassified | 4765 |
| 724 | Ga0207693_10038411 | 3300025915 | Bacteria | 3771 |
| 725 | Ga0207693_10115303 | 3300025915 | Bacteria | 2109 |
| 726 | Ga0207693_10155648 | 3300025915 | Bacteria | 1797 |
| 727 | Ga0207693_10155976 | 3300025915 | Bacteria | 1795 |
| 728 | Ga0207693_10400660 | 3300025915 | Unclassified | 1073 |
| 729 | Ga0207693_10412689 | 3300025915 | Unclassified | 1055 |
| 730 | Ga0207693_10413818 | 3300025915 | Unclassified | 1054 |
| 731 | Ga0207693_10583447 | 3300025915 | Unclassified | 871 |
| 732 | Ga0207693_10702365 | 3300025915 | Unclassified | 783 |
| 733 | Ga0207663_10001723 | 3300025916 | Bacteria | 10272 |
| 734 | Ga0207663_10006828 | 3300025916 | Bacteria | 5874 |
| 735 | Ga0207663_10009827 | 3300025916 | Bacteria | 5064 |
| 736 | Ga0207663_10075107 | 3300025916 | Bacteria | 2192 |
| 737 | Ga0207663_10170658 | 3300025916 | Bacteria | 1545 |
| 738 | Ga0207663_10187486 | 3300025916 | Unclassified | 1483 |
| 739 | Ga0207663_10301875 | 3300025916 | Bacteria | 1197 |
| 740 | Ga0207663_10307800 | 3300025916 | Unclassified | 1186 |
| 741 | Ga0207663_10324188 | 3300025916 | Unclassified | 1158 |
| 742 | Ga0207663_10377198 | 3300025916 | Bacteria | 1080 |
| 743 | Ga0207660_10015217 | 3300025917 | Bacteria | 5075 |
| 744 | Ga0207660_10064752 | 3300025917 | Bacteria | 2639 |
| 745 | Ga0207660_10086028 | 3300025917 | Bacteria | 2320 |
| 746 | Ga0207660_10090299 | 3300025917 | Bacteria | 2269 |
| 747 | Ga0207660_10200976 | 3300025917 | Bacteria | 1557 |
| 748 | Ga0207660_10451090 | 3300025917 | Unclassified | 1040 |
| 749 | Ga0207662_10002448 | 3300025918 | Bacteria | 9305 |
| 750 | Ga0207662_10014408 | 3300025918 | Unclassified | 4437 |
| 751 | Ga0207662_10127370 | 3300025918 | Bacteria | 1602 |
| 752 | Ga0207662_10242781 | 3300025918 | Bacteria | 1180 |
| 753 | Ga0207657_10000766 | 3300025919 | Bacteria | 34045 |
| 754 | Ga0207657_10001795 | 3300025919 | Bacteria | 23148 |
| 755 | Ga0207657_10003111 | 3300025919 | Bacteria | 17745 |
| 756 | Ga0207649_10000344 | 3300025920 | Bacteria | 35179 |
| 757 | Ga0207649_10025834 | 3300025920 | Bacteria | 3429 |
| 758 | Ga0207649_10065227 | 3300025920 | Bacteria | 2304 |
| 759 | Ga0207649_10086039 | 3300025920 | Unclassified | 2047 |
| 760 | Ga0207649_10387069 | 3300025920 | Bacteria | 1043 |
| 761 | Ga0207652_10030969 | 3300025921 | Bacteria | 4487 |
| 762 | Ga0207652_10032508 | 3300025921 | Bacteria | 4387 |
| 763 | Ga0207652_10062497 | 3300025921 | Bacteria | 3218 |
| 764 | Ga0207652_10116861 | 3300025921 | Bacteria | 2370 |
| 765 | Ga0207652_10132899 | 3300025921 | Unclassified | 2220 |
| 766 | Ga0207652_10445541 | 3300025921 | Unclassified | 1167 |
| 767 | Ga0207652_10466814 | 3300025921 | Bacteria | 1137 |
| 768 | Ga0207652_10546977 | 3300025921 | Unclassified | 1041 |
| 769 | Ga0207652_10626009 | 3300025921 | Unclassified | 963 |
| 770 | Ga0207646_10000676 | 3300025922 | Bacteria | 44173 |
| 771 | Ga0207646_10000939 | 3300025922 | Bacteria | 37488 |
| 772 | Ga0207646_10067160 | 3300025922 | Bacteria | 3201 |
| 773 | Ga0207646_10106211 | 3300025922 | Unclassified | 2518 |
| 774 | Ga0207646_10231197 | 3300025922 | Unclassified | 1670 |
| 775 | Ga0207646_10556048 | 3300025922 | Unclassified | 1031 |
| 776 | Ga0207681_10015679 | 3300025923 | Bacteria | 4729 |
| 777 | Ga0207681_10368025 | 3300025923 | Bacteria | 1154 |
| 778 | Ga0207694_10002265 | 3300025924 | Bacteria | 15742 |
| 779 | Ga0207694_10162233 | 3300025924 | Bacteria | 1806 |
| 780 | Ga0207694_10170624 | 3300025924 | Bacteria | 1761 |
| 781 | Ga0207694_10202650 | 3300025924 | Bacteria | 1615 |
| 782 | Ga0207694_10582098 | 3300025924 | Unclassified | 941 |
| 783 | Ga0207650_10000058 | 3300025925 | Bacteria | 153056 |
| 784 | Ga0207659_10046383 | 3300025926 | Bacteria | 3068 |
| 785 | Ga0207659_10425788 | 3300025926 | Bacteria | 1114 |
| 786 | Ga0207687_10031371 | 3300025927 | Bacteria | 3590 |
| 787 | Ga0207687_10050749 | 3300025927 | Bacteria | 2889 |
| 788 | Ga0207687_10126800 | 3300025927 | Bacteria | 1918 |
| 789 | Ga0207687_10130104 | 3300025927 | Bacteria | 1896 |
| 790 | Ga0207687_10156294 | 3300025927 | Bacteria | 1745 |
| 791 | Ga0207687_10207103 | 3300025927 | Bacteria | 1536 |
| 792 | Ga0207687_10920984 | 3300025927 | Bacteria | 748 |
| 793 | Ga0207700_10000095 | 3300025928 | Bacteria | 54191 |
| 794 | Ga0207700_10000224 | 3300025928 | Bacteria | 33925 |
| 795 | Ga0207700_10011823 | 3300025928 | Bacteria | 5589 |
| 796 | Ga0207700_10032670 | 3300025928 | Bacteria | 3715 |
| 797 | Ga0207700_10049855 | 3300025928 | Bacteria | 3116 |
| 798 | Ga0207700_10056574 | 3300025928 | Bacteria | 2953 |
| 799 | Ga0207700_10072527 | 3300025928 | Bacteria | 2656 |
| 800 | Ga0207700_10110494 | 3300025928 | Bacteria | 2211 |
| 801 | Ga0207700_10142878 | 3300025928 | Unclassified | 1968 |
| 802 | Ga0207700_10169504 | 3300025928 | Bacteria | 1820 |
| 803 | Ga0207700_10177684 | 3300025928 | Bacteria | 1780 |
| 804 | Ga0207700_10200661 | 3300025928 | Bacteria | 1681 |
| 805 | Ga0207700_10615083 | 3300025928 | Bacteria | 967 |
| 806 | Ga0207700_10855998 | 3300025928 | Unclassified | 813 |
| 807 | Ga0207664_10000265 | 3300025929 | Bacteria | 39382 |
| 808 | Ga0207664_10013334 | 3300025929 | Bacteria | 5896 |
| 809 | Ga0207664_10023325 | 3300025929 | Bacteria | 4634 |
| 810 | Ga0207664_10035312 | 3300025929 | Bacteria | 3856 |
| 811 | Ga0207664_10096721 | 3300025929 | Bacteria | 2431 |
| 812 | Ga0207664_10127067 | 3300025929 | Bacteria | 2142 |
| 813 | Ga0207664_10149849 | 3300025929 | Bacteria | 1981 |
| 814 | Ga0207664_10279644 | 3300025929 | Bacteria | 1464 |
| 815 | Ga0207664_10279866 | 3300025929 | Unclassified | 1464 |
| 816 | Ga0207664_10458497 | 3300025929 | Bacteria | 1138 |
| 817 | Ga0207664_10572533 | 3300025929 | Unclassified | 1014 |
| 818 | Ga0207664_10877192 | 3300025929 | Unclassified | 806 |
| 819 | Ga0207664_11037468 | 3300025929 | Unclassified | 734 |
| 820 | Ga0207644_10053840 | 3300025931 | Unclassified | 2897 |
| 821 | Ga0207644_10139235 | 3300025931 | Bacteria | 1867 |
| 822 | Ga0207690_10045837 | 3300025932 | Unclassified | 2892 |
| 823 | Ga0207690_10146131 | 3300025932 | Bacteria | 1748 |
| 824 | Ga0207690_10217148 | 3300025932 | Bacteria | 1461 |
| 825 | Ga0207706_10000732 | 3300025933 | Bacteria | 34191 |
| 826 | Ga0207706_10000956 | 3300025933 | Bacteria | 29545 |
| 827 | Ga0207686_10037996 | 3300025934 | Bacteria | 2909 |
| 828 | Ga0207686_10086943 | 3300025934 | Unclassified | 2055 |
| 829 | Ga0207686_10097718 | 3300025934 | Bacteria | 1953 |
| 830 | Ga0207686_10306280 | 3300025934 | Bacteria | 1182 |
| 831 | Ga0207709_10145090 | 3300025935 | Bacteria | 1637 |
| 832 | Ga0207670_10004801 | 3300025936 | Bacteria | 7337 |
| 833 | Ga0207704_10030050 | 3300025938 | Bacteria | 3041 |
| 834 | Ga0207704_10040377 | 3300025938 | Unclassified | 2727 |
| 835 | Ga0207704_10402581 | 3300025938 | Unclassified | 1080 |
| 836 | Ga0207665_10000049 | 3300025939 | Bacteria | 76350 |
| 837 | Ga0207665_10001658 | 3300025939 | Bacteria | 14980 |
| 838 | Ga0207665_10004144 | 3300025939 | Bacteria | 9653 |
| 839 | Ga0207665_10006523 | 3300025939 | Bacteria | 7738 |
| 840 | Ga0207665_10014854 | 3300025939 | Bacteria | 5120 |
| 841 | Ga0207665_10021191 | 3300025939 | Unclassified | 4272 |
| 842 | Ga0207665_10063800 | 3300025939 | Bacteria | 2502 |
| 843 | Ga0207665_10067114 | 3300025939 | Bacteria | 2442 |
| 844 | Ga0207665_10086460 | 3300025939 | Unclassified | 2165 |
| 845 | Ga0207665_10091299 | 3300025939 | Bacteria | 2111 |
| 846 | Ga0207665_10121606 | 3300025939 | Unclassified | 1845 |
| 847 | Ga0207665_10128813 | 3300025939 | Bacteria | 1794 |
| 848 | Ga0207665_10134194 | 3300025939 | Bacteria | 1760 |
| 849 | Ga0207665_10141989 | 3300025939 | Bacteria | 1713 |
| 850 | Ga0207665_10148147 | 3300025939 | Unclassified | 1679 |
| 851 | Ga0207665_10251247 | 3300025939 | Bacteria | 1307 |
| 852 | Ga0207665_10463539 | 3300025939 | Unclassified | 974 |
| 853 | Ga0207691_10002552 | 3300025940 | Bacteria | 17794 |
| 854 | Ga0207711_10029133 | 3300025941 | Bacteria | 4653 |
| 855 | Ga0207711_10167073 | 3300025941 | Bacteria | 1995 |
| 856 | Ga0207711_10171699 | 3300025941 | Bacteria | 1968 |
| 857 | Ga0207711_10196885 | 3300025941 | Unclassified | 1838 |
| 858 | Ga0207711_10208013 | 3300025941 | Bacteria | 1787 |
| 859 | Ga0207711_10310597 | 3300025941 | Bacteria | 1456 |
| 860 | Ga0207711_10492921 | 3300025941 | Bacteria | 1142 |
| 861 | Ga0207711_10630831 | 3300025941 | Unclassified | 1000 |
| 862 | Ga0207689_10000512 | 3300025942 | Bacteria | 36765 |
| 863 | Ga0207689_10001703 | 3300025942 | Bacteria | 20842 |
| 864 | Ga0207689_10022953 | 3300025942 | Bacteria | 5241 |
| 865 | Ga0207689_10036804 | 3300025942 | Unclassified | 4062 |
| 866 | Ga0207689_10920582 | 3300025942 | Unclassified | 738 |
| 867 | Ga0207661_10000328 | 3300025944 | Bacteria | 30179 |
| 868 | Ga0207661_10041003 | 3300025944 | Unclassified | 3643 |
| 869 | Ga0207661_10060196 | 3300025944 | Bacteria | 3063 |
| 870 | Ga0207661_10440422 | 3300025944 | Unclassified | 1186 |
| 871 | Ga0207661_10548139 | 3300025944 | Unclassified | 1059 |
| 872 | Ga0207661_10625923 | 3300025944 | Unclassified | 989 |
| 873 | Ga0207679_10000170 | 3300025945 | Bacteria | 53584 |
| 874 | Ga0207679_10012413 | 3300025945 | Bacteria | 5555 |
| 875 | Ga0207679_10037212 | 3300025945 | Bacteria | 3458 |
| 876 | Ga0207679_10242360 | 3300025945 | Bacteria | 1528 |
| 877 | Ga0207679_10379013 | 3300025945 | Unclassified | 1240 |
| 878 | Ga0207679_11027818 | 3300025945 | Unclassified | 756 |
| 879 | Ga0207667_10006788 | 3300025949 | Bacteria | 13823 |
| 880 | Ga0207667_10031195 | 3300025949 | Bacteria | 5755 |
| 881 | Ga0207667_10054117 | 3300025949 | Bacteria | 4221 |
| 882 | Ga0207667_10067834 | 3300025949 | Bacteria | 3715 |
| 883 | Ga0207667_10128087 | 3300025949 | Unclassified | 2615 |
| 884 | Ga0207667_10204606 | 3300025949 | Bacteria | 2024 |
| 885 | Ga0207667_10242732 | 3300025949 | Bacteria | 1843 |
| 886 | Ga0207667_10291787 | 3300025949 | Bacteria | 1666 |
| 887 | Ga0207667_10867515 | 3300025949 | Unclassified | 896 |
| 888 | Ga0207651_10008651 | 3300025960 | Bacteria | 5513 |
| 889 | Ga0207651_10436601 | 3300025960 | Bacteria | 1121 |
| 890 | Ga0207712_10035640 | 3300025961 | Bacteria | 3383 |
| 891 | Ga0207712_10928332 | 3300025961 | Unclassified | 770 |
| 892 | Ga0207668_10162558 | 3300025972 | Bacteria | 1741 |
| 893 | Ga0207668_10968346 | 3300025972 | Unclassified | 759 |
| 894 | Ga0207640_10004443 | 3300025981 | Bacteria | 7606 |
| 895 | Ga0207640_10118892 | 3300025981 | Bacteria | 1889 |
| 896 | Ga0207640_10129664 | 3300025981 | Unclassified | 1821 |
| 897 | Ga0207640_10146244 | 3300025981 | Bacteria | 1730 |
| 898 | Ga0207640_10193978 | 3300025981 | Bacteria | 1533 |
| 899 | Ga0207640_10537530 | 3300025981 | Unclassified | 980 |
| 900 | Ga0207640_10560632 | 3300025981 | Unclassified | 961 |
| 901 | Ga0207658_10160407 | 3300025986 | Bacteria | 1842 |
| 902 | Ga0207658_10246020 | 3300025986 | Bacteria | 1517 |
| 903 | Ga0207658_10625116 | 3300025986 | Bacteria | 969 |
| 904 | Ga0207677_10009877 | 3300026023 | Bacteria | 5380 |
| 905 | Ga0207677_10016958 | 3300026023 | Unclassified | 4328 |
| 906 | Ga0207677_10034948 | 3300026023 | Bacteria | 3259 |
| 907 | Ga0207677_10092488 | 3300026023 | Bacteria | 2202 |
| 908 | Ga0207677_10100208 | 3300026023 | Bacteria | 2129 |
| 909 | Ga0207677_10119496 | 3300026023 | Bacteria | 1979 |
| 910 | Ga0207677_10291891 | 3300026023 | Unclassified | 1343 |
| 911 | Ga0207677_10657725 | 3300026023 | Bacteria | 926 |
| 912 | Ga0207677_10717955 | 3300026023 | Unclassified | 888 |
| 913 | Ga0207703_10001237 | 3300026035 | Bacteria | 23917 |
| 914 | Ga0207703_10003326 | 3300026035 | Bacteria | 13502 |
| 915 | Ga0207703_10051504 | 3300026035 | Bacteria | 3337 |
| 916 | Ga0207703_10070136 | 3300026035 | Unclassified | 2892 |
| 917 | Ga0207703_10070460 | 3300026035 | Bacteria | 2886 |
| 918 | Ga0207703_10162224 | 3300026035 | Bacteria | 1958 |
| 919 | Ga0207639_10005167 | 3300026041 | Bacteria | 8804 |
| 920 | Ga0207639_10005894 | 3300026041 | Bacteria | 8304 |
| 921 | Ga0207639_10014708 | 3300026041 | Bacteria | 5511 |
| 922 | Ga0207639_10071290 | 3300026041 | Bacteria | 2717 |
| 923 | Ga0207639_10092463 | 3300026041 | Unclassified | 2424 |
| 924 | Ga0207639_10102406 | 3300026041 | Unclassified | 2318 |
| 925 | Ga0207639_10119152 | 3300026041 | Bacteria | 2166 |
| 926 | Ga0207639_10200206 | 3300026041 | Bacteria | 1712 |
| 927 | Ga0207678_10000887 | 3300026067 | Bacteria | 27526 |
| 928 | Ga0207678_10001608 | 3300026067 | Bacteria | 20769 |
| 929 | Ga0207702_10000415 | 3300026078 | Bacteria | 48713 |
| 930 | Ga0207702_10000866 | 3300026078 | Bacteria | 31529 |
| 931 | Ga0207702_10001193 | 3300026078 | Bacteria | 26376 |
| 932 | Ga0207702_10026868 | 3300026078 | Bacteria | 4779 |
| 933 | Ga0207702_10057298 | 3300026078 | Bacteria | 3311 |
| 934 | Ga0207702_10082101 | 3300026078 | Bacteria | 2802 |
| 935 | Ga0207702_10113285 | 3300026078 | Bacteria | 2415 |
| 936 | Ga0207702_10150393 | 3300026078 | Unclassified | 2117 |
| 937 | Ga0207702_10399113 | 3300026078 | Bacteria | 1326 |
| 938 | Ga0207702_10621857 | 3300026078 | Bacteria | 1061 |
| 939 | Ga0207641_10000323 | 3300026088 | Bacteria | 58693 |
| 940 | Ga0207641_10010259 | 3300026088 | Bacteria | 7705 |
| 941 | Ga0207641_10164887 | 3300026088 | Unclassified | 2017 |
| 942 | Ga0207648_10000870 | 3300026089 | Bacteria | 34025 |
| 943 | Ga0207648_10049697 | 3300026089 | Bacteria | 3668 |
| 944 | Ga0207648_10078342 | 3300026089 | Bacteria | 2883 |
| 945 | Ga0207676_10001412 | 3300026095 | Bacteria | 17835 |
| 946 | Ga0207676_10001649 | 3300026095 | Bacteria | 16439 |
| 947 | Ga0207676_10027339 | 3300026095 | Unclassified | 4248 |
| 948 | Ga0207676_10035580 | 3300026095 | Unclassified | 3781 |
| 949 | Ga0207676_10048872 | 3300026095 | Bacteria | 3287 |
| 950 | Ga0207676_10067197 | 3300026095 | Bacteria | 2863 |
| 951 | Ga0207676_10240306 | 3300026095 | Bacteria | 1624 |
| 952 | Ga0207674_10000164 | 3300026116 | Bacteria | 79381 |
| 953 | Ga0207674_10000269 | 3300026116 | Bacteria | 65505 |
| 954 | Ga0207674_10009605 | 3300026116 | Bacteria | 11035 |
| 955 | Ga0207674_10069953 | 3300026116 | Unclassified | 3528 |
| 956 | Ga0207674_10083587 | 3300026116 | Bacteria | 3192 |
| 957 | Ga0207674_10149144 | 3300026116 | Bacteria | 2296 |
| 958 | Ga0207674_10185924 | 3300026116 | Bacteria | 2028 |
| 959 | Ga0207675_100077714 | 3300026118 | Bacteria | 3110 |
| 960 | Ga0207675_100112466 | 3300026118 | Unclassified | 2570 |
| 961 | Ga0207675_100119688 | 3300026118 | Bacteria | 2491 |
| 962 | Ga0207683_10000493 | 3300026121 | Bacteria | 36475 |
| 963 | Ga0207683_10084329 | 3300026121 | Bacteria | 2824 |
| 964 | Ga0207683_10084876 | 3300026121 | Bacteria | 2815 |
| 965 | Ga0207698_10003243 | 3300026142 | Bacteria | 9769 |
| 966 | Ga0207698_10202364 | 3300026142 | Unclassified | 1779 |
| 967 | Ga0207698_10372421 | 3300026142 | Bacteria | 1356 |
| 968 | Ga0207698_10899694 | 3300026142 | Unclassified | 892 |
| 969 | Ga0207698_10983507 | 3300026142 | Unclassified | 854 |
| 970 | Ga0265354_1003879 | 3300028016 | Bacteria | 1621 |
| 971 | Ga0265356_1000796 | 3300028017 | Bacteria | 5269 |
| 972 | Ga0265356_1003059 | 3300028017 | Bacteria | 2143 |
| 973 | Ga0265355_1005336 | 3300028036 | Bacteria | 986 |
| 974 | Ga0268266_10006414 | 3300028379 | Bacteria | 10777 |
| 975 | Ga0268266_10057790 | 3300028379 | Bacteria | 3339 |
| 976 | Ga0268266_10626178 | 3300028379 | Bacteria | 1034 |
| 977 | Ga0268265_10002217 | 3300028380 | Bacteria | 14963 |
| 978 | Ga0268265_10066425 | 3300028380 | Bacteria | 2788 |
| 979 | Ga0268265_10104611 | 3300028380 | Bacteria | 2295 |
| 980 | Ga0268265_10474619 | 3300028380 | Unclassified | 1173 |
| 981 | Ga0268264_10007432 | 3300028381 | Bacteria | 9149 |
| 982 | Ga0268264_10030585 | 3300028381 | Bacteria | 4413 |
| 983 | Ga0268264_10031105 | 3300028381 | Bacteria | 4376 |
| 984 | Ga0268264_10064813 | 3300028381 | Unclassified | 3076 |
| 985 | Ga0268264_10133421 | 3300028381 | Bacteria | 2205 |
| 986 | Ga0265336_10076755 | 3300028666 | Bacteria | 998 |
| 987 | Ga0265338_10002180 | 3300028800 | Bacteria | 30032 |
| 988 | Ga0265338_10004188 | 3300028800 | Bacteria | 19676 |
| 989 | Ga0265338_10095093 | 3300028800 | Bacteria | 2449 |
| 990 | Ga0265338_10401812 | 3300028800 | Unclassified | 977 |
| 991 | Ga0265762_1001136 | 3300030760 | Bacteria | 4796 |
| 992 | Ga0265762_1001663 | 3300030760 | Unclassified | 4058 |
| 993 | Ga0265762_1002914 | 3300030760 | Unclassified | 3058 |
| 994 | Ga0265770_1020524 | 3300030878 | Bacteria | 1044 |
| 995 | Ga0265773_1009968 | 3300031018 | Bacteria | 793 |
| 996 | Ga0265760_10000931 | 3300031090 | Bacteria | 8432 |
| 997 | Ga0265760_10001483 | 3300031090 | Bacteria | 6912 |
| 998 | Ga0265760_10002685 | 3300031090 | Bacteria | 5207 |
| 999 | Ga0265760_10003511 | 3300031090 | Bacteria | 4547 |
| 1000 | Ga0265332_10154024 | 3300031238 | Unclassified | 961 |
| 1001 | Ga0265328_10051661 | 3300031239 | Bacteria | 1509 |
| 1002 | Ga0265325_10076336 | 3300031241 | Bacteria | 1672 |
| 1003 | Ga0265340_10074872 | 3300031247 | Unclassified | 1600 |
| 1004 | Ga0265340_10218955 | 3300031247 | Bacteria | 853 |
| 1005 | Ga0265339_10017636 | 3300031249 | Unclassified | 4223 |
| 1006 | Ga0265339_10047578 | 3300031249 | Bacteria | 2354 |
| 1007 | Ga0265339_10095739 | 3300031249 | Bacteria | 1550 |
| 1008 | Ga0265339_10101923 | 3300031249 | Bacteria | 1493 |
| 1009 | Ga0265339_10182021 | 3300031249 | Unclassified | 1046 |
| 1010 | Ga0265316_10007573 | 3300031344 | Bacteria | 10213 |
| 1011 | Ga0265314_10001626 | 3300031711 | Bacteria | 24596 |
| 1012 | Ga0265314_10015261 | 3300031711 | Bacteria | 6100 |
| 1013 | Ga0265314_10171917 | 3300031711 | Unclassified | 1307 |
| 1014 | Ga0307407_10068623 | 3300031903 | Bacteria | 2101 |
| 1015 | Ga0307409_100002346 | 3300031995 | Bacteria | 9841 |
| 1016 | Ga0307409_100009366 | 3300031995 | Bacteria | 6013 |
| 1017 | Ga0307416_100023736 | 3300032002 | Bacteria | 4459 |
| 1018 | Ga0307411_10013959 | 3300032005 | Unclassified | 4454 |
| 1019 | Ga0307415_100488840 | 3300032126 | Unclassified | 1073 |
| 1020 | Ga0316214_1001064 | 3300033545 | Unclassified | 3071 |
| 1021 | Ga0373930_0014593 | 3300034816 | Bacteria | 1465 |
| 1022 | Ga0373950_0039636 | 3300034818 | Bacteria | 898 |
| 1023 | Ga0373926_0003742 | 3300035083 | Bacteria | 4951 |
| 1024 | Ga0373926_0025902 | 3300035083 | Bacteria | 2049 |
| 1025 | Ga0373926_0084805 | 3300035083 | Bacteria | 1174 |
| 1026 | Ga0373926_0132537 | 3300035083 | Unclassified | 944 |
| 1027 | Ga0373928_0081321 | 3300035084 | Bacteria | 817 |
| 1028 | Ga0373934_0027565 | 3300035086 | Bacteria | 2208 |
| 1029 | Ga0373934_0057247 | 3300035086 | Unclassified | 1551 |
| 1030 | Ga0373940_0133126 | 3300035088 | Unclassified | 780 |
| 1031 | Ga0373944_0008880 | 3300035089 | Bacteria | 2718 |
| 1032 | Ga0373944_0009947 | 3300035089 | Unclassified | 2586 |
| 1033 | Ga0373949_0031524 | 3300035090 | Bacteria | 1265 |
| 1034 | Ga0373932_0077753 | 3300035112 | Bacteria | 1042 |
| 1035 | Ga0373936_0003050 | 3300035113 | Bacteria | 6264 |
| 1036 | Ga0373936_0024901 | 3300035113 | Bacteria | 2339 |
| 1037 | Ga0373936_0041474 | 3300035113 | Bacteria | 1846 |
| 1038 | Ga0373936_0082450 | 3300035113 | Bacteria | 1340 |
| 1039 | Ga0373941_0050711 | 3300035115 | Bacteria | 1318 |
| 1040 | Ga0373945_0004158 | 3300035116 | Bacteria | 4592 |
| 1041 | Ga0373945_0021455 | 3300035116 | Bacteria | 2219 |
| 1042 | Ga0373953_0111255 | 3300035117 | Unclassified | 1158 |
| 1043 | Ga0373953_0140048 | 3300035117 | Bacteria | 1034 |
| 1044 | Ga0373956_0006358 | 3300035119 | Bacteria | 4731 |
| 1045 | Ga0373957_0040791 | 3300035120 | Bacteria | 1746 |
| 1046 | Ga0373943_0002936 | 3300035170 | Bacteria | 7741 |
| 1047 | Ga0373943_0087919 | 3300035170 | Unclassified | 1605 |
| 1048 | Ga0373946_0058962 | 3300035171 | Bacteria | 1628 |
| 1049 | Ga0373955_0028626 | 3300035172 | Bacteria | 2890 |
| 1050 | Ga0373955_0047391 | 3300035172 | Unclassified | 2327 |
| 1051 | Ga0373961_0029302 | 3300035241 | Bacteria | 1524 |
| 1052 | Ga0373962_0077031 | 3300035242 | Bacteria | 1006 |
| 1053 | Ga0373924_0000405 | 3300035410 | Bacteria | 13237 |
| 1054 | Ga0373924_0006530 | 3300035410 | Bacteria | 4182 |
| 1055 | Ga0373924_0027003 | 3300035410 | Unclassified | 2281 |
| 1056 | Ga0373924_0125528 | 3300035410 | Unclassified | 1115 |
| 1057 | Ga0373924_0126742 | 3300035410 | Bacteria | 1110 |
| 1058 | Ga0373924_0153332 | 3300035410 | Unclassified | 1008 |
| 1059 | Ga0373931_0057852 | 3300035691 | Bacteria | 2080 |
| 1060 | Ga0373931_0061266 | 3300035691 | Bacteria | 2028 |
| 1061 | Ga0373931_0300403 | 3300035691 | Unclassified | 991 |
| 1062 | Ga0373935_0005782 | 3300035692 | Bacteria | 7314 |
| 1063 | Ga0373935_0011685 | 3300035692 | Bacteria | 5273 |
| 1064 | Ga0373935_0016240 | 3300035692 | Unclassified | 4506 |
| 1065 | Ga0373935_0119189 | 3300035692 | Unclassified | 1761 |
| 1066 | Ga0373935_0242141 | 3300035692 | Unclassified | 1260 |
| 1067 | Ga0373935_0304089 | 3300035692 | Unclassified | 1128 |
| 1068 | Ga0373935_0605230 | 3300035692 | Bacteria | 802 |
| 1069 | Ga0373935_0614905 | 3300035692 | Bacteria | 795 |
| 1070 | Ga0373927_0000389 | 3300035695 | Bacteria | 34120 |
| 1071 | Ga0373927_0017315 | 3300035695 | Bacteria | 4745 |
| 1072 | Ga0373927_0044905 | 3300035695 | Bacteria | 2858 |
| 1073 | Ga0373927_0126459 | 3300035695 | Bacteria | 1669 |
| 1074 | Ga0373933_0029202 | 3300035724 | Bacteria | 3187 |
| 1075 | Ga0373933_0267816 | 3300035724 | Unclassified | 1102 |
| 1076 | Ga0373933_0268063 | 3300035724 | Unclassified | 1102 |
| 1077 | Ga0373947_0000147 | 3300035725 | Bacteria | 36627 |
| 1078 | Ga0373947_0006209 | 3300035725 | Bacteria | 6949 |
| 1079 | Ga0373947_0014220 | 3300035725 | Bacteria | 4564 |
| 1080 | Ga0373947_0014909 | 3300035725 | Bacteria | 4461 |
| 1081 | Ga0373947_0370759 | 3300035725 | Bacteria | 963 |
| 1082 | Ga0373947_0462063 | 3300035725 | Unclassified | 860 |
| 1083 | Ga0373937_0000094 | 3300036401 | Bacteria | 82254 |
| 1084 | Ga0373937_0008668 | 3300036401 | Bacteria | 8836 |
| 1085 | Ga0373937_0147963 | 3300036401 | Unclassified | 2199 |
| 1086 | Ga0373937_0208147 | 3300036401 | Unclassified | 1840 |
| 1087 | Ga0373937_0423773 | 3300036401 | Unclassified | 1263 |
| 1088 | Ga0373937_0564071 | 3300036401 | Bacteria | 1081 |
| 1089 | Ga0373925_0000243 | 3300037068 | Bacteria | 57761 |
| 1090 | Ga0373925_0003398 | 3300037068 | Bacteria | 12340 |
| 1091 | Ga0373925_0005997 | 3300037068 | Bacteria | 9001 |
| 1092 | Ga0373925_0016103 | 3300037068 | Bacteria | 5414 |
| 1093 | Ga0373925_0021763 | 3300037068 | Bacteria | 4674 |
| 1094 | Ga0373925_0081225 | 3300037068 | Bacteria | 2465 |
| 1095 | Ga0373925_0161969 | 3300037068 | Bacteria | 1762 |
| 1096 | Ga0373925_0221335 | 3300037068 | Bacteria | 1511 |
| 1097 | Ga0373925_0274890 | 3300037068 | Bacteria | 1356 |
| 1098 | Ga0373925_0279246 | 3300037068 | Bacteria | 1345 |
| 1099 | Ga0373925_0520634 | 3300037068 | Unclassified | 977 |
| 1100 | Ga0395898_0182252 | 3300037466 | Bacteria | 2007 |
| 1101 | Ga0395898_0570543 | 3300037466 | Bacteria | 1074 |
| 1102 | Ga0395905_0147920 | 3300037471 | Bacteria | 2210 |
| 1103 | Ga0395905_0190557 | 3300037471 | Unclassified | 1923 |
| 1104 | Ga0395905_0218816 | 3300037471 | Bacteria | 1783 |
| 1105 | Ga0395905_0599568 | 3300037471 | Bacteria | 1003 |
| 1106 | Ga0436364_0606406 | 3300037853 | Unclassified | 1196 |
| 1107 | Ga0436365_1592604 | 3300039437 | Unclassified | 2606 |
| 1108 | Ga0436365_1640734 | 3300039437 | Bacteria | 1406 |
| 1109 | Ga0436360_1156664 | 3300039438 | Unclassified | 1061 |
| 1110 | Ga0436363_0154653 | 3300039450 | Bacteria | 2053 |
| 1111 | Ga0436363_0313774 | 3300039450 | Bacteria | 3723 |
| 1112 | Ga0436363_0350881 | 3300039450 | Unclassified | 3785 |
| 1113 | Ga0436363_0523760 | 3300039450 | Bacteria | 2459 |
| 1114 | Ga0436363_0779725 | 3300039450 | Unclassified | 1461 |
| 1115 | Ga0451577_0000760 | 3300042876 | Bacteria | 49191 |
| 1116 | Ga0451577_0421755 | 3300042876 | Bacteria | 1212 |
| 1117 | Ga0453683_0076861 | 3300044673 | Unclassified | 2091 |
| 1118 | Ga0466965_0060932 | 3300044683 | Unclassified | 1886 |
| 1119 | Ga0466966_0333952 | 3300044684 | Bacteria | 911 |
| 1120 | Ga0466961_0089571 | 3300044693 | Bacteria | 1943 |
| 1121 | Ga0466963_0004868 | 3300044694 | Bacteria | 7824 |
| 1122 | Ga0466963_0027676 | 3300044694 | Unclassified | 3633 |
| 1123 | Ga0466963_0054618 | 3300044694 | Bacteria | 2655 |
| 1124 | Ga0466964_0100453 | 3300044706 | Unclassified | 1275 |
| 1125 | Ga0466964_0246825 | 3300044706 | Bacteria | 878 |
| 1126 | Ga0466964_0360755 | 3300044706 | Unclassified | 749 |
| 1127 | Ga0453684_0000104 | 3300044712 | Bacteria | 365431 |
| 1128 | Ga0453684_0778348 | 3300044712 | Bacteria | 1034 |
| 1129 | Ga0466957_0000162 | 3300044842 | Bacteria | 29438 |
| 1130 | Ga0466957_0065767 | 3300044842 | Bacteria | 2234 |
| 1131 | Ga0466959_0004700 | 3300045049 | Bacteria | 9197 |
| 1132 | Ga0466959_0363592 | 3300045049 | Unclassified | 986 |
| 1133 | Ga0466959_0367344 | 3300045049 | Bacteria | 980 |
| 1134 | Ga0451576_0014185 | 3300045051 | Bacteria | 8879 |
| 1135 | Ga0451576_0014296 | 3300045051 | Bacteria | 8838 |
| 1136 | Ga0451576_0153169 | 3300045051 | Bacteria | 2404 |
| 1137 | Ga0466958_0033599 | 3300045836 | Unclassified | 3057 |
| 1138 | Ga0466967_0002458 | 3300045976 | Bacteria | 11542 |
| 1139 | Ga0466967_0021392 | 3300045976 | Bacteria | 5252 |
| 1140 | Ga0466967_0076966 | 3300045976 | Bacteria | 3002 |
| 1141 | Ga0466967_0140538 | 3300045976 | Bacteria | 2249 |
| 1142 | Ga0466967_0150081 | 3300045976 | Bacteria | 2177 |
| 1143 | Ga0466967_0332198 | 3300045976 | Bacteria | 1468 |
| 1144 | Ga0466967_0394082 | 3300045976 | Unclassified | 1346 |
| 1145 | Ga0466967_0727684 | 3300045976 | Unclassified | 983 |
| 1146 | Ga0495603_0128482 | 3300046455 | Unclassified | 1476 |
| 1147 | Ga0495629_0401346 | 3300046459 | Unclassified | 932 |
| 1148 | Ga0495651_0156573 | 3300046462 | Bacteria | 1637 |
| 1149 | Ga0495580_0000207 | 3300046472 | Bacteria | 45349 |
| 1150 | Ga0495580_0000954 | 3300046472 | Bacteria | 25313 |
| 1151 | Ga0495580_0001003 | 3300046472 | Bacteria | 24839 |
| 1152 | Ga0495580_0010373 | 3300046472 | Bacteria | 7262 |
| 1153 | Ga0495580_0010808 | 3300046472 | Bacteria | 7088 |
| 1154 | Ga0495580_0020655 | 3300046472 | Bacteria | 4871 |
| 1155 | Ga0495580_0028373 | 3300046472 | Unclassified | 4068 |
| 1156 | Ga0495580_0070919 | 3300046472 | Bacteria | 2434 |
| 1157 | Ga0495580_0113663 | 3300046472 | Bacteria | 1881 |
| 1158 | Ga0495580_0120103 | 3300046472 | Bacteria | 1825 |
| 1159 | Ga0495580_0148301 | 3300046472 | Bacteria | 1625 |
| 1160 | Ga0495580_0155658 | 3300046472 | Bacteria | 1582 |
| 1161 | Ga0495580_0168194 | 3300046472 | Bacteria | 1516 |
| 1162 | Ga0495580_0195544 | 3300046472 | Bacteria | 1394 |
| 1163 | Ga0495582_0001085 | 3300046473 | Bacteria | 15269 |
| 1164 | Ga0495582_0022396 | 3300046473 | Unclassified | 3457 |
| 1165 | Ga0495582_0099848 | 3300046473 | Bacteria | 1624 |
| 1166 | Ga0495605_0132789 | 3300046474 | Bacteria | 1122 |
| 1167 | Ga0495664_0245093 | 3300046477 | Bacteria | 1084 |
| 1168 | Ga0495664_0252096 | 3300046477 | Unclassified | 1067 |
| 1169 | Ga0495594_0025512 | 3300046499 | Bacteria | 3177 |
| 1170 | Ga0495594_0055427 | 3300046499 | Bacteria | 2186 |
| 1171 | Ga0495628_0303561 | 3300046516 | Bacteria | 1181 |
| 1172 | Ga0495628_0386846 | 3300046516 | Unclassified | 1024 |
| 1173 | Ga0495628_0480871 | 3300046516 | Bacteria | 899 |
| 1174 | Ga0495630_0058826 | 3300046517 | Bacteria | 2882 |
| 1175 | Ga0495630_0142593 | 3300046517 | Bacteria | 1822 |
| 1176 | Ga0495630_0183514 | 3300046517 | Bacteria | 1596 |
| 1177 | Ga0495666_0031598 | 3300046526 | Bacteria | 2594 |
| 1178 | Ga0495665_0006832 | 3300046531 | Bacteria | 6155 |
| 1179 | Ga0495665_0042263 | 3300046531 | Bacteria | 2426 |
| 1180 | Ga0495665_0161590 | 3300046531 | Bacteria | 1167 |
| 1181 | Ga0495586_0116406 | 3300046535 | Unclassified | 1491 |
| 1182 | Ga0495645_0308814 | 3300046543 | Unclassified | 1031 |
| 1183 | Ga0495667_0051260 | 3300046559 | Bacteria | 2723 |
| 1184 | Ga0495667_0389623 | 3300046559 | Unclassified | 878 |
| 1185 | Ga0495635_0145610 | 3300046663 | Bacteria | 1613 |
| 1186 | Ga0495659_0026242 | 3300046664 | Unclassified | 2001 |
| 1187 | Ga0495588_0136351 | 3300046674 | Bacteria | 1296 |
| 1188 | Ga0495657_0094763 | 3300046675 | Bacteria | 1909 |
| 1189 | Ga0495657_0405974 | 3300046675 | Bacteria | 801 |
| 1190 | Ga0495623_0083996 | 3300046679 | Bacteria | 1966 |
| 1191 | Ga0495623_0177865 | 3300046679 | Bacteria | 1238 |
| 1192 | Ga0495646_0328929 | 3300046680 | Bacteria | 804 |
| 1193 | Ga0495647_0187162 | 3300046681 | Bacteria | 903 |
| 1194 | Ga0495658_0013868 | 3300046683 | Bacteria | 4108 |
| 1195 | Ga0495658_0270365 | 3300046683 | Bacteria | 1071 |
| 1196 | Ga0495669_0009520 | 3300046684 | Bacteria | 4099 |
| 1197 | Ga0495669_0307451 | 3300046684 | Bacteria | 765 |
| 1198 | Ga0495624_0132825 | 3300046690 | Bacteria | 1526 |
| 1199 | Ga0495581_0169730 | 3300047315 | Bacteria | 1276 |
| 1200 | Ga0495581_0473133 | 3300047315 | Unclassified | 729 |
| 1201 | Ga0495604_0115648 | 3300047317 | Bacteria | 1949 |
| 1202 | Ga0495604_0141991 | 3300047317 | Unclassified | 1715 |
| 1203 | Ga0495604_0514267 | 3300047317 | Unclassified | 775 |
| 1204 | Ga0495674_0010677 | 3300047319 | Bacteria | 8691 |
| 1205 | Ga0495674_0012983 | 3300047319 | Bacteria | 7841 |
| 1206 | Ga0495674_0189938 | 3300047319 | Unclassified | 1708 |
| 1207 | Ga0495674_0230976 | 3300047319 | Unclassified | 1527 |
| 1208 | Ga0495674_0785433 | 3300047319 | Unclassified | 742 |
| 1209 | Ga0495684_0134004 | 3300047471 | Bacteria | 1859 |
| 1210 | Ga0495684_0264760 | 3300047471 | Bacteria | 1246 |
| 1211 | Ga0495593_0121341 | 3300047673 | Bacteria | 1330 |
| 1212 | Ga0495602_0042046 | 3300048088 | Unclassified | 4167 |
| 1213 | Ga0495602_0063358 | 3300048088 | Unclassified | 3204 |
| 1214 | Ga0495602_0173348 | 3300048088 | Bacteria | 1672 |
| 1215 | Ga0496100_0041074 | 3300048903 | Unclassified | 2946 |
| 1216 | Ga0496100_0079201 | 3300048903 | Bacteria | 2213 |
| 1217 | Ga0496100_0244587 | 3300048903 | Bacteria | 1325 |
| 1218 | Ga0496101_0050583 | 3300048904 | Bacteria | 2992 |
| 1219 | Ga0496101_0180335 | 3300048904 | Bacteria | 1626 |
| 1220 | Ga0496102_0002115 | 3300048905 | Bacteria | 17082 |
| 1221 | Ga0496102_0028941 | 3300048905 | Bacteria | 4952 |
| 1222 | Ga0496102_0032555 | 3300048905 | Bacteria | 4683 |
| 1223 | Ga0496102_0063173 | 3300048905 | Unclassified | 3390 |
| 1224 | Ga0496102_0085192 | 3300048905 | Bacteria | 2917 |
| 1225 | Ga0496102_0114753 | 3300048905 | Unclassified | 2513 |
| 1226 | Ga0496102_0151951 | 3300048905 | Unclassified | 2176 |
| 1227 | Ga0496102_0235804 | 3300048905 | Bacteria | 1725 |
| 1228 | Ga0496102_0419890 | 3300048905 | Bacteria | 1256 |
| 1229 | Ga0496102_1009024 | 3300048905 | Unclassified | 753 |
| 1230 | Ga0496103_0007300 | 3300048906 | Bacteria | 6585 |
| 1231 | Ga0496103_0098360 | 3300048906 | Bacteria | 1850 |
| 1232 | Ga0496103_0168476 | 3300048906 | Unclassified | 1406 |
| 1233 | Ga0496103_0284010 | 3300048906 | Bacteria | 1064 |
| 1234 | Ga0496103_0316981 | 3300048906 | Bacteria | 1003 |
| 1235 | Ga0496104_0027435 | 3300048907 | Bacteria | 5270 |
| 1236 | Ga0496104_0030003 | 3300048907 | Bacteria | 5050 |
| 1237 | Ga0496104_0040711 | 3300048907 | Bacteria | 4356 |
| 1238 | Ga0496104_0067886 | 3300048907 | Unclassified | 3388 |
| 1239 | Ga0496104_0082469 | 3300048907 | Bacteria | 3066 |
| 1240 | Ga0496104_0086428 | 3300048907 | Bacteria | 2994 |
| 1241 | Ga0496104_0149125 | 3300048907 | Bacteria | 2246 |
| 1242 | Ga0496104_0153281 | 3300048907 | Bacteria | 2212 |
| 1243 | Ga0496104_0153503 | 3300048907 | Bacteria | 2210 |
| 1244 | Ga0496104_0155909 | 3300048907 | Bacteria | 2191 |
| 1245 | Ga0496104_0186622 | 3300048907 | Bacteria | 1984 |
| 1246 | Ga0496104_0314397 | 3300048907 | Bacteria | 1479 |
| 1247 | Ga0496104_0465399 | 3300048907 | Bacteria | 1176 |
| 1248 | Ga0496104_0660524 | 3300048907 | Unclassified | 954 |
| 1249 | Ga0496104_0845381 | 3300048907 | Unclassified | 821 |
| 1250 | Ga0496105_0067370 | 3300048908 | Bacteria | 2956 |
| 1251 | Ga0496105_0073573 | 3300048908 | Bacteria | 2823 |
| 1252 | Ga0496105_0076554 | 3300048908 | Bacteria | 2763 |
| 1253 | Ga0496105_0106282 | 3300048908 | Unclassified | 2317 |
| 1254 | Ga0496105_0236303 | 3300048908 | Unclassified | 1484 |
| 1255 | Ga0496105_0302622 | 3300048908 | Unclassified | 1285 |
| 1256 | Ga0496106_0099506 | 3300048909 | Bacteria | 2254 |
| 1257 | Ga0496106_0118995 | 3300048909 | Unclassified | 2063 |
| 1258 | Ga0496106_0428852 | 3300048909 | Bacteria | 1062 |
| 1259 | Ga0496106_0434793 | 3300048909 | Bacteria | 1054 |
| 1260 | Ga0496107_0033870 | 3300048910 | Bacteria | 3656 |
| 1261 | Ga0496107_0171219 | 3300048910 | Bacteria | 1611 |
| 1262 | Ga0496107_0193790 | 3300048910 | Bacteria | 1510 |
| 1263 | Ga0496107_0350120 | 3300048910 | Bacteria | 1099 |
| 1264 | Ga0496107_0416370 | 3300048910 | Unclassified | 999 |
| 1265 | Ga0496108_0000444 | 3300048911 | Bacteria | 33175 |
| 1266 | Ga0496108_0242908 | 3300048911 | Bacteria | 1566 |
| 1267 | Ga0496108_0356470 | 3300048911 | Bacteria | 1276 |
| 1268 | Ga0496109_0002079 | 3300048912 | Bacteria | 16632 |
| 1269 | Ga0496109_0077503 | 3300048912 | Unclassified | 3059 |
| 1270 | Ga0496109_0121542 | 3300048912 | Bacteria | 2433 |
| 1271 | Ga0496109_0244716 | 3300048912 | Bacteria | 1688 |
| 1272 | Ga0496109_0796650 | 3300048912 | Unclassified | 883 |
| 1273 | Ga0496110_0009263 | 3300048913 | Bacteria | 7960 |
| 1274 | Ga0496110_0010922 | 3300048913 | Bacteria | 7406 |
| 1275 | Ga0496110_0012463 | 3300048913 | Bacteria | 6993 |
| 1276 | Ga0496110_0055531 | 3300048913 | Unclassified | 3485 |
| 1277 | Ga0496110_0920820 | 3300048913 | Unclassified | 780 |
| 1278 | Ga0496111_0003547 | 3300048914 | Bacteria | 9660 |
| 1279 | Ga0496111_0004197 | 3300048914 | Bacteria | 9069 |
| 1280 | Ga0496111_0005860 | 3300048914 | Bacteria | 7924 |
| 1281 | Ga0496111_0085473 | 3300048914 | Bacteria | 2307 |
| 1282 | Ga0496112_0000060 | 3300048915 | Bacteria | 74795 |
| 1283 | Ga0496112_0001326 | 3300048915 | Bacteria | 18793 |
| 1284 | Ga0496112_0001636 | 3300048915 | Bacteria | 17362 |
| 1285 | Ga0496112_0008785 | 3300048915 | Bacteria | 9067 |
| 1286 | Ga0496112_0016574 | 3300048915 | Bacteria | 6909 |
| 1287 | Ga0496112_0023715 | 3300048915 | Bacteria | 5869 |
| 1288 | Ga0496112_0028527 | 3300048915 | Bacteria | 5388 |
| 1289 | Ga0496112_0076772 | 3300048915 | Unclassified | 3304 |
| 1290 | Ga0496112_0097306 | 3300048915 | Bacteria | 2913 |
| 1291 | Ga0496112_0097765 | 3300048915 | Bacteria | 2906 |
| 1292 | Ga0496112_0146479 | 3300048915 | Bacteria | 2330 |
| 1293 | Ga0496112_0220059 | 3300048915 | Bacteria | 1855 |
| 1294 | Ga0496112_0280261 | 3300048915 | Bacteria | 1614 |
| 1295 | Ga0496112_0610930 | 3300048915 | Unclassified | 1022 |
| 1296 | Ga0496112_0770343 | 3300048915 | Unclassified | 888 |
| 1297 | Ga0496113_0002406 | 3300048916 | Bacteria | 10874 |
| 1298 | Ga0496113_0019372 | 3300048916 | Bacteria | 4758 |
| 1299 | Ga0496113_0043393 | 3300048916 | Bacteria | 3328 |
| 1300 | Ga0496113_0074664 | 3300048916 | Bacteria | 2585 |
| 1301 | Ga0496113_0326035 | 3300048916 | Unclassified | 1231 |
| 1302 | Ga0496114_0125800 | 3300048917 | Bacteria | 2210 |
| 1303 | Ga0496114_0143712 | 3300048917 | Bacteria | 2067 |
| 1304 | Ga0496115_0006392 | 3300048918 | Bacteria | 8636 |
| 1305 | Ga0496115_0009148 | 3300048918 | Bacteria | 7353 |
| 1306 | Ga0496115_0525485 | 3300048918 | Bacteria | 948 |
| 1307 | Ga0496115_0699200 | 3300048918 | Unclassified | 797 |
| 1308 | Ga0501298_011412 | 3300049521 | Unclassified | 1543 |
| 1309 | Ga0501299_012498 | 3300049522 | Unclassified | 1450 |
| 1310 | Ga0501069_0271838 | 3300049585 | Unclassified | 991 |
| 1311 | Ga0501073_0086975 | 3300049589 | Bacteria | 2174 |
| 1312 | Ga0501216_028329 | 3300049660 | Unclassified | 1021 |
| 1313 | Ga0501217_069987 | 3300049661 | Unclassified | 953 |
| 1314 | Ga0501257_020950 | 3300049686 | Unclassified | 1539 |
| 1315 | Ga0501257_056031 | 3300049686 | Unclassified | 990 |
| 1316 | Ga0501225_0051551 | 3300049705 | Bacteria | 1146 |
| 1317 | Ga0501272_015452 | 3300049769 | Unclassified | 889 |
| 1318 | nmdc:mga08y16_658830_c1 | 3300050511 | Bacteria | 1050 |
| 1319 | nmdc:mga0n895_110774_c1 | 3300050512 | Unclassified | 2761 |
| 1320 | nmdc:mga0n895_152296_c1 | 3300050512 | Bacteria | 2343 |
| 1321 | nmdc:mga0n895_423218_c1 | 3300050512 | Bacteria | 1346 |
| 1322 | nmdc:mga0n895_560_c1 | 3300050512 | Bacteria | 25527 |
| 1323 | nmdc:mga0n895_73080_c1 | 3300050512 | Bacteria | 3404 |
| 1324 | nmdc:mga0rr50_207971_c1 | 3300050513 | Unclassified | 1611 |
| 1325 | nmdc:mga0rr50_20917_c1 | 3300050513 | Bacteria | 4456 |
| 1326 | nmdc:mga0rr50_417396_c1 | 3300050513 | Unclassified | 1135 |
| 1327 | nmdc:mga0rr50_4515_c1 | 3300050513 | Bacteria | 8196 |
| 1328 | nmdc:mga0rr50_843333_c1 | 3300050513 | Unclassified | 782 |
| 1329 | nmdc:mga08x19_122466_c1 | 3300050514 | Unclassified | 1744 |
| 1330 | nmdc:mga08x19_13875_c1 | 3300050514 | Bacteria | 4880 |
| 1331 | nmdc:mga08x19_4249_c1 | 3300050514 | Bacteria | 8489 |
| 1332 | nmdc:mga08x19_57371_c1 | 3300050514 | Unclassified | 2516 |
| 1333 | nmdc:mga08x19_5779_c1 | 3300050514 | Bacteria | 7311 |
| 1334 | nmdc:mga0a205_21929_c1 | 3300050515 | Bacteria | 6041 |
| 1335 | nmdc:mga0a205_808600_c1 | 3300050515 | Unclassified | 785 |
| 1336 | Ga0495601_0039537 | 3300053077 | Bacteria | 2954 |
| 1337 | Ga0495601_0089406 | 3300053077 | Unclassified | 1980 |
| 1338 | Ga0495612_0170469 | 3300053078 | Bacteria | 953 |
| 1339 | Ga0495619_0236592 | 3300053085 | Bacteria | 1265 |
| 1340 | Ga0501084_0659959 | 3300054114 | Unclassified | 883 |
| 1341 | Ga0587073_0043795 | 3300059492 | Unclassified | 987 |
| 1342 | Ga0587077_056091 | 3300059493 | Unclassified | 840 |
| 1343 | Ga0587067_011688 | 3300059640 | Bacteria | 1357 |
| 1344 | Ga0587079_017890 | 3300059647 | Bacteria | 1236 |
| 1345 | Ga0587079_075628 | 3300059647 | Unclassified | 760 |
| 1346 | Ga0587071_024732 | 3300060344 | Unclassified | 1123 |
| 1347 | Ga0466962_0163198 | 3300061719 | Unclassified | 1083 |
| 1348 | Ga0496104_0178602 | |||
| 1349 | MRS1b_contig_8406324 | |||
| 1350 | MBSR1b_contig_8347319 | |||
| 1351 | MBSR1b_contig_9753513 | |||
| 1352 | LJNas_1000269 | |||
| 1353 | JGI24752J21851_1001182 | |||
| 1354 | JGI24034J26672_10000325 | |||
| 1355 | JGI24751J29686_10001201 | |||
| 1356 | Ga0058863_11372885 | |||
| 1357 | Ga0058861_10063214 | |||
| 1358 | Ga0058861_11314449 | |||
| 1359 | Ga0058862_12094930 | |||
| 1360 | Ga0058862_12654815 | |||
| 1361 | Ga0065712_10003687 | |||
| 1362 | Ga0065712_10110694 | |||
| 1363 | Ga0065712_10136907 | |||
| 1364 | Ga0065715_10124725 | |||
| 1365 | Ga0065715_10175677 | |||
| 1366 | Ga0065707_10233012 | |||
| 1367 | Ga0070658_10054106 | |||
| 1368 | Ga0070658_10402397 | |||
| 1369 | Ga0070676_10013388 | |||
| 1370 | Ga0070676_10013895 | |||
| 1371 | Ga0070683_100015072 | |||
| 1372 | Ga0070683_100018817 | |||
| 1373 | Ga0070683_100020038 | |||
| 1374 | Ga0070683_100133144 | |||
| 1375 | Ga0070683_100224105 | |||
| 1376 | Ga0070683_100561238 | |||
| 1377 | Ga0070683_100607026 | |||
| 1378 | Ga0070690_100006967 | |||
| 1379 | Ga0070690_100010719 | |||
| 1380 | Ga0070670_100017644 | |||
| 1381 | Ga0070670_100052679 | |||
| 1382 | Ga0068869_100000365 | |||
| 1383 | Ga0068869_100004818 | |||
| 1384 | Ga0068869_100021779 | |||
| 1385 | Ga0068869_100025160 | |||
| 1386 | Ga0070666_10002671 | |||
| 1387 | Ga0070680_100009284 | |||
| 1388 | Ga0070680_100079684 | |||
| 1389 | Ga0070680_100095633 | |||
| 1390 | Ga0070680_100137886 | |||
| 1391 | Ga0070680_100157759 | |||
| 1392 | Ga0070680_100290587 | |||
| 1393 | Ga0070680_100357712 | |||
| 1394 | Ga0070682_100006008 | |||
| 1395 | Ga0070682_100094191 | |||
| 1396 | Ga0068868_100003230 | |||
| 1397 | Ga0068868_100016148 | |||
| 1398 | Ga0068868_100041316 | |||
| 1399 | Ga0068868_100079865 | |||
| 1400 | Ga0068868_100091928 | |||
| 1401 | Ga0068868_100112431 | |||
| 1402 | Ga0068868_100119023 | |||
| 1403 | Ga0068868_100467557 | |||
| 1404 | Ga0068868_100502168 | |||
| 1405 | Ga0068868_100974054 | |||
| 1406 | Ga0070660_100022195 | |||
| 1407 | Ga0070660_100108602 | |||
| 1408 | Ga0070660_100206925 | |||
| 1409 | Ga0070660_100381384 | |||
| 1410 | Ga0070689_100050786 | |||
| 1411 | Ga0070689_100216712 | |||
| 1412 | Ga0070687_100060743 | |||
| 1413 | Ga0070687_100066136 | |||
| 1414 | Ga0070687_100383764 | |||
| 1415 | Ga0070661_100003055 | |||
| 1416 | Ga0070661_100009617 | |||
| 1417 | Ga0070661_100014979 | |||
| 1418 | Ga0070661_100041762 | |||
| 1419 | Ga0070661_100174851 | |||
| 1420 | Ga0070692_10060948 | |||
| 1421 | Ga0070668_100044360 | |||
| 1422 | Ga0070668_100066847 | |||
| 1423 | Ga0070668_100677355 | |||
| 1424 | Ga0070669_100023832 | |||
| 1425 | Ga0070669_100503023 | |||
| 1426 | Ga0070675_100140797 | |||
| 1427 | Ga0070675_100197438 | |||
| 1428 | Ga0070675_100514747 | |||
| 1429 | Ga0070671_100031332 | |||
| 1430 | Ga0070671_100062531 | |||
| 1431 | Ga0070671_100091869 | |||
| 1432 | Ga0070671_100386785 | |||
| 1433 | Ga0070674_100575452 | |||
| 1434 | Ga0070673_100001773 | |||
| 1435 | Ga0070673_100025530 | |||
| 1436 | Ga0070673_100735921 | |||
| 1437 | Ga0070688_100002766 | |||
| 1438 | Ga0070688_100591941 | |||
| 1439 | Ga0070659_100009058 | |||
| 1440 | Ga0070659_100020284 | |||
| 1441 | Ga0070659_100181349 | |||
| 1442 | Ga0070667_100045480 | |||
| 1443 | Ga0070667_100115683 | |||
| 1444 | Ga0070667_100688413 | |||
| 1445 | Ga0070709_10013312 | |||
| 1446 | Ga0070709_10019620 | |||
| 1447 | Ga0070709_10024439 | |||
| 1448 | Ga0070709_10027155 | |||
| 1449 | Ga0070709_10039113 | |||
| 1450 | Ga0070709_10042655 | |||
| 1451 | Ga0070709_10068926 | |||
| 1452 | Ga0070709_10104420 | |||
| 1453 | Ga0070709_10265257 | |||
| 1454 | Ga0070709_10303588 | |||
| 1455 | Ga0070714_100007036 | |||
| 1456 | Ga0070714_100008700 | |||
| 1457 | Ga0070714_100025376 | |||
| 1458 | Ga0070714_100044925 | |||
| 1459 | Ga0070714_100086557 | |||
| 1460 | Ga0070714_100107597 | |||
| 1461 | Ga0070714_100139303 | |||
| 1462 | Ga0070714_100285524 | |||
| 1463 | Ga0070714_100439135 | |||
| 1464 | Ga0070714_100636494 | |||
| 1465 | Ga0070713_100000073 | |||
| 1466 | Ga0070713_100000940 | |||
| 1467 | Ga0070713_100005524 | |||
| 1468 | Ga0070713_100013005 | |||
| 1469 | Ga0070713_100018529 | |||
| 1470 | Ga0070713_100049171 | |||
| 1471 | Ga0070713_100055645 | |||
| 1472 | Ga0070713_100057729 | |||
| 1473 | Ga0070713_100061416 | |||
| 1474 | Ga0070713_100070094 | |||
| 1475 | Ga0070713_100093717 | |||
| 1476 | Ga0070713_100143054 | |||
| 1477 | Ga0070713_100182969 | |||
| 1478 | Ga0070713_100185830 | |||
| 1479 | Ga0070713_100429813 | |||
| 1480 | Ga0070713_100584912 | |||
| 1481 | Ga0070713_100662733 | |||
| 1482 | Ga0070713_100731779 | |||
| 1483 | Ga0070713_100836640 | |||
| 1484 | Ga0070710_10009992 | |||
| 1485 | Ga0070710_10014746 | |||
| 1486 | Ga0070710_10024508 | |||
| 1487 | Ga0070710_10041647 | |||
| 1488 | Ga0070710_10125030 | |||
| 1489 | Ga0070710_10128501 | |||
| 1490 | Ga0070710_10131999 | |||
| 1491 | Ga0070710_10140541 | |||
| 1492 | Ga0070710_10162049 | |||
| 1493 | Ga0070701_10363946 | |||
| 1494 | Ga0070701_10528403 | |||
| 1495 | Ga0070711_100000360 | |||
| 1496 | Ga0070711_100001169 | |||
| 1497 | Ga0070711_100001873 | |||
| 1498 | Ga0070711_100012010 | |||
| 1499 | Ga0070711_100066853 | |||
| 1500 | Ga0070711_100080156 | |||
| 1501 | Ga0070711_100149158 | |||
| 1502 | Ga0070711_100184980 | |||
| 1503 | Ga0070694_100476679 | |||
| 1504 | Ga0070708_100000470 | |||
| 1505 | Ga0070708_100001120 | |||
| 1506 | Ga0070708_100002203 | |||
| 1507 | Ga0070708_100003678 | |||
| 1508 | Ga0070708_100008454 | |||
| 1509 | Ga0070708_100008675 | |||
| 1510 | Ga0070708_100010894 | |||
| 1511 | Ga0070708_100016315 | |||
| 1512 | Ga0070708_100022619 | |||
| 1513 | Ga0070708_100032064 | |||
| 1514 | Ga0070708_100076096 | |||
| 1515 | Ga0070708_100502630 | |||
| 1516 | Ga0070708_100631343 | |||
| 1517 | Ga0070663_100001680 | |||
| 1518 | Ga0070663_100077313 | |||
| 1519 | Ga0070678_100082081 | |||
| 1520 | Ga0070678_100743413 | |||
| 1521 | Ga0070662_100007994 | |||
| 1522 | Ga0070662_100098792 | |||
| 1523 | Ga0070681_10001396 | |||
| 1524 | Ga0070681_10013650 | |||
| 1525 | Ga0070681_10036782 | |||
| 1526 | Ga0070681_10045099 | |||
| 1527 | Ga0070681_10045120 | |||
| 1528 | Ga0070681_10046045 | |||
| 1529 | Ga0070681_10064230 | |||
| 1530 | Ga0070681_10081283 | |||
| 1531 | Ga0070681_10267962 | |||
| 1532 | Ga0070681_10277058 | |||
| 1533 | Ga0070681_10392102 | |||
| 1534 | Ga0070681_10438884 | |||
| 1535 | Ga0068867_100048374 | |||
| 1536 | Ga0068867_100067550 | |||
| 1537 | Ga0068867_100270608 | |||
| 1538 | Ga0068867_100332474 | |||
| 1539 | Ga0068867_100768046 | |||
| 1540 | Ga0070685_10009024 | |||
| 1541 | Ga0070685_10031814 | |||
| 1542 | Ga0070706_100001230 | |||
| 1543 | Ga0070706_100002235 | |||
| 1544 | Ga0070706_100013159 | |||
| 1545 | Ga0070706_100031003 | |||
| 1546 | Ga0070706_100055058 | |||
| 1547 | Ga0070706_100076896 | |||
| 1548 | Ga0070706_100119389 | |||
| 1549 | Ga0070706_100245804 | |||
| 1550 | Ga0070707_100001129 | |||
| 1551 | Ga0070707_100006316 | |||
| 1552 | Ga0070707_100010562 | |||
| 1553 | Ga0070707_100038485 | |||
| 1554 | Ga0070707_100098690 | |||
| 1555 | Ga0070707_100164833 | |||
| 1556 | Ga0070707_100572485 | |||
| 1557 | Ga0070698_100001238 | |||
| 1558 | Ga0070698_100021223 | |||
| 1559 | Ga0070698_100102352 | |||
| 1560 | Ga0070698_100897305 | |||
| 1561 | Ga0070699_100001045 | |||
| 1562 | Ga0070699_100001170 | |||
| 1563 | Ga0070699_100013583 | |||
| 1564 | Ga0070699_100036584 | |||
| 1565 | Ga0070699_100307141 | |||
| 1566 | Ga0070699_100375577 | |||
| 1567 | Ga0070679_100018579 | |||
| 1568 | Ga0070679_100028624 | |||
| 1569 | Ga0070679_100041563 | |||
| 1570 | Ga0070679_100136812 | |||
| 1571 | Ga0070679_100147055 | |||
| 1572 | Ga0070679_100168909 | |||
| 1573 | Ga0070679_100178045 | |||
| 1574 | Ga0070679_100230747 | |||
| 1575 | Ga0070679_100281263 | |||
| 1576 | Ga0070684_100006676 | |||
| 1577 | Ga0070684_100067165 | |||
| 1578 | Ga0070684_100106741 | |||
| 1579 | Ga0070684_100119146 | |||
| 1580 | Ga0070684_100121214 | |||
| 1581 | Ga0070697_100000092 | |||
| 1582 | Ga0070697_100000390 | |||
| 1583 | Ga0070697_100000630 | |||
| 1584 | Ga0070697_100007135 | |||
| 1585 | Ga0070697_100007394 | |||
| 1586 | Ga0070697_100010927 | |||
| 1587 | Ga0070697_100014170 | |||
| 1588 | Ga0070697_100080714 | |||
| 1589 | Ga0070697_100083676 | |||
| 1590 | Ga0070697_100181013 | |||
| 1591 | Ga0068853_100008057 | |||
| 1592 | Ga0068853_100014016 | |||
| 1593 | Ga0068853_100029102 | |||
| 1594 | Ga0068853_100114017 | |||
| 1595 | Ga0068853_100126603 | |||
| 1596 | Ga0068853_100380501 | |||
| 1597 | Ga0070672_100006933 | |||
| 1598 | Ga0070686_100004713 | |||
| 1599 | Ga0070686_100064105 | |||
| 1600 | Ga0070695_100026588 | |||
| 1601 | Ga0070695_100161742 | |||
| 1602 | Ga0070695_100285990 | |||
| 1603 | Ga0070696_100034110 | |||
| 1604 | Ga0070696_100215466 | |||
| 1605 | Ga0070693_100015053 | |||
| 1606 | Ga0070693_100028622 | |||
| 1607 | Ga0070693_100051056 | |||
| 1608 | Ga0070693_100187278 | |||
| 1609 | Ga0070693_100282128 | |||
| 1610 | Ga0070693_100488828 | |||
| 1611 | Ga0070665_100100285 | |||
| 1612 | Ga0070665_100255993 | |||
| 1613 | Ga0068855_100001369 | |||
| 1614 | Ga0068855_100006853 | |||
| 1615 | Ga0068855_100011661 | |||
| 1616 | Ga0068855_100058682 | |||
| 1617 | Ga0068855_100077403 | |||
| 1618 | Ga0068855_100088073 | |||
| 1619 | Ga0068855_100162121 | |||
| 1620 | Ga0068855_100344840 | |||
| 1621 | Ga0068855_100560888 | |||
| 1622 | Ga0068855_100575122 | |||
| 1623 | Ga0068855_100575951 | |||
| 1624 | Ga0070664_100000897 | |||
| 1625 | Ga0070664_100002745 | |||
| 1626 | Ga0070664_100116325 | |||
| 1627 | Ga0070664_100582324 | |||
| 1628 | Ga0068857_100003643 | |||
| 1629 | Ga0068857_100036791 | |||
| 1630 | Ga0068857_100042798 | |||
| 1631 | Ga0068857_100043637 | |||
| 1632 | Ga0068857_100055135 | |||
| 1633 | Ga0068857_100704569 | |||
| 1634 | Ga0068857_100753642 | |||
| 1635 | Ga0068854_100001461 | |||
| 1636 | Ga0068854_100008594 | |||
| 1637 | Ga0068854_100052238 | |||
| 1638 | Ga0068854_100081104 | |||
| 1639 | Ga0068854_100178857 | |||
| 1640 | Ga0068854_100671478 | |||
| 1641 | Ga0068856_100000995 | |||
| 1642 | Ga0068856_100007891 | |||
| 1643 | Ga0068856_100009877 | |||
| 1644 | Ga0068856_100035248 | |||
| 1645 | Ga0068856_100053539 | |||
| 1646 | Ga0068856_100057899 | |||
| 1647 | Ga0068856_100082778 | |||
| 1648 | Ga0068856_100168296 | |||
| 1649 | Ga0068856_100175193 | |||
| 1650 | Ga0068856_100295483 | |||
| 1651 | Ga0068856_100301052 | |||
| 1652 | Ga0070702_100061318 | |||
| 1653 | Ga0070702_100418593 | |||
| 1654 | Ga0068852_100004238 | |||
| 1655 | Ga0068852_100018595 | |||
| 1656 | Ga0068852_100047161 | |||
| 1657 | Ga0068852_100166064 | |||
| 1658 | Ga0068852_100307286 | |||
| 1659 | Ga0068852_100561500 | |||
| 1660 | Ga0068852_100687056 | |||
| 1661 | Ga0068852_101052688 | |||
| 1662 | Ga0068852_101353859 | |||
| 1663 | Ga0068859_100020260 | |||
| 1664 | Ga0068859_100076021 | |||
| 1665 | Ga0068859_100091071 | |||
| 1666 | Ga0068864_100003006 | |||
| 1667 | Ga0068864_100021497 | |||
| 1668 | Ga0068864_100030698 | |||
| 1669 | Ga0068864_100062311 | |||
| 1670 | Ga0068864_100259322 | |||
| 1671 | Ga0068866_10005181 | |||
| 1672 | Ga0068866_10018825 | |||
| 1673 | Ga0068866_10193835 | |||
| 1674 | Ga0068866_10208038 | |||
| 1675 | Ga0068861_100012876 | |||
| 1676 | Ga0068861_100080151 | |||
| 1677 | Ga0068861_100087408 | |||
| 1678 | Ga0068851_10008910 | |||
| 1679 | Ga0068851_10013151 | |||
| 1680 | Ga0068851_10029239 | |||
| 1681 | Ga0068851_10282003 | |||
| 1682 | Ga0068870_10002902 | |||
| 1683 | Ga0068870_10085367 | |||
| 1684 | Ga0068863_100001977 | |||
| 1685 | Ga0068863_100071658 | |||
| 1686 | Ga0068863_100079746 | |||
| 1687 | Ga0068863_100110800 | |||
| 1688 | Ga0068863_100125098 | |||
| 1689 | Ga0068863_100275007 | |||
| 1690 | Ga0068858_100000404 | |||
| 1691 | Ga0068858_100001080 | |||
| 1692 | Ga0068858_100038173 | |||
| 1693 | Ga0068858_100062953 | |||
| 1694 | Ga0068858_100062973 | |||
| 1695 | Ga0068858_100081667 | |||
| 1696 | Ga0068858_100627525 | |||
| 1697 | Ga0068860_100010559 | |||
| 1698 | Ga0068860_100061035 | |||
| 1699 | Ga0068860_100061841 | |||
| 1700 | Ga0068860_100071618 | |||
| 1701 | Ga0068860_100184530 | |||
| 1702 | Ga0068860_100315994 | |||
| 1703 | Ga0068862_100005387 | |||
| 1704 | Ga0068862_100018991 | |||
| 1705 | Ga0068862_100150532 | |||
| 1706 | Ga0068862_100162770 | |||
| 1707 | Ga0081540_1074881 | |||
| 1708 | Ga0070717_10001111 | |||
| 1709 | Ga0070717_10004965 | |||
| 1710 | Ga0070717_10005101 | |||
| 1711 | Ga0070717_10006905 | |||
| 1712 | Ga0070717_10008773 | |||
| 1713 | Ga0070717_10025076 | |||
| 1714 | Ga0070717_10027759 | |||
| 1715 | Ga0070717_10049947 | |||
| 1716 | Ga0070717_10084239 | |||
| 1717 | Ga0070717_10092273 | |||
| 1718 | Ga0070717_10122352 | |||
| 1719 | Ga0070717_10159457 | |||
| 1720 | Ga0070717_10187485 | |||
| 1721 | Ga0070717_10190248 | |||
| 1722 | Ga0070717_10483566 | |||
| 1723 | Ga0070717_10652242 | |||
| 1724 | Ga0070717_10958687 | |||
| 1725 | Ga0070715_10036619 | |||
| 1726 | Ga0070715_10061081 | |||
| 1727 | Ga0070715_10237498 | |||
| 1728 | Ga0070716_100000245 | |||
| 1729 | Ga0070716_100001067 | |||
| 1730 | Ga0070716_100003370 | |||
| 1731 | Ga0070716_100009779 | |||
| 1732 | Ga0070716_100024382 | |||
| 1733 | Ga0070716_100025014 | |||
| 1734 | Ga0070716_100036148 | |||
| 1735 | Ga0070716_100077776 | |||
| 1736 | Ga0070716_100082166 | |||
| 1737 | Ga0070716_100106187 | |||
| 1738 | Ga0070716_100120781 | |||
| 1739 | Ga0070716_100387439 | |||
| 1740 | Ga0070716_100402603 | |||
| 1741 | Ga0070716_100670127 | |||
| 1742 | Ga0070712_100000137 | |||
| 1743 | Ga0070712_100000160 | |||
| 1744 | Ga0070712_100003932 | |||
| 1745 | Ga0070712_100006526 | |||
| 1746 | Ga0070712_100025987 | |||
| 1747 | Ga0070712_100069905 | |||
| 1748 | Ga0070712_100098125 | |||
| 1749 | Ga0070712_100162254 | |||
| 1750 | Ga0070712_100235704 | |||
| 1751 | Ga0070712_100438380 | |||
| 1752 | Ga0097621_100000866 | |||
| 1753 | Ga0097621_100008142 | |||
| 1754 | Ga0097621_100012133 | |||
| 1755 | Ga0097621_100110307 | |||
| 1756 | Ga0097621_100120754 | |||
| 1757 | Ga0097621_100176521 | |||
| 1758 | Ga0097621_100385304 | |||
| 1759 | Ga0097621_100482653 | |||
| 1760 | Ga0068871_100000389 | |||
| 1761 | Ga0068871_100004381 | |||
| 1762 | Ga0068871_100013588 | |||
| 1763 | Ga0068871_100020430 | |||
| 1764 | Ga0068871_100061823 | |||
| 1765 | Ga0068871_100233209 | |||
| 1766 | Ga0068871_100233603 | |||
| 1767 | Ga0068871_100347086 | |||
| 1768 | Ga0068871_100624214 | |||
| 1769 | Ga0075433_10025998 | |||
| 1770 | Ga0075434_100025649 | |||
| 1771 | Ga0075434_100043722 | |||
| 1772 | Ga0068865_100038271 | |||
| 1773 | Ga0068865_100057745 | |||
| 1774 | Ga0068865_100437395 | |||
| 1775 | Ga0075436_100000617 | |||
| 1776 | Ga0075436_100005379 | |||
| 1777 | Ga0075436_100008224 | |||
| 1778 | Ga0075436_100071120 | |||
| 1779 | Ga0075436_100100756 | |||
| 1780 | Ga0075436_100136394 | |||
| 1781 | Ga0075436_100343536 | |||
| 1782 | Ga0097620_100020260 | |||
| 1783 | Ga0097620_100076013 | |||
| 1784 | Ga0097620_100091067 | |||
| 1785 | Ga0075435_100006248 | |||
| 1786 | Ga0075435_100015023 | |||
| 1787 | Ga0075435_100018883 | |||
| 1788 | Ga0075435_100106884 | |||
| 1789 | Ga0075435_100695746 | |||
| 1790 | Ga0099794_10040998 | |||
| 1791 | Ga0099795_10018617 | |||
| 1792 | Ga0105240_10012373 | |||
| 1793 | Ga0105240_10016937 | |||
| 1794 | Ga0105240_10048990 | |||
| 1795 | Ga0105240_10057299 | |||
| 1796 | Ga0105240_10059796 | |||
| 1797 | Ga0105240_10155789 | |||
| 1798 | Ga0105240_10178379 | |||
| 1799 | Ga0105240_10300769 | |||
| 1800 | Ga0105240_10323692 | |||
| 1801 | Ga0105240_10423596 | |||
| 1802 | Ga0111539_10251988 | |||
| 1803 | Ga0105245_10002517 | |||
| 1804 | Ga0105245_10005508 | |||
| 1805 | Ga0105245_10005571 | |||
| 1806 | Ga0105245_10079867 | |||
| 1807 | Ga0105245_10204433 | |||
| 1808 | Ga0105245_10259778 | |||
| 1809 | Ga0105245_10474573 | |||
| 1810 | Ga0105247_10002780 | |||
| 1811 | Ga0105247_10013406 | |||
| 1812 | Ga0105247_10049016 | |||
| 1813 | Ga0105247_10263774 | |||
| 1814 | Ga0105247_10474945 | |||
| 1815 | Ga0105243_10116675 | |||
| 1816 | Ga0105241_10015361 | |||
| 1817 | Ga0105241_10027756 | |||
| 1818 | Ga0105241_10035343 | |||
| 1819 | Ga0105241_10036363 | |||
| 1820 | Ga0105241_10118815 | |||
| 1821 | Ga0105241_10197038 | |||
| 1822 | Ga0105241_10233179 | |||
| 1823 | Ga0105241_10251502 | |||
| 1824 | Ga0105241_10361556 | |||
| 1825 | Ga0105241_10472177 | |||
| 1826 | Ga0105242_10003041 | |||
| 1827 | Ga0105242_10019959 | |||
| 1828 | Ga0105242_10062961 | |||
| 1829 | Ga0105242_10248530 | |||
| 1830 | Ga0105242_10253551 | |||
| 1831 | Ga0105248_10037033 | |||
| 1832 | Ga0105248_10047910 | |||
| 1833 | Ga0105248_10061302 | |||
| 1834 | Ga0105248_10140590 | |||
| 1835 | Ga0105248_10248648 | |||
| 1836 | Ga0105248_10258611 | |||
| 1837 | Ga0105248_10334378 | |||
| 1838 | Ga0105248_10336215 | |||
| 1839 | Ga0105237_10153239 | |||
| 1840 | Ga0105237_10221497 | |||
| 1841 | Ga0105237_10280979 | |||
| 1842 | Ga0105237_10299139 | |||
| 1843 | Ga0105237_10380467 | |||
| 1844 | Ga0105237_10523413 | |||
| 1845 | Ga0105237_10597693 | |||
| 1846 | Ga0105238_10000214 | |||
| 1847 | Ga0105238_10015383 | |||
| 1848 | Ga0105238_10064054 | |||
| 1849 | Ga0105238_10099757 | |||
| 1850 | Ga0105238_10110643 | |||
| 1851 | Ga0105238_10250616 | |||
| 1852 | Ga0105238_10811014 | |||
| 1853 | Ga0105249_10002544 | |||
| 1854 | Ga0105249_10003055 | |||
| 1855 | Ga0105249_10508169 | |||
| 1856 | Ga0105249_11392457 | |||
| 1857 | Ga0099796_10009269 | |||
| 1858 | Ga0099796_10018605 | |||
| 1859 | Ga0099796_10149114 | |||
| 1860 | Ga0105239_10005155 | |||
| 1861 | Ga0105239_10009279 | |||
| 1862 | Ga0105239_10031699 | |||
| 1863 | Ga0105239_10122752 | |||
| 1864 | Ga0105239_10160101 | |||
| 1865 | Ga0105239_10225318 | |||
| 1866 | Ga0105239_10241550 | |||
| 1867 | Ga0105239_10429208 | |||
| 1868 | Ga0105246_10002563 | |||
| 1869 | Ga0105246_10057806 | |||
| 1870 | Ga0105246_10152473 | |||
| 1871 | Ga0105246_10402909 | |||
| 1872 | Ga0157373_10021339 | |||
| 1873 | Ga0157373_10046278 | |||
| 1874 | Ga0157373_10068830 | |||
| 1875 | Ga0157373_10087635 | |||
| 1876 | Ga0157373_10102141 | |||
| 1877 | Ga0157373_10156450 | |||
| 1878 | Ga0157371_10006751 | |||
| 1879 | Ga0157371_10019416 | |||
| 1880 | Ga0157371_10082689 | |||
| 1881 | Ga0157371_10120725 | |||
| 1882 | Ga0157370_10093091 | |||
| 1883 | Ga0157370_10249512 | |||
| 1884 | Ga0157369_10001356 | |||
| 1885 | Ga0157369_10001450 | |||
| 1886 | Ga0157369_10024189 | |||
| 1887 | Ga0157369_10030481 | |||
| 1888 | Ga0157369_10040105 | |||
| 1889 | Ga0157369_10073618 | |||
| 1890 | Ga0157369_10138669 | |||
| 1891 | Ga0157369_10219666 | |||
| 1892 | Ga0157369_10220534 | |||
| 1893 | Ga0157369_11181304 | |||
| 1894 | Ga0157374_10000634 | |||
| 1895 | Ga0157374_10000933 | |||
| 1896 | Ga0157374_10012477 | |||
| 1897 | Ga0157374_10014623 | |||
| 1898 | Ga0157374_10021322 | |||
| 1899 | Ga0157374_10063078 | |||
| 1900 | Ga0157374_10090020 | |||
| 1901 | Ga0157374_10323651 | |||
| 1902 | Ga0157374_10783876 | |||
| 1903 | Ga0157378_10000202 | |||
| 1904 | Ga0157378_10000725 | |||
| 1905 | Ga0157378_10001987 | |||
| 1906 | Ga0157378_10011031 | |||
| 1907 | Ga0157378_10015615 | |||
| 1908 | Ga0157378_10024355 | |||
| 1909 | Ga0157378_10026606 | |||
| 1910 | Ga0157378_10095627 | |||
| 1911 | Ga0157378_10241690 | |||
| 1912 | Ga0157378_10287912 | |||
| 1913 | Ga0163162_10012550 | |||
| 1914 | Ga0163162_10019094 | |||
| 1915 | Ga0163162_10043772 | |||
| 1916 | Ga0163162_10093677 | |||
| 1917 | Ga0163162_10176548 | |||
| 1918 | Ga0163162_10645872 | |||
| 1919 | Ga0157372_10001366 | |||
| 1920 | Ga0157372_10001445 | |||
| 1921 | Ga0157372_10004384 | |||
| 1922 | Ga0157372_10017432 | |||
| 1923 | Ga0157372_10033801 | |||
| 1924 | Ga0157372_10047456 | |||
| 1925 | Ga0157372_10105423 | |||
| 1926 | Ga0157372_10171357 | |||
| 1927 | Ga0157372_10234647 | |||
| 1928 | Ga0157372_10302565 | |||
| 1929 | Ga0157372_10501345 | |||
| 1930 | Ga0157372_10823502 | |||
| 1931 | Ga0157372_10861820 | |||
| 1932 | Ga0157375_10094229 | |||
| 1933 | Ga0157375_10238673 | |||
| 1934 | Ga0163163_10002855 | |||
| 1935 | Ga0163163_10016774 | |||
| 1936 | Ga0163163_10057910 | |||
| 1937 | Ga0163163_10074503 | |||
| 1938 | Ga0163163_10135298 | |||
| 1939 | Ga0163163_10307810 | |||
| 1940 | Ga0163163_10848926 | |||
| 1941 | Ga0157380_10044873 | |||
| 1942 | Ga0157380_10356561 | |||
| 1943 | Ga0182008_10005873 | |||
| 1944 | Ga0182008_10006717 | |||
| 1945 | Ga0157377_10002769 | |||
| 1946 | Ga0157377_10187647 | |||
| 1947 | Ga0157379_10008575 | |||
| 1948 | Ga0157379_10091518 | |||
| 1949 | Ga0157379_10223549 | |||
| 1950 | Ga0157379_10439714 | |||
| 1951 | Ga0157379_10450281 | |||
| 1952 | Ga0157376_10041763 | |||
| 1953 | Ga0157376_10120230 | |||
| 1954 | Ga0157376_10151535 | |||
| 1955 | Ga0157376_10181851 | |||
| 1956 | Ga0157376_10187991 | |||
| 1957 | Ga0157376_10902401 | |||
| 1958 | Ga0182007_10008222 | |||
| 1959 | Ga0182007_10015579 | |||
| 1960 | Ga0163161_10011329 | |||
| 1961 | Ga0206355_1443854 | |||
| 1962 | Ga0213874_10010643 | |||
| 1963 | Ga0213874_10155955 | |||
| 1964 | Ga0224712_10023051 | |||
| 1965 | Ga0224570_100693 | |||
| 1966 | Ga0224569_100208 | |||
| 1967 | Ga0224571_100380 | |||
| 1968 | Ga0224572_1008493 | |||
| 1969 | Ga0224572_1011757 | |||
| 1970 | Ga0228598_1000444 | |||
| 1971 | Ga0228598_1001640 | |||
| 1972 | Ga0228598_1009745 | |||
| 1973 | Ga0228598_1043357 | |||
| 1974 | Ga0207697_10005790 | |||
| 1975 | Ga0207656_10004119 | |||
| 1976 | Ga0207656_10025256 | |||
| 1977 | Ga0207656_10053100 | |||
| 1978 | Ga0207656_10127260 | |||
| 1979 | Ga0207682_10000826 | |||
| 1980 | Ga0207692_10002949 | |||
| 1981 | Ga0207692_10008329 | |||
| 1982 | Ga0207692_10043513 | |||
| 1983 | Ga0207692_10057058 | |||
| 1984 | Ga0207692_10058217 | |||
| 1985 | Ga0207692_10085800 | |||
| 1986 | Ga0207692_10092433 | |||
| 1987 | Ga0207692_10156211 | |||
| 1988 | Ga0207692_10211514 | |||
| 1989 | Ga0207692_10366318 | |||
| 1990 | Ga0207692_10378490 | |||
| 1991 | Ga0207642_10036653 | |||
| 1992 | Ga0207642_10085903 | |||
| 1993 | Ga0207642_10118802 | |||
| 1994 | Ga0207642_10158218 | |||
| 1995 | Ga0207642_10192767 | |||
| 1996 | Ga0207642_10241147 | |||
| 1997 | Ga0207710_10005993 | |||
| 1998 | Ga0207710_10090240 | |||
| 1999 | Ga0207710_10137062 | |||
| 2000 | Ga0207688_10022482 | |||
| 2001 | Ga0207680_10045858 | |||
| 2002 | Ga0207680_10170647 | |||
| 2003 | Ga0207647_10016942 | |||
| 2004 | Ga0207647_10033091 | |||
| 2005 | Ga0207647_10040863 | |||
| 2006 | Ga0207685_10012926 | |||
| 2007 | Ga0207685_10041434 | |||
| 2008 | Ga0207685_10111628 | |||
| 2009 | Ga0207685_10281829 | |||
| 2010 | Ga0207699_10000500 | |||
| 2011 | Ga0207699_10004194 | |||
| 2012 | Ga0207699_10018669 | |||
| 2013 | Ga0207699_10046705 | |||
| 2014 | Ga0207699_10054546 | |||
| 2015 | Ga0207699_10088565 | |||
| 2016 | Ga0207699_10107418 | |||
| 2017 | Ga0207699_10114827 | |||
| 2018 | Ga0207699_10116432 | |||
| 2019 | Ga0207699_10139997 | |||
| 2020 | Ga0207699_10141170 | |||
| 2021 | Ga0207699_10153670 | |||
| 2022 | Ga0207699_10154767 | |||
| 2023 | Ga0207699_10184632 | |||
| 2024 | Ga0207699_10264616 | |||
| 2025 | Ga0207645_10000559 | |||
| 2026 | Ga0207645_10004273 | |||
| 2027 | Ga0207643_10001182 | |||
| 2028 | Ga0207643_10166663 | |||
| 2029 | Ga0207705_10307733 | |||
| 2030 | Ga0207705_10617399 | |||
| 2031 | Ga0207684_10000447 | |||
| 2032 | Ga0207684_10003786 | |||
| 2033 | Ga0207684_10029173 | |||
| 2034 | Ga0207684_10049625 | |||
| 2035 | Ga0207684_10051528 | |||
| 2036 | Ga0207684_10080416 | |||
| 2037 | Ga0207684_10092510 | |||
| 2038 | Ga0207654_10025850 | |||
| 2039 | Ga0207654_10031513 | |||
| 2040 | Ga0207654_10095545 | |||
| 2041 | Ga0207654_10342241 | |||
| 2042 | Ga0207707_10007113 | |||
| 2043 | Ga0207707_10007719 | |||
| 2044 | Ga0207707_10024683 | |||
| 2045 | Ga0207707_10036015 | |||
| 2046 | Ga0207707_10057464 | |||
| 2047 | Ga0207707_10066212 | |||
| 2048 | Ga0207707_10156366 | |||
| 2049 | Ga0207707_10234807 | |||
| 2050 | Ga0207707_10297769 | |||
| 2051 | Ga0207695_10016663 | |||
| 2052 | Ga0207695_10021009 | |||
| 2053 | Ga0207695_10041339 | |||
| 2054 | Ga0207695_10049139 | |||
| 2055 | Ga0207695_10102997 | |||
| 2056 | Ga0207695_10121129 | |||
| 2057 | Ga0207695_10124888 | |||
| 2058 | Ga0207695_10154131 | |||
| 2059 | Ga0207695_10205401 | |||
| 2060 | Ga0207695_10247082 | |||
| 2061 | Ga0207695_10711240 | |||
| 2062 | Ga0207671_10078351 | |||
| 2063 | Ga0207671_10089763 | |||
| 2064 | Ga0207671_10127506 | |||
| 2065 | Ga0207671_10567030 | |||
| 2066 | Ga0207693_10000015 | |||
| 2067 | Ga0207693_10000271 | |||
| 2068 | Ga0207693_10000440 | |||
| 2069 | Ga0207693_10004290 | |||
| 2070 | Ga0207693_10024713 | |||
| 2071 | Ga0207693_10038411 | |||
| 2072 | Ga0207693_10115303 | |||
| 2073 | Ga0207693_10155648 | |||
| 2074 | Ga0207693_10155976 | |||
| 2075 | Ga0207693_10400660 | |||
| 2076 | Ga0207693_10412689 | |||
| 2077 | Ga0207693_10413818 | |||
| 2078 | Ga0207693_10583447 | |||
| 2079 | Ga0207693_10702365 | |||
| 2080 | Ga0207663_10001723 | |||
| 2081 | Ga0207663_10006828 | |||
| 2082 | Ga0207663_10009827 | |||
| 2083 | Ga0207663_10075107 | |||
| 2084 | Ga0207663_10170658 | |||
| 2085 | Ga0207663_10187486 | |||
| 2086 | Ga0207663_10301875 | |||
| 2087 | Ga0207663_10307800 | |||
| 2088 | Ga0207663_10324188 | |||
| 2089 | Ga0207663_10377198 | |||
| 2090 | Ga0207660_10015217 | |||
| 2091 | Ga0207660_10064752 | |||
| 2092 | Ga0207660_10086028 | |||
| 2093 | Ga0207660_10090299 | |||
| 2094 | Ga0207660_10200976 | |||
| 2095 | Ga0207660_10451090 | |||
| 2096 | Ga0207662_10002448 | |||
| 2097 | Ga0207662_10014408 | |||
| 2098 | Ga0207662_10127370 | |||
| 2099 | Ga0207662_10242781 | |||
| 2100 | Ga0207657_10000766 | |||
| 2101 | Ga0207657_10001795 | |||
| 2102 | Ga0207657_10003111 | |||
| 2103 | Ga0207649_10000344 | |||
| 2104 | Ga0207649_10025834 | |||
| 2105 | Ga0207649_10065227 | |||
| 2106 | Ga0207649_10086039 | |||
| 2107 | Ga0207649_10387069 | |||
| 2108 | Ga0207652_10030969 | |||
| 2109 | Ga0207652_10032508 | |||
| 2110 | Ga0207652_10062497 | |||
| 2111 | Ga0207652_10116861 | |||
| 2112 | Ga0207652_10132899 | |||
| 2113 | Ga0207652_10445541 | |||
| 2114 | Ga0207652_10466814 | |||
| 2115 | Ga0207652_10546977 | |||
| 2116 | Ga0207652_10626009 | |||
| 2117 | Ga0207646_10000676 | |||
| 2118 | Ga0207646_10000939 | |||
| 2119 | Ga0207646_10067160 | |||
| 2120 | Ga0207646_10106211 | |||
| 2121 | Ga0207646_10231197 | |||
| 2122 | Ga0207646_10556048 | |||
| 2123 | Ga0207681_10015679 | |||
| 2124 | Ga0207681_10368025 | |||
| 2125 | Ga0207694_10002265 | |||
| 2126 | Ga0207694_10162233 | |||
| 2127 | Ga0207694_10170624 | |||
| 2128 | Ga0207694_10202650 | |||
| 2129 | Ga0207694_10582098 | |||
| 2130 | Ga0207650_10000058 | |||
| 2131 | Ga0207659_10046383 | |||
| 2132 | Ga0207659_10425788 | |||
| 2133 | Ga0207687_10031371 | |||
| 2134 | Ga0207687_10050749 | |||
| 2135 | Ga0207687_10126800 | |||
| 2136 | Ga0207687_10130104 | |||
| 2137 | Ga0207687_10156294 | |||
| 2138 | Ga0207687_10207103 | |||
| 2139 | Ga0207687_10920984 | |||
| 2140 | Ga0207700_10000095 | |||
| 2141 | Ga0207700_10000224 | |||
| 2142 | Ga0207700_10011823 | |||
| 2143 | Ga0207700_10032670 | |||
| 2144 | Ga0207700_10049855 | |||
| 2145 | Ga0207700_10056574 | |||
| 2146 | Ga0207700_10072527 | |||
| 2147 | Ga0207700_10110494 | |||
| 2148 | Ga0207700_10142878 | |||
| 2149 | Ga0207700_10169504 | |||
| 2150 | Ga0207700_10177684 | |||
| 2151 | Ga0207700_10200661 | |||
| 2152 | Ga0207700_10615083 | |||
| 2153 | Ga0207700_10855998 | |||
| 2154 | Ga0207664_10000265 | |||
| 2155 | Ga0207664_10013334 | |||
| 2156 | Ga0207664_10023325 | |||
| 2157 | Ga0207664_10035312 | |||
| 2158 | Ga0207664_10096721 | |||
| 2159 | Ga0207664_10127067 | |||
| 2160 | Ga0207664_10149849 | |||
| 2161 | Ga0207664_10279644 | |||
| 2162 | Ga0207664_10279866 | |||
| 2163 | Ga0207664_10458497 | |||
| 2164 | Ga0207664_10572533 | |||
| 2165 | Ga0207664_10877192 | |||
| 2166 | Ga0207664_11037468 | |||
| 2167 | Ga0207644_10053840 | |||
| 2168 | Ga0207644_10139235 | |||
| 2169 | Ga0207690_10045837 | |||
| 2170 | Ga0207690_10146131 | |||
| 2171 | Ga0207690_10217148 | |||
| 2172 | Ga0207706_10000732 | |||
| 2173 | Ga0207706_10000956 | |||
| 2174 | Ga0207686_10037996 | |||
| 2175 | Ga0207686_10086943 | |||
| 2176 | Ga0207686_10097718 | |||
| 2177 | Ga0207686_10306280 | |||
| 2178 | Ga0207709_10145090 | |||
| 2179 | Ga0207670_10004801 | |||
| 2180 | Ga0207704_10030050 | |||
| 2181 | Ga0207704_10040377 | |||
| 2182 | Ga0207704_10402581 | |||
| 2183 | Ga0207665_10000049 | |||
| 2184 | Ga0207665_10001658 | |||
| 2185 | Ga0207665_10004144 | |||
| 2186 | Ga0207665_10006523 | |||
| 2187 | Ga0207665_10014854 | |||
| 2188 | Ga0207665_10021191 | |||
| 2189 | Ga0207665_10063800 | |||
| 2190 | Ga0207665_10067114 | |||
| 2191 | Ga0207665_10086460 | |||
| 2192 | Ga0207665_10091299 | |||
| 2193 | Ga0207665_10121606 | |||
| 2194 | Ga0207665_10128813 | |||
| 2195 | Ga0207665_10134194 | |||
| 2196 | Ga0207665_10141989 | |||
| 2197 | Ga0207665_10148147 | |||
| 2198 | Ga0207665_10251247 | |||
| 2199 | Ga0207665_10463539 | |||
| 2200 | Ga0207691_10002552 | |||
| 2201 | Ga0207711_10029133 | |||
| 2202 | Ga0207711_10167073 | |||
| 2203 | Ga0207711_10171699 | |||
| 2204 | Ga0207711_10196885 | |||
| 2205 | Ga0207711_10208013 | |||
| 2206 | Ga0207711_10310597 | |||
| 2207 | Ga0207711_10492921 | |||
| 2208 | Ga0207711_10630831 | |||
| 2209 | Ga0207689_10000512 | |||
| 2210 | Ga0207689_10001703 | |||
| 2211 | Ga0207689_10022953 | |||
| 2212 | Ga0207689_10036804 | |||
| 2213 | Ga0207689_10920582 | |||
| 2214 | Ga0207661_10000328 | |||
| 2215 | Ga0207661_10041003 | |||
| 2216 | Ga0207661_10060196 | |||
| 2217 | Ga0207661_10440422 | |||
| 2218 | Ga0207661_10548139 | |||
| 2219 | Ga0207661_10625923 | |||
| 2220 | Ga0207679_10000170 | |||
| 2221 | Ga0207679_10012413 | |||
| 2222 | Ga0207679_10037212 | |||
| 2223 | Ga0207679_10242360 | |||
| 2224 | Ga0207679_10379013 | |||
| 2225 | Ga0207679_11027818 | |||
| 2226 | Ga0207667_10006788 | |||
| 2227 | Ga0207667_10031195 | |||
| 2228 | Ga0207667_10054117 | |||
| 2229 | Ga0207667_10067834 | |||
| 2230 | Ga0207667_10128087 | |||
| 2231 | Ga0207667_10204606 | |||
| 2232 | Ga0207667_10242732 | |||
| 2233 | Ga0207667_10291787 | |||
| 2234 | Ga0207667_10867515 | |||
| 2235 | Ga0207651_10008651 | |||
| 2236 | Ga0207651_10436601 | |||
| 2237 | Ga0207712_10035640 | |||
| 2238 | Ga0207712_10928332 | |||
| 2239 | Ga0207668_10162558 | |||
| 2240 | Ga0207668_10968346 | |||
| 2241 | Ga0207640_10004443 | |||
| 2242 | Ga0207640_10118892 | |||
| 2243 | Ga0207640_10129664 | |||
| 2244 | Ga0207640_10146244 | |||
| 2245 | Ga0207640_10193978 | |||
| 2246 | Ga0207640_10537530 | |||
| 2247 | Ga0207640_10560632 | |||
| 2248 | Ga0207658_10160407 | |||
| 2249 | Ga0207658_10246020 | |||
| 2250 | Ga0207658_10625116 | |||
| 2251 | Ga0207677_10009877 | |||
| 2252 | Ga0207677_10016958 | |||
| 2253 | Ga0207677_10034948 | |||
| 2254 | Ga0207677_10092488 | |||
| 2255 | Ga0207677_10100208 | |||
| 2256 | Ga0207677_10119496 | |||
| 2257 | Ga0207677_10291891 | |||
| 2258 | Ga0207677_10657725 | |||
| 2259 | Ga0207677_10717955 | |||
| 2260 | Ga0207703_10001237 | |||
| 2261 | Ga0207703_10003326 | |||
| 2262 | Ga0207703_10051504 | |||
| 2263 | Ga0207703_10070136 | |||
| 2264 | Ga0207703_10070460 | |||
| 2265 | Ga0207703_10162224 | |||
| 2266 | Ga0207639_10005167 | |||
| 2267 | Ga0207639_10005894 | |||
| 2268 | Ga0207639_10014708 | |||
| 2269 | Ga0207639_10071290 | |||
| 2270 | Ga0207639_10092463 | |||
| 2271 | Ga0207639_10102406 | |||
| 2272 | Ga0207639_10119152 | |||
| 2273 | Ga0207639_10200206 | |||
| 2274 | Ga0207678_10000887 | |||
| 2275 | Ga0207678_10001608 | |||
| 2276 | Ga0207702_10000415 | |||
| 2277 | Ga0207702_10000866 | |||
| 2278 | Ga0207702_10001193 | |||
| 2279 | Ga0207702_10026868 | |||
| 2280 | Ga0207702_10057298 | |||
| 2281 | Ga0207702_10082101 | |||
| 2282 | Ga0207702_10113285 | |||
| 2283 | Ga0207702_10150393 | |||
| 2284 | Ga0207702_10399113 | |||
| 2285 | Ga0207702_10621857 | |||
| 2286 | Ga0207641_10000323 | |||
| 2287 | Ga0207641_10010259 | |||
| 2288 | Ga0207641_10164887 | |||
| 2289 | Ga0207648_10000870 | |||
| 2290 | Ga0207648_10049697 | |||
| 2291 | Ga0207648_10078342 | |||
| 2292 | Ga0207676_10001412 | |||
| 2293 | Ga0207676_10001649 | |||
| 2294 | Ga0207676_10027339 | |||
| 2295 | Ga0207676_10035580 | |||
| 2296 | Ga0207676_10048872 | |||
| 2297 | Ga0207676_10067197 | |||
| 2298 | Ga0207676_10240306 | |||
| 2299 | Ga0207674_10000164 | |||
| 2300 | Ga0207674_10000269 | |||
| 2301 | Ga0207674_10009605 | |||
| 2302 | Ga0207674_10069953 | |||
| 2303 | Ga0207674_10083587 | |||
| 2304 | Ga0207674_10149144 | |||
| 2305 | Ga0207674_10185924 | |||
| 2306 | Ga0207675_100077714 | |||
| 2307 | Ga0207675_100112466 | |||
| 2308 | Ga0207675_100119688 | |||
| 2309 | Ga0207683_10000493 | |||
| 2310 | Ga0207683_10084329 | |||
| 2311 | Ga0207683_10084876 | |||
| 2312 | Ga0207698_10003243 | |||
| 2313 | Ga0207698_10202364 | |||
| 2314 | Ga0207698_10372421 | |||
| 2315 | Ga0207698_10899694 | |||
| 2316 | Ga0207698_10983507 | |||
| 2317 | Ga0265354_1003879 | |||
| 2318 | Ga0265356_1000796 | |||
| 2319 | Ga0265356_1003059 | |||
| 2320 | Ga0265355_1005336 | |||
| 2321 | Ga0268266_10006414 | |||
| 2322 | Ga0268266_10057790 | |||
| 2323 | Ga0268266_10626178 | |||
| 2324 | Ga0268265_10002217 | |||
| 2325 | Ga0268265_10066425 | |||
| 2326 | Ga0268265_10104611 | |||
| 2327 | Ga0268265_10474619 | |||
| 2328 | Ga0268264_10007432 | |||
| 2329 | Ga0268264_10030585 | |||
| 2330 | Ga0268264_10031105 | |||
| 2331 | Ga0268264_10064813 | |||
| 2332 | Ga0268264_10133421 | |||
| 2333 | Ga0265336_10076755 | |||
| 2334 | Ga0265338_10002180 | |||
| 2335 | Ga0265338_10004188 | |||
| 2336 | Ga0265338_10095093 | |||
| 2337 | Ga0265338_10401812 | |||
| 2338 | Ga0265762_1001136 | |||
| 2339 | Ga0265762_1001663 | |||
| 2340 | Ga0265762_1002914 | |||
| 2341 | Ga0265770_1020524 | |||
| 2342 | Ga0265773_1009968 | |||
| 2343 | Ga0265760_10000931 | |||
| 2344 | Ga0265760_10001483 | |||
| 2345 | Ga0265760_10002685 | |||
| 2346 | Ga0265760_10003511 | |||
| 2347 | Ga0265332_10154024 | |||
| 2348 | Ga0265328_10051661 | |||
| 2349 | Ga0265325_10076336 | |||
| 2350 | Ga0265340_10074872 | |||
| 2351 | Ga0265340_10218955 | |||
| 2352 | Ga0265339_10017636 | |||
| 2353 | Ga0265339_10047578 | |||
| 2354 | Ga0265339_10095739 | |||
| 2355 | Ga0265339_10101923 | |||
| 2356 | Ga0265339_10182021 | |||
| 2357 | Ga0265316_10007573 | |||
| 2358 | Ga0265314_10001626 | |||
| 2359 | Ga0265314_10015261 | |||
| 2360 | Ga0265314_10171917 | |||
| 2361 | Ga0307407_10068623 | |||
| 2362 | Ga0307409_100002346 | |||
| 2363 | Ga0307409_100009366 | |||
| 2364 | Ga0307416_100023736 | |||
| 2365 | Ga0307411_10013959 | |||
| 2366 | Ga0307415_100488840 | |||
| 2367 | Ga0316214_1001064 | |||
| 2368 | Ga0373930_0014593 | |||
| 2369 | Ga0373950_0039636 | |||
| 2370 | Ga0373926_0003742 | |||
| 2371 | Ga0373926_0025902 | |||
| 2372 | Ga0373926_0084805 | |||
| 2373 | Ga0373926_0132537 | |||
| 2374 | Ga0373928_0081321 | |||
| 2375 | Ga0373934_0027565 | |||
| 2376 | Ga0373934_0057247 | |||
| 2377 | Ga0373940_0133126 | |||
| 2378 | Ga0373944_0008880 | |||
| 2379 | Ga0373944_0009947 | |||
| 2380 | Ga0373949_0031524 | |||
| 2381 | Ga0373932_0077753 | |||
| 2382 | Ga0373936_0003050 | |||
| 2383 | Ga0373936_0024901 | |||
| 2384 | Ga0373936_0041474 | |||
| 2385 | Ga0373936_0082450 | |||
| 2386 | Ga0373941_0050711 | |||
| 2387 | Ga0373945_0004158 | |||
| 2388 | Ga0373945_0021455 | |||
| 2389 | Ga0373953_0111255 | |||
| 2390 | Ga0373953_0140048 | |||
| 2391 | Ga0373956_0006358 | |||
| 2392 | Ga0373957_0040791 | |||
| 2393 | Ga0373943_0002936 | |||
| 2394 | Ga0373943_0087919 | |||
| 2395 | Ga0373946_0058962 | |||
| 2396 | Ga0373955_0028626 | |||
| 2397 | Ga0373955_0047391 | |||
| 2398 | Ga0373961_0029302 | |||
| 2399 | Ga0373962_0077031 | |||
| 2400 | Ga0373924_0000405 | |||
| 2401 | Ga0373924_0006530 | |||
| 2402 | Ga0373924_0027003 | |||
| 2403 | Ga0373924_0125528 | |||
| 2404 | Ga0373924_0126742 | |||
| 2405 | Ga0373924_0153332 | |||
| 2406 | Ga0373931_0057852 | |||
| 2407 | Ga0373931_0061266 | |||
| 2408 | Ga0373931_0300403 | |||
| 2409 | Ga0373935_0005782 | |||
| 2410 | Ga0373935_0011685 | |||
| 2411 | Ga0373935_0016240 | |||
| 2412 | Ga0373935_0119189 | |||
| 2413 | Ga0373935_0242141 | |||
| 2414 | Ga0373935_0304089 | |||
| 2415 | Ga0373935_0605230 | |||
| 2416 | Ga0373935_0614905 | |||
| 2417 | Ga0373927_0000389 | |||
| 2418 | Ga0373927_0017315 | |||
| 2419 | Ga0373927_0044905 | |||
| 2420 | Ga0373927_0126459 | |||
| 2421 | Ga0373933_0029202 | |||
| 2422 | Ga0373933_0267816 | |||
| 2423 | Ga0373933_0268063 | |||
| 2424 | Ga0373947_0000147 | |||
| 2425 | Ga0373947_0006209 | |||
| 2426 | Ga0373947_0014220 | |||
| 2427 | Ga0373947_0014909 | |||
| 2428 | Ga0373947_0370759 | |||
| 2429 | Ga0373947_0462063 | |||
| 2430 | Ga0373937_0000094 | |||
| 2431 | Ga0373937_0008668 | |||
| 2432 | Ga0373937_0147963 | |||
| 2433 | Ga0373937_0208147 | |||
| 2434 | Ga0373937_0423773 | |||
| 2435 | Ga0373937_0564071 | |||
| 2436 | Ga0373925_0000243 | |||
| 2437 | Ga0373925_0003398 | |||
| 2438 | Ga0373925_0005997 | |||
| 2439 | Ga0373925_0016103 | |||
| 2440 | Ga0373925_0021763 | |||
| 2441 | Ga0373925_0081225 | |||
| 2442 | Ga0373925_0161969 | |||
| 2443 | Ga0373925_0221335 | |||
| 2444 | Ga0373925_0274890 | |||
| 2445 | Ga0373925_0279246 | |||
| 2446 | Ga0373925_0520634 | |||
| 2447 | Ga0395898_0182252 | |||
| 2448 | Ga0395898_0570543 | |||
| 2449 | Ga0395905_0147920 | |||
| 2450 | Ga0395905_0190557 | |||
| 2451 | Ga0395905_0218816 | |||
| 2452 | Ga0395905_0599568 | |||
| 2453 | Ga0436364_0606406 | |||
| 2454 | Ga0436365_1592604 | |||
| 2455 | Ga0436365_1640734 | |||
| 2456 | Ga0436360_1156664 | |||
| 2457 | Ga0436363_0154653 | |||
| 2458 | Ga0436363_0313774 | |||
| 2459 | Ga0436363_0350881 | |||
| 2460 | Ga0436363_0523760 | |||
| 2461 | Ga0436363_0779725 | |||
| 2462 | Ga0451577_0000760 | |||
| 2463 | Ga0451577_0421755 | |||
| 2464 | Ga0453683_0076861 | |||
| 2465 | Ga0466965_0060932 | |||
| 2466 | Ga0466966_0333952 | |||
| 2467 | Ga0466961_0089571 | |||
| 2468 | Ga0466963_0004868 | |||
| 2469 | Ga0466963_0027676 | |||
| 2470 | Ga0466963_0054618 | |||
| 2471 | Ga0466964_0100453 | |||
| 2472 | Ga0466964_0246825 | |||
| 2473 | Ga0466964_0360755 | |||
| 2474 | Ga0453684_0000104 | |||
| 2475 | Ga0453684_0778348 | |||
| 2476 | Ga0466957_0000162 | |||
| 2477 | Ga0466957_0065767 | |||
| 2478 | Ga0466959_0004700 | |||
| 2479 | Ga0466959_0363592 | |||
| 2480 | Ga0466959_0367344 | |||
| 2481 | Ga0451576_0014185 | |||
| 2482 | Ga0451576_0014296 | |||
| 2483 | Ga0451576_0153169 | |||
| 2484 | Ga0466958_0033599 | |||
| 2485 | Ga0466967_0002458 | |||
| 2486 | Ga0466967_0021392 | |||
| 2487 | Ga0466967_0076966 | |||
| 2488 | Ga0466967_0140538 | |||
| 2489 | Ga0466967_0150081 | |||
| 2490 | Ga0466967_0332198 | |||
| 2491 | Ga0466967_0394082 | |||
| 2492 | Ga0466967_0727684 | |||
| 2493 | Ga0495603_0128482 | |||
| 2494 | Ga0495629_0401346 | |||
| 2495 | Ga0495651_0156573 | |||
| 2496 | Ga0495580_0000207 | |||
| 2497 | Ga0495580_0000954 | |||
| 2498 | Ga0495580_0001003 | |||
| 2499 | Ga0495580_0010373 | |||
| 2500 | Ga0495580_0010808 | |||
| 2501 | Ga0495580_0020655 | |||
| 2502 | Ga0495580_0028373 | |||
| 2503 | Ga0495580_0070919 | |||
| 2504 | Ga0495580_0113663 | |||
| 2505 | Ga0495580_0120103 | |||
| 2506 | Ga0495580_0148301 | |||
| 2507 | Ga0495580_0155658 | |||
| 2508 | Ga0495580_0168194 | |||
| 2509 | Ga0495580_0195544 | |||
| 2510 | Ga0495582_0001085 | |||
| 2511 | Ga0495582_0022396 | |||
| 2512 | Ga0495582_0099848 | |||
| 2513 | Ga0495605_0132789 | |||
| 2514 | Ga0495664_0245093 | |||
| 2515 | Ga0495664_0252096 | |||
| 2516 | Ga0495594_0025512 | |||
| 2517 | Ga0495594_0055427 | |||
| 2518 | Ga0495628_0303561 | |||
| 2519 | Ga0495628_0386846 | |||
| 2520 | Ga0495628_0480871 | |||
| 2521 | Ga0495630_0058826 | |||
| 2522 | Ga0495630_0142593 | |||
| 2523 | Ga0495630_0183514 | |||
| 2524 | Ga0495666_0031598 | |||
| 2525 | Ga0495665_0006832 | |||
| 2526 | Ga0495665_0042263 | |||
| 2527 | Ga0495665_0161590 | |||
| 2528 | Ga0495586_0116406 | |||
| 2529 | Ga0495645_0308814 | |||
| 2530 | Ga0495667_0051260 | |||
| 2531 | Ga0495667_0389623 | |||
| 2532 | Ga0495635_0145610 | |||
| 2533 | Ga0495659_0026242 | |||
| 2534 | Ga0495588_0136351 | |||
| 2535 | Ga0495657_0094763 | |||
| 2536 | Ga0495657_0405974 | |||
| 2537 | Ga0495623_0083996 | |||
| 2538 | Ga0495623_0177865 | |||
| 2539 | Ga0495646_0328929 | |||
| 2540 | Ga0495647_0187162 | |||
| 2541 | Ga0495658_0013868 | |||
| 2542 | Ga0495658_0270365 | |||
| 2543 | Ga0495669_0009520 | |||
| 2544 | Ga0495669_0307451 | |||
| 2545 | Ga0495624_0132825 | |||
| 2546 | Ga0495581_0169730 | |||
| 2547 | Ga0495581_0473133 | |||
| 2548 | Ga0495604_0115648 | |||
| 2549 | Ga0495604_0141991 | |||
| 2550 | Ga0495604_0514267 | |||
| 2551 | Ga0495674_0010677 | |||
| 2552 | Ga0495674_0012983 | |||
| 2553 | Ga0495674_0189938 | |||
| 2554 | Ga0495674_0230976 | |||
| 2555 | Ga0495674_0785433 | |||
| 2556 | Ga0495684_0134004 | |||
| 2557 | Ga0495684_0264760 | |||
| 2558 | Ga0495593_0121341 | |||
| 2559 | Ga0495602_0042046 | |||
| 2560 | Ga0495602_0063358 | |||
| 2561 | Ga0495602_0173348 | |||
| 2562 | Ga0496100_0041074 | |||
| 2563 | Ga0496100_0079201 | |||
| 2564 | Ga0496100_0244587 | |||
| 2565 | Ga0496101_0050583 | |||
| 2566 | Ga0496101_0180335 | |||
| 2567 | Ga0496102_0002115 | |||
| 2568 | Ga0496102_0028941 | |||
| 2569 | Ga0496102_0032555 | |||
| 2570 | Ga0496102_0063173 | |||
| 2571 | Ga0496102_0085192 | |||
| 2572 | Ga0496102_0114753 | |||
| 2573 | Ga0496102_0151951 | |||
| 2574 | Ga0496102_0235804 | |||
| 2575 | Ga0496102_0419890 | |||
| 2576 | Ga0496102_1009024 | |||
| 2577 | Ga0496103_0007300 | |||
| 2578 | Ga0496103_0098360 | |||
| 2579 | Ga0496103_0168476 | |||
| 2580 | Ga0496103_0284010 | |||
| 2581 | Ga0496103_0316981 | |||
| 2582 | Ga0496104_0027435 | |||
| 2583 | Ga0496104_0030003 | |||
| 2584 | Ga0496104_0040711 | |||
| 2585 | Ga0496104_0067886 | |||
| 2586 | Ga0496104_0082469 | |||
| 2587 | Ga0496104_0086428 | |||
| 2588 | Ga0496104_0149125 | |||
| 2589 | Ga0496104_0153281 | |||
| 2590 | Ga0496104_0153503 | |||
| 2591 | Ga0496104_0155909 | |||
| 2592 | Ga0496104_0186622 | |||
| 2593 | Ga0496104_0314397 | |||
| 2594 | Ga0496104_0465399 | |||
| 2595 | Ga0496104_0660524 | |||
| 2596 | Ga0496104_0845381 | |||
| 2597 | Ga0496105_0067370 | |||
| 2598 | Ga0496105_0073573 | |||
| 2599 | Ga0496105_0076554 | |||
| 2600 | Ga0496105_0106282 | |||
| 2601 | Ga0496105_0236303 | |||
| 2602 | Ga0496105_0302622 | |||
| 2603 | Ga0496106_0099506 | |||
| 2604 | Ga0496106_0118995 | |||
| 2605 | Ga0496106_0428852 | |||
| 2606 | Ga0496106_0434793 | |||
| 2607 | Ga0496107_0033870 | |||
| 2608 | Ga0496107_0171219 | |||
| 2609 | Ga0496107_0193790 | |||
| 2610 | Ga0496107_0350120 | |||
| 2611 | Ga0496107_0416370 | |||
| 2612 | Ga0496108_0000444 | |||
| 2613 | Ga0496108_0242908 | |||
| 2614 | Ga0496108_0356470 | |||
| 2615 | Ga0496109_0002079 | |||
| 2616 | Ga0496109_0077503 | |||
| 2617 | Ga0496109_0121542 | |||
| 2618 | Ga0496109_0244716 | |||
| 2619 | Ga0496109_0796650 | |||
| 2620 | Ga0496110_0009263 | |||
| 2621 | Ga0496110_0010922 | |||
| 2622 | Ga0496110_0012463 | |||
| 2623 | Ga0496110_0055531 | |||
| 2624 | Ga0496110_0920820 | |||
| 2625 | Ga0496111_0003547 | |||
| 2626 | Ga0496111_0004197 | |||
| 2627 | Ga0496111_0005860 | |||
| 2628 | Ga0496111_0085473 | |||
| 2629 | Ga0496112_0000060 | |||
| 2630 | Ga0496112_0001326 | |||
| 2631 | Ga0496112_0001636 | |||
| 2632 | Ga0496112_0008785 | |||
| 2633 | Ga0496112_0016574 | |||
| 2634 | Ga0496112_0023715 | |||
| 2635 | Ga0496112_0028527 | |||
| 2636 | Ga0496112_0076772 | |||
| 2637 | Ga0496112_0097306 | |||
| 2638 | Ga0496112_0097765 | |||
| 2639 | Ga0496112_0146479 | |||
| 2640 | Ga0496112_0220059 | |||
| 2641 | Ga0496112_0280261 | |||
| 2642 | Ga0496112_0610930 | |||
| 2643 | Ga0496112_0770343 | |||
| 2644 | Ga0496113_0002406 | |||
| 2645 | Ga0496113_0019372 | |||
| 2646 | Ga0496113_0043393 | |||
| 2647 | Ga0496113_0074664 | |||
| 2648 | Ga0496113_0326035 | |||
| 2649 | Ga0496114_0125800 | |||
| 2650 | Ga0496114_0143712 | |||
| 2651 | Ga0496115_0006392 | |||
| 2652 | Ga0496115_0009148 | |||
| 2653 | Ga0496115_0525485 | |||
| 2654 | Ga0496115_0699200 | |||
| 2655 | Ga0501298_011412 | |||
| 2656 | Ga0501299_012498 | |||
| 2657 | Ga0501069_0271838 | |||
| 2658 | Ga0501073_0086975 | |||
| 2659 | Ga0501216_028329 | |||
| 2660 | Ga0501217_069987 | |||
| 2661 | Ga0501257_020950 | |||
| 2662 | Ga0501257_056031 | |||
| 2663 | Ga0501225_0051551 | |||
| 2664 | Ga0501272_015452 | |||
| 2665 | nmdc:mga08y16_658830_c1 | |||
| 2666 | nmdc:mga0n895_110774_c1 | |||
| 2667 | nmdc:mga0n895_152296_c1 | |||
| 2668 | nmdc:mga0n895_423218_c1 | |||
| 2669 | nmdc:mga0n895_560_c1 | |||
| 2670 | nmdc:mga0n895_73080_c1 | |||
| 2671 | nmdc:mga0rr50_207971_c1 | |||
| 2672 | nmdc:mga0rr50_20917_c1 | |||
| 2673 | nmdc:mga0rr50_417396_c1 | |||
| 2674 | nmdc:mga0rr50_4515_c1 | |||
| 2675 | nmdc:mga0rr50_843333_c1 | |||
| 2676 | nmdc:mga08x19_122466_c1 | |||
| 2677 | nmdc:mga08x19_13875_c1 | |||
| 2678 | nmdc:mga08x19_4249_c1 | |||
| 2679 | nmdc:mga08x19_57371_c1 | |||
| 2680 | nmdc:mga08x19_5779_c1 | |||
| 2681 | nmdc:mga0a205_21929_c1 | |||
| 2682 | nmdc:mga0a205_808600_c1 | |||
| 2683 | Ga0495601_0039537 | |||
| 2684 | Ga0495601_0089406 | |||
| 2685 | Ga0495612_0170469 | |||
| 2686 | Ga0495619_0236592 | |||
| 2687 | Ga0501084_0659959 | |||
| 2688 | Ga0587073_0043795 | |||
| 2689 | Ga0587077_056091 | |||
| 2690 | Ga0587067_011688 | |||
| 2691 | Ga0587079_017890 | |||
| 2692 | Ga0587079_075628 | |||
| 2693 | Ga0587071_024732 | |||
| 2694 | Ga0466962_0163198 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 3jte-assembly1.cif.gz_A | crystal structure of response regulator receiver domain protein from clostridium thermocellum | 0.8838 | 10 | 119 |
| 2qxy-assembly1.cif.gz_A | crystal structure of a response regulator from thermotoga maritima | 0.8809 | 10 | 122 |
| 7od9-assembly1.cif.gz_B | crystal structure of activated chey fused to the c-terminal domain of chef | 0.88 | 10 | 122 |
| 4qpj-assembly2.cif.gz_C | 2.7 angstrom structure of a phosphotransferase in complex with a receiver domain | 0.8693 | 10 | 123 |
| 7m0s-assembly1.cif.gz_B | n-terminal domain of pmra from acinetobacter baumannii | 0.8667 | 10 | 123 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3cloA02 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.9096 | 155 | 203 | 1.10.10.10 |
| 3jteA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8838 | 10 | 119 | 3.40.50.2300 |
| af_P14375_1_129_3.40.50.2300 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8837 | 11 | 122 | 3.40.50.2300 |
| af_P77171_5_91_1.10.10.10 | Mainly Alpha;Orthogonal Bundle;Arc Repressor Mutant, subunit A;Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain | 0.8814 | 155 | 199 | 1.10.10.10 |
| 4d6yA00 | Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;Response regulator | 0.8712 | 13 | 123 | 3.40.50.2300 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A2V9PM93-F1-model_v4 | Response regulatory domain-containing protein | 0.9468 | 1 | 116 |
GO:0000160
|
| AF-A0A2V9PM93-F1-model_v4 | Response regulatory domain-containing protein | 0.939 | 1 | 116 |
GO:0000160
|
| AF-A0A1Q7KQU5-F1-model_v4 | Response regulatory domain-containing protein | 0.8689 | 1 | 157 |
GO:0000160
|
| AF-A0A3M1HPD4-F1-model_v4 | DNA-binding response regulator | 0.8443 | 9 | 143 |
GO:0000160
GO:0003677 |
| AF-C9ZAU5-F1-model_v4 | Sensory transduction protein RegX3 | 0.842 | 10 | 123 |
GO:0000156
GO:0000976 GO:0005829 GO:0006355 GO:0032993 |