F493144

General Info

Members Datasets Scaffolds Average Seq Length
1339 382 2678 132

Family's Representative Sequence

Representative Sequence 3300014497|Ga0182008_10130751|Ga0182008_101307512
Length 146
Sequence MADRQDKRRLPDKEMSTVTDPIADLLARVRNGAQAQKPELFVPYSKVKAEIARILKEEGYITDYELDRTAAHPRIKITNKLVNRSCAITGLKRVSRPGLRRYVGADEIPRVLGGMGIAILSTSRGVLSGREAKKQNVGGELLAYVW

Samples

Sample ID Description Type Environment
1 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
2 2162886007 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 Metagenome Rhizosphere
3 2209111006 Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 Metagenome Rhizosphere
4 3300001438 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
5 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
6 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
7 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
8 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
9 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
10 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
11 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
12 3300005288 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) Metagenome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
39 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
40 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
41 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
42 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
43 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
44 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
45 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
46 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
47 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
48 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
49 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
50 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
51 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
52 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
53 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
54 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
55 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
56 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
57 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
58 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
59 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
60 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
61 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
62 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
63 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
64 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
65 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
66 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
67 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
68 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
69 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
70 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
71 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
72 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
73 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
74 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
84 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
85 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
86 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
87 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
88 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
91 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
92 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
93 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
94 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
95 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
96 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
97 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
98 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
102 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
103 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
104 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
105 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
106 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
107 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
108 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
109 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
110 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
111 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
112 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
113 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
114 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
115 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
116 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
117 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
118 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
119 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
120 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
121 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
122 3300012503 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R Metagenome Rhizosphere
123 3300012508 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 Metagenome Rhizosphere
124 3300012512 Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 Metagenome Rhizosphere
125 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
126 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
127 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
128 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
129 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
130 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
131 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
132 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
133 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
134 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
135 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
136 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
137 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
140 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
141 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
142 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
194 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300027360 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) Metagenome Rhizosphere
206 3300027364 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) Metagenome Rhizosphere
207 3300027378 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) Metagenome Rhizosphere
208 3300027424 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027543 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027552 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027614 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) Metagenome Rhizosphere
212 3300027665 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) Metagenome Rhizosphere
213 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300027682 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) Metagenome Rhizosphere
215 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
220 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
222 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
223 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
224 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
225 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
226 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
227 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
228 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
229 3300035091 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 Metagenome Rhizosphere
230 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
231 3300035112 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 Metagenome Rhizosphere
232 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
233 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
234 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
235 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
236 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
237 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
238 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
239 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
240 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
241 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
242 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
243 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
244 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
245 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
246 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
247 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
248 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
249 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
250 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
251 3300037312 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 Metagenome Rhizosphere
252 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
253 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
254 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
255 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
256 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
257 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
258 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
259 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
260 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
261 3300041456 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG Metagenome Rhizoplane
262 3300041458 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG Metagenome Rhizoplane
263 3300041459 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG Metagenome Rhizoplane
264 3300041460 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG Metagenome Rhizoplane
265 3300041486 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG Metagenome Rhizoplane
266 3300041494 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG Metagenome Unclassified
267 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
268 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
269 3300041512 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG Metagenome Unclassified
270 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
271 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
272 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
273 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
274 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
275 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
276 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
277 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
278 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
279 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
280 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
281 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
282 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
283 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
284 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
285 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
286 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
287 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
288 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
289 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
290 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
291 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
292 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
293 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
294 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
295 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
296 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
297 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
298 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
299 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
300 3300046528 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere Metagenome Rhizosphere
301 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
302 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
303 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
304 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
305 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
306 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
307 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
308 3300046542 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere Metagenome Rhizosphere
309 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
310 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
311 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
312 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
313 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
314 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
315 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
316 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
317 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
318 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
319 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
320 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
321 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
322 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
323 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
324 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
325 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
326 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
327 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
328 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
329 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
330 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
331 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
332 3300047446 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere Metagenome Rhizosphere
333 3300047470 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere Metagenome Rhizosphere
334 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
335 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
336 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
337 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
338 3300048091 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
351 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
352 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
353 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
354 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
355 3300049539 Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
356 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
358 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
359 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
360 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
366 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
367 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
368 3300049766 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought Metagenome Rhizosphere
369 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
370 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
371 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
372 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
373 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
374 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
375 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
376 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
377 3300053087 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere Metagenome Endosphere
378 3300053103 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere Metagenome Endosphere
379 3300053139 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere Metagenome Endosphere
380 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.93
Metatranscriptomes 0.07
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.37
Nodule 0
Rhizoplane 8.07
Rhizosphere 90.52
Stem 0
Stem Tuber 0
Unclassified 19.04

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0182008_10130751 3300014497 Unclassified 1251
2 SwRhRL2b_contig_3185009 2162886007 Unclassified 1058
3 2214871332 2209111006 Unclassified 589
4 JGI24035J14997_100183 3300001438 Unclassified 591
5 JGI24746J21847_1007470 3300001977 Bacteria 1672
6 JGI24737J22298_10073669 3300001990 Bacteria 1018
7 JGI24748J21848_1058165 3300002074 Unclassified 513
8 JGI24744J21845_10009043 3300002077 Bacteria 2047
9 JGI24035J26624_1000379 3300002126 Bacteria 4177
10 JGI24035J26624_1001833 3300002126 Bacteria 1984
11 JGI24035J26624_1006039 3300002126 Bacteria 1164
12 JGI24035J26624_1008033 3300002126 Unclassified 1030
13 JGI25406J46586_10000007 3300003203 Bacteria 112227
14 JGI25405J52794_10003510 3300003911 Bacteria 2754
15 JGI25405J52794_10007684 3300003911 Bacteria 1994
16 Ga0065714_10099910 3300005288 Bacteria 1663
17 Ga0065704_10002652 3300005289 Bacteria 8381
18 Ga0065704_10154003 3300005289 Bacteria 1405
19 Ga0065704_10172946 3300005289 Bacteria 1281
20 Ga0065704_10659453 3300005289 Bacteria 579
21 Ga0065712_10006848 3300005290 Unclassified 2525
22 Ga0065712_10040837 3300005290 Unclassified 1298
23 Ga0065712_10070849 3300005290 Bacteria 5654
24 Ga0065712_10084132 3300005290 Bacteria 2788
25 Ga0065712_10088457 3300005290 Bacteria 2519
26 Ga0065712_10099828 3300005290 Bacteria 2080
27 Ga0065712_10108970 3300005290 Bacteria 1863
28 Ga0065712_10130323 3300005290 Bacteria 1557
29 Ga0065712_10325714 3300005290 Unclassified 821
30 Ga0065712_10462430 3300005290 Bacteria 677
31 Ga0065715_10005423 3300005293 Bacteria 7616
32 Ga0065715_10090524 3300005293 Bacteria 6854
33 Ga0065715_10114446 3300005293 Bacteria 2451
34 Ga0065715_10136006 3300005293 Unclassified 1929
35 Ga0065715_10159921 3300005293 Bacteria 1638
36 Ga0065715_10181691 3300005293 Bacteria 1472
37 Ga0065715_10222055 3300005293 Bacteria 1268
38 Ga0065715_10225288 3300005293 Bacteria 1245
39 Ga0065715_10242281 3300005293 Unclassified 1195
40 Ga0065715_10254589 3300005293 Bacteria 1148
41 Ga0065715_10334136 3300005293 Unclassified 973
42 Ga0065715_10350677 3300005293 Bacteria 945
43 Ga0065715_10427404 3300005293 Bacteria 851
44 Ga0065707_10009888 3300005295 Bacteria 2894
45 Ga0065707_10233776 3300005295 Bacteria 1179
46 Ga0065707_10608558 3300005295 Unclassified 686
47 Ga0070658_10080732 3300005327 Bacteria 2671
48 Ga0070658_10410039 3300005327 Bacteria 1164
49 Ga0070658_11783697 3300005327 Unclassified 532
50 Ga0070676_10023857 3300005328 Bacteria 3441
51 Ga0070676_10032758 3300005328 Bacteria 2979
52 Ga0070676_10069962 3300005328 Bacteria 2104
53 Ga0070676_10108518 3300005328 Bacteria 1725
54 Ga0070676_10202196 3300005328 Bacteria 1303
55 Ga0070676_11182432 3300005328 Bacteria 581
56 Ga0070683_100026491 3300005329 Bacteria 5221
57 Ga0070683_100054847 3300005329 Bacteria 3696
58 Ga0070683_100055457 3300005329 Bacteria 3678
59 Ga0070683_100495741 3300005329 Bacteria 1167
60 Ga0070683_100832067 3300005329 Bacteria 885
61 Ga0070683_100899954 3300005329 Unclassified 849
62 Ga0070690_100052450 3300005330 Bacteria 2607
63 Ga0070690_100056424 3300005330 Bacteria 2518
64 Ga0070690_100167796 3300005330 Unclassified 1509
65 Ga0070690_100399974 3300005330 Unclassified 1008
66 Ga0070670_100000833 3300005331 Bacteria 24086
67 Ga0070670_100003742 3300005331 Bacteria 12666
68 Ga0070670_100136296 3300005331 Bacteria 2121
69 Ga0070670_100620275 3300005331 Unclassified 969
70 Ga0070670_100869512 3300005331 Unclassified 816
71 Ga0070677_10137184 3300005333 Bacteria 1124
72 Ga0070677_10383944 3300005333 Unclassified 736
73 Ga0068869_100113989 3300005334 Bacteria 2060
74 Ga0068869_100720816 3300005334 Bacteria 852
75 Ga0068869_100930508 3300005334 Unclassified 754
76 Ga0070666_10001876 3300005335 Bacteria 12791
77 Ga0070666_10002056 3300005335 Bacteria 12212
78 Ga0070666_10097738 3300005335 Bacteria 2021
79 Ga0070666_10121884 3300005335 Bacteria 1808
80 Ga0070666_10760310 3300005335 Unclassified 712
81 Ga0070680_100100517 3300005336 Bacteria 2400
82 Ga0070680_100348965 3300005336 Bacteria 1258
83 Ga0070680_100488806 3300005336 Bacteria 1052
84 Ga0070682_100426049 3300005337 Bacteria 1010
85 Ga0068868_100031366 3300005338 Bacteria 4081
86 Ga0068868_100096533 3300005338 Bacteria 2388
87 Ga0068868_100199105 3300005338 Bacteria 1669
88 Ga0068868_100697156 3300005338 Unclassified 908
89 Ga0068868_102359363 3300005338 Unclassified 508
90 Ga0070660_100023190 3300005339 Bacteria 4596
91 Ga0070660_100378975 3300005339 Bacteria 1168
92 Ga0070660_100647314 3300005339 Unclassified 885
93 Ga0070689_100021098 3300005340 Unclassified 4844
94 Ga0070689_100064515 3300005340 Bacteria 2851
95 Ga0070689_100100534 3300005340 Bacteria 2288
96 Ga0070689_100145272 3300005340 Bacteria 1910
97 Ga0070689_100273588 3300005340 Bacteria 1399
98 Ga0070689_100842260 3300005340 Unclassified 809
99 Ga0070687_100000382 3300005343 Bacteria 15047
100 Ga0070687_100114661 3300005343 Bacteria 1531
101 Ga0070661_100062340 3300005344 Bacteria 2737
102 Ga0070661_100292077 3300005344 Unclassified 1267
103 Ga0070661_100393326 3300005344 Bacteria 1095
104 Ga0070661_100838629 3300005344 Bacteria 756
105 Ga0070692_10001104 3300005345 Bacteria 9415
106 Ga0070692_10107559 3300005345 Bacteria 1538
107 Ga0070668_100000403 3300005347 Bacteria 28684
108 Ga0070668_100050196 3300005347 Bacteria 3211
109 Ga0070668_100050229 3300005347 Bacteria 3210
110 Ga0070668_100056885 3300005347 Bacteria 3021
111 Ga0070668_100056962 3300005347 Bacteria 3019
112 Ga0070668_100069825 3300005347 Bacteria 2734
113 Ga0070668_100135575 3300005347 Bacteria 1980
114 Ga0070668_100258296 3300005347 Bacteria 1448
115 Ga0070669_100002011 3300005353 Bacteria 14710
116 Ga0070669_100006097 3300005353 Bacteria 8698
117 Ga0070669_100125169 3300005353 Bacteria 1966
118 Ga0070669_100300055 3300005353 Bacteria 1292
119 Ga0070669_100483782 3300005353 Bacteria 1025
120 Ga0070669_100852327 3300005353 Unclassified 776
121 Ga0070675_100004678 3300005354 Bacteria 10447
122 Ga0070675_100048534 3300005354 Bacteria 3482
123 Ga0070675_100083047 3300005354 Bacteria 2673
124 Ga0070675_100129528 3300005354 Unclassified 2149
125 Ga0070675_100135890 3300005354 Bacteria 2098
126 Ga0070675_100158863 3300005354 Bacteria 1943
127 Ga0070675_100200776 3300005354 Bacteria 1731
128 Ga0070675_100295769 3300005354 Bacteria 1425
129 Ga0070675_100429872 3300005354 Bacteria 1182
130 Ga0070675_100755041 3300005354 Bacteria 888
131 Ga0070671_100000283 3300005355 Bacteria 34469
132 Ga0070671_100011134 3300005355 Bacteria 7224
133 Ga0070671_100042031 3300005355 Bacteria 3799
134 Ga0070671_100047998 3300005355 Unclassified 3550
135 Ga0070671_100054306 3300005355 Bacteria 3331
136 Ga0070671_100187898 3300005355 Bacteria 1751
137 Ga0070671_100286550 3300005355 Bacteria 1401
138 Ga0070671_100333656 3300005355 Bacteria 1293
139 Ga0070671_100614611 3300005355 Bacteria 940
140 Ga0070671_100623853 3300005355 Bacteria 932
141 Ga0070671_100853150 3300005355 Unclassified 794
142 Ga0070674_100007500 3300005356 Bacteria 6436
143 Ga0070674_100064027 3300005356 Bacteria 2575
144 Ga0070674_100222619 3300005356 Bacteria 1468
145 Ga0070674_100376888 3300005356 Bacteria 1153
146 Ga0070673_100008141 3300005364 Bacteria 6955
147 Ga0070673_100014325 3300005364 Bacteria 5516
148 Ga0070673_100075213 3300005364 Bacteria 2724
149 Ga0070673_100163504 3300005364 Bacteria 1895
150 Ga0070673_100283494 3300005364 Bacteria 1454
151 Ga0070673_100476403 3300005364 Bacteria 1126
152 Ga0070688_100000733 3300005365 Bacteria 16191
153 Ga0070688_100001414 3300005365 Bacteria 11953
154 Ga0070688_100016452 3300005365 Bacteria 4229
155 Ga0070688_100054122 3300005365 Bacteria 2512
156 Ga0070688_100102629 3300005365 Bacteria 1888
157 Ga0070659_100001154 3300005366 Bacteria 19280
158 Ga0070659_100002483 3300005366 Bacteria 13098
159 Ga0070659_100117793 3300005366 Bacteria 2148
160 Ga0070659_100340292 3300005366 Bacteria 1257
161 Ga0070659_100981448 3300005366 Unclassified 741
162 Ga0070659_101608257 3300005366 Unclassified 580
163 Ga0070667_100004665 3300005367 Bacteria 11504
164 Ga0070667_100010004 3300005367 Bacteria 7858
165 Ga0070667_100320999 3300005367 Unclassified 1397
166 Ga0070667_100509990 3300005367 Bacteria 1103
167 Ga0070667_100821221 3300005367 Bacteria 863
168 Ga0070667_101061349 3300005367 Bacteria 757
169 Ga0070667_101517174 3300005367 Unclassified 629
170 Ga0070709_10176197 3300005434 Bacteria 1498
171 Ga0070709_10246697 3300005434 Bacteria 1285
172 Ga0070709_11624732 3300005434 Bacteria 527
173 Ga0070714_100207992 3300005435 Bacteria 1792
174 Ga0070714_100286340 3300005435 Bacteria 1532
175 Ga0070714_101115819 3300005435 Bacteria 769
176 Ga0070714_102135992 3300005435 Bacteria 545
177 Ga0070714_102328832 3300005435 Unclassified 521
178 Ga0070713_100019600 3300005436 Bacteria 5170
179 Ga0070713_100040250 3300005436 Bacteria 3798
180 Ga0070713_100048466 3300005436 Bacteria 3498
181 Ga0070713_100182167 3300005436 Bacteria 1888
182 Ga0070713_100214091 3300005436 Bacteria 1746
183 Ga0070713_101066359 3300005436 Unclassified 780
184 Ga0070713_102475417 3300005436 Unclassified 502
185 Ga0070710_10048829 3300005437 Bacteria 2365
186 Ga0070710_10132576 3300005437 Bacteria 1520
187 Ga0070710_10214317 3300005437 Bacteria 1222
188 Ga0070710_10419844 3300005437 Bacteria 900
189 Ga0070710_11209518 3300005437 Unclassified 559
190 Ga0070701_10317022 3300005438 Unclassified 964
191 Ga0070711_100006116 3300005439 Bacteria 7237
192 Ga0070711_100078511 3300005439 Bacteria 2345
193 Ga0070711_100112752 3300005439 Bacteria 1998
194 Ga0070711_100448438 3300005439 Bacteria 1056
195 Ga0070711_100619508 3300005439 Bacteria 904
196 Ga0070711_101027982 3300005439 Unclassified 708
197 Ga0070705_100075673 3300005440 Bacteria 2050
198 Ga0070705_100204996 3300005440 Bacteria 1355
199 Ga0070705_100232819 3300005440 Unclassified 1283
200 Ga0070705_101023435 3300005440 Unclassified 672
201 Ga0070705_101065448 3300005440 Unclassified 659
202 Ga0070700_100003660 3300005441 Bacteria 7944
203 Ga0070700_101249815 3300005441 Unclassified 622
204 Ga0070694_100004904 3300005444 Bacteria 8062
205 Ga0070694_100087162 3300005444 Bacteria 2183
206 Ga0070694_100746208 3300005444 Bacteria 799
207 Ga0070694_100750996 3300005444 Bacteria 797
208 Ga0070708_100003581 3300005445 Bacteria 12183
209 Ga0070708_100036156 3300005445 Bacteria 4307
210 Ga0070708_100050882 3300005445 Bacteria 3669
211 Ga0070708_100053105 3300005445 Bacteria 3595
212 Ga0070708_100054749 3300005445 Bacteria 3545
213 Ga0070708_100057410 3300005445 Bacteria 3465
214 Ga0070708_100136047 3300005445 Bacteria 2276
215 Ga0070708_100141727 3300005445 Bacteria 2229
216 Ga0070708_100156410 3300005445 Bacteria 2122
217 Ga0070708_100261350 3300005445 Bacteria 1627
218 Ga0070708_100442592 3300005445 Bacteria 1226
219 Ga0070708_100566950 3300005445 Bacteria 1071
220 Ga0070708_101041682 3300005445 Unclassified 767
221 Ga0070708_101158650 3300005445 Bacteria 723
222 Ga0070708_102076977 3300005445 Bacteria 526
223 Ga0070663_100100368 3300005455 Bacteria 2159
224 Ga0070663_100656577 3300005455 Bacteria 887
225 Ga0070678_100001511 3300005456 Bacteria 12415
226 Ga0070678_100094691 3300005456 Bacteria 2299
227 Ga0070678_100236091 3300005456 Bacteria 1526
228 Ga0070678_100506587 3300005456 Unclassified 1066
229 Ga0070678_100806887 3300005456 Unclassified 852
230 Ga0070678_101910917 3300005456 Bacteria 561
231 Ga0070662_100004281 3300005457 Bacteria 9009
232 Ga0070662_100016152 3300005457 Bacteria 5009
233 Ga0070662_100091226 3300005457 Bacteria 2288
234 Ga0070662_100133833 3300005457 Bacteria 1915
235 Ga0070662_101404111 3300005457 Unclassified 602
236 Ga0070681_10052300 3300005458 Bacteria 4073
237 Ga0068867_100044767 3300005459 Bacteria 3243
238 Ga0068867_100386194 3300005459 Unclassified 1177
239 Ga0070685_10106425 3300005466 Bacteria 1721
240 Ga0070685_10140714 3300005466 Bacteria 1519
241 Ga0070685_10208732 3300005466 Bacteria 1274
242 Ga0070685_10358273 3300005466 Bacteria 999
243 Ga0070685_10367787 3300005466 Bacteria 987
244 Ga0070685_10838743 3300005466 Unclassified 680
245 Ga0070706_100006577 3300005467 Bacteria 10965
246 Ga0070706_100020444 3300005467 Bacteria 6102
247 Ga0070706_100020521 3300005467 Bacteria 6089
248 Ga0070706_100025982 3300005467 Bacteria 5388
249 Ga0070706_100137442 3300005467 Bacteria 2280
250 Ga0070706_100145108 3300005467 Bacteria 2216
251 Ga0070706_100302668 3300005467 Bacteria 1492
252 Ga0070706_100519386 3300005467 Bacteria 1108
253 Ga0070706_100676488 3300005467 Unclassified 958
254 Ga0070706_102009540 3300005467 Bacteria 523
255 Ga0070707_100000292 3300005468 Bacteria 49172
256 Ga0070707_100003721 3300005468 Bacteria 14386
257 Ga0070707_100016188 3300005468 Bacteria 6997
258 Ga0070707_100030502 3300005468 Bacteria 5134
259 Ga0070707_100032046 3300005468 Bacteria 5006
260 Ga0070707_100039193 3300005468 Bacteria 4529
261 Ga0070707_100063474 3300005468 Bacteria 3545
262 Ga0070707_100072311 3300005468 Bacteria 3323
263 Ga0070707_100081504 3300005468 Bacteria 3124
264 Ga0070707_100193267 3300005468 Bacteria 1984
265 Ga0070707_100320831 3300005468 Unclassified 1505
266 Ga0070707_100338980 3300005468 Unclassified 1461
267 Ga0070707_100342021 3300005468 Bacteria 1453
268 Ga0070707_100362651 3300005468 Bacteria 1408
269 Ga0070707_100453112 3300005468 Bacteria 1244
270 Ga0070707_100832304 3300005468 Bacteria 887
271 Ga0070707_100956168 3300005468 Bacteria 822
272 Ga0070707_101713715 3300005468 Unclassified 596
273 Ga0070698_100001836 3300005471 Bacteria 23657
274 Ga0070698_100007384 3300005471 Bacteria 11891
275 Ga0070698_100022395 3300005471 Bacteria 6610
276 Ga0070698_100032196 3300005471 Bacteria 5431
277 Ga0070698_100329532 3300005471 Bacteria 1458
278 Ga0070698_100354407 3300005471 Unclassified 1399
279 Ga0070698_100661926 3300005471 Bacteria 985
280 Ga0070698_100786651 3300005471 Bacteria 895
281 Ga0070698_101504696 3300005471 Unclassified 624
282 Ga0070699_100027581 3300005518 Bacteria 4897
283 Ga0070699_100036501 3300005518 Bacteria 4251
284 Ga0070699_100058834 3300005518 Bacteria 3329
285 Ga0070699_100176052 3300005518 Bacteria 1897
286 Ga0070699_100222626 3300005518 Bacteria 1682
287 Ga0070699_100509403 3300005518 Unclassified 1094
288 Ga0070699_100732863 3300005518 Bacteria 904
289 Ga0070699_100739219 3300005518 Bacteria 900
290 Ga0070699_100773376 3300005518 Unclassified 878
291 Ga0070699_100870976 3300005518 Bacteria 825
292 Ga0070679_100054949 3300005530 Bacteria 3965
293 Ga0070679_100649064 3300005530 Bacteria 998
294 Ga0070684_100001312 3300005535 Bacteria 17819
295 Ga0070684_100029216 3300005535 Bacteria 4670
296 Ga0070684_100302970 3300005535 Bacteria 1467
297 Ga0070697_100000826 3300005536 Bacteria 23247
298 Ga0070697_100002201 3300005536 Bacteria 14963
299 Ga0070697_100002768 3300005536 Bacteria 13496
300 Ga0070697_100003773 3300005536 Bacteria 11628
301 Ga0070697_100005694 3300005536 Bacteria 9598
302 Ga0070697_100045125 3300005536 Bacteria 3571
303 Ga0070697_100057785 3300005536 Bacteria 3156
304 Ga0070697_100121642 3300005536 Bacteria 2184
305 Ga0070697_100124376 3300005536 Bacteria 2160
306 Ga0070697_100141887 3300005536 Bacteria 2021
307 Ga0070697_100214500 3300005536 Bacteria 1639
308 Ga0070697_100449182 3300005536 Bacteria 1123
309 Ga0070697_100500503 3300005536 Bacteria 1062
310 Ga0070697_100558094 3300005536 Bacteria 1004
311 Ga0070697_100596480 3300005536 Unclassified 971
312 Ga0070697_100776024 3300005536 Unclassified 847
313 Ga0068853_100107206 3300005539 Bacteria 2477
314 Ga0070672_100000353 3300005543 Bacteria 26400
315 Ga0070672_100004247 3300005543 Bacteria 9368
316 Ga0070672_100041736 3300005543 Bacteria 3529
317 Ga0070672_100136749 3300005543 Bacteria 2018
318 Ga0070672_100209084 3300005543 Bacteria 1634
319 Ga0070672_100958515 3300005543 Bacteria 757
320 Ga0070672_101246723 3300005543 Bacteria 663
321 Ga0070672_101436047 3300005543 Unclassified 617
322 Ga0070686_100054207 3300005544 Bacteria 2564
323 Ga0070686_100126507 3300005544 Bacteria 1761
324 Ga0070695_100017240 3300005545 Bacteria 4379
325 Ga0070695_100073003 3300005545 Bacteria 2251
326 Ga0070695_100271901 3300005545 Unclassified 1241
327 Ga0070696_100012751 3300005546 Bacteria 5644
328 Ga0070696_100494645 3300005546 Bacteria 972
329 Ga0070696_101568040 3300005546 Bacteria 565
330 Ga0070693_100229378 3300005547 Bacteria 1221
331 Ga0070693_100415757 3300005547 Bacteria 936
332 Ga0070693_100709430 3300005547 Bacteria 737
333 Ga0070665_100008787 3300005548 Bacteria 10223
334 Ga0070665_100070912 3300005548 Bacteria 3491
335 Ga0070665_100114878 3300005548 Bacteria 2694
336 Ga0070665_100200931 3300005548 Bacteria 1994
337 Ga0070665_100234438 3300005548 Bacteria 1836
338 Ga0070665_100496622 3300005548 Bacteria 1231
339 Ga0070665_100965700 3300005548 Unclassified 864
340 Ga0070665_101232371 3300005548 Unclassified 759
341 Ga0070704_100029184 3300005549 Bacteria 3680
342 Ga0070704_100082187 3300005549 Bacteria 2375
343 Ga0070704_100273457 3300005549 Bacteria 1397
344 Ga0070704_100919742 3300005549 Unclassified 788
345 Ga0068855_100308936 3300005563 Bacteria 1750
346 Ga0070664_100125926 3300005564 Bacteria 2247
347 Ga0070664_100182011 3300005564 Bacteria 1868
348 Ga0070664_100248105 3300005564 Bacteria 1600
349 Ga0070664_100301215 3300005564 Bacteria 1449
350 Ga0070664_100454291 3300005564 Bacteria 1176
351 Ga0068854_100608047 3300005578 Bacteria 934
352 Ga0068856_100017528 3300005614 Bacteria 6939
353 Ga0068856_100456081 3300005614 Bacteria 1299
354 Ga0068856_100982990 3300005614 Bacteria 862
355 Ga0070702_100018870 3300005615 Bacteria 3585
356 Ga0070702_100196422 3300005615 Bacteria 1332
357 Ga0070702_100671110 3300005615 Bacteria 786
358 Ga0068852_100345260 3300005616 Bacteria 1452
359 Ga0068859_100077354 3300005617 Bacteria 3368
360 Ga0068859_100117580 3300005617 Bacteria 2724
361 Ga0068859_100586714 3300005617 Bacteria 1208
362 Ga0068859_100756896 3300005617 Bacteria 1060
363 Ga0068864_100285604 3300005618 Bacteria 1541
364 Ga0068864_100287593 3300005618 Bacteria 1536
365 Ga0068864_100347280 3300005618 Bacteria 1399
366 Ga0068864_100388810 3300005618 Bacteria 1324
367 Ga0068864_100919300 3300005618 Bacteria 865
368 Ga0068864_102000274 3300005618 Unclassified 586
369 Ga0068866_10177069 3300005718 Bacteria 1257
370 Ga0068866_10892409 3300005718 Bacteria 625
371 Ga0068866_10906136 3300005718 Bacteria 620
372 Ga0068861_100107874 3300005719 Bacteria 2227
373 Ga0068861_100158124 3300005719 Bacteria 1866
374 Ga0068861_100177914 3300005719 Bacteria 1768
375 Ga0068863_100007967 3300005841 Bacteria 10355
376 Ga0068863_100383370 3300005841 Bacteria 1373
377 Ga0068863_100590505 3300005841 Unclassified 1099
378 Ga0068863_100940299 3300005841 Unclassified 866
379 Ga0068858_100052055 3300005842 Bacteria 3788
380 Ga0068858_100142777 3300005842 Bacteria 2248
381 Ga0068858_100224419 3300005842 Unclassified 1780
382 Ga0068858_100401480 3300005842 Bacteria 1317
383 Ga0068858_102243340 3300005842 Unclassified 540
384 Ga0068858_102281690 3300005842 Unclassified 535
385 Ga0068860_100010603 3300005843 Bacteria 9101
386 Ga0068860_100066467 3300005843 Bacteria 3425
387 Ga0068860_100108998 3300005843 Bacteria 2646
388 Ga0068860_100762370 3300005843 Bacteria 980
389 Ga0068862_100003143 3300005844 Bacteria 14358
390 Ga0068862_100041432 3300005844 Bacteria 3918
391 Ga0068862_101002808 3300005844 Bacteria 826
392 Ga0081455_10001399 3300005937 Bacteria 29813
393 Ga0081455_10021886 3300005937 Bacteria 5988
394 Ga0081455_10031292 3300005937 Bacteria 4817
395 Ga0081455_10031464 3300005937 Bacteria 4801
396 Ga0081455_10284179 3300005937 Bacteria 1194
397 Ga0081455_10288089 3300005937 Bacteria 1183
398 Ga0081455_10344702 3300005937 Bacteria 1053
399 Ga0081455_10648182 3300005937 Unclassified 680
400 Ga0081538_10100476 3300005981 Bacteria 1458
401 Ga0081540_1000036 3300005983 Bacteria 140805
402 Ga0081540_1025675 3300005983 Bacteria 3384
403 Ga0081540_1065432 3300005983 Bacteria 1709
404 Ga0081539_10000014 3300005985 Bacteria 411270
405 Ga0081539_10001730 3300005985 Bacteria 34868
406 Ga0081539_10022038 3300005985 Bacteria 4229
407 Ga0081539_10030228 3300005985 Bacteria 3367
408 Ga0081539_10059040 3300005985 Bacteria 2114
409 Ga0081539_10113538 3300005985 Bacteria 1359
410 Ga0070717_10016944 3300006028 Bacteria 5659
411 Ga0070717_10027717 3300006028 Unclassified 4529
412 Ga0070717_10028090 3300006028 Bacteria 4500
413 Ga0070717_10037326 3300006028 Bacteria 3945
414 Ga0070717_10037361 3300006028 Bacteria 3943
415 Ga0070717_10410936 3300006028 Bacteria 1217
416 Ga0070717_10488751 3300006028 Bacteria 1112
417 Ga0070717_10992822 3300006028 Unclassified 764
418 Ga0070715_10015930 3300006163 Bacteria 2813
419 Ga0070715_10059680 3300006163 Bacteria 1670
420 Ga0070715_10399498 3300006163 Unclassified 763
421 Ga0070715_10401984 3300006163 Unclassified 761
422 Ga0070716_100011207 3300006173 Bacteria 4513
423 Ga0070716_100199559 3300006173 Bacteria 1328
424 Ga0070716_100205703 3300006173 Bacteria 1312
425 Ga0070716_100304877 3300006173 Bacteria 1109
426 Ga0070716_100369139 3300006173 Bacteria 1022
427 Ga0070716_100649827 3300006173 Unclassified 799
428 Ga0070716_100774044 3300006173 Unclassified 740
429 Ga0070712_100023808 3300006175 Bacteria 4049
430 Ga0070712_100046609 3300006175 Bacteria 2997
431 Ga0070712_100049660 3300006175 Unclassified 2914
432 Ga0070712_100052822 3300006175 Bacteria 2836
433 Ga0070712_100093977 3300006175 Bacteria 2202
434 Ga0070712_100271568 3300006175 Unclassified 1362
435 Ga0070712_100357662 3300006175 Bacteria 1196
436 Ga0070712_100388371 3300006175 Bacteria 1150
437 Ga0070712_100401676 3300006175 Bacteria 1132
438 Ga0070712_100657490 3300006175 Unclassified 891
439 Ga0070712_100932690 3300006175 Unclassified 749
440 Ga0070712_101220012 3300006175 Unclassified 654
441 Ga0070712_101321383 3300006175 Unclassified 628
442 Ga0070712_101431055 3300006175 Bacteria 603
443 Ga0097621_100014055 3300006237 Bacteria 5982
444 Ga0097621_100018403 3300006237 Bacteria 5335
445 Ga0097621_100024099 3300006237 Bacteria 4748
446 Ga0097621_100991687 3300006237 Unclassified 785
447 Ga0068871_100084135 3300006358 Bacteria 2640
448 Ga0068871_100336065 3300006358 Bacteria 1333
449 Ga0068871_100727499 3300006358 Unclassified 911
450 Ga0068871_100955037 3300006358 Unclassified 796
451 Ga0075428_100093456 3300006844 Bacteria 3279
452 Ga0075428_100095839 3300006844 Bacteria 3235
453 Ga0075428_100416748 3300006844 Bacteria 1439
454 Ga0075430_100277403 3300006846 Bacteria 1387
455 Ga0075433_10196766 3300006852 Bacteria 1793
456 Ga0075433_10674838 3300006852 Bacteria 906
457 Ga0075433_10827267 3300006852 Bacteria 809
458 Ga0075433_11004728 3300006852 Unclassified 727
459 Ga0075433_11475672 3300006852 Unclassified 588
460 Ga0075434_100014841 3300006871 Bacteria 7452
461 Ga0075434_100147155 3300006871 Bacteria 2376
462 Ga0075434_100200364 3300006871 Bacteria 2016
463 Ga0075434_100540910 3300006871 Unclassified 1185
464 Ga0075434_100657972 3300006871 Unclassified 1066
465 Ga0075434_101028397 3300006871 Bacteria 838
466 Ga0075434_101466271 3300006871 Unclassified 692
467 Ga0068865_100017414 3300006881 Bacteria 4621
468 Ga0068865_100105971 3300006881 Bacteria 2066
469 Ga0068865_100149571 3300006881 Bacteria 1770
470 Ga0068865_100214443 3300006881 Bacteria 1502
471 Ga0068865_100831403 3300006881 Bacteria 799
472 Ga0075436_100032597 3300006914 Bacteria 3592
473 Ga0075436_100370089 3300006914 Unclassified 1035
474 Ga0075436_100413342 3300006914 Unclassified 979
475 Ga0075436_100922148 3300006914 Unclassified 654
476 Ga0097620_100077352 3300006931 Bacteria 3368
477 Ga0097620_100117582 3300006931 Bacteria 2724
478 Ga0097620_100586684 3300006931 Bacteria 1208
479 Ga0097620_100756876 3300006931 Bacteria 1060
480 Ga0075435_100541635 3300007076 Bacteria 1008
481 Ga0075435_100651782 3300007076 Bacteria 914
482 Ga0075435_101100459 3300007076 Bacteria 695
483 Ga0099794_10020565 3300007265 Bacteria 2989
484 Ga0099794_10179950 3300007265 Bacteria 1079
485 Ga0099794_10470990 3300007265 Bacteria 660
486 Ga0099794_10711006 3300007265 Unclassified 535
487 Ga0099795_10341386 3300007788 Unclassified 668
488 Ga0099795_10474030 3300007788 Unclassified 580
489 Ga0105240_11673074 3300009093 Unclassified 665
490 Ga0111539_10524306 3300009094 Bacteria 1380
491 Ga0111539_11803835 3300009094 Bacteria 709
492 Ga0111539_12134840 3300009094 Bacteria 650
493 Ga0111539_12893719 3300009094 Unclassified 555
494 Ga0105245_10006614 3300009098 Bacteria 10180
495 Ga0105245_10030852 3300009098 Bacteria 4740
496 Ga0105245_10214619 3300009098 Bacteria 1854
497 Ga0105245_11624256 3300009098 Unclassified 698
498 Ga0105247_10084384 3300009101 Bacteria 2007
499 Ga0105247_10731540 3300009101 Unclassified 748
500 Ga0105247_11036774 3300009101 Unclassified 643
501 Ga0114129_10001417 3300009147 Bacteria 32326
502 Ga0114129_10003445 3300009147 Bacteria 22244
503 Ga0114129_10032401 3300009147 Bacteria 7386
504 Ga0114129_10241662 3300009147 Bacteria 2427
505 Ga0114129_12192928 3300009147 Unclassified 665
506 Ga0105243_10033332 3300009148 Bacteria 3982
507 Ga0105243_10331810 3300009148 Bacteria 1390
508 Ga0105243_10648599 3300009148 Bacteria 1023
509 Ga0105241_10713440 3300009174 Bacteria 916
510 Ga0105242_10043482 3300009176 Bacteria 3634
511 Ga0105242_10167170 3300009176 Bacteria 1930
512 Ga0105242_10276372 3300009176 Bacteria 1524
513 Ga0105242_10875677 3300009176 Bacteria 896
514 Ga0105242_10939690 3300009176 Bacteria 868
515 Ga0105248_10321465 3300009177 Bacteria 1743
516 Ga0105237_10134456 3300009545 Unclassified 2467
517 Ga0105237_10225438 3300009545 Bacteria 1875
518 Ga0105238_11121242 3300009551 Bacteria 810
519 Ga0105249_10007788 3300009553 Bacteria 9333
520 Ga0105249_10011097 3300009553 Bacteria 7914
521 Ga0105249_10431190 3300009553 Bacteria 1354
522 Ga0105249_11334773 3300009553 Bacteria 789
523 Ga0099796_10005301 3300010159 Bacteria 3206
524 Ga0099796_10011175 3300010159 Bacteria 2496
525 Ga0099796_10103366 3300010159 Bacteria 1075
526 Ga0105239_10070002 3300010375 Bacteria 3853
527 Ga0105239_10100267 3300010375 Bacteria 3203
528 Ga0105239_10139759 3300010375 Bacteria 2698
529 Ga0105239_12151893 3300010375 Bacteria 648
530 Ga0105246_10182706 3300011119 Bacteria 1616
531 Ga0105246_10383239 3300011119 Bacteria 1162
532 Ga0105246_12137735 3300011119 Unclassified 543
533 Ga0157313_1005513 3300012503 Bacteria 917
534 Ga0157315_1056796 3300012508 Unclassified 541
535 Ga0157327_1046819 3300012512 Unclassified 602
536 Ga0157373_10116401 3300013100 Bacteria 1879
537 Ga0157373_11545504 3300013100 Bacteria 507
538 Ga0157371_10058341 3300013102 Bacteria 2738
539 Ga0157371_10323452 3300013102 Bacteria 1119
540 Ga0157370_11019409 3300013104 Unclassified 749
541 Ga0157369_10182471 3300013105 Bacteria 2208
542 Ga0157374_10001473 3300013296 Bacteria 19879
543 Ga0157374_10005577 3300013296 Bacteria 10597
544 Ga0157374_10019745 3300013296 Bacteria 5970
545 Ga0157374_10033688 3300013296 Bacteria 4675
546 Ga0157374_10055882 3300013296 Bacteria 3685
547 Ga0157374_10120813 3300013296 Bacteria 2528
548 Ga0157374_10317951 3300013296 Bacteria 1542
549 Ga0157374_10431232 3300013296 Bacteria 1318
550 Ga0157374_10574067 3300013296 Bacteria 1137
551 Ga0157374_10996360 3300013296 Bacteria 857
552 Ga0157374_11038725 3300013296 Unclassified 839
553 Ga0157374_11350962 3300013296 Bacteria 735
554 Ga0157374_12134377 3300013296 Unclassified 587
555 Ga0157378_10005509 3300013297 Bacteria 11097
556 Ga0157378_10026553 3300013297 Bacteria 5104
557 Ga0157378_10043528 3300013297 Bacteria 3987
558 Ga0157378_10048884 3300013297 Bacteria 3762
559 Ga0157378_10058061 3300013297 Bacteria 3451
560 Ga0157378_10174062 3300013297 Unclassified 2021
561 Ga0157378_10191930 3300013297 Bacteria 1927
562 Ga0157378_10246614 3300013297 Bacteria 1708
563 Ga0157378_10326750 3300013297 Bacteria 1491
564 Ga0157378_10384057 3300013297 Bacteria 1380
565 Ga0157378_10409772 3300013297 Bacteria 1337
566 Ga0157378_10451731 3300013297 Bacteria 1276
567 Ga0157378_10529437 3300013297 Bacteria 1181
568 Ga0157378_10705913 3300013297 Bacteria 1028
569 Ga0157378_10799313 3300013297 Bacteria 969
570 Ga0157378_11522416 3300013297 Bacteria 714
571 Ga0157378_11702122 3300013297 Bacteria 678
572 Ga0157378_12767619 3300013297 Unclassified 543
573 Ga0163162_10003249 3300013306 Bacteria 15541
574 Ga0163162_10014121 3300013306 Bacteria 7805
575 Ga0163162_10017445 3300013306 Bacteria 7024
576 Ga0163162_10023520 3300013306 Bacteria 6081
577 Ga0163162_10034354 3300013306 Bacteria 5046
578 Ga0163162_10042501 3300013306 Bacteria 4549
579 Ga0163162_10086566 3300013306 Bacteria 3211
580 Ga0163162_10203836 3300013306 Bacteria 2107
581 Ga0163162_10224090 3300013306 Bacteria 2010
582 Ga0163162_10782207 3300013306 Bacteria 1072
583 Ga0157372_10037163 3300013307 Bacteria 5368
584 Ga0157372_10040369 3300013307 Bacteria 5155
585 Ga0157372_10167743 3300013307 Bacteria 2539
586 Ga0157372_10260634 3300013307 Bacteria 2013
587 Ga0157372_10837918 3300013307 Bacteria 1068
588 Ga0157372_11596687 3300013307 Bacteria 751
589 Ga0157375_10000287 3300013308 Bacteria 45998
590 Ga0157375_10001868 3300013308 Bacteria 18135
591 Ga0157375_10007782 3300013308 Bacteria 9374
592 Ga0157375_10044228 3300013308 Bacteria 4324
593 Ga0157375_10082239 3300013308 Bacteria 3261
594 Ga0157375_10159468 3300013308 Bacteria 2397
595 Ga0157375_10368137 3300013308 Bacteria 1603
596 Ga0157375_10511654 3300013308 Bacteria 1364
597 Ga0157375_12062506 3300013308 Bacteria 678
598 Ga0163163_10294276 3300014325 Bacteria 1676
599 Ga0163163_10297508 3300014325 Bacteria 1666
600 Ga0163163_10307094 3300014325 Bacteria 1639
601 Ga0163163_11108141 3300014325 Bacteria 855
602 Ga0163163_11115034 3300014325 Bacteria 852
603 Ga0182008_10063220 3300014497 Bacteria 1823
604 Ga0182008_10421309 3300014497 Unclassified 721
605 Ga0157377_10013826 3300014745 Bacteria 4092
606 Ga0157377_10110643 3300014745 Bacteria 1650
607 Ga0157377_10369438 3300014745 Bacteria 968
608 Ga0157377_10400617 3300014745 Bacteria 934
609 Ga0157379_10005647 3300014968 Bacteria 10748
610 Ga0157379_10083913 3300014968 Bacteria 2856
611 Ga0157379_10421858 3300014968 Bacteria 1229
612 Ga0157379_10432610 3300014968 Bacteria 1213
613 Ga0157379_11264189 3300014968 Bacteria 712
614 Ga0157376_10009509 3300014969 Bacteria 7064
615 Ga0157376_10149842 3300014969 Bacteria 2102
616 Ga0157376_10154833 3300014969 Bacteria 2071
617 Ga0157376_10164048 3300014969 Bacteria 2017
618 Ga0157376_10180657 3300014969 Bacteria 1928
619 Ga0157376_10349606 3300014969 Bacteria 1414
620 Ga0157376_10404419 3300014969 Bacteria 1321
621 Ga0157376_11853928 3300014969 Bacteria 640
622 Ga0157376_12268419 3300014969 Unclassified 582
623 Ga0163161_10046543 3300017792 Bacteria 3130
624 Ga0163161_10177049 3300017792 Bacteria 1633
625 Ga0163161_10302024 3300017792 Bacteria 1261
626 Ga0163161_10457796 3300017792 Bacteria 1032
627 Ga0163161_11290942 3300017792 Bacteria 634
628 Ga0213874_10318189 3300021377 Bacteria 589
629 Ga0213876_10006558 3300021384 Bacteria 6346
630 Ga0207666_1000898 3300025271 Bacteria 3558
631 Ga0207666_1002318 3300025271 Bacteria 2288
632 Ga0207666_1019393 3300025271 Unclassified 992
633 Ga0207673_1000900 3300025290 Unclassified 3196
634 Ga0207673_1002318 3300025290 Bacteria 2161
635 Ga0207673_1008168 3300025290 Bacteria 1322
636 Ga0207673_1016725 3300025290 Bacteria 976
637 Ga0207673_1032820 3300025290 Unclassified 721
638 Ga0207697_10000010 3300025315 Bacteria 65144
639 Ga0207697_10000131 3300025315 Bacteria 36154
640 Ga0207697_10000495 3300025315 Bacteria 22147
641 Ga0207697_10002230 3300025315 Bacteria 10127
642 Ga0207697_10002322 3300025315 Bacteria 9909
643 Ga0207697_10013157 3300025315 Bacteria 3455
644 Ga0207697_10022681 3300025315 Bacteria 2571
645 Ga0207697_10260276 3300025315 Bacteria 768
646 Ga0207653_10039724 3300025885 Bacteria 1541
647 Ga0207653_10050379 3300025885 Bacteria 1384
648 Ga0207692_10073082 3300025898 Bacteria 1813
649 Ga0207692_10167630 3300025898 Bacteria 1270
650 Ga0207692_10402536 3300025898 Bacteria 854
651 Ga0207642_10079022 3300025899 Bacteria 1592
652 Ga0207642_10140377 3300025899 Bacteria 1273
653 Ga0207642_10190964 3300025899 Bacteria 1124
654 Ga0207642_10235101 3300025899 Bacteria 1032
655 Ga0207642_10813163 3300025899 Bacteria 595
656 Ga0207710_10089084 3300025900 Bacteria 1442
657 Ga0207688_10001208 3300025901 Bacteria 13377
658 Ga0207688_10014566 3300025901 Bacteria 4271
659 Ga0207688_10076002 3300025901 Bacteria 1912
660 Ga0207688_10154580 3300025901 Bacteria 1357
661 Ga0207688_10214307 3300025901 Bacteria 1158
662 Ga0207680_10003944 3300025903 Bacteria 7004
663 Ga0207680_10025390 3300025903 Bacteria 3268
664 Ga0207680_10032106 3300025903 Bacteria 2981
665 Ga0207680_10113689 3300025903 Bacteria 1760
666 Ga0207680_10157831 3300025903 Bacteria 1518
667 Ga0207647_10122822 3300025904 Bacteria 1530
668 Ga0207647_10573618 3300025904 Bacteria 624
669 Ga0207685_10003968 3300025905 Bacteria 3683
670 Ga0207685_10023055 3300025905 Bacteria 2113
671 Ga0207699_10008911 3300025906 Bacteria 4974
672 Ga0207699_10020861 3300025906 Bacteria 3520
673 Ga0207699_10205598 3300025906 Bacteria 1336
674 Ga0207699_10245878 3300025906 Bacteria 1231
675 Ga0207699_10354681 3300025906 Unclassified 1036
676 Ga0207645_10001786 3300025907 Bacteria 17391
677 Ga0207645_10002762 3300025907 Bacteria 13659
678 Ga0207645_10004253 3300025907 Bacteria 10632
679 Ga0207645_10004432 3300025907 Bacteria 10394
680 Ga0207645_10125827 3300025907 Bacteria 1666
681 Ga0207645_10241866 3300025907 Unclassified 1192
682 Ga0207645_10474049 3300025907 Bacteria 846
683 Ga0207705_10629080 3300025909 Unclassified 835
684 Ga0207705_10657783 3300025909 Unclassified 815
685 Ga0207705_11370015 3300025909 Unclassified 539
686 Ga0207684_10000028 3300025910 Bacteria 306450
687 Ga0207684_10003766 3300025910 Bacteria 14658
688 Ga0207684_10008671 3300025910 Bacteria 9025
689 Ga0207684_10011143 3300025910 Bacteria 7871
690 Ga0207684_10019695 3300025910 Bacteria 5771
691 Ga0207684_10030870 3300025910 Bacteria 4561
692 Ga0207684_10059810 3300025910 Bacteria 3235
693 Ga0207684_10072862 3300025910 Bacteria 2917
694 Ga0207684_10074641 3300025910 Bacteria 2881
695 Ga0207684_10248195 3300025910 Bacteria 1536
696 Ga0207684_10504496 3300025910 Bacteria 1037
697 Ga0207684_10507609 3300025910 Bacteria 1033
698 Ga0207684_10514905 3300025910 Bacteria 1025
699 Ga0207654_10853293 3300025911 Unclassified 659
700 Ga0207654_11011087 3300025911 Unclassified 605
701 Ga0207707_10035549 3300025912 Bacteria 4356
702 Ga0207671_10132187 3300025914 Bacteria 1916
703 Ga0207671_10203874 3300025914 Bacteria 1545
704 Ga0207693_10000889 3300025915 Bacteria 26818
705 Ga0207693_10006942 3300025915 Bacteria 9356
706 Ga0207693_10021211 3300025915 Bacteria 5163
707 Ga0207693_10035010 3300025915 Bacteria 3961
708 Ga0207693_10157817 3300025915 Bacteria 1785
709 Ga0207693_10167995 3300025915 Bacteria 1727
710 Ga0207693_10323521 3300025915 Bacteria 1207
711 Ga0207693_10339935 3300025915 Bacteria 1175
712 Ga0207693_10459107 3300025915 Unclassified 995
713 Ga0207693_10463811 3300025915 Bacteria 990
714 Ga0207693_10537288 3300025915 Bacteria 912
715 Ga0207693_10665350 3300025915 Unclassified 808
716 Ga0207693_10972828 3300025915 Bacteria 649
717 Ga0207693_11034901 3300025915 Unclassified 626
718 Ga0207663_10002290 3300025916 Bacteria 9171
719 Ga0207663_10071768 3300025916 Unclassified 2236
720 Ga0207663_10129162 3300025916 Bacteria 1743
721 Ga0207663_10742089 3300025916 Bacteria 779
722 Ga0207663_10923940 3300025916 Unclassified 698
723 Ga0207663_11460993 3300025916 Unclassified 551
724 Ga0207660_10087575 3300025917 Bacteria 2301
725 Ga0207660_10605332 3300025917 Bacteria 893
726 Ga0207662_10000699 3300025918 Bacteria 15308
727 Ga0207662_10163389 3300025918 Bacteria 1424
728 Ga0207662_10629477 3300025918 Bacteria 748
729 Ga0207657_10073181 3300025919 Bacteria 2897
730 Ga0207657_10152237 3300025919 Bacteria 1883
731 Ga0207657_10347033 3300025919 Unclassified 1171
732 Ga0207657_10508684 3300025919 Bacteria 943
733 Ga0207649_10201065 3300025920 Bacteria 1408
734 Ga0207649_10757870 3300025920 Bacteria 756
735 Ga0207649_11133067 3300025920 Unclassified 618
736 Ga0207652_10250204 3300025921 Bacteria 1598
737 Ga0207652_11358490 3300025921 Unclassified 614
738 Ga0207646_10000191 3300025922 Bacteria 83638
739 Ga0207646_10001393 3300025922 Bacteria 29980
740 Ga0207646_10005640 3300025922 Bacteria 13143
741 Ga0207646_10005692 3300025922 Bacteria 13070
742 Ga0207646_10009621 3300025922 Bacteria 9535
743 Ga0207646_10010143 3300025922 Bacteria 9230
744 Ga0207646_10028198 3300025922 Bacteria 5113
745 Ga0207646_10065346 3300025922 Bacteria 3248
746 Ga0207646_10068226 3300025922 Bacteria 3176
747 Ga0207646_10073074 3300025922 Bacteria 3063
748 Ga0207646_10295729 3300025922 Bacteria 1463
749 Ga0207646_10346952 3300025922 Bacteria 1341
750 Ga0207646_10482144 3300025922 Bacteria 1118
751 Ga0207646_10507633 3300025922 Bacteria 1086
752 Ga0207646_10840249 3300025922 Unclassified 817
753 Ga0207646_10849897 3300025922 Bacteria 811
754 Ga0207681_10004055 3300025923 Bacteria 9086
755 Ga0207681_10069483 3300025923 Bacteria 2450
756 Ga0207681_10363047 3300025923 Unclassified 1162
757 Ga0207681_10437614 3300025923 Bacteria 1062
758 Ga0207650_10006836 3300025925 Bacteria 7782
759 Ga0207650_10007428 3300025925 Bacteria 7468
760 Ga0207650_10018287 3300025925 Bacteria 4917
761 Ga0207650_10140098 3300025925 Bacteria 1901
762 Ga0207650_10152097 3300025925 Bacteria 1827
763 Ga0207650_11259579 3300025925 Unclassified 630
764 Ga0207659_10003512 3300025926 Bacteria 9421
765 Ga0207659_10045484 3300025926 Bacteria 3095
766 Ga0207659_10049761 3300025926 Bacteria 2974
767 Ga0207659_10054917 3300025926 Bacteria 2846
768 Ga0207659_10266888 3300025926 Bacteria 1395
769 Ga0207659_10843472 3300025926 Bacteria 788
770 Ga0207659_11810958 3300025926 Unclassified 518
771 Ga0207687_10109907 3300025927 Bacteria 2043
772 Ga0207687_10414708 3300025927 Bacteria 1110
773 Ga0207700_10022621 3300025928 Bacteria 4317
774 Ga0207700_10087236 3300025928 Bacteria 2454
775 Ga0207700_10145225 3300025928 Bacteria 1954
776 Ga0207700_10209424 3300025928 Bacteria 1647
777 Ga0207700_10532870 3300025928 Bacteria 1041
778 Ga0207700_10557764 3300025928 Bacteria 1017
779 Ga0207664_10120019 3300025929 Bacteria 2199
780 Ga0207664_10172266 3300025929 Bacteria 1853
781 Ga0207664_10207690 3300025929 Bacteria 1693
782 Ga0207664_10263641 3300025929 Bacteria 1507
783 Ga0207664_11315927 3300025929 Bacteria 642
784 Ga0207644_10029826 3300025931 Bacteria 3787
785 Ga0207644_10035251 3300025931 Bacteria 3504
786 Ga0207644_10049869 3300025931 Bacteria 2998
787 Ga0207644_10092545 3300025931 Bacteria 2256
788 Ga0207644_10101578 3300025931 Bacteria 2161
789 Ga0207644_10112816 3300025931 Bacteria 2058
790 Ga0207644_10166997 3300025931 Bacteria 1715
791 Ga0207644_10187708 3300025931 Bacteria 1624
792 Ga0207644_10221395 3300025931 Bacteria 1500
793 Ga0207644_10515266 3300025931 Bacteria 988
794 Ga0207644_10653564 3300025931 Unclassified 875
795 Ga0207644_10783165 3300025931 Bacteria 797
796 Ga0207644_10813221 3300025931 Bacteria 782
797 Ga0207644_11332041 3300025931 Unclassified 603
798 Ga0207690_10001098 3300025932 Bacteria 17229
799 Ga0207690_10191132 3300025932 Bacteria 1548
800 Ga0207690_10396035 3300025932 Bacteria 1100
801 Ga0207706_10008197 3300025933 Bacteria 9637
802 Ga0207706_10027339 3300025933 Bacteria 5102
803 Ga0207706_10070025 3300025933 Bacteria 3084
804 Ga0207706_10127775 3300025933 Bacteria 2235
805 Ga0207706_10287059 3300025933 Bacteria 1435
806 Ga0207706_10456723 3300025933 Bacteria 1105
807 Ga0207706_10588936 3300025933 Unclassified 956
808 Ga0207706_10660496 3300025933 Unclassified 895
809 Ga0207686_10913136 3300025934 Bacteria 709
810 Ga0207709_10368837 3300025935 Bacteria 1089
811 Ga0207670_10009200 3300025936 Bacteria 5622
812 Ga0207670_10104247 3300025936 Bacteria 2031
813 Ga0207670_10131649 3300025936 Bacteria 1833
814 Ga0207670_10343447 3300025936 Bacteria 1180
815 Ga0207670_10348962 3300025936 Bacteria 1171
816 Ga0207670_10507031 3300025936 Bacteria 980
817 Ga0207670_10706085 3300025936 Unclassified 835
818 Ga0207669_10002532 3300025937 Bacteria 7802
819 Ga0207669_10011026 3300025937 Bacteria 4378
820 Ga0207669_10213532 3300025937 Bacteria 1410
821 Ga0207669_10585160 3300025937 Bacteria 905
822 Ga0207669_10698358 3300025937 Bacteria 834
823 Ga0207669_10811855 3300025937 Unclassified 776
824 Ga0207669_11063791 3300025937 Bacteria 682
825 Ga0207704_10122214 3300025938 Bacteria 1785
826 Ga0207704_10133056 3300025938 Bacteria 1726
827 Ga0207704_10183501 3300025938 Bacteria 1514
828 Ga0207704_10318899 3300025938 Bacteria 1198
829 Ga0207704_10331575 3300025938 Bacteria 1178
830 Ga0207704_11241883 3300025938 Bacteria 636
831 Ga0207704_11945061 3300025938 Unclassified 506
832 Ga0207665_10025655 3300025939 Bacteria 3889
833 Ga0207665_10048049 3300025939 Bacteria 2863
834 Ga0207665_10075192 3300025939 Bacteria 2313
835 Ga0207665_10089858 3300025939 Bacteria 2128
836 Ga0207665_10136465 3300025939 Bacteria 1746
837 Ga0207665_10194109 3300025939 Bacteria 1477
838 Ga0207665_10215560 3300025939 Bacteria 1405
839 Ga0207665_10263985 3300025939 Bacteria 1276
840 Ga0207691_10000142 3300025940 Bacteria 66224
841 Ga0207691_10000247 3300025940 Bacteria 53502
842 Ga0207691_10002644 3300025940 Bacteria 17504
843 Ga0207691_10016028 3300025940 Bacteria 7119
844 Ga0207691_10037047 3300025940 Bacteria 4518
845 Ga0207691_10253085 3300025940 Bacteria 1520
846 Ga0207691_10512972 3300025940 Unclassified 1018
847 Ga0207691_10775711 3300025940 Bacteria 806
848 Ga0207711_10549769 3300025941 Bacteria 1077
849 Ga0207689_10009503 3300025942 Bacteria 8397
850 Ga0207689_10086541 3300025942 Bacteria 2576
851 Ga0207689_10468828 3300025942 Bacteria 1054
852 Ga0207689_10920703 3300025942 Unclassified 738
853 Ga0207661_10031201 3300025944 Bacteria 4113
854 Ga0207661_10077884 3300025944 Bacteria 2728
855 Ga0207661_10124065 3300025944 Bacteria 2203
856 Ga0207661_10653381 3300025944 Bacteria 966
857 Ga0207661_10803283 3300025944 Bacteria 866
858 Ga0207679_10185257 3300025945 Bacteria 1725
859 Ga0207679_10282029 3300025945 Unclassified 1425
860 Ga0207679_11569338 3300025945 Unclassified 603
861 Ga0207667_11021945 3300025949 Bacteria 813
862 Ga0207651_10007253 3300025960 Bacteria 5894
863 Ga0207651_10027669 3300025960 Bacteria 3565
864 Ga0207651_10083018 3300025960 Bacteria 2315
865 Ga0207651_10197170 3300025960 Bacteria 1610
866 Ga0207651_10235820 3300025960 Bacteria 1488
867 Ga0207651_10245165 3300025960 Unclassified 1463
868 Ga0207651_10845199 3300025960 Bacteria 813
869 Ga0207651_11832245 3300025960 Unclassified 546
870 Ga0207712_10010310 3300025961 Bacteria 5932
871 Ga0207712_10328930 3300025961 Bacteria 1263
872 Ga0207712_10542551 3300025961 Bacteria 999
873 Ga0207668_10009836 3300025972 Bacteria 5747
874 Ga0207668_10026495 3300025972 Bacteria 3764
875 Ga0207668_10052709 3300025972 Bacteria 2816
876 Ga0207668_11025480 3300025972 Unclassified 738
877 Ga0207668_11310109 3300025972 Bacteria 652
878 Ga0207640_10886173 3300025981 Bacteria 778
879 Ga0207640_11451827 3300025981 Bacteria 615
880 Ga0207658_10010242 3300025986 Bacteria 6370
881 Ga0207658_10014736 3300025986 Bacteria 5357
882 Ga0207658_10046961 3300025986 Bacteria 3157
883 Ga0207658_10338757 3300025986 Bacteria 1307
884 Ga0207658_10483665 3300025986 Bacteria 1100
885 Ga0207658_10708972 3300025986 Bacteria 910
886 Ga0207658_10831112 3300025986 Unclassified 839
887 Ga0207658_10889835 3300025986 Unclassified 810
888 Ga0207658_12175480 3300025986 Bacteria 504
889 Ga0207677_10008042 3300026023 Bacteria 5871
890 Ga0207677_10020703 3300026023 Bacteria 4000
891 Ga0207677_10109071 3300026023 Bacteria 2057
892 Ga0207677_10188958 3300026023 Unclassified 1627
893 Ga0207677_10650977 3300026023 Bacteria 930
894 Ga0207677_10811172 3300026023 Bacteria 838
895 Ga0207703_10003624 3300026035 Bacteria 12889
896 Ga0207703_10142997 3300026035 Bacteria 2078
897 Ga0207703_10309352 3300026035 Unclassified 1444
898 Ga0207703_10531807 3300026035 Bacteria 1107
899 Ga0207703_10584444 3300026035 Unclassified 1055
900 Ga0207703_10701560 3300026035 Bacteria 962
901 Ga0207703_10989909 3300026035 Unclassified 807
902 Ga0207639_10200729 3300026041 Bacteria 1710
903 Ga0207678_10020455 3300026067 Bacteria 5804
904 Ga0207678_10138642 3300026067 Bacteria 2076
905 Ga0207678_10246654 3300026067 Bacteria 1529
906 Ga0207708_10538280 3300026075 Bacteria 983
907 Ga0207702_10038562 3300026078 Bacteria 4001
908 Ga0207702_11698650 3300026078 Unclassified 624
909 Ga0207702_11966261 3300026078 Unclassified 575
910 Ga0207641_10022387 3300026088 Bacteria 5202
911 Ga0207641_10436029 3300026088 Bacteria 1264
912 Ga0207648_10149163 3300026089 Bacteria 2063
913 Ga0207648_10179022 3300026089 Bacteria 1876
914 Ga0207648_10727172 3300026089 Unclassified 921
915 Ga0207676_10474000 3300026095 Bacteria 1184
916 Ga0207676_10525676 3300026095 Bacteria 1127
917 Ga0207676_11029435 3300026095 Unclassified 812
918 Ga0207676_11180751 3300026095 Unclassified 758
919 Ga0207676_11311066 3300026095 Unclassified 719
920 Ga0207675_100094187 3300026118 Bacteria 2817
921 Ga0207675_100119142 3300026118 Bacteria 2497
922 Ga0207675_100165775 3300026118 Bacteria 2110
923 Ga0207683_10006977 3300026121 Bacteria 9683
924 Ga0207683_10008842 3300026121 Bacteria 8591
925 Ga0207683_10009866 3300026121 Bacteria 8145
926 Ga0207683_10015583 3300026121 Bacteria 6470
927 Ga0207683_10872708 3300026121 Unclassified 835
928 Ga0207683_11529710 3300026121 Bacteria 616
929 Ga0207683_11711425 3300026121 Unclassified 578
930 Ga0207698_10525239 3300026142 Unclassified 1156
931 Ga0209969_1030523 3300027360 Bacteria 823
932 Ga0209967_1044749 3300027364 Unclassified 676
933 Ga0209981_1058211 3300027378 Bacteria 590
934 Ga0209984_1004426 3300027424 Bacteria 1656
935 Ga0209984_1037284 3300027424 Bacteria 695
936 Ga0209999_1004693 3300027543 Bacteria 2453
937 Ga0209982_1046842 3300027552 Bacteria 694
938 Ga0209970_1005891 3300027614 Bacteria 2014
939 Ga0209983_1000280 3300027665 Bacteria 10618
940 Ga0209588_1112866 3300027671 Bacteria 872
941 Ga0209588_1142593 3300027671 Unclassified 761
942 Ga0209588_1214259 3300027671 Bacteria 597
943 Ga0209971_1000384 3300027682 Bacteria 12081
944 Ga0209971_1164380 3300027682 Bacteria 547
945 Ga0209998_10026839 3300027717 Bacteria 1259
946 Ga0209974_10004420 3300027876 Bacteria 5002
947 Ga0209974_10023640 3300027876 Bacteria 2034
948 Ga0209974_10073397 3300027876 Bacteria 1170
949 Ga0207428_10252411 3300027907 Bacteria 1315
950 Ga0207428_10551247 3300027907 Bacteria 834
951 Ga0268266_10004179 3300028379 Bacteria 13926
952 Ga0268266_10026994 3300028379 Bacteria 4885
953 Ga0268266_10076422 3300028379 Bacteria 2910
954 Ga0268266_10141029 3300028379 Bacteria 2163
955 Ga0268266_10219749 3300028379 Bacteria 1746
956 Ga0268266_10371687 3300028379 Unclassified 1347
957 Ga0268266_10395721 3300028379 Bacteria 1305
958 Ga0268266_11176992 3300028379 Unclassified 741
959 Ga0268265_10044999 3300028380 Bacteria 3290
960 Ga0268265_10368503 3300028380 Bacteria 1318
961 Ga0268264_10001807 3300028381 Bacteria 19555
962 Ga0268264_10029276 3300028381 Unclassified 4509
963 Ga0268264_10149965 3300028381 Bacteria 2089
964 Ga0268264_10178518 3300028381 Bacteria 1926
965 Ga0268264_10521444 3300028381 Bacteria 1162
966 Ga0307513_10023335 3300031456 Bacteria 7230
967 Ga0307414_10460102 3300032004 Bacteria 1118
968 Ga0373930_0160298 3300034816 Unclassified 569
969 Ga0373948_0190428 3300034817 Bacteria 531
970 Ga0373959_0161854 3300034820 Bacteria 572
971 Ga0373926_0025205 3300035083 Bacteria 2075
972 Ga0373926_0070283 3300035083 Bacteria 1286
973 Ga0373926_0077902 3300035083 Bacteria 1223
974 Ga0373940_0150688 3300035088 Bacteria 741
975 Ga0373944_0061394 3300035089 Bacteria 1207
976 Ga0373944_0215748 3300035089 Unclassified 699
977 Ga0373944_0253299 3300035089 Bacteria 650
978 Ga0373951_0035882 3300035091 Bacteria 1182
979 Ga0373923_0090520 3300035111 Bacteria 1338
980 Ga0373932_0207585 3300035112 Unclassified 699
981 Ga0373936_0311305 3300035113 Unclassified 712
982 Ga0373936_0412525 3300035113 Bacteria 621
983 Ga0373936_0487609 3300035113 Unclassified 572
984 Ga0373939_0103156 3300035114 Bacteria 982
985 Ga0373941_0205467 3300035115 Bacteria 751
986 Ga0373945_0005962 3300035116 Bacteria 3914
987 Ga0373954_0021155 3300035118 Bacteria 2944
988 Ga0373956_0326539 3300035119 Unclassified 731
989 Ga0373960_0090100 3300035121 Unclassified 979
990 Ga0373943_0005531 3300035170 Bacteria 5673
991 Ga0373943_0057911 3300035170 Bacteria 1927
992 Ga0373943_0080926 3300035170 Bacteria 1665
993 Ga0373943_0235000 3300035170 Bacteria 1025
994 Ga0373943_0283262 3300035170 Unclassified 938
995 Ga0373946_0045201 3300035171 Bacteria 1821
996 Ga0373946_0071572 3300035171 Bacteria 1499
997 Ga0373955_0619939 3300035172 Bacteria 663
998 Ga0373955_0638582 3300035172 Unclassified 653
999 Ga0373942_0339145 3300035207 Unclassified 529
1000 Ga0373961_0244091 3300035241 Unclassified 648
1001 Ga0373931_0108890 3300035691 Bacteria 1569
1002 Ga0373931_0130279 3300035691 Bacteria 1447
1003 Ga0373931_0149850 3300035691 Bacteria 1359
1004 Ga0373931_0234351 3300035691 Bacteria 1110
1005 Ga0373935_0031757 3300035692 Bacteria 3279
1006 Ga0373935_0302849 3300035692 Unclassified 1130
1007 Ga0373935_0314802 3300035692 Bacteria 1109
1008 Ga0373935_0450838 3300035692 Bacteria 929
1009 Ga0373927_0031651 3300035695 Bacteria 3446
1010 Ga0373927_0123175 3300035695 Bacteria 1692
1011 Ga0373927_0176977 3300035695 Bacteria 1399
1012 Ga0373927_0297200 3300035695 Bacteria 1063
1013 Ga0373933_0052084 3300035724 Bacteria 2448
1014 Ga0373947_0036106 3300035725 Bacteria 2929
1015 Ga0373947_0054112 3300035725 Bacteria 2422
1016 Ga0373947_0069919 3300035725 Bacteria 2150
1017 Ga0373947_0099277 3300035725 Bacteria 1827
1018 Ga0373947_0517462 3300035725 Bacteria 811
1019 Ga0373947_1093627 3300035725 Bacteria 543
1020 Ga0373937_0065643 3300036401 Bacteria 3341
1021 Ga0373937_0114836 3300036401 Bacteria 2506
1022 Ga0373937_0124137 3300036401 Bacteria 2407
1023 Ga0373937_0201678 3300036401 Bacteria 1870
1024 Ga0373937_0397543 3300036401 Bacteria 1307
1025 Ga0373925_0006124 3300037068 Bacteria 8887
1026 Ga0373925_0014401 3300037068 Bacteria 5718
1027 Ga0373925_0040917 3300037068 Bacteria 3433
1028 Ga0373925_0460076 3300037068 Bacteria 1042
1029 Ga0373925_0603063 3300037068 Unclassified 904
1030 Ga0373925_0910866 3300037068 Unclassified 724
1031 Ga0373925_1412547 3300037068 Unclassified 570
1032 Ga0395899_0081216 3300037312 Bacteria 2359
1033 Ga0395899_0549618 3300037312 Bacteria 742
1034 Ga0395899_0845785 3300037312 Unclassified 562
1035 Ga0395900_0002526 3300037418 Bacteria 20035
1036 Ga0395900_0008031 3300037418 Bacteria 10861
1037 Ga0395900_0232346 3300037418 Bacteria 1854
1038 Ga0395900_1933523 3300037418 Unclassified 500
1039 Ga0395898_0002044 3300037466 Bacteria 25218
1040 Ga0395898_0041866 3300037466 Bacteria 4522
1041 Ga0395898_0405534 3300037466 Bacteria 1300
1042 Ga0395898_0580639 3300037466 Bacteria 1063
1043 Ga0395898_0913905 3300037466 Unclassified 816
1044 Ga0395905_0045531 3300037471 Bacteria 4115
1045 Ga0395905_0389610 3300037471 Bacteria 1288
1046 Ga0395905_0416146 3300037471 Bacteria 1240
1047 Ga0395905_0703597 3300037471 Bacteria 913
1048 Ga0436364_0440977 3300037853 Bacteria 999
1049 Ga0436364_1193811 3300037853 Bacteria 3102
1050 Ga0395901_0002964 3300038443 Bacteria 17124
1051 Ga0395901_0039538 3300038443 Bacteria 4881
1052 Ga0395901_0083535 3300038443 Bacteria 3338
1053 Ga0395901_0280015 3300038443 Bacteria 1733
1054 Ga0395901_0703660 3300038443 Bacteria 1008
1055 Ga0436365_0026349 3300039437 Bacteria 2262
1056 Ga0436365_1454817 3300039437 Bacteria 8544
1057 Ga0436360_1356494 3300039438 Unclassified 538
1058 Ga0436363_0428075 3300039450 Bacteria 713
1059 Ga0436362_0051725 3300039453 Bacteria 2518
1060 Ga0451795_0218717 3300041456 Bacteria 1245
1061 Ga0451795_1070674 3300041456 Unclassified 508
1062 Ga0451795_1097033 3300041456 Bacteria 1235
1063 Ga0451798_0051088 3300041458 Bacteria 786
1064 Ga0451800_0294886 3300041459 Unclassified 893
1065 Ga0451802_1916692 3300041460 Unclassified 505
1066 Ga0451807_0465582 3300041486 Bacteria 836
1067 Ga0451807_2171196 3300041486 Unclassified 883
1068 Ga0451837_0657191 3300041494 Unclassified 515
1069 Ga0451839_0785113 3300041496 Unclassified 647
1070 Ga0451855_0504270 3300041511 Bacteria 957
1071 Ga0451855_1662967 3300041511 Bacteria 1322
1072 Ga0451853_0537436 3300041512 Bacteria 1055
1073 Ga0451853_0644242 3300041512 Unclassified 804
1074 Ga0439448_0066736 3300042005 Bacteria 1195
1075 Ga0439448_0090520 3300042005 Bacteria 1033
1076 Ga0439451_017252 3300042009 Bacteria 1455
1077 Ga0439464_0019868 3300042439 Bacteria 1836
1078 Ga0439464_0127029 3300042439 Bacteria 788
1079 Ga0439460_0120465 3300042461 Unclassified 858
1080 Ga0451577_0003056 3300042876 Bacteria 19007
1081 Ga0453683_0012218 3300044673 Bacteria 5632
1082 Ga0453684_0033176 3300044712 Bacteria 7203
1083 Ga0453684_0818663 3300044712 Bacteria 1003
1084 Ga0453684_1160797 3300044712 Unclassified 813
1085 Ga0451576_0000055 3300045051 Bacteria 304830
1086 Ga0451576_0032997 3300045051 Bacteria 5505
1087 Ga0451576_0230708 3300045051 Bacteria 1933
1088 Ga0451576_0271845 3300045051 Bacteria 1772
1089 Ga0451576_0289458 3300045051 Bacteria 1713
1090 Ga0451576_0359913 3300045051 Bacteria 1524
1091 Ga0466967_0032556 3300045976 Bacteria 4403
1092 Ga0466967_0230794 3300045976 Bacteria 1762
1093 Ga0495592_0013560 3300046454 Bacteria 6201
1094 Ga0495603_0055534 3300046455 Bacteria 2346
1095 Ga0495629_0008333 3300046459 Bacteria 7622
1096 Ga0495629_0286104 3300046459 Bacteria 1130
1097 Ga0495641_0080416 3300046461 Bacteria 1460
1098 Ga0495651_0232273 3300046462 Bacteria 1269
1099 Ga0495653_0463193 3300046463 Unclassified 795
1100 Ga0495653_0692492 3300046463 Unclassified 619
1101 Ga0495580_0064954 3300046472 Bacteria 2557
1102 Ga0495580_0107757 3300046472 Bacteria 1935
1103 Ga0495580_0165118 3300046472 Bacteria 1532
1104 Ga0495580_0186167 3300046472 Bacteria 1433
1105 Ga0495580_0319707 3300046472 Bacteria 1055
1106 Ga0495582_0177182 3300046473 Unclassified 1214
1107 Ga0495605_0241838 3300046474 Unclassified 775
1108 Ga0495605_0492088 3300046474 Unclassified 502
1109 Ga0495662_0069387 3300046476 Bacteria 1707
1110 Ga0495664_0197075 3300046477 Bacteria 1221
1111 Ga0495664_0202283 3300046477 Bacteria 1203
1112 Ga0495584_0022505 3300046491 Bacteria 3197
1113 Ga0495584_0532480 3300046491 Unclassified 599
1114 Ga0495585_0274372 3300046492 Bacteria 835
1115 Ga0495607_0294471 3300046501 Bacteria 766
1116 Ga0495608_0655926 3300046511 Unclassified 627
1117 Ga0495628_0040395 3300046516 Bacteria 3728
1118 Ga0495628_0208490 3300046516 Bacteria 1470
1119 Ga0495628_0528697 3300046516 Bacteria 849
1120 Ga0495630_0017678 3300046517 Bacteria 5227
1121 Ga0495630_0041206 3300046517 Bacteria 3448
1122 Ga0495630_0228479 3300046517 Unclassified 1421
1123 Ga0495630_0465867 3300046517 Unclassified 968
1124 Ga0495631_0478114 3300046518 Unclassified 531
1125 Ga0495637_0089666 3300046520 Bacteria 1215
1126 Ga0495644_0227498 3300046523 Bacteria 722
1127 Ga0495644_0449758 3300046523 Unclassified 513
1128 Ga0495666_0100205 3300046526 Bacteria 1365
1129 Ga0495642_0022869 3300046528 Bacteria 2465
1130 Ga0495642_0222200 3300046528 Bacteria 825
1131 Ga0495652_0045601 3300046529 Bacteria 3767
1132 Ga0495652_1020926 3300046529 Unclassified 540
1133 Ga0495665_0043688 3300046531 Bacteria 2383
1134 Ga0495640_0432390 3300046533 Unclassified 805
1135 Ga0495586_0014140 3300046535 Bacteria 4240
1136 Ga0495587_0009500 3300046536 Bacteria 6231
1137 Ga0495598_0000901 3300046537 Bacteria 5725
1138 Ga0495598_0027087 3300046537 Bacteria 1578
1139 Ga0495598_0048134 3300046537 Bacteria 1274
1140 Ga0495598_0095720 3300046537 Unclassified 975
1141 Ga0495621_0309943 3300046539 Unclassified 656
1142 Ga0495597_0185047 3300046542 Bacteria 840
1143 Ga0495645_0001076 3300046543 Bacteria 18525
1144 Ga0495633_0154083 3300046558 Bacteria 1061
1145 Ga0495667_0561934 3300046559 Unclassified 712
1146 Ga0495656_0268106 3300046615 Unclassified 867
1147 Ga0495635_0281409 3300046663 Bacteria 1117
1148 Ga0495635_0394740 3300046663 Unclassified 919
1149 Ga0495659_0087755 3300046664 Bacteria 1190
1150 Ga0495659_0121259 3300046664 Bacteria 1030
1151 Ga0495659_0129759 3300046664 Bacteria 999
1152 Ga0495659_0247028 3300046664 Bacteria 743
1153 Ga0495661_0227291 3300046665 Bacteria 964
1154 Ga0495588_0066650 3300046674 Bacteria 1869
1155 Ga0495588_0148087 3300046674 Unclassified 1241
1156 Ga0495657_0218503 3300046675 Bacteria 1156
1157 Ga0495657_0357846 3300046675 Unclassified 863
1158 Ga0495599_0000317 3300046678 Bacteria 28802
1159 Ga0495623_0000811 3300046679 Bacteria 21045
1160 Ga0495646_0002940 3300046680 Bacteria 10561
1161 Ga0495647_0028223 3300046681 Bacteria 2068
1162 Ga0495647_0058248 3300046681 Bacteria 1518
1163 Ga0495658_0129662 3300046683 Bacteria 1534
1164 Ga0495658_0141734 3300046683 Bacteria 1470
1165 Ga0495669_0009247 3300046684 Bacteria 4152
1166 Ga0495669_0142072 3300046684 Bacteria 1133
1167 Ga0495669_0385127 3300046684 Unclassified 679
1168 Ga0495613_0124871 3300046689 Bacteria 1846
1169 Ga0495613_0213064 3300046689 Bacteria 1358
1170 Ga0495670_0321637 3300046691 Unclassified 831
1171 Ga0495600_0196305 3300046809 Bacteria 1297
1172 Ga0495581_0123308 3300047315 Bacteria 1508
1173 Ga0495604_0053697 3300047317 Bacteria 3112
1174 Ga0495604_0233324 3300047317 Bacteria 1261
1175 Ga0495604_0276899 3300047317 Bacteria 1135
1176 Ga0495604_0869028 3300047317 Unclassified 565
1177 Ga0495636_0128954 3300047318 Bacteria 1124
1178 Ga0495636_0136190 3300047318 Bacteria 1095
1179 Ga0495674_0047362 3300047319 Bacteria 3813
1180 Ga0495674_1186421 3300047319 Unclassified 577
1181 Ga0495675_0002584 3300047444 Bacteria 10850
1182 Ga0495675_0010133 3300047444 Bacteria 5878
1183 Ga0495679_072938 3300047446 Bacteria 986
1184 Ga0495681_0155566 3300047470 Unclassified 956
1185 Ga0495684_0063571 3300047471 Bacteria 2805
1186 Ga0495684_0441974 3300047471 Unclassified 905
1187 Ga0495593_0125575 3300047673 Bacteria 1304
1188 Ga0495602_0017278 3300048088 Bacteria 7234
1189 Ga0495602_0319298 3300048088 Unclassified 1130
1190 Ga0495614_0256744 3300048089 Unclassified 800
1191 Ga0495626_0436823 3300048091 Bacteria 504
1192 Ga0496100_0021201 3300048903 Bacteria 3910
1193 Ga0496100_0156080 3300048903 Bacteria 1632
1194 Ga0496101_0031362 3300048904 Bacteria 3735
1195 Ga0496101_0033960 3300048904 Bacteria 3602
1196 Ga0496101_0108830 3300048904 Bacteria 2084
1197 Ga0496101_0332739 3300048904 Bacteria 1192
1198 Ga0496101_0436945 3300048904 Unclassified 1032
1199 Ga0496101_1349063 3300048904 Unclassified 557
1200 Ga0496102_0009851 3300048905 Bacteria 8216
1201 Ga0496102_0028763 3300048905 Bacteria 4968
1202 Ga0496102_0035336 3300048905 Bacteria 4498
1203 Ga0496102_0367403 3300048905 Bacteria 1354
1204 Ga0496102_1084114 3300048905 Unclassified 721
1205 Ga0496102_1138239 3300048905 Unclassified 700
1206 Ga0496103_0011535 3300048906 Bacteria 5238
1207 Ga0496103_0019686 3300048906 Bacteria 4052
1208 Ga0496103_0191846 3300048906 Bacteria 1314
1209 Ga0496104_0012446 3300048907 Bacteria 7651
1210 Ga0496104_0072184 3300048907 Bacteria 3282
1211 Ga0496104_0077845 3300048907 Bacteria 3160
1212 Ga0496104_0159226 3300048907 Bacteria 2166
1213 Ga0496104_0367572 3300048907 Bacteria 1351
1214 Ga0496104_0403967 3300048907 Bacteria 1278
1215 Ga0496104_0500938 3300048907 Bacteria 1126
1216 Ga0496104_1370905 3300048907 Unclassified 610
1217 Ga0496105_0044348 3300048908 Bacteria 3668
1218 Ga0496105_0162019 3300048908 Unclassified 1836
1219 Ga0496105_0168019 3300048908 Bacteria 1799
1220 Ga0496105_0209619 3300048908 Bacteria 1589
1221 Ga0496105_0334842 3300048908 Bacteria 1211
1222 Ga0496106_0002174 3300048909 Bacteria 14655
1223 Ga0496106_0023076 3300048909 Bacteria 4621
1224 Ga0496106_0083615 3300048909 Bacteria 2455
1225 Ga0496106_0281934 3300048909 Bacteria 1331
1226 Ga0496106_0386891 3300048909 Bacteria 1124
1227 Ga0496106_0695051 3300048909 Unclassified 811
1228 Ga0496106_0954534 3300048909 Unclassified 676
1229 Ga0496107_0018540 3300048910 Bacteria 4901
1230 Ga0496107_0170479 3300048910 Bacteria 1615
1231 Ga0496107_0211431 3300048910 Bacteria 1442
1232 Ga0496107_0549569 3300048910 Unclassified 855
1233 Ga0496107_1223414 3300048910 Unclassified 539
1234 Ga0496108_0032258 3300048911 Bacteria 4350
1235 Ga0496108_0042309 3300048911 Bacteria 3803
1236 Ga0496108_0150540 3300048911 Bacteria 2008
1237 Ga0496108_0202863 3300048911 Bacteria 1721
1238 Ga0496108_0299120 3300048911 Bacteria 1402
1239 Ga0496108_0455425 3300048911 Bacteria 1118
1240 Ga0496108_0878263 3300048911 Bacteria 770
1241 Ga0496109_0063355 3300048912 Bacteria 3382
1242 Ga0496109_0080035 3300048912 Bacteria 3010
1243 Ga0496109_0271092 3300048912 Bacteria 1599
1244 Ga0496109_0293107 3300048912 Bacteria 1534
1245 Ga0496109_0337800 3300048912 Bacteria 1422
1246 Ga0496109_0396259 3300048912 Bacteria 1304
1247 Ga0496109_0486714 3300048912 Bacteria 1165
1248 Ga0496109_0534195 3300048912 Bacteria 1106
1249 Ga0496110_0097184 3300048913 Bacteria 2639
1250 Ga0496110_0171464 3300048913 Bacteria 1969
1251 Ga0496110_0209515 3300048913 Bacteria 1772
1252 Ga0496110_0325509 3300048913 Bacteria 1400
1253 Ga0496110_0472005 3300048913 Bacteria 1143
1254 Ga0496110_1014764 3300048913 Bacteria 737
1255 Ga0496111_0184825 3300048914 Bacteria 1550
1256 Ga0496111_0204705 3300048914 Bacteria 1466
1257 Ga0496111_0362231 3300048914 Bacteria 1073
1258 Ga0496111_0395934 3300048914 Bacteria 1021
1259 Ga0496111_0440872 3300048914 Unclassified 961
1260 Ga0496111_0626273 3300048914 Unclassified 786
1261 Ga0496112_0017121 3300048915 Bacteria 6804
1262 Ga0496112_0050307 3300048915 Bacteria 4086
1263 Ga0496112_0087521 3300048915 Bacteria 3082
1264 Ga0496112_0106562 3300048915 Bacteria 2773
1265 Ga0496112_0141497 3300048915 Bacteria 2375
1266 Ga0496112_0155440 3300048915 Unclassified 2254
1267 Ga0496112_0180552 3300048915 Bacteria 2074
1268 Ga0496112_0231179 3300048915 Bacteria 1804
1269 Ga0496112_0426235 3300048915 Bacteria 1265
1270 Ga0496112_0731749 3300048915 Bacteria 916
1271 Ga0496112_0915914 3300048915 Unclassified 798
1272 Ga0496112_1008795 3300048915 Bacteria 752
1273 Ga0496112_1269759 3300048915 Bacteria 652
1274 Ga0496113_0069914 3300048916 Bacteria 2667
1275 Ga0496113_0140358 3300048916 Bacteria 1901
1276 Ga0496113_0180835 3300048916 Bacteria 1672
1277 Ga0496113_0519020 3300048916 Bacteria 956
1278 Ga0496113_0714352 3300048916 Unclassified 799
1279 Ga0496113_0925727 3300048916 Unclassified 689
1280 Ga0496113_1075709 3300048916 Unclassified 631
1281 Ga0496114_0012996 3300048917 Bacteria 6672
1282 Ga0496114_0012997 3300048917 Bacteria 6672
1283 Ga0496114_0591740 3300048917 Bacteria 978
1284 Ga0496114_1344397 3300048917 Unclassified 602
1285 Ga0496115_0002575 3300048918 Bacteria 13018
1286 Ga0496115_0004314 3300048918 Bacteria 10290
1287 Ga0496115_0009615 3300048918 Bacteria 7191
1288 Ga0496115_0026271 3300048918 Bacteria 4543
1289 Ga0496115_0091504 3300048918 Bacteria 2486
1290 Ga0496115_0163516 3300048918 Bacteria 1840
1291 Ga0496115_0674581 3300048918 Bacteria 815
1292 Ga0501323_033420 3300049539 Bacteria 731
1293 Ga0501036_1203504 3300049572 Bacteria 617
1294 Ga0501038_0198598 3300049574 Bacteria 1611
1295 Ga0501048_0931269 3300049582 Bacteria 625
1296 Ga0501068_0554486 3300049584 Unclassified 747
1297 Ga0501070_0658494 3300049586 Unclassified 831
1298 Ga0501072_0079503 3300049588 Bacteria 2597
1299 Ga0501073_0037486 3300049589 Bacteria 3442
1300 Ga0501074_0067186 3300049590 Bacteria 2579
1301 Ga0501075_0201190 3300049591 Bacteria 1519
1302 Ga0501079_0039652 3300049741 Bacteria 3632
1303 Ga0501080_0078950 3300049742 Bacteria 3060
1304 Ga0501081_0042874 3300049743 Bacteria 3102
1305 Ga0501269_026792 3300049766 Bacteria 730
1306 nmdc:mga05p37_135223_c1 3300050507 Bacteria 3024
1307 nmdc:mga05p37_140290_c1 3300050507 Bacteria 2961
1308 nmdc:mga05p37_1701_c1 3300050507 Bacteria 25630
1309 nmdc:mga05p37_468622_c1 3300050507 Bacteria 1454
1310 nmdc:mga08y16_1151339_c1 3300050511 Bacteria 748
1311 nmdc:mga08y16_1272337_c1 3300050511 Bacteria 703
1312 nmdc:mga08y16_2132647_c1 3300050511 Unclassified 508
1313 nmdc:mga08y16_724873_c1 3300050511 Bacteria 992
1314 nmdc:mga08y16_786981_c1 3300050511 Bacteria 945
1315 nmdc:mga0n895_15345_c1 3300050512 Bacteria 6981
1316 nmdc:mga0n895_344747_c1 3300050512 Bacteria 1509
1317 nmdc:mga0n895_507216_c1 3300050512 Bacteria 1215
1318 nmdc:mga0n895_575194_c1 3300050512 Bacteria 1131
1319 nmdc:mga0n895_764651_c1 3300050512 Unclassified 958
1320 nmdc:mga0rr50_1043890_c1 3300050513 Unclassified 696
1321 nmdc:mga0rr50_1337496_c1 3300050513 Bacteria 607
1322 nmdc:mga0rr50_772511_c1 3300050513 Bacteria 820
1323 nmdc:mga0rr50_968519_c1 3300050513 Bacteria 725
1324 nmdc:mga08x19_576507_c1 3300050514 Unclassified 797
1325 nmdc:mga08x19_80561_c1 3300050514 Bacteria 2137
1326 nmdc:mga0a205_392963_c1 3300050515 Bacteria 1251
1327 nmdc:mga0a205_442986_c1 3300050515 Bacteria 1159
1328 nmdc:mga0a205_480816_c1 3300050515 Bacteria 1100
1329 nmdc:mga0a205_8807_c1 3300050515 Bacteria 9192
1330 Ga0495601_0001921 3300053077 Bacteria 11624
1331 Ga0495601_0180268 3300053077 Bacteria 1381
1332 Ga0495619_0108420 3300053085 Bacteria 1895
1333 Ga0500643_172821 3300053087 Unclassified 579
1334 Ga0500555_000015 3300053103 Bacteria 230204
1335 Ga0500568_0043000 3300053139 Bacteria 1807
1336 Ga0500616_0003906 3300053153 Bacteria 10963
1337 Ga0500616_0006989 3300053153 Bacteria 7263
1338 Ga0501084_0195523 3300054114 Bacteria 1706
1339 Ga0501082_0025331 3300060353 Bacteria 5112
1340 Ga0182008_10130751
1341 SwRhRL2b_contig_3185009
1342 2214871332
1343 JGI24035J14997_100183
1344 JGI24746J21847_1007470
1345 JGI24737J22298_10073669
1346 JGI24748J21848_1058165
1347 JGI24744J21845_10009043
1348 JGI24035J26624_1000379
1349 JGI24035J26624_1001833
1350 JGI24035J26624_1006039
1351 JGI24035J26624_1008033
1352 JGI25406J46586_10000007
1353 JGI25405J52794_10003510
1354 JGI25405J52794_10007684
1355 Ga0065714_10099910
1356 Ga0065704_10002652
1357 Ga0065704_10154003
1358 Ga0065704_10172946
1359 Ga0065704_10659453
1360 Ga0065712_10006848
1361 Ga0065712_10040837
1362 Ga0065712_10070849
1363 Ga0065712_10084132
1364 Ga0065712_10088457
1365 Ga0065712_10099828
1366 Ga0065712_10108970
1367 Ga0065712_10130323
1368 Ga0065712_10325714
1369 Ga0065712_10462430
1370 Ga0065715_10005423
1371 Ga0065715_10090524
1372 Ga0065715_10114446
1373 Ga0065715_10136006
1374 Ga0065715_10159921
1375 Ga0065715_10181691
1376 Ga0065715_10222055
1377 Ga0065715_10225288
1378 Ga0065715_10242281
1379 Ga0065715_10254589
1380 Ga0065715_10334136
1381 Ga0065715_10350677
1382 Ga0065715_10427404
1383 Ga0065707_10009888
1384 Ga0065707_10233776
1385 Ga0065707_10608558
1386 Ga0070658_10080732
1387 Ga0070658_10410039
1388 Ga0070658_11783697
1389 Ga0070676_10023857
1390 Ga0070676_10032758
1391 Ga0070676_10069962
1392 Ga0070676_10108518
1393 Ga0070676_10202196
1394 Ga0070676_11182432
1395 Ga0070683_100026491
1396 Ga0070683_100054847
1397 Ga0070683_100055457
1398 Ga0070683_100495741
1399 Ga0070683_100832067
1400 Ga0070683_100899954
1401 Ga0070690_100052450
1402 Ga0070690_100056424
1403 Ga0070690_100167796
1404 Ga0070690_100399974
1405 Ga0070670_100000833
1406 Ga0070670_100003742
1407 Ga0070670_100136296
1408 Ga0070670_100620275
1409 Ga0070670_100869512
1410 Ga0070677_10137184
1411 Ga0070677_10383944
1412 Ga0068869_100113989
1413 Ga0068869_100720816
1414 Ga0068869_100930508
1415 Ga0070666_10001876
1416 Ga0070666_10002056
1417 Ga0070666_10097738
1418 Ga0070666_10121884
1419 Ga0070666_10760310
1420 Ga0070680_100100517
1421 Ga0070680_100348965
1422 Ga0070680_100488806
1423 Ga0070682_100426049
1424 Ga0068868_100031366
1425 Ga0068868_100096533
1426 Ga0068868_100199105
1427 Ga0068868_100697156
1428 Ga0068868_102359363
1429 Ga0070660_100023190
1430 Ga0070660_100378975
1431 Ga0070660_100647314
1432 Ga0070689_100021098
1433 Ga0070689_100064515
1434 Ga0070689_100100534
1435 Ga0070689_100145272
1436 Ga0070689_100273588
1437 Ga0070689_100842260
1438 Ga0070687_100000382
1439 Ga0070687_100114661
1440 Ga0070661_100062340
1441 Ga0070661_100292077
1442 Ga0070661_100393326
1443 Ga0070661_100838629
1444 Ga0070692_10001104
1445 Ga0070692_10107559
1446 Ga0070668_100000403
1447 Ga0070668_100050196
1448 Ga0070668_100050229
1449 Ga0070668_100056885
1450 Ga0070668_100056962
1451 Ga0070668_100069825
1452 Ga0070668_100135575
1453 Ga0070668_100258296
1454 Ga0070669_100002011
1455 Ga0070669_100006097
1456 Ga0070669_100125169
1457 Ga0070669_100300055
1458 Ga0070669_100483782
1459 Ga0070669_100852327
1460 Ga0070675_100004678
1461 Ga0070675_100048534
1462 Ga0070675_100083047
1463 Ga0070675_100129528
1464 Ga0070675_100135890
1465 Ga0070675_100158863
1466 Ga0070675_100200776
1467 Ga0070675_100295769
1468 Ga0070675_100429872
1469 Ga0070675_100755041
1470 Ga0070671_100000283
1471 Ga0070671_100011134
1472 Ga0070671_100042031
1473 Ga0070671_100047998
1474 Ga0070671_100054306
1475 Ga0070671_100187898
1476 Ga0070671_100286550
1477 Ga0070671_100333656
1478 Ga0070671_100614611
1479 Ga0070671_100623853
1480 Ga0070671_100853150
1481 Ga0070674_100007500
1482 Ga0070674_100064027
1483 Ga0070674_100222619
1484 Ga0070674_100376888
1485 Ga0070673_100008141
1486 Ga0070673_100014325
1487 Ga0070673_100075213
1488 Ga0070673_100163504
1489 Ga0070673_100283494
1490 Ga0070673_100476403
1491 Ga0070688_100000733
1492 Ga0070688_100001414
1493 Ga0070688_100016452
1494 Ga0070688_100054122
1495 Ga0070688_100102629
1496 Ga0070659_100001154
1497 Ga0070659_100002483
1498 Ga0070659_100117793
1499 Ga0070659_100340292
1500 Ga0070659_100981448
1501 Ga0070659_101608257
1502 Ga0070667_100004665
1503 Ga0070667_100010004
1504 Ga0070667_100320999
1505 Ga0070667_100509990
1506 Ga0070667_100821221
1507 Ga0070667_101061349
1508 Ga0070667_101517174
1509 Ga0070709_10176197
1510 Ga0070709_10246697
1511 Ga0070709_11624732
1512 Ga0070714_100207992
1513 Ga0070714_100286340
1514 Ga0070714_101115819
1515 Ga0070714_102135992
1516 Ga0070714_102328832
1517 Ga0070713_100019600
1518 Ga0070713_100040250
1519 Ga0070713_100048466
1520 Ga0070713_100182167
1521 Ga0070713_100214091
1522 Ga0070713_101066359
1523 Ga0070713_102475417
1524 Ga0070710_10048829
1525 Ga0070710_10132576
1526 Ga0070710_10214317
1527 Ga0070710_10419844
1528 Ga0070710_11209518
1529 Ga0070701_10317022
1530 Ga0070711_100006116
1531 Ga0070711_100078511
1532 Ga0070711_100112752
1533 Ga0070711_100448438
1534 Ga0070711_100619508
1535 Ga0070711_101027982
1536 Ga0070705_100075673
1537 Ga0070705_100204996
1538 Ga0070705_100232819
1539 Ga0070705_101023435
1540 Ga0070705_101065448
1541 Ga0070700_100003660
1542 Ga0070700_101249815
1543 Ga0070694_100004904
1544 Ga0070694_100087162
1545 Ga0070694_100746208
1546 Ga0070694_100750996
1547 Ga0070708_100003581
1548 Ga0070708_100036156
1549 Ga0070708_100050882
1550 Ga0070708_100053105
1551 Ga0070708_100054749
1552 Ga0070708_100057410
1553 Ga0070708_100136047
1554 Ga0070708_100141727
1555 Ga0070708_100156410
1556 Ga0070708_100261350
1557 Ga0070708_100442592
1558 Ga0070708_100566950
1559 Ga0070708_101041682
1560 Ga0070708_101158650
1561 Ga0070708_102076977
1562 Ga0070663_100100368
1563 Ga0070663_100656577
1564 Ga0070678_100001511
1565 Ga0070678_100094691
1566 Ga0070678_100236091
1567 Ga0070678_100506587
1568 Ga0070678_100806887
1569 Ga0070678_101910917
1570 Ga0070662_100004281
1571 Ga0070662_100016152
1572 Ga0070662_100091226
1573 Ga0070662_100133833
1574 Ga0070662_101404111
1575 Ga0070681_10052300
1576 Ga0068867_100044767
1577 Ga0068867_100386194
1578 Ga0070685_10106425
1579 Ga0070685_10140714
1580 Ga0070685_10208732
1581 Ga0070685_10358273
1582 Ga0070685_10367787
1583 Ga0070685_10838743
1584 Ga0070706_100006577
1585 Ga0070706_100020444
1586 Ga0070706_100020521
1587 Ga0070706_100025982
1588 Ga0070706_100137442
1589 Ga0070706_100145108
1590 Ga0070706_100302668
1591 Ga0070706_100519386
1592 Ga0070706_100676488
1593 Ga0070706_102009540
1594 Ga0070707_100000292
1595 Ga0070707_100003721
1596 Ga0070707_100016188
1597 Ga0070707_100030502
1598 Ga0070707_100032046
1599 Ga0070707_100039193
1600 Ga0070707_100063474
1601 Ga0070707_100072311
1602 Ga0070707_100081504
1603 Ga0070707_100193267
1604 Ga0070707_100320831
1605 Ga0070707_100338980
1606 Ga0070707_100342021
1607 Ga0070707_100362651
1608 Ga0070707_100453112
1609 Ga0070707_100832304
1610 Ga0070707_100956168
1611 Ga0070707_101713715
1612 Ga0070698_100001836
1613 Ga0070698_100007384
1614 Ga0070698_100022395
1615 Ga0070698_100032196
1616 Ga0070698_100329532
1617 Ga0070698_100354407
1618 Ga0070698_100661926
1619 Ga0070698_100786651
1620 Ga0070698_101504696
1621 Ga0070699_100027581
1622 Ga0070699_100036501
1623 Ga0070699_100058834
1624 Ga0070699_100176052
1625 Ga0070699_100222626
1626 Ga0070699_100509403
1627 Ga0070699_100732863
1628 Ga0070699_100739219
1629 Ga0070699_100773376
1630 Ga0070699_100870976
1631 Ga0070679_100054949
1632 Ga0070679_100649064
1633 Ga0070684_100001312
1634 Ga0070684_100029216
1635 Ga0070684_100302970
1636 Ga0070697_100000826
1637 Ga0070697_100002201
1638 Ga0070697_100002768
1639 Ga0070697_100003773
1640 Ga0070697_100005694
1641 Ga0070697_100045125
1642 Ga0070697_100057785
1643 Ga0070697_100121642
1644 Ga0070697_100124376
1645 Ga0070697_100141887
1646 Ga0070697_100214500
1647 Ga0070697_100449182
1648 Ga0070697_100500503
1649 Ga0070697_100558094
1650 Ga0070697_100596480
1651 Ga0070697_100776024
1652 Ga0068853_100107206
1653 Ga0070672_100000353
1654 Ga0070672_100004247
1655 Ga0070672_100041736
1656 Ga0070672_100136749
1657 Ga0070672_100209084
1658 Ga0070672_100958515
1659 Ga0070672_101246723
1660 Ga0070672_101436047
1661 Ga0070686_100054207
1662 Ga0070686_100126507
1663 Ga0070695_100017240
1664 Ga0070695_100073003
1665 Ga0070695_100271901
1666 Ga0070696_100012751
1667 Ga0070696_100494645
1668 Ga0070696_101568040
1669 Ga0070693_100229378
1670 Ga0070693_100415757
1671 Ga0070693_100709430
1672 Ga0070665_100008787
1673 Ga0070665_100070912
1674 Ga0070665_100114878
1675 Ga0070665_100200931
1676 Ga0070665_100234438
1677 Ga0070665_100496622
1678 Ga0070665_100965700
1679 Ga0070665_101232371
1680 Ga0070704_100029184
1681 Ga0070704_100082187
1682 Ga0070704_100273457
1683 Ga0070704_100919742
1684 Ga0068855_100308936
1685 Ga0070664_100125926
1686 Ga0070664_100182011
1687 Ga0070664_100248105
1688 Ga0070664_100301215
1689 Ga0070664_100454291
1690 Ga0068854_100608047
1691 Ga0068856_100017528
1692 Ga0068856_100456081
1693 Ga0068856_100982990
1694 Ga0070702_100018870
1695 Ga0070702_100196422
1696 Ga0070702_100671110
1697 Ga0068852_100345260
1698 Ga0068859_100077354
1699 Ga0068859_100117580
1700 Ga0068859_100586714
1701 Ga0068859_100756896
1702 Ga0068864_100285604
1703 Ga0068864_100287593
1704 Ga0068864_100347280
1705 Ga0068864_100388810
1706 Ga0068864_100919300
1707 Ga0068864_102000274
1708 Ga0068866_10177069
1709 Ga0068866_10892409
1710 Ga0068866_10906136
1711 Ga0068861_100107874
1712 Ga0068861_100158124
1713 Ga0068861_100177914
1714 Ga0068863_100007967
1715 Ga0068863_100383370
1716 Ga0068863_100590505
1717 Ga0068863_100940299
1718 Ga0068858_100052055
1719 Ga0068858_100142777
1720 Ga0068858_100224419
1721 Ga0068858_100401480
1722 Ga0068858_102243340
1723 Ga0068858_102281690
1724 Ga0068860_100010603
1725 Ga0068860_100066467
1726 Ga0068860_100108998
1727 Ga0068860_100762370
1728 Ga0068862_100003143
1729 Ga0068862_100041432
1730 Ga0068862_101002808
1731 Ga0081455_10001399
1732 Ga0081455_10021886
1733 Ga0081455_10031292
1734 Ga0081455_10031464
1735 Ga0081455_10284179
1736 Ga0081455_10288089
1737 Ga0081455_10344702
1738 Ga0081455_10648182
1739 Ga0081538_10100476
1740 Ga0081540_1000036
1741 Ga0081540_1025675
1742 Ga0081540_1065432
1743 Ga0081539_10000014
1744 Ga0081539_10001730
1745 Ga0081539_10022038
1746 Ga0081539_10030228
1747 Ga0081539_10059040
1748 Ga0081539_10113538
1749 Ga0070717_10016944
1750 Ga0070717_10027717
1751 Ga0070717_10028090
1752 Ga0070717_10037326
1753 Ga0070717_10037361
1754 Ga0070717_10410936
1755 Ga0070717_10488751
1756 Ga0070717_10992822
1757 Ga0070715_10015930
1758 Ga0070715_10059680
1759 Ga0070715_10399498
1760 Ga0070715_10401984
1761 Ga0070716_100011207
1762 Ga0070716_100199559
1763 Ga0070716_100205703
1764 Ga0070716_100304877
1765 Ga0070716_100369139
1766 Ga0070716_100649827
1767 Ga0070716_100774044
1768 Ga0070712_100023808
1769 Ga0070712_100046609
1770 Ga0070712_100049660
1771 Ga0070712_100052822
1772 Ga0070712_100093977
1773 Ga0070712_100271568
1774 Ga0070712_100357662
1775 Ga0070712_100388371
1776 Ga0070712_100401676
1777 Ga0070712_100657490
1778 Ga0070712_100932690
1779 Ga0070712_101220012
1780 Ga0070712_101321383
1781 Ga0070712_101431055
1782 Ga0097621_100014055
1783 Ga0097621_100018403
1784 Ga0097621_100024099
1785 Ga0097621_100991687
1786 Ga0068871_100084135
1787 Ga0068871_100336065
1788 Ga0068871_100727499
1789 Ga0068871_100955037
1790 Ga0075428_100093456
1791 Ga0075428_100095839
1792 Ga0075428_100416748
1793 Ga0075430_100277403
1794 Ga0075433_10196766
1795 Ga0075433_10674838
1796 Ga0075433_10827267
1797 Ga0075433_11004728
1798 Ga0075433_11475672
1799 Ga0075434_100014841
1800 Ga0075434_100147155
1801 Ga0075434_100200364
1802 Ga0075434_100540910
1803 Ga0075434_100657972
1804 Ga0075434_101028397
1805 Ga0075434_101466271
1806 Ga0068865_100017414
1807 Ga0068865_100105971
1808 Ga0068865_100149571
1809 Ga0068865_100214443
1810 Ga0068865_100831403
1811 Ga0075436_100032597
1812 Ga0075436_100370089
1813 Ga0075436_100413342
1814 Ga0075436_100922148
1815 Ga0097620_100077352
1816 Ga0097620_100117582
1817 Ga0097620_100586684
1818 Ga0097620_100756876
1819 Ga0075435_100541635
1820 Ga0075435_100651782
1821 Ga0075435_101100459
1822 Ga0099794_10020565
1823 Ga0099794_10179950
1824 Ga0099794_10470990
1825 Ga0099794_10711006
1826 Ga0099795_10341386
1827 Ga0099795_10474030
1828 Ga0105240_11673074
1829 Ga0111539_10524306
1830 Ga0111539_11803835
1831 Ga0111539_12134840
1832 Ga0111539_12893719
1833 Ga0105245_10006614
1834 Ga0105245_10030852
1835 Ga0105245_10214619
1836 Ga0105245_11624256
1837 Ga0105247_10084384
1838 Ga0105247_10731540
1839 Ga0105247_11036774
1840 Ga0114129_10001417
1841 Ga0114129_10003445
1842 Ga0114129_10032401
1843 Ga0114129_10241662
1844 Ga0114129_12192928
1845 Ga0105243_10033332
1846 Ga0105243_10331810
1847 Ga0105243_10648599
1848 Ga0105241_10713440
1849 Ga0105242_10043482
1850 Ga0105242_10167170
1851 Ga0105242_10276372
1852 Ga0105242_10875677
1853 Ga0105242_10939690
1854 Ga0105248_10321465
1855 Ga0105237_10134456
1856 Ga0105237_10225438
1857 Ga0105238_11121242
1858 Ga0105249_10007788
1859 Ga0105249_10011097
1860 Ga0105249_10431190
1861 Ga0105249_11334773
1862 Ga0099796_10005301
1863 Ga0099796_10011175
1864 Ga0099796_10103366
1865 Ga0105239_10070002
1866 Ga0105239_10100267
1867 Ga0105239_10139759
1868 Ga0105239_12151893
1869 Ga0105246_10182706
1870 Ga0105246_10383239
1871 Ga0105246_12137735
1872 Ga0157313_1005513
1873 Ga0157315_1056796
1874 Ga0157327_1046819
1875 Ga0157373_10116401
1876 Ga0157373_11545504
1877 Ga0157371_10058341
1878 Ga0157371_10323452
1879 Ga0157370_11019409
1880 Ga0157369_10182471
1881 Ga0157374_10001473
1882 Ga0157374_10005577
1883 Ga0157374_10019745
1884 Ga0157374_10033688
1885 Ga0157374_10055882
1886 Ga0157374_10120813
1887 Ga0157374_10317951
1888 Ga0157374_10431232
1889 Ga0157374_10574067
1890 Ga0157374_10996360
1891 Ga0157374_11038725
1892 Ga0157374_11350962
1893 Ga0157374_12134377
1894 Ga0157378_10005509
1895 Ga0157378_10026553
1896 Ga0157378_10043528
1897 Ga0157378_10048884
1898 Ga0157378_10058061
1899 Ga0157378_10174062
1900 Ga0157378_10191930
1901 Ga0157378_10246614
1902 Ga0157378_10326750
1903 Ga0157378_10384057
1904 Ga0157378_10409772
1905 Ga0157378_10451731
1906 Ga0157378_10529437
1907 Ga0157378_10705913
1908 Ga0157378_10799313
1909 Ga0157378_11522416
1910 Ga0157378_11702122
1911 Ga0157378_12767619
1912 Ga0163162_10003249
1913 Ga0163162_10014121
1914 Ga0163162_10017445
1915 Ga0163162_10023520
1916 Ga0163162_10034354
1917 Ga0163162_10042501
1918 Ga0163162_10086566
1919 Ga0163162_10203836
1920 Ga0163162_10224090
1921 Ga0163162_10782207
1922 Ga0157372_10037163
1923 Ga0157372_10040369
1924 Ga0157372_10167743
1925 Ga0157372_10260634
1926 Ga0157372_10837918
1927 Ga0157372_11596687
1928 Ga0157375_10000287
1929 Ga0157375_10001868
1930 Ga0157375_10007782
1931 Ga0157375_10044228
1932 Ga0157375_10082239
1933 Ga0157375_10159468
1934 Ga0157375_10368137
1935 Ga0157375_10511654
1936 Ga0157375_12062506
1937 Ga0163163_10294276
1938 Ga0163163_10297508
1939 Ga0163163_10307094
1940 Ga0163163_11108141
1941 Ga0163163_11115034
1942 Ga0182008_10063220
1943 Ga0182008_10421309
1944 Ga0157377_10013826
1945 Ga0157377_10110643
1946 Ga0157377_10369438
1947 Ga0157377_10400617
1948 Ga0157379_10005647
1949 Ga0157379_10083913
1950 Ga0157379_10421858
1951 Ga0157379_10432610
1952 Ga0157379_11264189
1953 Ga0157376_10009509
1954 Ga0157376_10149842
1955 Ga0157376_10154833
1956 Ga0157376_10164048
1957 Ga0157376_10180657
1958 Ga0157376_10349606
1959 Ga0157376_10404419
1960 Ga0157376_11853928
1961 Ga0157376_12268419
1962 Ga0163161_10046543
1963 Ga0163161_10177049
1964 Ga0163161_10302024
1965 Ga0163161_10457796
1966 Ga0163161_11290942
1967 Ga0213874_10318189
1968 Ga0213876_10006558
1969 Ga0207666_1000898
1970 Ga0207666_1002318
1971 Ga0207666_1019393
1972 Ga0207673_1000900
1973 Ga0207673_1002318
1974 Ga0207673_1008168
1975 Ga0207673_1016725
1976 Ga0207673_1032820
1977 Ga0207697_10000010
1978 Ga0207697_10000131
1979 Ga0207697_10000495
1980 Ga0207697_10002230
1981 Ga0207697_10002322
1982 Ga0207697_10013157
1983 Ga0207697_10022681
1984 Ga0207697_10260276
1985 Ga0207653_10039724
1986 Ga0207653_10050379
1987 Ga0207692_10073082
1988 Ga0207692_10167630
1989 Ga0207692_10402536
1990 Ga0207642_10079022
1991 Ga0207642_10140377
1992 Ga0207642_10190964
1993 Ga0207642_10235101
1994 Ga0207642_10813163
1995 Ga0207710_10089084
1996 Ga0207688_10001208
1997 Ga0207688_10014566
1998 Ga0207688_10076002
1999 Ga0207688_10154580
2000 Ga0207688_10214307
2001 Ga0207680_10003944
2002 Ga0207680_10025390
2003 Ga0207680_10032106
2004 Ga0207680_10113689
2005 Ga0207680_10157831
2006 Ga0207647_10122822
2007 Ga0207647_10573618
2008 Ga0207685_10003968
2009 Ga0207685_10023055
2010 Ga0207699_10008911
2011 Ga0207699_10020861
2012 Ga0207699_10205598
2013 Ga0207699_10245878
2014 Ga0207699_10354681
2015 Ga0207645_10001786
2016 Ga0207645_10002762
2017 Ga0207645_10004253
2018 Ga0207645_10004432
2019 Ga0207645_10125827
2020 Ga0207645_10241866
2021 Ga0207645_10474049
2022 Ga0207705_10629080
2023 Ga0207705_10657783
2024 Ga0207705_11370015
2025 Ga0207684_10000028
2026 Ga0207684_10003766
2027 Ga0207684_10008671
2028 Ga0207684_10011143
2029 Ga0207684_10019695
2030 Ga0207684_10030870
2031 Ga0207684_10059810
2032 Ga0207684_10072862
2033 Ga0207684_10074641
2034 Ga0207684_10248195
2035 Ga0207684_10504496
2036 Ga0207684_10507609
2037 Ga0207684_10514905
2038 Ga0207654_10853293
2039 Ga0207654_11011087
2040 Ga0207707_10035549
2041 Ga0207671_10132187
2042 Ga0207671_10203874
2043 Ga0207693_10000889
2044 Ga0207693_10006942
2045 Ga0207693_10021211
2046 Ga0207693_10035010
2047 Ga0207693_10157817
2048 Ga0207693_10167995
2049 Ga0207693_10323521
2050 Ga0207693_10339935
2051 Ga0207693_10459107
2052 Ga0207693_10463811
2053 Ga0207693_10537288
2054 Ga0207693_10665350
2055 Ga0207693_10972828
2056 Ga0207693_11034901
2057 Ga0207663_10002290
2058 Ga0207663_10071768
2059 Ga0207663_10129162
2060 Ga0207663_10742089
2061 Ga0207663_10923940
2062 Ga0207663_11460993
2063 Ga0207660_10087575
2064 Ga0207660_10605332
2065 Ga0207662_10000699
2066 Ga0207662_10163389
2067 Ga0207662_10629477
2068 Ga0207657_10073181
2069 Ga0207657_10152237
2070 Ga0207657_10347033
2071 Ga0207657_10508684
2072 Ga0207649_10201065
2073 Ga0207649_10757870
2074 Ga0207649_11133067
2075 Ga0207652_10250204
2076 Ga0207652_11358490
2077 Ga0207646_10000191
2078 Ga0207646_10001393
2079 Ga0207646_10005640
2080 Ga0207646_10005692
2081 Ga0207646_10009621
2082 Ga0207646_10010143
2083 Ga0207646_10028198
2084 Ga0207646_10065346
2085 Ga0207646_10068226
2086 Ga0207646_10073074
2087 Ga0207646_10295729
2088 Ga0207646_10346952
2089 Ga0207646_10482144
2090 Ga0207646_10507633
2091 Ga0207646_10840249
2092 Ga0207646_10849897
2093 Ga0207681_10004055
2094 Ga0207681_10069483
2095 Ga0207681_10363047
2096 Ga0207681_10437614
2097 Ga0207650_10006836
2098 Ga0207650_10007428
2099 Ga0207650_10018287
2100 Ga0207650_10140098
2101 Ga0207650_10152097
2102 Ga0207650_11259579
2103 Ga0207659_10003512
2104 Ga0207659_10045484
2105 Ga0207659_10049761
2106 Ga0207659_10054917
2107 Ga0207659_10266888
2108 Ga0207659_10843472
2109 Ga0207659_11810958
2110 Ga0207687_10109907
2111 Ga0207687_10414708
2112 Ga0207700_10022621
2113 Ga0207700_10087236
2114 Ga0207700_10145225
2115 Ga0207700_10209424
2116 Ga0207700_10532870
2117 Ga0207700_10557764
2118 Ga0207664_10120019
2119 Ga0207664_10172266
2120 Ga0207664_10207690
2121 Ga0207664_10263641
2122 Ga0207664_11315927
2123 Ga0207644_10029826
2124 Ga0207644_10035251
2125 Ga0207644_10049869
2126 Ga0207644_10092545
2127 Ga0207644_10101578
2128 Ga0207644_10112816
2129 Ga0207644_10166997
2130 Ga0207644_10187708
2131 Ga0207644_10221395
2132 Ga0207644_10515266
2133 Ga0207644_10653564
2134 Ga0207644_10783165
2135 Ga0207644_10813221
2136 Ga0207644_11332041
2137 Ga0207690_10001098
2138 Ga0207690_10191132
2139 Ga0207690_10396035
2140 Ga0207706_10008197
2141 Ga0207706_10027339
2142 Ga0207706_10070025
2143 Ga0207706_10127775
2144 Ga0207706_10287059
2145 Ga0207706_10456723
2146 Ga0207706_10588936
2147 Ga0207706_10660496
2148 Ga0207686_10913136
2149 Ga0207709_10368837
2150 Ga0207670_10009200
2151 Ga0207670_10104247
2152 Ga0207670_10131649
2153 Ga0207670_10343447
2154 Ga0207670_10348962
2155 Ga0207670_10507031
2156 Ga0207670_10706085
2157 Ga0207669_10002532
2158 Ga0207669_10011026
2159 Ga0207669_10213532
2160 Ga0207669_10585160
2161 Ga0207669_10698358
2162 Ga0207669_10811855
2163 Ga0207669_11063791
2164 Ga0207704_10122214
2165 Ga0207704_10133056
2166 Ga0207704_10183501
2167 Ga0207704_10318899
2168 Ga0207704_10331575
2169 Ga0207704_11241883
2170 Ga0207704_11945061
2171 Ga0207665_10025655
2172 Ga0207665_10048049
2173 Ga0207665_10075192
2174 Ga0207665_10089858
2175 Ga0207665_10136465
2176 Ga0207665_10194109
2177 Ga0207665_10215560
2178 Ga0207665_10263985
2179 Ga0207691_10000142
2180 Ga0207691_10000247
2181 Ga0207691_10002644
2182 Ga0207691_10016028
2183 Ga0207691_10037047
2184 Ga0207691_10253085
2185 Ga0207691_10512972
2186 Ga0207691_10775711
2187 Ga0207711_10549769
2188 Ga0207689_10009503
2189 Ga0207689_10086541
2190 Ga0207689_10468828
2191 Ga0207689_10920703
2192 Ga0207661_10031201
2193 Ga0207661_10077884
2194 Ga0207661_10124065
2195 Ga0207661_10653381
2196 Ga0207661_10803283
2197 Ga0207679_10185257
2198 Ga0207679_10282029
2199 Ga0207679_11569338
2200 Ga0207667_11021945
2201 Ga0207651_10007253
2202 Ga0207651_10027669
2203 Ga0207651_10083018
2204 Ga0207651_10197170
2205 Ga0207651_10235820
2206 Ga0207651_10245165
2207 Ga0207651_10845199
2208 Ga0207651_11832245
2209 Ga0207712_10010310
2210 Ga0207712_10328930
2211 Ga0207712_10542551
2212 Ga0207668_10009836
2213 Ga0207668_10026495
2214 Ga0207668_10052709
2215 Ga0207668_11025480
2216 Ga0207668_11310109
2217 Ga0207640_10886173
2218 Ga0207640_11451827
2219 Ga0207658_10010242
2220 Ga0207658_10014736
2221 Ga0207658_10046961
2222 Ga0207658_10338757
2223 Ga0207658_10483665
2224 Ga0207658_10708972
2225 Ga0207658_10831112
2226 Ga0207658_10889835
2227 Ga0207658_12175480
2228 Ga0207677_10008042
2229 Ga0207677_10020703
2230 Ga0207677_10109071
2231 Ga0207677_10188958
2232 Ga0207677_10650977
2233 Ga0207677_10811172
2234 Ga0207703_10003624
2235 Ga0207703_10142997
2236 Ga0207703_10309352
2237 Ga0207703_10531807
2238 Ga0207703_10584444
2239 Ga0207703_10701560
2240 Ga0207703_10989909
2241 Ga0207639_10200729
2242 Ga0207678_10020455
2243 Ga0207678_10138642
2244 Ga0207678_10246654
2245 Ga0207708_10538280
2246 Ga0207702_10038562
2247 Ga0207702_11698650
2248 Ga0207702_11966261
2249 Ga0207641_10022387
2250 Ga0207641_10436029
2251 Ga0207648_10149163
2252 Ga0207648_10179022
2253 Ga0207648_10727172
2254 Ga0207676_10474000
2255 Ga0207676_10525676
2256 Ga0207676_11029435
2257 Ga0207676_11180751
2258 Ga0207676_11311066
2259 Ga0207675_100094187
2260 Ga0207675_100119142
2261 Ga0207675_100165775
2262 Ga0207683_10006977
2263 Ga0207683_10008842
2264 Ga0207683_10009866
2265 Ga0207683_10015583
2266 Ga0207683_10872708
2267 Ga0207683_11529710
2268 Ga0207683_11711425
2269 Ga0207698_10525239
2270 Ga0209969_1030523
2271 Ga0209967_1044749
2272 Ga0209981_1058211
2273 Ga0209984_1004426
2274 Ga0209984_1037284
2275 Ga0209999_1004693
2276 Ga0209982_1046842
2277 Ga0209970_1005891
2278 Ga0209983_1000280
2279 Ga0209588_1112866
2280 Ga0209588_1142593
2281 Ga0209588_1214259
2282 Ga0209971_1000384
2283 Ga0209971_1164380
2284 Ga0209998_10026839
2285 Ga0209974_10004420
2286 Ga0209974_10023640
2287 Ga0209974_10073397
2288 Ga0207428_10252411
2289 Ga0207428_10551247
2290 Ga0268266_10004179
2291 Ga0268266_10026994
2292 Ga0268266_10076422
2293 Ga0268266_10141029
2294 Ga0268266_10219749
2295 Ga0268266_10371687
2296 Ga0268266_10395721
2297 Ga0268266_11176992
2298 Ga0268265_10044999
2299 Ga0268265_10368503
2300 Ga0268264_10001807
2301 Ga0268264_10029276
2302 Ga0268264_10149965
2303 Ga0268264_10178518
2304 Ga0268264_10521444
2305 Ga0307513_10023335
2306 Ga0307414_10460102
2307 Ga0373930_0160298
2308 Ga0373948_0190428
2309 Ga0373959_0161854
2310 Ga0373926_0025205
2311 Ga0373926_0070283
2312 Ga0373926_0077902
2313 Ga0373940_0150688
2314 Ga0373944_0061394
2315 Ga0373944_0215748
2316 Ga0373944_0253299
2317 Ga0373951_0035882
2318 Ga0373923_0090520
2319 Ga0373932_0207585
2320 Ga0373936_0311305
2321 Ga0373936_0412525
2322 Ga0373936_0487609
2323 Ga0373939_0103156
2324 Ga0373941_0205467
2325 Ga0373945_0005962
2326 Ga0373954_0021155
2327 Ga0373956_0326539
2328 Ga0373960_0090100
2329 Ga0373943_0005531
2330 Ga0373943_0057911
2331 Ga0373943_0080926
2332 Ga0373943_0235000
2333 Ga0373943_0283262
2334 Ga0373946_0045201
2335 Ga0373946_0071572
2336 Ga0373955_0619939
2337 Ga0373955_0638582
2338 Ga0373942_0339145
2339 Ga0373961_0244091
2340 Ga0373931_0108890
2341 Ga0373931_0130279
2342 Ga0373931_0149850
2343 Ga0373931_0234351
2344 Ga0373935_0031757
2345 Ga0373935_0302849
2346 Ga0373935_0314802
2347 Ga0373935_0450838
2348 Ga0373927_0031651
2349 Ga0373927_0123175
2350 Ga0373927_0176977
2351 Ga0373927_0297200
2352 Ga0373933_0052084
2353 Ga0373947_0036106
2354 Ga0373947_0054112
2355 Ga0373947_0069919
2356 Ga0373947_0099277
2357 Ga0373947_0517462
2358 Ga0373947_1093627
2359 Ga0373937_0065643
2360 Ga0373937_0114836
2361 Ga0373937_0124137
2362 Ga0373937_0201678
2363 Ga0373937_0397543
2364 Ga0373925_0006124
2365 Ga0373925_0014401
2366 Ga0373925_0040917
2367 Ga0373925_0460076
2368 Ga0373925_0603063
2369 Ga0373925_0910866
2370 Ga0373925_1412547
2371 Ga0395899_0081216
2372 Ga0395899_0549618
2373 Ga0395899_0845785
2374 Ga0395900_0002526
2375 Ga0395900_0008031
2376 Ga0395900_0232346
2377 Ga0395900_1933523
2378 Ga0395898_0002044
2379 Ga0395898_0041866
2380 Ga0395898_0405534
2381 Ga0395898_0580639
2382 Ga0395898_0913905
2383 Ga0395905_0045531
2384 Ga0395905_0389610
2385 Ga0395905_0416146
2386 Ga0395905_0703597
2387 Ga0436364_0440977
2388 Ga0436364_1193811
2389 Ga0395901_0002964
2390 Ga0395901_0039538
2391 Ga0395901_0083535
2392 Ga0395901_0280015
2393 Ga0395901_0703660
2394 Ga0436365_0026349
2395 Ga0436365_1454817
2396 Ga0436360_1356494
2397 Ga0436363_0428075
2398 Ga0436362_0051725
2399 Ga0451795_0218717
2400 Ga0451795_1070674
2401 Ga0451795_1097033
2402 Ga0451798_0051088
2403 Ga0451800_0294886
2404 Ga0451802_1916692
2405 Ga0451807_0465582
2406 Ga0451807_2171196
2407 Ga0451837_0657191
2408 Ga0451839_0785113
2409 Ga0451855_0504270
2410 Ga0451855_1662967
2411 Ga0451853_0537436
2412 Ga0451853_0644242
2413 Ga0439448_0066736
2414 Ga0439448_0090520
2415 Ga0439451_017252
2416 Ga0439464_0019868
2417 Ga0439464_0127029
2418 Ga0439460_0120465
2419 Ga0451577_0003056
2420 Ga0453683_0012218
2421 Ga0453684_0033176
2422 Ga0453684_0818663
2423 Ga0453684_1160797
2424 Ga0451576_0000055
2425 Ga0451576_0032997
2426 Ga0451576_0230708
2427 Ga0451576_0271845
2428 Ga0451576_0289458
2429 Ga0451576_0359913
2430 Ga0466967_0032556
2431 Ga0466967_0230794
2432 Ga0495592_0013560
2433 Ga0495603_0055534
2434 Ga0495629_0008333
2435 Ga0495629_0286104
2436 Ga0495641_0080416
2437 Ga0495651_0232273
2438 Ga0495653_0463193
2439 Ga0495653_0692492
2440 Ga0495580_0064954
2441 Ga0495580_0107757
2442 Ga0495580_0165118
2443 Ga0495580_0186167
2444 Ga0495580_0319707
2445 Ga0495582_0177182
2446 Ga0495605_0241838
2447 Ga0495605_0492088
2448 Ga0495662_0069387
2449 Ga0495664_0197075
2450 Ga0495664_0202283
2451 Ga0495584_0022505
2452 Ga0495584_0532480
2453 Ga0495585_0274372
2454 Ga0495607_0294471
2455 Ga0495608_0655926
2456 Ga0495628_0040395
2457 Ga0495628_0208490
2458 Ga0495628_0528697
2459 Ga0495630_0017678
2460 Ga0495630_0041206
2461 Ga0495630_0228479
2462 Ga0495630_0465867
2463 Ga0495631_0478114
2464 Ga0495637_0089666
2465 Ga0495644_0227498
2466 Ga0495644_0449758
2467 Ga0495666_0100205
2468 Ga0495642_0022869
2469 Ga0495642_0222200
2470 Ga0495652_0045601
2471 Ga0495652_1020926
2472 Ga0495665_0043688
2473 Ga0495640_0432390
2474 Ga0495586_0014140
2475 Ga0495587_0009500
2476 Ga0495598_0000901
2477 Ga0495598_0027087
2478 Ga0495598_0048134
2479 Ga0495598_0095720
2480 Ga0495621_0309943
2481 Ga0495597_0185047
2482 Ga0495645_0001076
2483 Ga0495633_0154083
2484 Ga0495667_0561934
2485 Ga0495656_0268106
2486 Ga0495635_0281409
2487 Ga0495635_0394740
2488 Ga0495659_0087755
2489 Ga0495659_0121259
2490 Ga0495659_0129759
2491 Ga0495659_0247028
2492 Ga0495661_0227291
2493 Ga0495588_0066650
2494 Ga0495588_0148087
2495 Ga0495657_0218503
2496 Ga0495657_0357846
2497 Ga0495599_0000317
2498 Ga0495623_0000811
2499 Ga0495646_0002940
2500 Ga0495647_0028223
2501 Ga0495647_0058248
2502 Ga0495658_0129662
2503 Ga0495658_0141734
2504 Ga0495669_0009247
2505 Ga0495669_0142072
2506 Ga0495669_0385127
2507 Ga0495613_0124871
2508 Ga0495613_0213064
2509 Ga0495670_0321637
2510 Ga0495600_0196305
2511 Ga0495581_0123308
2512 Ga0495604_0053697
2513 Ga0495604_0233324
2514 Ga0495604_0276899
2515 Ga0495604_0869028
2516 Ga0495636_0128954
2517 Ga0495636_0136190
2518 Ga0495674_0047362
2519 Ga0495674_1186421
2520 Ga0495675_0002584
2521 Ga0495675_0010133
2522 Ga0495679_072938
2523 Ga0495681_0155566
2524 Ga0495684_0063571
2525 Ga0495684_0441974
2526 Ga0495593_0125575
2527 Ga0495602_0017278
2528 Ga0495602_0319298
2529 Ga0495614_0256744
2530 Ga0495626_0436823
2531 Ga0496100_0021201
2532 Ga0496100_0156080
2533 Ga0496101_0031362
2534 Ga0496101_0033960
2535 Ga0496101_0108830
2536 Ga0496101_0332739
2537 Ga0496101_0436945
2538 Ga0496101_1349063
2539 Ga0496102_0009851
2540 Ga0496102_0028763
2541 Ga0496102_0035336
2542 Ga0496102_0367403
2543 Ga0496102_1084114
2544 Ga0496102_1138239
2545 Ga0496103_0011535
2546 Ga0496103_0019686
2547 Ga0496103_0191846
2548 Ga0496104_0012446
2549 Ga0496104_0072184
2550 Ga0496104_0077845
2551 Ga0496104_0159226
2552 Ga0496104_0367572
2553 Ga0496104_0403967
2554 Ga0496104_0500938
2555 Ga0496104_1370905
2556 Ga0496105_0044348
2557 Ga0496105_0162019
2558 Ga0496105_0168019
2559 Ga0496105_0209619
2560 Ga0496105_0334842
2561 Ga0496106_0002174
2562 Ga0496106_0023076
2563 Ga0496106_0083615
2564 Ga0496106_0281934
2565 Ga0496106_0386891
2566 Ga0496106_0695051
2567 Ga0496106_0954534
2568 Ga0496107_0018540
2569 Ga0496107_0170479
2570 Ga0496107_0211431
2571 Ga0496107_0549569
2572 Ga0496107_1223414
2573 Ga0496108_0032258
2574 Ga0496108_0042309
2575 Ga0496108_0150540
2576 Ga0496108_0202863
2577 Ga0496108_0299120
2578 Ga0496108_0455425
2579 Ga0496108_0878263
2580 Ga0496109_0063355
2581 Ga0496109_0080035
2582 Ga0496109_0271092
2583 Ga0496109_0293107
2584 Ga0496109_0337800
2585 Ga0496109_0396259
2586 Ga0496109_0486714
2587 Ga0496109_0534195
2588 Ga0496110_0097184
2589 Ga0496110_0171464
2590 Ga0496110_0209515
2591 Ga0496110_0325509
2592 Ga0496110_0472005
2593 Ga0496110_1014764
2594 Ga0496111_0184825
2595 Ga0496111_0204705
2596 Ga0496111_0362231
2597 Ga0496111_0395934
2598 Ga0496111_0440872
2599 Ga0496111_0626273
2600 Ga0496112_0017121
2601 Ga0496112_0050307
2602 Ga0496112_0087521
2603 Ga0496112_0106562
2604 Ga0496112_0141497
2605 Ga0496112_0155440
2606 Ga0496112_0180552
2607 Ga0496112_0231179
2608 Ga0496112_0426235
2609 Ga0496112_0731749
2610 Ga0496112_0915914
2611 Ga0496112_1008795
2612 Ga0496112_1269759
2613 Ga0496113_0069914
2614 Ga0496113_0140358
2615 Ga0496113_0180835
2616 Ga0496113_0519020
2617 Ga0496113_0714352
2618 Ga0496113_0925727
2619 Ga0496113_1075709
2620 Ga0496114_0012996
2621 Ga0496114_0012997
2622 Ga0496114_0591740
2623 Ga0496114_1344397
2624 Ga0496115_0002575
2625 Ga0496115_0004314
2626 Ga0496115_0009615
2627 Ga0496115_0026271
2628 Ga0496115_0091504
2629 Ga0496115_0163516
2630 Ga0496115_0674581
2631 Ga0501323_033420
2632 Ga0501036_1203504
2633 Ga0501038_0198598
2634 Ga0501048_0931269
2635 Ga0501068_0554486
2636 Ga0501070_0658494
2637 Ga0501072_0079503
2638 Ga0501073_0037486
2639 Ga0501074_0067186
2640 Ga0501075_0201190
2641 Ga0501079_0039652
2642 Ga0501080_0078950
2643 Ga0501081_0042874
2644 Ga0501269_026792
2645 nmdc:mga05p37_135223_c1
2646 nmdc:mga05p37_140290_c1
2647 nmdc:mga05p37_1701_c1
2648 nmdc:mga05p37_468622_c1
2649 nmdc:mga08y16_1151339_c1
2650 nmdc:mga08y16_1272337_c1
2651 nmdc:mga08y16_2132647_c1
2652 nmdc:mga08y16_724873_c1
2653 nmdc:mga08y16_786981_c1
2654 nmdc:mga0n895_15345_c1
2655 nmdc:mga0n895_344747_c1
2656 nmdc:mga0n895_507216_c1
2657 nmdc:mga0n895_575194_c1
2658 nmdc:mga0n895_764651_c1
2659 nmdc:mga0rr50_1043890_c1
2660 nmdc:mga0rr50_1337496_c1
2661 nmdc:mga0rr50_772511_c1
2662 nmdc:mga0rr50_968519_c1
2663 nmdc:mga08x19_576507_c1
2664 nmdc:mga08x19_80561_c1
2665 nmdc:mga0a205_392963_c1
2666 nmdc:mga0a205_442986_c1
2667 nmdc:mga0a205_480816_c1
2668 nmdc:mga0a205_8807_c1
2669 Ga0495601_0001921
2670 Ga0495601_0180268
2671 Ga0495619_0108420
2672 Ga0500643_172821
2673 Ga0500555_000015
2674 Ga0500568_0043000
2675 Ga0500616_0003906
2676 Ga0500616_0006989
2677 Ga0501084_0195523
2678 Ga0501082_0025331

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00410

Ribosomal_S8

Ribosomal protein S8

20

146

0.96

Structural Annotation

Top 5 Hits

ID Description Score Start End
8fmw-assembly1.cif.gz_H the structure of a hibernating ribosome in the lyme disease pathogen 0.969 3 132
5zeb-assembly1.cif.gz_h m. smegmatis p/p state 70s ribosome structure 0.9649 4 132
4pdb-assembly1.cif.gz_A crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer 0.96 5 132
7unu-assembly1.cif.gz_h pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) 0.9563 3 132
8cwo-assembly1.cif.gz_H cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map 0.9547 3 132
ID Description Score Start End Superfamily
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9804 76 132 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.976 76 132 3.30.1490.10
3uz6K02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.948 76 132 3.30.1490.10
3ofpH02 Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; 0.9438 76 132 3.30.1490.10
3ofbH01 Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; 0.9201 6 73 3.30.1370.30
ID Description Score Start End GO Terms
AF-A0A1V6DPD0-F1-model_v4 deleted 0.9942 65 132
AF-A0A3D2E2Q9-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9927 71 132 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2V6HX14-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9924 17 116 GO:0003735
GO:0005737
GO:0005840
GO:0006412
GO:1990904
AF-A0A2M7NWQ0-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9921 65 132 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A2V7XB09-F1-model_v4 Small ribosomal subunit protein uS8 (30S ribosomal protein S8) 0.9917 69 132 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Map