F493144
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1339 | 382 | 2678 | 132 |
Family's Representative Sequence
| Representative Sequence | 3300014497|Ga0182008_10130751|Ga0182008_101307512 |
| Length | 146 |
| Sequence | MADRQDKRRLPDKEMSTVTDPIADLLARVRNGAQAQKPELFVPYSKVKAEIARILKEEGYITDYELDRTAAHPRIKITNKLVNRSCAITGLKRVSRPGLRRYVGADEIPRVLGGMGIAILSTSRGVLSGREAKKQNVGGELLAYVW |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 2 | 2162886007 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v1 | Metagenome | Rhizosphere |
| 3 | 2209111006 | Arabidopsis rhizosphere microbial communities from the University of North Carolina - sample Wild type Col-0 v1 | Metagenome | Rhizosphere |
| 4 | 3300001438 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 5 | 3300001977 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 | Metagenome | Rhizosphere |
| 6 | 3300001990 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 | Metagenome | Rhizosphere |
| 7 | 3300002074 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 | Metagenome | Rhizosphere |
| 8 | 3300002077 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 | Metagenome | Rhizosphere |
| 9 | 3300002126 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 | Metagenome | Rhizosphere |
| 10 | 3300003203 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 11 | 3300003911 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 12 | 3300005288 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 2: eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 13 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 14 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 15 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 16 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 17 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 18 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 20 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 21 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 22 | 3300005333 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 24 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 25 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 26 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 27 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 28 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 30 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 31 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 33 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 35 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 38 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 40 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 41 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 42 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 43 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 45 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 46 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 47 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 50 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 51 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 52 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 53 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 54 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 55 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 56 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 57 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 58 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 59 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 60 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 61 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 63 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 64 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 65 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 66 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 68 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 69 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 71 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 72 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 73 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 74 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 75 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 76 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 77 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 78 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 79 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 80 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 81 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 82 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 83 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 84 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 85 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 86 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 87 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 88 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 89 | 3300005983 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 | Metagenome | Rhizosphere |
| 90 | 3300005985 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 | Metagenome | Rhizosphere |
| 91 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 92 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 94 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 95 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 96 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 97 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 98 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 102 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 103 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 104 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 105 | 3300007265 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 | Metagenome | Rhizosphere |
| 106 | 3300007788 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 | Metagenome | Rhizosphere |
| 107 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 108 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 109 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 111 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 112 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300010159 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 | Metagenome | Rhizosphere |
| 120 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 121 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 122 | 3300012503 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.5.old.080610_R | Metagenome | Rhizosphere |
| 123 | 3300012508 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.2.old.270510 | Metagenome | Rhizosphere |
| 124 | 3300012512 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Oy.3.old.270510 | Metagenome | Rhizosphere |
| 125 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 133 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 137 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300021377 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 | Metagenome | Unclassified |
| 140 | 3300021384 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 | Metagenome | Unclassified |
| 141 | 3300025271 | Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 142 | 3300025290 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) | Metagenome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025885 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025905 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300027360 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300027364 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300027378 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300027424 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027543 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027552 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027614 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant Co S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 212 | 3300027665 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M1 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300027682 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S AM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 216 | 3300027876 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 217 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 218 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 219 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 220 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 221 | 3300031456 | Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM | Metagenome | Unclassified |
| 222 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 223 | 3300034816 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 | Metagenome | Rhizosphere |
| 224 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 225 | 3300034820 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 | Metagenome | Rhizosphere |
| 226 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 227 | 3300035088 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 | Metagenome | Rhizosphere |
| 228 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 229 | 3300035091 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_4 | Metagenome | Rhizosphere |
| 230 | 3300035111 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 231 | 3300035112 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_16 | Metagenome | Rhizosphere |
| 232 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 233 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 234 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 235 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 236 | 3300035118 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 | Metagenome | Rhizosphere |
| 237 | 3300035119 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 | Metagenome | Rhizosphere |
| 238 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 239 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 240 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 241 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 242 | 3300035207 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 | Metagenome | Rhizosphere |
| 243 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 244 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 245 | 3300035692 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 | Metagenome | Rhizosphere |
| 246 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 247 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 248 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 249 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 250 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 251 | 3300037312 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_B SG_2 | Metagenome | Rhizosphere |
| 252 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 253 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 254 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 255 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 256 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 257 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 258 | 3300039438 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 | Metagenome | Rhizosphere |
| 259 | 3300039450 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 | Metagenome | Unclassified |
| 260 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 261 | 3300041456 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR17_5 MetaG | Metagenome | Rhizoplane |
| 262 | 3300041458 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_10 MetaG | Metagenome | Rhizoplane |
| 263 | 3300041459 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_11 MetaG | Metagenome | Rhizoplane |
| 264 | 3300041460 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_12 MetaG | Metagenome | Rhizoplane |
| 265 | 3300041486 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_9 MetaG | Metagenome | Rhizoplane |
| 266 | 3300041494 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_3 MetaG | Metagenome | Unclassified |
| 267 | 3300041496 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG | Metagenome | Unclassified |
| 268 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 269 | 3300041512 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_11 MetaG | Metagenome | Unclassified |
| 270 | 3300042005 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 | Metagenome | Rhizosphere |
| 271 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 272 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 273 | 3300042461 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 | Metagenome | Rhizosphere |
| 274 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 275 | 3300044673 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED | Metagenome | Rhizosphere |
| 276 | 3300044712 | Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED | Metagenome | Rhizosphere |
| 277 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 278 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 279 | 3300046454 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere | Metagenome | Rhizosphere |
| 280 | 3300046455 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere | Metagenome | Rhizosphere |
| 281 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 282 | 3300046461 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere | Metagenome | Rhizosphere |
| 283 | 3300046462 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere | Metagenome | Rhizosphere |
| 284 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 285 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 286 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 287 | 3300046474 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere | Metagenome | Rhizosphere |
| 288 | 3300046476 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere | Metagenome | Rhizosphere |
| 289 | 3300046477 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere | Metagenome | Rhizosphere |
| 290 | 3300046491 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere | Metagenome | Rhizosphere |
| 291 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 292 | 3300046501 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046516 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046520 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046526 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046528 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co1_24_3 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046533 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046537 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046539 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046542 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co2_52_27 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046558 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046559 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046663 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046664 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046665 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046675 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300046680 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300046681 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300046809 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere | Metagenome | Rhizosphere |
| 327 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 328 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 329 | 3300047318 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere | Metagenome | Rhizosphere |
| 330 | 3300047319 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere | Metagenome | Rhizosphere |
| 331 | 3300047444 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere | Metagenome | Rhizosphere |
| 332 | 3300047446 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 rhizosphere | Metagenome | Rhizosphere |
| 333 | 3300047470 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co1_3_5 rhizosphere | Metagenome | Rhizosphere |
| 334 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 335 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 336 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 337 | 3300048089 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere | Metagenome | Rhizosphere |
| 338 | 3300048091 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co2_54_7 rhizosphere | Metagenome | Rhizosphere |
| 339 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 340 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 341 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 342 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 343 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 344 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 345 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 346 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 347 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 348 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 349 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 350 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 351 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 352 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 353 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 354 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 355 | 3300049539 | Metatranscriptome of panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - H12_B_3_drought (Metagenome Metatranscriptome) | Metatranscriptome | Rhizosphere |
| 356 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 360 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 368 | 3300049766 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - E14_B_4_drought | Metagenome | Rhizosphere |
| 369 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 370 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 371 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 372 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 373 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 374 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 375 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 376 | 3300053085 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere | Metagenome | Rhizosphere |
| 377 | 3300053087 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 endosphere | Metagenome | Endosphere |
| 378 | 3300053103 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co1_30_3 endosphere | Metagenome | Endosphere |
| 379 | 3300053139 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co1_23_3 endosphere | Metagenome | Endosphere |
| 380 | 3300053153 | Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere | Metagenome | Endosphere |
| 381 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 382 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.93 |
| Metatranscriptomes | 0.07 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.37 |
| Nodule | 0 |
| Rhizoplane | 8.07 |
| Rhizosphere | 90.52 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 19.04 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0182008_10130751 | 3300014497 | Unclassified | 1251 |
| 2 | SwRhRL2b_contig_3185009 | 2162886007 | Unclassified | 1058 |
| 3 | 2214871332 | 2209111006 | Unclassified | 589 |
| 4 | JGI24035J14997_100183 | 3300001438 | Unclassified | 591 |
| 5 | JGI24746J21847_1007470 | 3300001977 | Bacteria | 1672 |
| 6 | JGI24737J22298_10073669 | 3300001990 | Bacteria | 1018 |
| 7 | JGI24748J21848_1058165 | 3300002074 | Unclassified | 513 |
| 8 | JGI24744J21845_10009043 | 3300002077 | Bacteria | 2047 |
| 9 | JGI24035J26624_1000379 | 3300002126 | Bacteria | 4177 |
| 10 | JGI24035J26624_1001833 | 3300002126 | Bacteria | 1984 |
| 11 | JGI24035J26624_1006039 | 3300002126 | Bacteria | 1164 |
| 12 | JGI24035J26624_1008033 | 3300002126 | Unclassified | 1030 |
| 13 | JGI25406J46586_10000007 | 3300003203 | Bacteria | 112227 |
| 14 | JGI25405J52794_10003510 | 3300003911 | Bacteria | 2754 |
| 15 | JGI25405J52794_10007684 | 3300003911 | Bacteria | 1994 |
| 16 | Ga0065714_10099910 | 3300005288 | Bacteria | 1663 |
| 17 | Ga0065704_10002652 | 3300005289 | Bacteria | 8381 |
| 18 | Ga0065704_10154003 | 3300005289 | Bacteria | 1405 |
| 19 | Ga0065704_10172946 | 3300005289 | Bacteria | 1281 |
| 20 | Ga0065704_10659453 | 3300005289 | Bacteria | 579 |
| 21 | Ga0065712_10006848 | 3300005290 | Unclassified | 2525 |
| 22 | Ga0065712_10040837 | 3300005290 | Unclassified | 1298 |
| 23 | Ga0065712_10070849 | 3300005290 | Bacteria | 5654 |
| 24 | Ga0065712_10084132 | 3300005290 | Bacteria | 2788 |
| 25 | Ga0065712_10088457 | 3300005290 | Bacteria | 2519 |
| 26 | Ga0065712_10099828 | 3300005290 | Bacteria | 2080 |
| 27 | Ga0065712_10108970 | 3300005290 | Bacteria | 1863 |
| 28 | Ga0065712_10130323 | 3300005290 | Bacteria | 1557 |
| 29 | Ga0065712_10325714 | 3300005290 | Unclassified | 821 |
| 30 | Ga0065712_10462430 | 3300005290 | Bacteria | 677 |
| 31 | Ga0065715_10005423 | 3300005293 | Bacteria | 7616 |
| 32 | Ga0065715_10090524 | 3300005293 | Bacteria | 6854 |
| 33 | Ga0065715_10114446 | 3300005293 | Bacteria | 2451 |
| 34 | Ga0065715_10136006 | 3300005293 | Unclassified | 1929 |
| 35 | Ga0065715_10159921 | 3300005293 | Bacteria | 1638 |
| 36 | Ga0065715_10181691 | 3300005293 | Bacteria | 1472 |
| 37 | Ga0065715_10222055 | 3300005293 | Bacteria | 1268 |
| 38 | Ga0065715_10225288 | 3300005293 | Bacteria | 1245 |
| 39 | Ga0065715_10242281 | 3300005293 | Unclassified | 1195 |
| 40 | Ga0065715_10254589 | 3300005293 | Bacteria | 1148 |
| 41 | Ga0065715_10334136 | 3300005293 | Unclassified | 973 |
| 42 | Ga0065715_10350677 | 3300005293 | Bacteria | 945 |
| 43 | Ga0065715_10427404 | 3300005293 | Bacteria | 851 |
| 44 | Ga0065707_10009888 | 3300005295 | Bacteria | 2894 |
| 45 | Ga0065707_10233776 | 3300005295 | Bacteria | 1179 |
| 46 | Ga0065707_10608558 | 3300005295 | Unclassified | 686 |
| 47 | Ga0070658_10080732 | 3300005327 | Bacteria | 2671 |
| 48 | Ga0070658_10410039 | 3300005327 | Bacteria | 1164 |
| 49 | Ga0070658_11783697 | 3300005327 | Unclassified | 532 |
| 50 | Ga0070676_10023857 | 3300005328 | Bacteria | 3441 |
| 51 | Ga0070676_10032758 | 3300005328 | Bacteria | 2979 |
| 52 | Ga0070676_10069962 | 3300005328 | Bacteria | 2104 |
| 53 | Ga0070676_10108518 | 3300005328 | Bacteria | 1725 |
| 54 | Ga0070676_10202196 | 3300005328 | Bacteria | 1303 |
| 55 | Ga0070676_11182432 | 3300005328 | Bacteria | 581 |
| 56 | Ga0070683_100026491 | 3300005329 | Bacteria | 5221 |
| 57 | Ga0070683_100054847 | 3300005329 | Bacteria | 3696 |
| 58 | Ga0070683_100055457 | 3300005329 | Bacteria | 3678 |
| 59 | Ga0070683_100495741 | 3300005329 | Bacteria | 1167 |
| 60 | Ga0070683_100832067 | 3300005329 | Bacteria | 885 |
| 61 | Ga0070683_100899954 | 3300005329 | Unclassified | 849 |
| 62 | Ga0070690_100052450 | 3300005330 | Bacteria | 2607 |
| 63 | Ga0070690_100056424 | 3300005330 | Bacteria | 2518 |
| 64 | Ga0070690_100167796 | 3300005330 | Unclassified | 1509 |
| 65 | Ga0070690_100399974 | 3300005330 | Unclassified | 1008 |
| 66 | Ga0070670_100000833 | 3300005331 | Bacteria | 24086 |
| 67 | Ga0070670_100003742 | 3300005331 | Bacteria | 12666 |
| 68 | Ga0070670_100136296 | 3300005331 | Bacteria | 2121 |
| 69 | Ga0070670_100620275 | 3300005331 | Unclassified | 969 |
| 70 | Ga0070670_100869512 | 3300005331 | Unclassified | 816 |
| 71 | Ga0070677_10137184 | 3300005333 | Bacteria | 1124 |
| 72 | Ga0070677_10383944 | 3300005333 | Unclassified | 736 |
| 73 | Ga0068869_100113989 | 3300005334 | Bacteria | 2060 |
| 74 | Ga0068869_100720816 | 3300005334 | Bacteria | 852 |
| 75 | Ga0068869_100930508 | 3300005334 | Unclassified | 754 |
| 76 | Ga0070666_10001876 | 3300005335 | Bacteria | 12791 |
| 77 | Ga0070666_10002056 | 3300005335 | Bacteria | 12212 |
| 78 | Ga0070666_10097738 | 3300005335 | Bacteria | 2021 |
| 79 | Ga0070666_10121884 | 3300005335 | Bacteria | 1808 |
| 80 | Ga0070666_10760310 | 3300005335 | Unclassified | 712 |
| 81 | Ga0070680_100100517 | 3300005336 | Bacteria | 2400 |
| 82 | Ga0070680_100348965 | 3300005336 | Bacteria | 1258 |
| 83 | Ga0070680_100488806 | 3300005336 | Bacteria | 1052 |
| 84 | Ga0070682_100426049 | 3300005337 | Bacteria | 1010 |
| 85 | Ga0068868_100031366 | 3300005338 | Bacteria | 4081 |
| 86 | Ga0068868_100096533 | 3300005338 | Bacteria | 2388 |
| 87 | Ga0068868_100199105 | 3300005338 | Bacteria | 1669 |
| 88 | Ga0068868_100697156 | 3300005338 | Unclassified | 908 |
| 89 | Ga0068868_102359363 | 3300005338 | Unclassified | 508 |
| 90 | Ga0070660_100023190 | 3300005339 | Bacteria | 4596 |
| 91 | Ga0070660_100378975 | 3300005339 | Bacteria | 1168 |
| 92 | Ga0070660_100647314 | 3300005339 | Unclassified | 885 |
| 93 | Ga0070689_100021098 | 3300005340 | Unclassified | 4844 |
| 94 | Ga0070689_100064515 | 3300005340 | Bacteria | 2851 |
| 95 | Ga0070689_100100534 | 3300005340 | Bacteria | 2288 |
| 96 | Ga0070689_100145272 | 3300005340 | Bacteria | 1910 |
| 97 | Ga0070689_100273588 | 3300005340 | Bacteria | 1399 |
| 98 | Ga0070689_100842260 | 3300005340 | Unclassified | 809 |
| 99 | Ga0070687_100000382 | 3300005343 | Bacteria | 15047 |
| 100 | Ga0070687_100114661 | 3300005343 | Bacteria | 1531 |
| 101 | Ga0070661_100062340 | 3300005344 | Bacteria | 2737 |
| 102 | Ga0070661_100292077 | 3300005344 | Unclassified | 1267 |
| 103 | Ga0070661_100393326 | 3300005344 | Bacteria | 1095 |
| 104 | Ga0070661_100838629 | 3300005344 | Bacteria | 756 |
| 105 | Ga0070692_10001104 | 3300005345 | Bacteria | 9415 |
| 106 | Ga0070692_10107559 | 3300005345 | Bacteria | 1538 |
| 107 | Ga0070668_100000403 | 3300005347 | Bacteria | 28684 |
| 108 | Ga0070668_100050196 | 3300005347 | Bacteria | 3211 |
| 109 | Ga0070668_100050229 | 3300005347 | Bacteria | 3210 |
| 110 | Ga0070668_100056885 | 3300005347 | Bacteria | 3021 |
| 111 | Ga0070668_100056962 | 3300005347 | Bacteria | 3019 |
| 112 | Ga0070668_100069825 | 3300005347 | Bacteria | 2734 |
| 113 | Ga0070668_100135575 | 3300005347 | Bacteria | 1980 |
| 114 | Ga0070668_100258296 | 3300005347 | Bacteria | 1448 |
| 115 | Ga0070669_100002011 | 3300005353 | Bacteria | 14710 |
| 116 | Ga0070669_100006097 | 3300005353 | Bacteria | 8698 |
| 117 | Ga0070669_100125169 | 3300005353 | Bacteria | 1966 |
| 118 | Ga0070669_100300055 | 3300005353 | Bacteria | 1292 |
| 119 | Ga0070669_100483782 | 3300005353 | Bacteria | 1025 |
| 120 | Ga0070669_100852327 | 3300005353 | Unclassified | 776 |
| 121 | Ga0070675_100004678 | 3300005354 | Bacteria | 10447 |
| 122 | Ga0070675_100048534 | 3300005354 | Bacteria | 3482 |
| 123 | Ga0070675_100083047 | 3300005354 | Bacteria | 2673 |
| 124 | Ga0070675_100129528 | 3300005354 | Unclassified | 2149 |
| 125 | Ga0070675_100135890 | 3300005354 | Bacteria | 2098 |
| 126 | Ga0070675_100158863 | 3300005354 | Bacteria | 1943 |
| 127 | Ga0070675_100200776 | 3300005354 | Bacteria | 1731 |
| 128 | Ga0070675_100295769 | 3300005354 | Bacteria | 1425 |
| 129 | Ga0070675_100429872 | 3300005354 | Bacteria | 1182 |
| 130 | Ga0070675_100755041 | 3300005354 | Bacteria | 888 |
| 131 | Ga0070671_100000283 | 3300005355 | Bacteria | 34469 |
| 132 | Ga0070671_100011134 | 3300005355 | Bacteria | 7224 |
| 133 | Ga0070671_100042031 | 3300005355 | Bacteria | 3799 |
| 134 | Ga0070671_100047998 | 3300005355 | Unclassified | 3550 |
| 135 | Ga0070671_100054306 | 3300005355 | Bacteria | 3331 |
| 136 | Ga0070671_100187898 | 3300005355 | Bacteria | 1751 |
| 137 | Ga0070671_100286550 | 3300005355 | Bacteria | 1401 |
| 138 | Ga0070671_100333656 | 3300005355 | Bacteria | 1293 |
| 139 | Ga0070671_100614611 | 3300005355 | Bacteria | 940 |
| 140 | Ga0070671_100623853 | 3300005355 | Bacteria | 932 |
| 141 | Ga0070671_100853150 | 3300005355 | Unclassified | 794 |
| 142 | Ga0070674_100007500 | 3300005356 | Bacteria | 6436 |
| 143 | Ga0070674_100064027 | 3300005356 | Bacteria | 2575 |
| 144 | Ga0070674_100222619 | 3300005356 | Bacteria | 1468 |
| 145 | Ga0070674_100376888 | 3300005356 | Bacteria | 1153 |
| 146 | Ga0070673_100008141 | 3300005364 | Bacteria | 6955 |
| 147 | Ga0070673_100014325 | 3300005364 | Bacteria | 5516 |
| 148 | Ga0070673_100075213 | 3300005364 | Bacteria | 2724 |
| 149 | Ga0070673_100163504 | 3300005364 | Bacteria | 1895 |
| 150 | Ga0070673_100283494 | 3300005364 | Bacteria | 1454 |
| 151 | Ga0070673_100476403 | 3300005364 | Bacteria | 1126 |
| 152 | Ga0070688_100000733 | 3300005365 | Bacteria | 16191 |
| 153 | Ga0070688_100001414 | 3300005365 | Bacteria | 11953 |
| 154 | Ga0070688_100016452 | 3300005365 | Bacteria | 4229 |
| 155 | Ga0070688_100054122 | 3300005365 | Bacteria | 2512 |
| 156 | Ga0070688_100102629 | 3300005365 | Bacteria | 1888 |
| 157 | Ga0070659_100001154 | 3300005366 | Bacteria | 19280 |
| 158 | Ga0070659_100002483 | 3300005366 | Bacteria | 13098 |
| 159 | Ga0070659_100117793 | 3300005366 | Bacteria | 2148 |
| 160 | Ga0070659_100340292 | 3300005366 | Bacteria | 1257 |
| 161 | Ga0070659_100981448 | 3300005366 | Unclassified | 741 |
| 162 | Ga0070659_101608257 | 3300005366 | Unclassified | 580 |
| 163 | Ga0070667_100004665 | 3300005367 | Bacteria | 11504 |
| 164 | Ga0070667_100010004 | 3300005367 | Bacteria | 7858 |
| 165 | Ga0070667_100320999 | 3300005367 | Unclassified | 1397 |
| 166 | Ga0070667_100509990 | 3300005367 | Bacteria | 1103 |
| 167 | Ga0070667_100821221 | 3300005367 | Bacteria | 863 |
| 168 | Ga0070667_101061349 | 3300005367 | Bacteria | 757 |
| 169 | Ga0070667_101517174 | 3300005367 | Unclassified | 629 |
| 170 | Ga0070709_10176197 | 3300005434 | Bacteria | 1498 |
| 171 | Ga0070709_10246697 | 3300005434 | Bacteria | 1285 |
| 172 | Ga0070709_11624732 | 3300005434 | Bacteria | 527 |
| 173 | Ga0070714_100207992 | 3300005435 | Bacteria | 1792 |
| 174 | Ga0070714_100286340 | 3300005435 | Bacteria | 1532 |
| 175 | Ga0070714_101115819 | 3300005435 | Bacteria | 769 |
| 176 | Ga0070714_102135992 | 3300005435 | Bacteria | 545 |
| 177 | Ga0070714_102328832 | 3300005435 | Unclassified | 521 |
| 178 | Ga0070713_100019600 | 3300005436 | Bacteria | 5170 |
| 179 | Ga0070713_100040250 | 3300005436 | Bacteria | 3798 |
| 180 | Ga0070713_100048466 | 3300005436 | Bacteria | 3498 |
| 181 | Ga0070713_100182167 | 3300005436 | Bacteria | 1888 |
| 182 | Ga0070713_100214091 | 3300005436 | Bacteria | 1746 |
| 183 | Ga0070713_101066359 | 3300005436 | Unclassified | 780 |
| 184 | Ga0070713_102475417 | 3300005436 | Unclassified | 502 |
| 185 | Ga0070710_10048829 | 3300005437 | Bacteria | 2365 |
| 186 | Ga0070710_10132576 | 3300005437 | Bacteria | 1520 |
| 187 | Ga0070710_10214317 | 3300005437 | Bacteria | 1222 |
| 188 | Ga0070710_10419844 | 3300005437 | Bacteria | 900 |
| 189 | Ga0070710_11209518 | 3300005437 | Unclassified | 559 |
| 190 | Ga0070701_10317022 | 3300005438 | Unclassified | 964 |
| 191 | Ga0070711_100006116 | 3300005439 | Bacteria | 7237 |
| 192 | Ga0070711_100078511 | 3300005439 | Bacteria | 2345 |
| 193 | Ga0070711_100112752 | 3300005439 | Bacteria | 1998 |
| 194 | Ga0070711_100448438 | 3300005439 | Bacteria | 1056 |
| 195 | Ga0070711_100619508 | 3300005439 | Bacteria | 904 |
| 196 | Ga0070711_101027982 | 3300005439 | Unclassified | 708 |
| 197 | Ga0070705_100075673 | 3300005440 | Bacteria | 2050 |
| 198 | Ga0070705_100204996 | 3300005440 | Bacteria | 1355 |
| 199 | Ga0070705_100232819 | 3300005440 | Unclassified | 1283 |
| 200 | Ga0070705_101023435 | 3300005440 | Unclassified | 672 |
| 201 | Ga0070705_101065448 | 3300005440 | Unclassified | 659 |
| 202 | Ga0070700_100003660 | 3300005441 | Bacteria | 7944 |
| 203 | Ga0070700_101249815 | 3300005441 | Unclassified | 622 |
| 204 | Ga0070694_100004904 | 3300005444 | Bacteria | 8062 |
| 205 | Ga0070694_100087162 | 3300005444 | Bacteria | 2183 |
| 206 | Ga0070694_100746208 | 3300005444 | Bacteria | 799 |
| 207 | Ga0070694_100750996 | 3300005444 | Bacteria | 797 |
| 208 | Ga0070708_100003581 | 3300005445 | Bacteria | 12183 |
| 209 | Ga0070708_100036156 | 3300005445 | Bacteria | 4307 |
| 210 | Ga0070708_100050882 | 3300005445 | Bacteria | 3669 |
| 211 | Ga0070708_100053105 | 3300005445 | Bacteria | 3595 |
| 212 | Ga0070708_100054749 | 3300005445 | Bacteria | 3545 |
| 213 | Ga0070708_100057410 | 3300005445 | Bacteria | 3465 |
| 214 | Ga0070708_100136047 | 3300005445 | Bacteria | 2276 |
| 215 | Ga0070708_100141727 | 3300005445 | Bacteria | 2229 |
| 216 | Ga0070708_100156410 | 3300005445 | Bacteria | 2122 |
| 217 | Ga0070708_100261350 | 3300005445 | Bacteria | 1627 |
| 218 | Ga0070708_100442592 | 3300005445 | Bacteria | 1226 |
| 219 | Ga0070708_100566950 | 3300005445 | Bacteria | 1071 |
| 220 | Ga0070708_101041682 | 3300005445 | Unclassified | 767 |
| 221 | Ga0070708_101158650 | 3300005445 | Bacteria | 723 |
| 222 | Ga0070708_102076977 | 3300005445 | Bacteria | 526 |
| 223 | Ga0070663_100100368 | 3300005455 | Bacteria | 2159 |
| 224 | Ga0070663_100656577 | 3300005455 | Bacteria | 887 |
| 225 | Ga0070678_100001511 | 3300005456 | Bacteria | 12415 |
| 226 | Ga0070678_100094691 | 3300005456 | Bacteria | 2299 |
| 227 | Ga0070678_100236091 | 3300005456 | Bacteria | 1526 |
| 228 | Ga0070678_100506587 | 3300005456 | Unclassified | 1066 |
| 229 | Ga0070678_100806887 | 3300005456 | Unclassified | 852 |
| 230 | Ga0070678_101910917 | 3300005456 | Bacteria | 561 |
| 231 | Ga0070662_100004281 | 3300005457 | Bacteria | 9009 |
| 232 | Ga0070662_100016152 | 3300005457 | Bacteria | 5009 |
| 233 | Ga0070662_100091226 | 3300005457 | Bacteria | 2288 |
| 234 | Ga0070662_100133833 | 3300005457 | Bacteria | 1915 |
| 235 | Ga0070662_101404111 | 3300005457 | Unclassified | 602 |
| 236 | Ga0070681_10052300 | 3300005458 | Bacteria | 4073 |
| 237 | Ga0068867_100044767 | 3300005459 | Bacteria | 3243 |
| 238 | Ga0068867_100386194 | 3300005459 | Unclassified | 1177 |
| 239 | Ga0070685_10106425 | 3300005466 | Bacteria | 1721 |
| 240 | Ga0070685_10140714 | 3300005466 | Bacteria | 1519 |
| 241 | Ga0070685_10208732 | 3300005466 | Bacteria | 1274 |
| 242 | Ga0070685_10358273 | 3300005466 | Bacteria | 999 |
| 243 | Ga0070685_10367787 | 3300005466 | Bacteria | 987 |
| 244 | Ga0070685_10838743 | 3300005466 | Unclassified | 680 |
| 245 | Ga0070706_100006577 | 3300005467 | Bacteria | 10965 |
| 246 | Ga0070706_100020444 | 3300005467 | Bacteria | 6102 |
| 247 | Ga0070706_100020521 | 3300005467 | Bacteria | 6089 |
| 248 | Ga0070706_100025982 | 3300005467 | Bacteria | 5388 |
| 249 | Ga0070706_100137442 | 3300005467 | Bacteria | 2280 |
| 250 | Ga0070706_100145108 | 3300005467 | Bacteria | 2216 |
| 251 | Ga0070706_100302668 | 3300005467 | Bacteria | 1492 |
| 252 | Ga0070706_100519386 | 3300005467 | Bacteria | 1108 |
| 253 | Ga0070706_100676488 | 3300005467 | Unclassified | 958 |
| 254 | Ga0070706_102009540 | 3300005467 | Bacteria | 523 |
| 255 | Ga0070707_100000292 | 3300005468 | Bacteria | 49172 |
| 256 | Ga0070707_100003721 | 3300005468 | Bacteria | 14386 |
| 257 | Ga0070707_100016188 | 3300005468 | Bacteria | 6997 |
| 258 | Ga0070707_100030502 | 3300005468 | Bacteria | 5134 |
| 259 | Ga0070707_100032046 | 3300005468 | Bacteria | 5006 |
| 260 | Ga0070707_100039193 | 3300005468 | Bacteria | 4529 |
| 261 | Ga0070707_100063474 | 3300005468 | Bacteria | 3545 |
| 262 | Ga0070707_100072311 | 3300005468 | Bacteria | 3323 |
| 263 | Ga0070707_100081504 | 3300005468 | Bacteria | 3124 |
| 264 | Ga0070707_100193267 | 3300005468 | Bacteria | 1984 |
| 265 | Ga0070707_100320831 | 3300005468 | Unclassified | 1505 |
| 266 | Ga0070707_100338980 | 3300005468 | Unclassified | 1461 |
| 267 | Ga0070707_100342021 | 3300005468 | Bacteria | 1453 |
| 268 | Ga0070707_100362651 | 3300005468 | Bacteria | 1408 |
| 269 | Ga0070707_100453112 | 3300005468 | Bacteria | 1244 |
| 270 | Ga0070707_100832304 | 3300005468 | Bacteria | 887 |
| 271 | Ga0070707_100956168 | 3300005468 | Bacteria | 822 |
| 272 | Ga0070707_101713715 | 3300005468 | Unclassified | 596 |
| 273 | Ga0070698_100001836 | 3300005471 | Bacteria | 23657 |
| 274 | Ga0070698_100007384 | 3300005471 | Bacteria | 11891 |
| 275 | Ga0070698_100022395 | 3300005471 | Bacteria | 6610 |
| 276 | Ga0070698_100032196 | 3300005471 | Bacteria | 5431 |
| 277 | Ga0070698_100329532 | 3300005471 | Bacteria | 1458 |
| 278 | Ga0070698_100354407 | 3300005471 | Unclassified | 1399 |
| 279 | Ga0070698_100661926 | 3300005471 | Bacteria | 985 |
| 280 | Ga0070698_100786651 | 3300005471 | Bacteria | 895 |
| 281 | Ga0070698_101504696 | 3300005471 | Unclassified | 624 |
| 282 | Ga0070699_100027581 | 3300005518 | Bacteria | 4897 |
| 283 | Ga0070699_100036501 | 3300005518 | Bacteria | 4251 |
| 284 | Ga0070699_100058834 | 3300005518 | Bacteria | 3329 |
| 285 | Ga0070699_100176052 | 3300005518 | Bacteria | 1897 |
| 286 | Ga0070699_100222626 | 3300005518 | Bacteria | 1682 |
| 287 | Ga0070699_100509403 | 3300005518 | Unclassified | 1094 |
| 288 | Ga0070699_100732863 | 3300005518 | Bacteria | 904 |
| 289 | Ga0070699_100739219 | 3300005518 | Bacteria | 900 |
| 290 | Ga0070699_100773376 | 3300005518 | Unclassified | 878 |
| 291 | Ga0070699_100870976 | 3300005518 | Bacteria | 825 |
| 292 | Ga0070679_100054949 | 3300005530 | Bacteria | 3965 |
| 293 | Ga0070679_100649064 | 3300005530 | Bacteria | 998 |
| 294 | Ga0070684_100001312 | 3300005535 | Bacteria | 17819 |
| 295 | Ga0070684_100029216 | 3300005535 | Bacteria | 4670 |
| 296 | Ga0070684_100302970 | 3300005535 | Bacteria | 1467 |
| 297 | Ga0070697_100000826 | 3300005536 | Bacteria | 23247 |
| 298 | Ga0070697_100002201 | 3300005536 | Bacteria | 14963 |
| 299 | Ga0070697_100002768 | 3300005536 | Bacteria | 13496 |
| 300 | Ga0070697_100003773 | 3300005536 | Bacteria | 11628 |
| 301 | Ga0070697_100005694 | 3300005536 | Bacteria | 9598 |
| 302 | Ga0070697_100045125 | 3300005536 | Bacteria | 3571 |
| 303 | Ga0070697_100057785 | 3300005536 | Bacteria | 3156 |
| 304 | Ga0070697_100121642 | 3300005536 | Bacteria | 2184 |
| 305 | Ga0070697_100124376 | 3300005536 | Bacteria | 2160 |
| 306 | Ga0070697_100141887 | 3300005536 | Bacteria | 2021 |
| 307 | Ga0070697_100214500 | 3300005536 | Bacteria | 1639 |
| 308 | Ga0070697_100449182 | 3300005536 | Bacteria | 1123 |
| 309 | Ga0070697_100500503 | 3300005536 | Bacteria | 1062 |
| 310 | Ga0070697_100558094 | 3300005536 | Bacteria | 1004 |
| 311 | Ga0070697_100596480 | 3300005536 | Unclassified | 971 |
| 312 | Ga0070697_100776024 | 3300005536 | Unclassified | 847 |
| 313 | Ga0068853_100107206 | 3300005539 | Bacteria | 2477 |
| 314 | Ga0070672_100000353 | 3300005543 | Bacteria | 26400 |
| 315 | Ga0070672_100004247 | 3300005543 | Bacteria | 9368 |
| 316 | Ga0070672_100041736 | 3300005543 | Bacteria | 3529 |
| 317 | Ga0070672_100136749 | 3300005543 | Bacteria | 2018 |
| 318 | Ga0070672_100209084 | 3300005543 | Bacteria | 1634 |
| 319 | Ga0070672_100958515 | 3300005543 | Bacteria | 757 |
| 320 | Ga0070672_101246723 | 3300005543 | Bacteria | 663 |
| 321 | Ga0070672_101436047 | 3300005543 | Unclassified | 617 |
| 322 | Ga0070686_100054207 | 3300005544 | Bacteria | 2564 |
| 323 | Ga0070686_100126507 | 3300005544 | Bacteria | 1761 |
| 324 | Ga0070695_100017240 | 3300005545 | Bacteria | 4379 |
| 325 | Ga0070695_100073003 | 3300005545 | Bacteria | 2251 |
| 326 | Ga0070695_100271901 | 3300005545 | Unclassified | 1241 |
| 327 | Ga0070696_100012751 | 3300005546 | Bacteria | 5644 |
| 328 | Ga0070696_100494645 | 3300005546 | Bacteria | 972 |
| 329 | Ga0070696_101568040 | 3300005546 | Bacteria | 565 |
| 330 | Ga0070693_100229378 | 3300005547 | Bacteria | 1221 |
| 331 | Ga0070693_100415757 | 3300005547 | Bacteria | 936 |
| 332 | Ga0070693_100709430 | 3300005547 | Bacteria | 737 |
| 333 | Ga0070665_100008787 | 3300005548 | Bacteria | 10223 |
| 334 | Ga0070665_100070912 | 3300005548 | Bacteria | 3491 |
| 335 | Ga0070665_100114878 | 3300005548 | Bacteria | 2694 |
| 336 | Ga0070665_100200931 | 3300005548 | Bacteria | 1994 |
| 337 | Ga0070665_100234438 | 3300005548 | Bacteria | 1836 |
| 338 | Ga0070665_100496622 | 3300005548 | Bacteria | 1231 |
| 339 | Ga0070665_100965700 | 3300005548 | Unclassified | 864 |
| 340 | Ga0070665_101232371 | 3300005548 | Unclassified | 759 |
| 341 | Ga0070704_100029184 | 3300005549 | Bacteria | 3680 |
| 342 | Ga0070704_100082187 | 3300005549 | Bacteria | 2375 |
| 343 | Ga0070704_100273457 | 3300005549 | Bacteria | 1397 |
| 344 | Ga0070704_100919742 | 3300005549 | Unclassified | 788 |
| 345 | Ga0068855_100308936 | 3300005563 | Bacteria | 1750 |
| 346 | Ga0070664_100125926 | 3300005564 | Bacteria | 2247 |
| 347 | Ga0070664_100182011 | 3300005564 | Bacteria | 1868 |
| 348 | Ga0070664_100248105 | 3300005564 | Bacteria | 1600 |
| 349 | Ga0070664_100301215 | 3300005564 | Bacteria | 1449 |
| 350 | Ga0070664_100454291 | 3300005564 | Bacteria | 1176 |
| 351 | Ga0068854_100608047 | 3300005578 | Bacteria | 934 |
| 352 | Ga0068856_100017528 | 3300005614 | Bacteria | 6939 |
| 353 | Ga0068856_100456081 | 3300005614 | Bacteria | 1299 |
| 354 | Ga0068856_100982990 | 3300005614 | Bacteria | 862 |
| 355 | Ga0070702_100018870 | 3300005615 | Bacteria | 3585 |
| 356 | Ga0070702_100196422 | 3300005615 | Bacteria | 1332 |
| 357 | Ga0070702_100671110 | 3300005615 | Bacteria | 786 |
| 358 | Ga0068852_100345260 | 3300005616 | Bacteria | 1452 |
| 359 | Ga0068859_100077354 | 3300005617 | Bacteria | 3368 |
| 360 | Ga0068859_100117580 | 3300005617 | Bacteria | 2724 |
| 361 | Ga0068859_100586714 | 3300005617 | Bacteria | 1208 |
| 362 | Ga0068859_100756896 | 3300005617 | Bacteria | 1060 |
| 363 | Ga0068864_100285604 | 3300005618 | Bacteria | 1541 |
| 364 | Ga0068864_100287593 | 3300005618 | Bacteria | 1536 |
| 365 | Ga0068864_100347280 | 3300005618 | Bacteria | 1399 |
| 366 | Ga0068864_100388810 | 3300005618 | Bacteria | 1324 |
| 367 | Ga0068864_100919300 | 3300005618 | Bacteria | 865 |
| 368 | Ga0068864_102000274 | 3300005618 | Unclassified | 586 |
| 369 | Ga0068866_10177069 | 3300005718 | Bacteria | 1257 |
| 370 | Ga0068866_10892409 | 3300005718 | Bacteria | 625 |
| 371 | Ga0068866_10906136 | 3300005718 | Bacteria | 620 |
| 372 | Ga0068861_100107874 | 3300005719 | Bacteria | 2227 |
| 373 | Ga0068861_100158124 | 3300005719 | Bacteria | 1866 |
| 374 | Ga0068861_100177914 | 3300005719 | Bacteria | 1768 |
| 375 | Ga0068863_100007967 | 3300005841 | Bacteria | 10355 |
| 376 | Ga0068863_100383370 | 3300005841 | Bacteria | 1373 |
| 377 | Ga0068863_100590505 | 3300005841 | Unclassified | 1099 |
| 378 | Ga0068863_100940299 | 3300005841 | Unclassified | 866 |
| 379 | Ga0068858_100052055 | 3300005842 | Bacteria | 3788 |
| 380 | Ga0068858_100142777 | 3300005842 | Bacteria | 2248 |
| 381 | Ga0068858_100224419 | 3300005842 | Unclassified | 1780 |
| 382 | Ga0068858_100401480 | 3300005842 | Bacteria | 1317 |
| 383 | Ga0068858_102243340 | 3300005842 | Unclassified | 540 |
| 384 | Ga0068858_102281690 | 3300005842 | Unclassified | 535 |
| 385 | Ga0068860_100010603 | 3300005843 | Bacteria | 9101 |
| 386 | Ga0068860_100066467 | 3300005843 | Bacteria | 3425 |
| 387 | Ga0068860_100108998 | 3300005843 | Bacteria | 2646 |
| 388 | Ga0068860_100762370 | 3300005843 | Bacteria | 980 |
| 389 | Ga0068862_100003143 | 3300005844 | Bacteria | 14358 |
| 390 | Ga0068862_100041432 | 3300005844 | Bacteria | 3918 |
| 391 | Ga0068862_101002808 | 3300005844 | Bacteria | 826 |
| 392 | Ga0081455_10001399 | 3300005937 | Bacteria | 29813 |
| 393 | Ga0081455_10021886 | 3300005937 | Bacteria | 5988 |
| 394 | Ga0081455_10031292 | 3300005937 | Bacteria | 4817 |
| 395 | Ga0081455_10031464 | 3300005937 | Bacteria | 4801 |
| 396 | Ga0081455_10284179 | 3300005937 | Bacteria | 1194 |
| 397 | Ga0081455_10288089 | 3300005937 | Bacteria | 1183 |
| 398 | Ga0081455_10344702 | 3300005937 | Bacteria | 1053 |
| 399 | Ga0081455_10648182 | 3300005937 | Unclassified | 680 |
| 400 | Ga0081538_10100476 | 3300005981 | Bacteria | 1458 |
| 401 | Ga0081540_1000036 | 3300005983 | Bacteria | 140805 |
| 402 | Ga0081540_1025675 | 3300005983 | Bacteria | 3384 |
| 403 | Ga0081540_1065432 | 3300005983 | Bacteria | 1709 |
| 404 | Ga0081539_10000014 | 3300005985 | Bacteria | 411270 |
| 405 | Ga0081539_10001730 | 3300005985 | Bacteria | 34868 |
| 406 | Ga0081539_10022038 | 3300005985 | Bacteria | 4229 |
| 407 | Ga0081539_10030228 | 3300005985 | Bacteria | 3367 |
| 408 | Ga0081539_10059040 | 3300005985 | Bacteria | 2114 |
| 409 | Ga0081539_10113538 | 3300005985 | Bacteria | 1359 |
| 410 | Ga0070717_10016944 | 3300006028 | Bacteria | 5659 |
| 411 | Ga0070717_10027717 | 3300006028 | Unclassified | 4529 |
| 412 | Ga0070717_10028090 | 3300006028 | Bacteria | 4500 |
| 413 | Ga0070717_10037326 | 3300006028 | Bacteria | 3945 |
| 414 | Ga0070717_10037361 | 3300006028 | Bacteria | 3943 |
| 415 | Ga0070717_10410936 | 3300006028 | Bacteria | 1217 |
| 416 | Ga0070717_10488751 | 3300006028 | Bacteria | 1112 |
| 417 | Ga0070717_10992822 | 3300006028 | Unclassified | 764 |
| 418 | Ga0070715_10015930 | 3300006163 | Bacteria | 2813 |
| 419 | Ga0070715_10059680 | 3300006163 | Bacteria | 1670 |
| 420 | Ga0070715_10399498 | 3300006163 | Unclassified | 763 |
| 421 | Ga0070715_10401984 | 3300006163 | Unclassified | 761 |
| 422 | Ga0070716_100011207 | 3300006173 | Bacteria | 4513 |
| 423 | Ga0070716_100199559 | 3300006173 | Bacteria | 1328 |
| 424 | Ga0070716_100205703 | 3300006173 | Bacteria | 1312 |
| 425 | Ga0070716_100304877 | 3300006173 | Bacteria | 1109 |
| 426 | Ga0070716_100369139 | 3300006173 | Bacteria | 1022 |
| 427 | Ga0070716_100649827 | 3300006173 | Unclassified | 799 |
| 428 | Ga0070716_100774044 | 3300006173 | Unclassified | 740 |
| 429 | Ga0070712_100023808 | 3300006175 | Bacteria | 4049 |
| 430 | Ga0070712_100046609 | 3300006175 | Bacteria | 2997 |
| 431 | Ga0070712_100049660 | 3300006175 | Unclassified | 2914 |
| 432 | Ga0070712_100052822 | 3300006175 | Bacteria | 2836 |
| 433 | Ga0070712_100093977 | 3300006175 | Bacteria | 2202 |
| 434 | Ga0070712_100271568 | 3300006175 | Unclassified | 1362 |
| 435 | Ga0070712_100357662 | 3300006175 | Bacteria | 1196 |
| 436 | Ga0070712_100388371 | 3300006175 | Bacteria | 1150 |
| 437 | Ga0070712_100401676 | 3300006175 | Bacteria | 1132 |
| 438 | Ga0070712_100657490 | 3300006175 | Unclassified | 891 |
| 439 | Ga0070712_100932690 | 3300006175 | Unclassified | 749 |
| 440 | Ga0070712_101220012 | 3300006175 | Unclassified | 654 |
| 441 | Ga0070712_101321383 | 3300006175 | Unclassified | 628 |
| 442 | Ga0070712_101431055 | 3300006175 | Bacteria | 603 |
| 443 | Ga0097621_100014055 | 3300006237 | Bacteria | 5982 |
| 444 | Ga0097621_100018403 | 3300006237 | Bacteria | 5335 |
| 445 | Ga0097621_100024099 | 3300006237 | Bacteria | 4748 |
| 446 | Ga0097621_100991687 | 3300006237 | Unclassified | 785 |
| 447 | Ga0068871_100084135 | 3300006358 | Bacteria | 2640 |
| 448 | Ga0068871_100336065 | 3300006358 | Bacteria | 1333 |
| 449 | Ga0068871_100727499 | 3300006358 | Unclassified | 911 |
| 450 | Ga0068871_100955037 | 3300006358 | Unclassified | 796 |
| 451 | Ga0075428_100093456 | 3300006844 | Bacteria | 3279 |
| 452 | Ga0075428_100095839 | 3300006844 | Bacteria | 3235 |
| 453 | Ga0075428_100416748 | 3300006844 | Bacteria | 1439 |
| 454 | Ga0075430_100277403 | 3300006846 | Bacteria | 1387 |
| 455 | Ga0075433_10196766 | 3300006852 | Bacteria | 1793 |
| 456 | Ga0075433_10674838 | 3300006852 | Bacteria | 906 |
| 457 | Ga0075433_10827267 | 3300006852 | Bacteria | 809 |
| 458 | Ga0075433_11004728 | 3300006852 | Unclassified | 727 |
| 459 | Ga0075433_11475672 | 3300006852 | Unclassified | 588 |
| 460 | Ga0075434_100014841 | 3300006871 | Bacteria | 7452 |
| 461 | Ga0075434_100147155 | 3300006871 | Bacteria | 2376 |
| 462 | Ga0075434_100200364 | 3300006871 | Bacteria | 2016 |
| 463 | Ga0075434_100540910 | 3300006871 | Unclassified | 1185 |
| 464 | Ga0075434_100657972 | 3300006871 | Unclassified | 1066 |
| 465 | Ga0075434_101028397 | 3300006871 | Bacteria | 838 |
| 466 | Ga0075434_101466271 | 3300006871 | Unclassified | 692 |
| 467 | Ga0068865_100017414 | 3300006881 | Bacteria | 4621 |
| 468 | Ga0068865_100105971 | 3300006881 | Bacteria | 2066 |
| 469 | Ga0068865_100149571 | 3300006881 | Bacteria | 1770 |
| 470 | Ga0068865_100214443 | 3300006881 | Bacteria | 1502 |
| 471 | Ga0068865_100831403 | 3300006881 | Bacteria | 799 |
| 472 | Ga0075436_100032597 | 3300006914 | Bacteria | 3592 |
| 473 | Ga0075436_100370089 | 3300006914 | Unclassified | 1035 |
| 474 | Ga0075436_100413342 | 3300006914 | Unclassified | 979 |
| 475 | Ga0075436_100922148 | 3300006914 | Unclassified | 654 |
| 476 | Ga0097620_100077352 | 3300006931 | Bacteria | 3368 |
| 477 | Ga0097620_100117582 | 3300006931 | Bacteria | 2724 |
| 478 | Ga0097620_100586684 | 3300006931 | Bacteria | 1208 |
| 479 | Ga0097620_100756876 | 3300006931 | Bacteria | 1060 |
| 480 | Ga0075435_100541635 | 3300007076 | Bacteria | 1008 |
| 481 | Ga0075435_100651782 | 3300007076 | Bacteria | 914 |
| 482 | Ga0075435_101100459 | 3300007076 | Bacteria | 695 |
| 483 | Ga0099794_10020565 | 3300007265 | Bacteria | 2989 |
| 484 | Ga0099794_10179950 | 3300007265 | Bacteria | 1079 |
| 485 | Ga0099794_10470990 | 3300007265 | Bacteria | 660 |
| 486 | Ga0099794_10711006 | 3300007265 | Unclassified | 535 |
| 487 | Ga0099795_10341386 | 3300007788 | Unclassified | 668 |
| 488 | Ga0099795_10474030 | 3300007788 | Unclassified | 580 |
| 489 | Ga0105240_11673074 | 3300009093 | Unclassified | 665 |
| 490 | Ga0111539_10524306 | 3300009094 | Bacteria | 1380 |
| 491 | Ga0111539_11803835 | 3300009094 | Bacteria | 709 |
| 492 | Ga0111539_12134840 | 3300009094 | Bacteria | 650 |
| 493 | Ga0111539_12893719 | 3300009094 | Unclassified | 555 |
| 494 | Ga0105245_10006614 | 3300009098 | Bacteria | 10180 |
| 495 | Ga0105245_10030852 | 3300009098 | Bacteria | 4740 |
| 496 | Ga0105245_10214619 | 3300009098 | Bacteria | 1854 |
| 497 | Ga0105245_11624256 | 3300009098 | Unclassified | 698 |
| 498 | Ga0105247_10084384 | 3300009101 | Bacteria | 2007 |
| 499 | Ga0105247_10731540 | 3300009101 | Unclassified | 748 |
| 500 | Ga0105247_11036774 | 3300009101 | Unclassified | 643 |
| 501 | Ga0114129_10001417 | 3300009147 | Bacteria | 32326 |
| 502 | Ga0114129_10003445 | 3300009147 | Bacteria | 22244 |
| 503 | Ga0114129_10032401 | 3300009147 | Bacteria | 7386 |
| 504 | Ga0114129_10241662 | 3300009147 | Bacteria | 2427 |
| 505 | Ga0114129_12192928 | 3300009147 | Unclassified | 665 |
| 506 | Ga0105243_10033332 | 3300009148 | Bacteria | 3982 |
| 507 | Ga0105243_10331810 | 3300009148 | Bacteria | 1390 |
| 508 | Ga0105243_10648599 | 3300009148 | Bacteria | 1023 |
| 509 | Ga0105241_10713440 | 3300009174 | Bacteria | 916 |
| 510 | Ga0105242_10043482 | 3300009176 | Bacteria | 3634 |
| 511 | Ga0105242_10167170 | 3300009176 | Bacteria | 1930 |
| 512 | Ga0105242_10276372 | 3300009176 | Bacteria | 1524 |
| 513 | Ga0105242_10875677 | 3300009176 | Bacteria | 896 |
| 514 | Ga0105242_10939690 | 3300009176 | Bacteria | 868 |
| 515 | Ga0105248_10321465 | 3300009177 | Bacteria | 1743 |
| 516 | Ga0105237_10134456 | 3300009545 | Unclassified | 2467 |
| 517 | Ga0105237_10225438 | 3300009545 | Bacteria | 1875 |
| 518 | Ga0105238_11121242 | 3300009551 | Bacteria | 810 |
| 519 | Ga0105249_10007788 | 3300009553 | Bacteria | 9333 |
| 520 | Ga0105249_10011097 | 3300009553 | Bacteria | 7914 |
| 521 | Ga0105249_10431190 | 3300009553 | Bacteria | 1354 |
| 522 | Ga0105249_11334773 | 3300009553 | Bacteria | 789 |
| 523 | Ga0099796_10005301 | 3300010159 | Bacteria | 3206 |
| 524 | Ga0099796_10011175 | 3300010159 | Bacteria | 2496 |
| 525 | Ga0099796_10103366 | 3300010159 | Bacteria | 1075 |
| 526 | Ga0105239_10070002 | 3300010375 | Bacteria | 3853 |
| 527 | Ga0105239_10100267 | 3300010375 | Bacteria | 3203 |
| 528 | Ga0105239_10139759 | 3300010375 | Bacteria | 2698 |
| 529 | Ga0105239_12151893 | 3300010375 | Bacteria | 648 |
| 530 | Ga0105246_10182706 | 3300011119 | Bacteria | 1616 |
| 531 | Ga0105246_10383239 | 3300011119 | Bacteria | 1162 |
| 532 | Ga0105246_12137735 | 3300011119 | Unclassified | 543 |
| 533 | Ga0157313_1005513 | 3300012503 | Bacteria | 917 |
| 534 | Ga0157315_1056796 | 3300012508 | Unclassified | 541 |
| 535 | Ga0157327_1046819 | 3300012512 | Unclassified | 602 |
| 536 | Ga0157373_10116401 | 3300013100 | Bacteria | 1879 |
| 537 | Ga0157373_11545504 | 3300013100 | Bacteria | 507 |
| 538 | Ga0157371_10058341 | 3300013102 | Bacteria | 2738 |
| 539 | Ga0157371_10323452 | 3300013102 | Bacteria | 1119 |
| 540 | Ga0157370_11019409 | 3300013104 | Unclassified | 749 |
| 541 | Ga0157369_10182471 | 3300013105 | Bacteria | 2208 |
| 542 | Ga0157374_10001473 | 3300013296 | Bacteria | 19879 |
| 543 | Ga0157374_10005577 | 3300013296 | Bacteria | 10597 |
| 544 | Ga0157374_10019745 | 3300013296 | Bacteria | 5970 |
| 545 | Ga0157374_10033688 | 3300013296 | Bacteria | 4675 |
| 546 | Ga0157374_10055882 | 3300013296 | Bacteria | 3685 |
| 547 | Ga0157374_10120813 | 3300013296 | Bacteria | 2528 |
| 548 | Ga0157374_10317951 | 3300013296 | Bacteria | 1542 |
| 549 | Ga0157374_10431232 | 3300013296 | Bacteria | 1318 |
| 550 | Ga0157374_10574067 | 3300013296 | Bacteria | 1137 |
| 551 | Ga0157374_10996360 | 3300013296 | Bacteria | 857 |
| 552 | Ga0157374_11038725 | 3300013296 | Unclassified | 839 |
| 553 | Ga0157374_11350962 | 3300013296 | Bacteria | 735 |
| 554 | Ga0157374_12134377 | 3300013296 | Unclassified | 587 |
| 555 | Ga0157378_10005509 | 3300013297 | Bacteria | 11097 |
| 556 | Ga0157378_10026553 | 3300013297 | Bacteria | 5104 |
| 557 | Ga0157378_10043528 | 3300013297 | Bacteria | 3987 |
| 558 | Ga0157378_10048884 | 3300013297 | Bacteria | 3762 |
| 559 | Ga0157378_10058061 | 3300013297 | Bacteria | 3451 |
| 560 | Ga0157378_10174062 | 3300013297 | Unclassified | 2021 |
| 561 | Ga0157378_10191930 | 3300013297 | Bacteria | 1927 |
| 562 | Ga0157378_10246614 | 3300013297 | Bacteria | 1708 |
| 563 | Ga0157378_10326750 | 3300013297 | Bacteria | 1491 |
| 564 | Ga0157378_10384057 | 3300013297 | Bacteria | 1380 |
| 565 | Ga0157378_10409772 | 3300013297 | Bacteria | 1337 |
| 566 | Ga0157378_10451731 | 3300013297 | Bacteria | 1276 |
| 567 | Ga0157378_10529437 | 3300013297 | Bacteria | 1181 |
| 568 | Ga0157378_10705913 | 3300013297 | Bacteria | 1028 |
| 569 | Ga0157378_10799313 | 3300013297 | Bacteria | 969 |
| 570 | Ga0157378_11522416 | 3300013297 | Bacteria | 714 |
| 571 | Ga0157378_11702122 | 3300013297 | Bacteria | 678 |
| 572 | Ga0157378_12767619 | 3300013297 | Unclassified | 543 |
| 573 | Ga0163162_10003249 | 3300013306 | Bacteria | 15541 |
| 574 | Ga0163162_10014121 | 3300013306 | Bacteria | 7805 |
| 575 | Ga0163162_10017445 | 3300013306 | Bacteria | 7024 |
| 576 | Ga0163162_10023520 | 3300013306 | Bacteria | 6081 |
| 577 | Ga0163162_10034354 | 3300013306 | Bacteria | 5046 |
| 578 | Ga0163162_10042501 | 3300013306 | Bacteria | 4549 |
| 579 | Ga0163162_10086566 | 3300013306 | Bacteria | 3211 |
| 580 | Ga0163162_10203836 | 3300013306 | Bacteria | 2107 |
| 581 | Ga0163162_10224090 | 3300013306 | Bacteria | 2010 |
| 582 | Ga0163162_10782207 | 3300013306 | Bacteria | 1072 |
| 583 | Ga0157372_10037163 | 3300013307 | Bacteria | 5368 |
| 584 | Ga0157372_10040369 | 3300013307 | Bacteria | 5155 |
| 585 | Ga0157372_10167743 | 3300013307 | Bacteria | 2539 |
| 586 | Ga0157372_10260634 | 3300013307 | Bacteria | 2013 |
| 587 | Ga0157372_10837918 | 3300013307 | Bacteria | 1068 |
| 588 | Ga0157372_11596687 | 3300013307 | Bacteria | 751 |
| 589 | Ga0157375_10000287 | 3300013308 | Bacteria | 45998 |
| 590 | Ga0157375_10001868 | 3300013308 | Bacteria | 18135 |
| 591 | Ga0157375_10007782 | 3300013308 | Bacteria | 9374 |
| 592 | Ga0157375_10044228 | 3300013308 | Bacteria | 4324 |
| 593 | Ga0157375_10082239 | 3300013308 | Bacteria | 3261 |
| 594 | Ga0157375_10159468 | 3300013308 | Bacteria | 2397 |
| 595 | Ga0157375_10368137 | 3300013308 | Bacteria | 1603 |
| 596 | Ga0157375_10511654 | 3300013308 | Bacteria | 1364 |
| 597 | Ga0157375_12062506 | 3300013308 | Bacteria | 678 |
| 598 | Ga0163163_10294276 | 3300014325 | Bacteria | 1676 |
| 599 | Ga0163163_10297508 | 3300014325 | Bacteria | 1666 |
| 600 | Ga0163163_10307094 | 3300014325 | Bacteria | 1639 |
| 601 | Ga0163163_11108141 | 3300014325 | Bacteria | 855 |
| 602 | Ga0163163_11115034 | 3300014325 | Bacteria | 852 |
| 603 | Ga0182008_10063220 | 3300014497 | Bacteria | 1823 |
| 604 | Ga0182008_10421309 | 3300014497 | Unclassified | 721 |
| 605 | Ga0157377_10013826 | 3300014745 | Bacteria | 4092 |
| 606 | Ga0157377_10110643 | 3300014745 | Bacteria | 1650 |
| 607 | Ga0157377_10369438 | 3300014745 | Bacteria | 968 |
| 608 | Ga0157377_10400617 | 3300014745 | Bacteria | 934 |
| 609 | Ga0157379_10005647 | 3300014968 | Bacteria | 10748 |
| 610 | Ga0157379_10083913 | 3300014968 | Bacteria | 2856 |
| 611 | Ga0157379_10421858 | 3300014968 | Bacteria | 1229 |
| 612 | Ga0157379_10432610 | 3300014968 | Bacteria | 1213 |
| 613 | Ga0157379_11264189 | 3300014968 | Bacteria | 712 |
| 614 | Ga0157376_10009509 | 3300014969 | Bacteria | 7064 |
| 615 | Ga0157376_10149842 | 3300014969 | Bacteria | 2102 |
| 616 | Ga0157376_10154833 | 3300014969 | Bacteria | 2071 |
| 617 | Ga0157376_10164048 | 3300014969 | Bacteria | 2017 |
| 618 | Ga0157376_10180657 | 3300014969 | Bacteria | 1928 |
| 619 | Ga0157376_10349606 | 3300014969 | Bacteria | 1414 |
| 620 | Ga0157376_10404419 | 3300014969 | Bacteria | 1321 |
| 621 | Ga0157376_11853928 | 3300014969 | Bacteria | 640 |
| 622 | Ga0157376_12268419 | 3300014969 | Unclassified | 582 |
| 623 | Ga0163161_10046543 | 3300017792 | Bacteria | 3130 |
| 624 | Ga0163161_10177049 | 3300017792 | Bacteria | 1633 |
| 625 | Ga0163161_10302024 | 3300017792 | Bacteria | 1261 |
| 626 | Ga0163161_10457796 | 3300017792 | Bacteria | 1032 |
| 627 | Ga0163161_11290942 | 3300017792 | Bacteria | 634 |
| 628 | Ga0213874_10318189 | 3300021377 | Bacteria | 589 |
| 629 | Ga0213876_10006558 | 3300021384 | Bacteria | 6346 |
| 630 | Ga0207666_1000898 | 3300025271 | Bacteria | 3558 |
| 631 | Ga0207666_1002318 | 3300025271 | Bacteria | 2288 |
| 632 | Ga0207666_1019393 | 3300025271 | Unclassified | 992 |
| 633 | Ga0207673_1000900 | 3300025290 | Unclassified | 3196 |
| 634 | Ga0207673_1002318 | 3300025290 | Bacteria | 2161 |
| 635 | Ga0207673_1008168 | 3300025290 | Bacteria | 1322 |
| 636 | Ga0207673_1016725 | 3300025290 | Bacteria | 976 |
| 637 | Ga0207673_1032820 | 3300025290 | Unclassified | 721 |
| 638 | Ga0207697_10000010 | 3300025315 | Bacteria | 65144 |
| 639 | Ga0207697_10000131 | 3300025315 | Bacteria | 36154 |
| 640 | Ga0207697_10000495 | 3300025315 | Bacteria | 22147 |
| 641 | Ga0207697_10002230 | 3300025315 | Bacteria | 10127 |
| 642 | Ga0207697_10002322 | 3300025315 | Bacteria | 9909 |
| 643 | Ga0207697_10013157 | 3300025315 | Bacteria | 3455 |
| 644 | Ga0207697_10022681 | 3300025315 | Bacteria | 2571 |
| 645 | Ga0207697_10260276 | 3300025315 | Bacteria | 768 |
| 646 | Ga0207653_10039724 | 3300025885 | Bacteria | 1541 |
| 647 | Ga0207653_10050379 | 3300025885 | Bacteria | 1384 |
| 648 | Ga0207692_10073082 | 3300025898 | Bacteria | 1813 |
| 649 | Ga0207692_10167630 | 3300025898 | Bacteria | 1270 |
| 650 | Ga0207692_10402536 | 3300025898 | Bacteria | 854 |
| 651 | Ga0207642_10079022 | 3300025899 | Bacteria | 1592 |
| 652 | Ga0207642_10140377 | 3300025899 | Bacteria | 1273 |
| 653 | Ga0207642_10190964 | 3300025899 | Bacteria | 1124 |
| 654 | Ga0207642_10235101 | 3300025899 | Bacteria | 1032 |
| 655 | Ga0207642_10813163 | 3300025899 | Bacteria | 595 |
| 656 | Ga0207710_10089084 | 3300025900 | Bacteria | 1442 |
| 657 | Ga0207688_10001208 | 3300025901 | Bacteria | 13377 |
| 658 | Ga0207688_10014566 | 3300025901 | Bacteria | 4271 |
| 659 | Ga0207688_10076002 | 3300025901 | Bacteria | 1912 |
| 660 | Ga0207688_10154580 | 3300025901 | Bacteria | 1357 |
| 661 | Ga0207688_10214307 | 3300025901 | Bacteria | 1158 |
| 662 | Ga0207680_10003944 | 3300025903 | Bacteria | 7004 |
| 663 | Ga0207680_10025390 | 3300025903 | Bacteria | 3268 |
| 664 | Ga0207680_10032106 | 3300025903 | Bacteria | 2981 |
| 665 | Ga0207680_10113689 | 3300025903 | Bacteria | 1760 |
| 666 | Ga0207680_10157831 | 3300025903 | Bacteria | 1518 |
| 667 | Ga0207647_10122822 | 3300025904 | Bacteria | 1530 |
| 668 | Ga0207647_10573618 | 3300025904 | Bacteria | 624 |
| 669 | Ga0207685_10003968 | 3300025905 | Bacteria | 3683 |
| 670 | Ga0207685_10023055 | 3300025905 | Bacteria | 2113 |
| 671 | Ga0207699_10008911 | 3300025906 | Bacteria | 4974 |
| 672 | Ga0207699_10020861 | 3300025906 | Bacteria | 3520 |
| 673 | Ga0207699_10205598 | 3300025906 | Bacteria | 1336 |
| 674 | Ga0207699_10245878 | 3300025906 | Bacteria | 1231 |
| 675 | Ga0207699_10354681 | 3300025906 | Unclassified | 1036 |
| 676 | Ga0207645_10001786 | 3300025907 | Bacteria | 17391 |
| 677 | Ga0207645_10002762 | 3300025907 | Bacteria | 13659 |
| 678 | Ga0207645_10004253 | 3300025907 | Bacteria | 10632 |
| 679 | Ga0207645_10004432 | 3300025907 | Bacteria | 10394 |
| 680 | Ga0207645_10125827 | 3300025907 | Bacteria | 1666 |
| 681 | Ga0207645_10241866 | 3300025907 | Unclassified | 1192 |
| 682 | Ga0207645_10474049 | 3300025907 | Bacteria | 846 |
| 683 | Ga0207705_10629080 | 3300025909 | Unclassified | 835 |
| 684 | Ga0207705_10657783 | 3300025909 | Unclassified | 815 |
| 685 | Ga0207705_11370015 | 3300025909 | Unclassified | 539 |
| 686 | Ga0207684_10000028 | 3300025910 | Bacteria | 306450 |
| 687 | Ga0207684_10003766 | 3300025910 | Bacteria | 14658 |
| 688 | Ga0207684_10008671 | 3300025910 | Bacteria | 9025 |
| 689 | Ga0207684_10011143 | 3300025910 | Bacteria | 7871 |
| 690 | Ga0207684_10019695 | 3300025910 | Bacteria | 5771 |
| 691 | Ga0207684_10030870 | 3300025910 | Bacteria | 4561 |
| 692 | Ga0207684_10059810 | 3300025910 | Bacteria | 3235 |
| 693 | Ga0207684_10072862 | 3300025910 | Bacteria | 2917 |
| 694 | Ga0207684_10074641 | 3300025910 | Bacteria | 2881 |
| 695 | Ga0207684_10248195 | 3300025910 | Bacteria | 1536 |
| 696 | Ga0207684_10504496 | 3300025910 | Bacteria | 1037 |
| 697 | Ga0207684_10507609 | 3300025910 | Bacteria | 1033 |
| 698 | Ga0207684_10514905 | 3300025910 | Bacteria | 1025 |
| 699 | Ga0207654_10853293 | 3300025911 | Unclassified | 659 |
| 700 | Ga0207654_11011087 | 3300025911 | Unclassified | 605 |
| 701 | Ga0207707_10035549 | 3300025912 | Bacteria | 4356 |
| 702 | Ga0207671_10132187 | 3300025914 | Bacteria | 1916 |
| 703 | Ga0207671_10203874 | 3300025914 | Bacteria | 1545 |
| 704 | Ga0207693_10000889 | 3300025915 | Bacteria | 26818 |
| 705 | Ga0207693_10006942 | 3300025915 | Bacteria | 9356 |
| 706 | Ga0207693_10021211 | 3300025915 | Bacteria | 5163 |
| 707 | Ga0207693_10035010 | 3300025915 | Bacteria | 3961 |
| 708 | Ga0207693_10157817 | 3300025915 | Bacteria | 1785 |
| 709 | Ga0207693_10167995 | 3300025915 | Bacteria | 1727 |
| 710 | Ga0207693_10323521 | 3300025915 | Bacteria | 1207 |
| 711 | Ga0207693_10339935 | 3300025915 | Bacteria | 1175 |
| 712 | Ga0207693_10459107 | 3300025915 | Unclassified | 995 |
| 713 | Ga0207693_10463811 | 3300025915 | Bacteria | 990 |
| 714 | Ga0207693_10537288 | 3300025915 | Bacteria | 912 |
| 715 | Ga0207693_10665350 | 3300025915 | Unclassified | 808 |
| 716 | Ga0207693_10972828 | 3300025915 | Bacteria | 649 |
| 717 | Ga0207693_11034901 | 3300025915 | Unclassified | 626 |
| 718 | Ga0207663_10002290 | 3300025916 | Bacteria | 9171 |
| 719 | Ga0207663_10071768 | 3300025916 | Unclassified | 2236 |
| 720 | Ga0207663_10129162 | 3300025916 | Bacteria | 1743 |
| 721 | Ga0207663_10742089 | 3300025916 | Bacteria | 779 |
| 722 | Ga0207663_10923940 | 3300025916 | Unclassified | 698 |
| 723 | Ga0207663_11460993 | 3300025916 | Unclassified | 551 |
| 724 | Ga0207660_10087575 | 3300025917 | Bacteria | 2301 |
| 725 | Ga0207660_10605332 | 3300025917 | Bacteria | 893 |
| 726 | Ga0207662_10000699 | 3300025918 | Bacteria | 15308 |
| 727 | Ga0207662_10163389 | 3300025918 | Bacteria | 1424 |
| 728 | Ga0207662_10629477 | 3300025918 | Bacteria | 748 |
| 729 | Ga0207657_10073181 | 3300025919 | Bacteria | 2897 |
| 730 | Ga0207657_10152237 | 3300025919 | Bacteria | 1883 |
| 731 | Ga0207657_10347033 | 3300025919 | Unclassified | 1171 |
| 732 | Ga0207657_10508684 | 3300025919 | Bacteria | 943 |
| 733 | Ga0207649_10201065 | 3300025920 | Bacteria | 1408 |
| 734 | Ga0207649_10757870 | 3300025920 | Bacteria | 756 |
| 735 | Ga0207649_11133067 | 3300025920 | Unclassified | 618 |
| 736 | Ga0207652_10250204 | 3300025921 | Bacteria | 1598 |
| 737 | Ga0207652_11358490 | 3300025921 | Unclassified | 614 |
| 738 | Ga0207646_10000191 | 3300025922 | Bacteria | 83638 |
| 739 | Ga0207646_10001393 | 3300025922 | Bacteria | 29980 |
| 740 | Ga0207646_10005640 | 3300025922 | Bacteria | 13143 |
| 741 | Ga0207646_10005692 | 3300025922 | Bacteria | 13070 |
| 742 | Ga0207646_10009621 | 3300025922 | Bacteria | 9535 |
| 743 | Ga0207646_10010143 | 3300025922 | Bacteria | 9230 |
| 744 | Ga0207646_10028198 | 3300025922 | Bacteria | 5113 |
| 745 | Ga0207646_10065346 | 3300025922 | Bacteria | 3248 |
| 746 | Ga0207646_10068226 | 3300025922 | Bacteria | 3176 |
| 747 | Ga0207646_10073074 | 3300025922 | Bacteria | 3063 |
| 748 | Ga0207646_10295729 | 3300025922 | Bacteria | 1463 |
| 749 | Ga0207646_10346952 | 3300025922 | Bacteria | 1341 |
| 750 | Ga0207646_10482144 | 3300025922 | Bacteria | 1118 |
| 751 | Ga0207646_10507633 | 3300025922 | Bacteria | 1086 |
| 752 | Ga0207646_10840249 | 3300025922 | Unclassified | 817 |
| 753 | Ga0207646_10849897 | 3300025922 | Bacteria | 811 |
| 754 | Ga0207681_10004055 | 3300025923 | Bacteria | 9086 |
| 755 | Ga0207681_10069483 | 3300025923 | Bacteria | 2450 |
| 756 | Ga0207681_10363047 | 3300025923 | Unclassified | 1162 |
| 757 | Ga0207681_10437614 | 3300025923 | Bacteria | 1062 |
| 758 | Ga0207650_10006836 | 3300025925 | Bacteria | 7782 |
| 759 | Ga0207650_10007428 | 3300025925 | Bacteria | 7468 |
| 760 | Ga0207650_10018287 | 3300025925 | Bacteria | 4917 |
| 761 | Ga0207650_10140098 | 3300025925 | Bacteria | 1901 |
| 762 | Ga0207650_10152097 | 3300025925 | Bacteria | 1827 |
| 763 | Ga0207650_11259579 | 3300025925 | Unclassified | 630 |
| 764 | Ga0207659_10003512 | 3300025926 | Bacteria | 9421 |
| 765 | Ga0207659_10045484 | 3300025926 | Bacteria | 3095 |
| 766 | Ga0207659_10049761 | 3300025926 | Bacteria | 2974 |
| 767 | Ga0207659_10054917 | 3300025926 | Bacteria | 2846 |
| 768 | Ga0207659_10266888 | 3300025926 | Bacteria | 1395 |
| 769 | Ga0207659_10843472 | 3300025926 | Bacteria | 788 |
| 770 | Ga0207659_11810958 | 3300025926 | Unclassified | 518 |
| 771 | Ga0207687_10109907 | 3300025927 | Bacteria | 2043 |
| 772 | Ga0207687_10414708 | 3300025927 | Bacteria | 1110 |
| 773 | Ga0207700_10022621 | 3300025928 | Bacteria | 4317 |
| 774 | Ga0207700_10087236 | 3300025928 | Bacteria | 2454 |
| 775 | Ga0207700_10145225 | 3300025928 | Bacteria | 1954 |
| 776 | Ga0207700_10209424 | 3300025928 | Bacteria | 1647 |
| 777 | Ga0207700_10532870 | 3300025928 | Bacteria | 1041 |
| 778 | Ga0207700_10557764 | 3300025928 | Bacteria | 1017 |
| 779 | Ga0207664_10120019 | 3300025929 | Bacteria | 2199 |
| 780 | Ga0207664_10172266 | 3300025929 | Bacteria | 1853 |
| 781 | Ga0207664_10207690 | 3300025929 | Bacteria | 1693 |
| 782 | Ga0207664_10263641 | 3300025929 | Bacteria | 1507 |
| 783 | Ga0207664_11315927 | 3300025929 | Bacteria | 642 |
| 784 | Ga0207644_10029826 | 3300025931 | Bacteria | 3787 |
| 785 | Ga0207644_10035251 | 3300025931 | Bacteria | 3504 |
| 786 | Ga0207644_10049869 | 3300025931 | Bacteria | 2998 |
| 787 | Ga0207644_10092545 | 3300025931 | Bacteria | 2256 |
| 788 | Ga0207644_10101578 | 3300025931 | Bacteria | 2161 |
| 789 | Ga0207644_10112816 | 3300025931 | Bacteria | 2058 |
| 790 | Ga0207644_10166997 | 3300025931 | Bacteria | 1715 |
| 791 | Ga0207644_10187708 | 3300025931 | Bacteria | 1624 |
| 792 | Ga0207644_10221395 | 3300025931 | Bacteria | 1500 |
| 793 | Ga0207644_10515266 | 3300025931 | Bacteria | 988 |
| 794 | Ga0207644_10653564 | 3300025931 | Unclassified | 875 |
| 795 | Ga0207644_10783165 | 3300025931 | Bacteria | 797 |
| 796 | Ga0207644_10813221 | 3300025931 | Bacteria | 782 |
| 797 | Ga0207644_11332041 | 3300025931 | Unclassified | 603 |
| 798 | Ga0207690_10001098 | 3300025932 | Bacteria | 17229 |
| 799 | Ga0207690_10191132 | 3300025932 | Bacteria | 1548 |
| 800 | Ga0207690_10396035 | 3300025932 | Bacteria | 1100 |
| 801 | Ga0207706_10008197 | 3300025933 | Bacteria | 9637 |
| 802 | Ga0207706_10027339 | 3300025933 | Bacteria | 5102 |
| 803 | Ga0207706_10070025 | 3300025933 | Bacteria | 3084 |
| 804 | Ga0207706_10127775 | 3300025933 | Bacteria | 2235 |
| 805 | Ga0207706_10287059 | 3300025933 | Bacteria | 1435 |
| 806 | Ga0207706_10456723 | 3300025933 | Bacteria | 1105 |
| 807 | Ga0207706_10588936 | 3300025933 | Unclassified | 956 |
| 808 | Ga0207706_10660496 | 3300025933 | Unclassified | 895 |
| 809 | Ga0207686_10913136 | 3300025934 | Bacteria | 709 |
| 810 | Ga0207709_10368837 | 3300025935 | Bacteria | 1089 |
| 811 | Ga0207670_10009200 | 3300025936 | Bacteria | 5622 |
| 812 | Ga0207670_10104247 | 3300025936 | Bacteria | 2031 |
| 813 | Ga0207670_10131649 | 3300025936 | Bacteria | 1833 |
| 814 | Ga0207670_10343447 | 3300025936 | Bacteria | 1180 |
| 815 | Ga0207670_10348962 | 3300025936 | Bacteria | 1171 |
| 816 | Ga0207670_10507031 | 3300025936 | Bacteria | 980 |
| 817 | Ga0207670_10706085 | 3300025936 | Unclassified | 835 |
| 818 | Ga0207669_10002532 | 3300025937 | Bacteria | 7802 |
| 819 | Ga0207669_10011026 | 3300025937 | Bacteria | 4378 |
| 820 | Ga0207669_10213532 | 3300025937 | Bacteria | 1410 |
| 821 | Ga0207669_10585160 | 3300025937 | Bacteria | 905 |
| 822 | Ga0207669_10698358 | 3300025937 | Bacteria | 834 |
| 823 | Ga0207669_10811855 | 3300025937 | Unclassified | 776 |
| 824 | Ga0207669_11063791 | 3300025937 | Bacteria | 682 |
| 825 | Ga0207704_10122214 | 3300025938 | Bacteria | 1785 |
| 826 | Ga0207704_10133056 | 3300025938 | Bacteria | 1726 |
| 827 | Ga0207704_10183501 | 3300025938 | Bacteria | 1514 |
| 828 | Ga0207704_10318899 | 3300025938 | Bacteria | 1198 |
| 829 | Ga0207704_10331575 | 3300025938 | Bacteria | 1178 |
| 830 | Ga0207704_11241883 | 3300025938 | Bacteria | 636 |
| 831 | Ga0207704_11945061 | 3300025938 | Unclassified | 506 |
| 832 | Ga0207665_10025655 | 3300025939 | Bacteria | 3889 |
| 833 | Ga0207665_10048049 | 3300025939 | Bacteria | 2863 |
| 834 | Ga0207665_10075192 | 3300025939 | Bacteria | 2313 |
| 835 | Ga0207665_10089858 | 3300025939 | Bacteria | 2128 |
| 836 | Ga0207665_10136465 | 3300025939 | Bacteria | 1746 |
| 837 | Ga0207665_10194109 | 3300025939 | Bacteria | 1477 |
| 838 | Ga0207665_10215560 | 3300025939 | Bacteria | 1405 |
| 839 | Ga0207665_10263985 | 3300025939 | Bacteria | 1276 |
| 840 | Ga0207691_10000142 | 3300025940 | Bacteria | 66224 |
| 841 | Ga0207691_10000247 | 3300025940 | Bacteria | 53502 |
| 842 | Ga0207691_10002644 | 3300025940 | Bacteria | 17504 |
| 843 | Ga0207691_10016028 | 3300025940 | Bacteria | 7119 |
| 844 | Ga0207691_10037047 | 3300025940 | Bacteria | 4518 |
| 845 | Ga0207691_10253085 | 3300025940 | Bacteria | 1520 |
| 846 | Ga0207691_10512972 | 3300025940 | Unclassified | 1018 |
| 847 | Ga0207691_10775711 | 3300025940 | Bacteria | 806 |
| 848 | Ga0207711_10549769 | 3300025941 | Bacteria | 1077 |
| 849 | Ga0207689_10009503 | 3300025942 | Bacteria | 8397 |
| 850 | Ga0207689_10086541 | 3300025942 | Bacteria | 2576 |
| 851 | Ga0207689_10468828 | 3300025942 | Bacteria | 1054 |
| 852 | Ga0207689_10920703 | 3300025942 | Unclassified | 738 |
| 853 | Ga0207661_10031201 | 3300025944 | Bacteria | 4113 |
| 854 | Ga0207661_10077884 | 3300025944 | Bacteria | 2728 |
| 855 | Ga0207661_10124065 | 3300025944 | Bacteria | 2203 |
| 856 | Ga0207661_10653381 | 3300025944 | Bacteria | 966 |
| 857 | Ga0207661_10803283 | 3300025944 | Bacteria | 866 |
| 858 | Ga0207679_10185257 | 3300025945 | Bacteria | 1725 |
| 859 | Ga0207679_10282029 | 3300025945 | Unclassified | 1425 |
| 860 | Ga0207679_11569338 | 3300025945 | Unclassified | 603 |
| 861 | Ga0207667_11021945 | 3300025949 | Bacteria | 813 |
| 862 | Ga0207651_10007253 | 3300025960 | Bacteria | 5894 |
| 863 | Ga0207651_10027669 | 3300025960 | Bacteria | 3565 |
| 864 | Ga0207651_10083018 | 3300025960 | Bacteria | 2315 |
| 865 | Ga0207651_10197170 | 3300025960 | Bacteria | 1610 |
| 866 | Ga0207651_10235820 | 3300025960 | Bacteria | 1488 |
| 867 | Ga0207651_10245165 | 3300025960 | Unclassified | 1463 |
| 868 | Ga0207651_10845199 | 3300025960 | Bacteria | 813 |
| 869 | Ga0207651_11832245 | 3300025960 | Unclassified | 546 |
| 870 | Ga0207712_10010310 | 3300025961 | Bacteria | 5932 |
| 871 | Ga0207712_10328930 | 3300025961 | Bacteria | 1263 |
| 872 | Ga0207712_10542551 | 3300025961 | Bacteria | 999 |
| 873 | Ga0207668_10009836 | 3300025972 | Bacteria | 5747 |
| 874 | Ga0207668_10026495 | 3300025972 | Bacteria | 3764 |
| 875 | Ga0207668_10052709 | 3300025972 | Bacteria | 2816 |
| 876 | Ga0207668_11025480 | 3300025972 | Unclassified | 738 |
| 877 | Ga0207668_11310109 | 3300025972 | Bacteria | 652 |
| 878 | Ga0207640_10886173 | 3300025981 | Bacteria | 778 |
| 879 | Ga0207640_11451827 | 3300025981 | Bacteria | 615 |
| 880 | Ga0207658_10010242 | 3300025986 | Bacteria | 6370 |
| 881 | Ga0207658_10014736 | 3300025986 | Bacteria | 5357 |
| 882 | Ga0207658_10046961 | 3300025986 | Bacteria | 3157 |
| 883 | Ga0207658_10338757 | 3300025986 | Bacteria | 1307 |
| 884 | Ga0207658_10483665 | 3300025986 | Bacteria | 1100 |
| 885 | Ga0207658_10708972 | 3300025986 | Bacteria | 910 |
| 886 | Ga0207658_10831112 | 3300025986 | Unclassified | 839 |
| 887 | Ga0207658_10889835 | 3300025986 | Unclassified | 810 |
| 888 | Ga0207658_12175480 | 3300025986 | Bacteria | 504 |
| 889 | Ga0207677_10008042 | 3300026023 | Bacteria | 5871 |
| 890 | Ga0207677_10020703 | 3300026023 | Bacteria | 4000 |
| 891 | Ga0207677_10109071 | 3300026023 | Bacteria | 2057 |
| 892 | Ga0207677_10188958 | 3300026023 | Unclassified | 1627 |
| 893 | Ga0207677_10650977 | 3300026023 | Bacteria | 930 |
| 894 | Ga0207677_10811172 | 3300026023 | Bacteria | 838 |
| 895 | Ga0207703_10003624 | 3300026035 | Bacteria | 12889 |
| 896 | Ga0207703_10142997 | 3300026035 | Bacteria | 2078 |
| 897 | Ga0207703_10309352 | 3300026035 | Unclassified | 1444 |
| 898 | Ga0207703_10531807 | 3300026035 | Bacteria | 1107 |
| 899 | Ga0207703_10584444 | 3300026035 | Unclassified | 1055 |
| 900 | Ga0207703_10701560 | 3300026035 | Bacteria | 962 |
| 901 | Ga0207703_10989909 | 3300026035 | Unclassified | 807 |
| 902 | Ga0207639_10200729 | 3300026041 | Bacteria | 1710 |
| 903 | Ga0207678_10020455 | 3300026067 | Bacteria | 5804 |
| 904 | Ga0207678_10138642 | 3300026067 | Bacteria | 2076 |
| 905 | Ga0207678_10246654 | 3300026067 | Bacteria | 1529 |
| 906 | Ga0207708_10538280 | 3300026075 | Bacteria | 983 |
| 907 | Ga0207702_10038562 | 3300026078 | Bacteria | 4001 |
| 908 | Ga0207702_11698650 | 3300026078 | Unclassified | 624 |
| 909 | Ga0207702_11966261 | 3300026078 | Unclassified | 575 |
| 910 | Ga0207641_10022387 | 3300026088 | Bacteria | 5202 |
| 911 | Ga0207641_10436029 | 3300026088 | Bacteria | 1264 |
| 912 | Ga0207648_10149163 | 3300026089 | Bacteria | 2063 |
| 913 | Ga0207648_10179022 | 3300026089 | Bacteria | 1876 |
| 914 | Ga0207648_10727172 | 3300026089 | Unclassified | 921 |
| 915 | Ga0207676_10474000 | 3300026095 | Bacteria | 1184 |
| 916 | Ga0207676_10525676 | 3300026095 | Bacteria | 1127 |
| 917 | Ga0207676_11029435 | 3300026095 | Unclassified | 812 |
| 918 | Ga0207676_11180751 | 3300026095 | Unclassified | 758 |
| 919 | Ga0207676_11311066 | 3300026095 | Unclassified | 719 |
| 920 | Ga0207675_100094187 | 3300026118 | Bacteria | 2817 |
| 921 | Ga0207675_100119142 | 3300026118 | Bacteria | 2497 |
| 922 | Ga0207675_100165775 | 3300026118 | Bacteria | 2110 |
| 923 | Ga0207683_10006977 | 3300026121 | Bacteria | 9683 |
| 924 | Ga0207683_10008842 | 3300026121 | Bacteria | 8591 |
| 925 | Ga0207683_10009866 | 3300026121 | Bacteria | 8145 |
| 926 | Ga0207683_10015583 | 3300026121 | Bacteria | 6470 |
| 927 | Ga0207683_10872708 | 3300026121 | Unclassified | 835 |
| 928 | Ga0207683_11529710 | 3300026121 | Bacteria | 616 |
| 929 | Ga0207683_11711425 | 3300026121 | Unclassified | 578 |
| 930 | Ga0207698_10525239 | 3300026142 | Unclassified | 1156 |
| 931 | Ga0209969_1030523 | 3300027360 | Bacteria | 823 |
| 932 | Ga0209967_1044749 | 3300027364 | Unclassified | 676 |
| 933 | Ga0209981_1058211 | 3300027378 | Bacteria | 590 |
| 934 | Ga0209984_1004426 | 3300027424 | Bacteria | 1656 |
| 935 | Ga0209984_1037284 | 3300027424 | Bacteria | 695 |
| 936 | Ga0209999_1004693 | 3300027543 | Bacteria | 2453 |
| 937 | Ga0209982_1046842 | 3300027552 | Bacteria | 694 |
| 938 | Ga0209970_1005891 | 3300027614 | Bacteria | 2014 |
| 939 | Ga0209983_1000280 | 3300027665 | Bacteria | 10618 |
| 940 | Ga0209588_1112866 | 3300027671 | Bacteria | 872 |
| 941 | Ga0209588_1142593 | 3300027671 | Unclassified | 761 |
| 942 | Ga0209588_1214259 | 3300027671 | Bacteria | 597 |
| 943 | Ga0209971_1000384 | 3300027682 | Bacteria | 12081 |
| 944 | Ga0209971_1164380 | 3300027682 | Bacteria | 547 |
| 945 | Ga0209998_10026839 | 3300027717 | Bacteria | 1259 |
| 946 | Ga0209974_10004420 | 3300027876 | Bacteria | 5002 |
| 947 | Ga0209974_10023640 | 3300027876 | Bacteria | 2034 |
| 948 | Ga0209974_10073397 | 3300027876 | Bacteria | 1170 |
| 949 | Ga0207428_10252411 | 3300027907 | Bacteria | 1315 |
| 950 | Ga0207428_10551247 | 3300027907 | Bacteria | 834 |
| 951 | Ga0268266_10004179 | 3300028379 | Bacteria | 13926 |
| 952 | Ga0268266_10026994 | 3300028379 | Bacteria | 4885 |
| 953 | Ga0268266_10076422 | 3300028379 | Bacteria | 2910 |
| 954 | Ga0268266_10141029 | 3300028379 | Bacteria | 2163 |
| 955 | Ga0268266_10219749 | 3300028379 | Bacteria | 1746 |
| 956 | Ga0268266_10371687 | 3300028379 | Unclassified | 1347 |
| 957 | Ga0268266_10395721 | 3300028379 | Bacteria | 1305 |
| 958 | Ga0268266_11176992 | 3300028379 | Unclassified | 741 |
| 959 | Ga0268265_10044999 | 3300028380 | Bacteria | 3290 |
| 960 | Ga0268265_10368503 | 3300028380 | Bacteria | 1318 |
| 961 | Ga0268264_10001807 | 3300028381 | Bacteria | 19555 |
| 962 | Ga0268264_10029276 | 3300028381 | Unclassified | 4509 |
| 963 | Ga0268264_10149965 | 3300028381 | Bacteria | 2089 |
| 964 | Ga0268264_10178518 | 3300028381 | Bacteria | 1926 |
| 965 | Ga0268264_10521444 | 3300028381 | Bacteria | 1162 |
| 966 | Ga0307513_10023335 | 3300031456 | Bacteria | 7230 |
| 967 | Ga0307414_10460102 | 3300032004 | Bacteria | 1118 |
| 968 | Ga0373930_0160298 | 3300034816 | Unclassified | 569 |
| 969 | Ga0373948_0190428 | 3300034817 | Bacteria | 531 |
| 970 | Ga0373959_0161854 | 3300034820 | Bacteria | 572 |
| 971 | Ga0373926_0025205 | 3300035083 | Bacteria | 2075 |
| 972 | Ga0373926_0070283 | 3300035083 | Bacteria | 1286 |
| 973 | Ga0373926_0077902 | 3300035083 | Bacteria | 1223 |
| 974 | Ga0373940_0150688 | 3300035088 | Bacteria | 741 |
| 975 | Ga0373944_0061394 | 3300035089 | Bacteria | 1207 |
| 976 | Ga0373944_0215748 | 3300035089 | Unclassified | 699 |
| 977 | Ga0373944_0253299 | 3300035089 | Bacteria | 650 |
| 978 | Ga0373951_0035882 | 3300035091 | Bacteria | 1182 |
| 979 | Ga0373923_0090520 | 3300035111 | Bacteria | 1338 |
| 980 | Ga0373932_0207585 | 3300035112 | Unclassified | 699 |
| 981 | Ga0373936_0311305 | 3300035113 | Unclassified | 712 |
| 982 | Ga0373936_0412525 | 3300035113 | Bacteria | 621 |
| 983 | Ga0373936_0487609 | 3300035113 | Unclassified | 572 |
| 984 | Ga0373939_0103156 | 3300035114 | Bacteria | 982 |
| 985 | Ga0373941_0205467 | 3300035115 | Bacteria | 751 |
| 986 | Ga0373945_0005962 | 3300035116 | Bacteria | 3914 |
| 987 | Ga0373954_0021155 | 3300035118 | Bacteria | 2944 |
| 988 | Ga0373956_0326539 | 3300035119 | Unclassified | 731 |
| 989 | Ga0373960_0090100 | 3300035121 | Unclassified | 979 |
| 990 | Ga0373943_0005531 | 3300035170 | Bacteria | 5673 |
| 991 | Ga0373943_0057911 | 3300035170 | Bacteria | 1927 |
| 992 | Ga0373943_0080926 | 3300035170 | Bacteria | 1665 |
| 993 | Ga0373943_0235000 | 3300035170 | Bacteria | 1025 |
| 994 | Ga0373943_0283262 | 3300035170 | Unclassified | 938 |
| 995 | Ga0373946_0045201 | 3300035171 | Bacteria | 1821 |
| 996 | Ga0373946_0071572 | 3300035171 | Bacteria | 1499 |
| 997 | Ga0373955_0619939 | 3300035172 | Bacteria | 663 |
| 998 | Ga0373955_0638582 | 3300035172 | Unclassified | 653 |
| 999 | Ga0373942_0339145 | 3300035207 | Unclassified | 529 |
| 1000 | Ga0373961_0244091 | 3300035241 | Unclassified | 648 |
| 1001 | Ga0373931_0108890 | 3300035691 | Bacteria | 1569 |
| 1002 | Ga0373931_0130279 | 3300035691 | Bacteria | 1447 |
| 1003 | Ga0373931_0149850 | 3300035691 | Bacteria | 1359 |
| 1004 | Ga0373931_0234351 | 3300035691 | Bacteria | 1110 |
| 1005 | Ga0373935_0031757 | 3300035692 | Bacteria | 3279 |
| 1006 | Ga0373935_0302849 | 3300035692 | Unclassified | 1130 |
| 1007 | Ga0373935_0314802 | 3300035692 | Bacteria | 1109 |
| 1008 | Ga0373935_0450838 | 3300035692 | Bacteria | 929 |
| 1009 | Ga0373927_0031651 | 3300035695 | Bacteria | 3446 |
| 1010 | Ga0373927_0123175 | 3300035695 | Bacteria | 1692 |
| 1011 | Ga0373927_0176977 | 3300035695 | Bacteria | 1399 |
| 1012 | Ga0373927_0297200 | 3300035695 | Bacteria | 1063 |
| 1013 | Ga0373933_0052084 | 3300035724 | Bacteria | 2448 |
| 1014 | Ga0373947_0036106 | 3300035725 | Bacteria | 2929 |
| 1015 | Ga0373947_0054112 | 3300035725 | Bacteria | 2422 |
| 1016 | Ga0373947_0069919 | 3300035725 | Bacteria | 2150 |
| 1017 | Ga0373947_0099277 | 3300035725 | Bacteria | 1827 |
| 1018 | Ga0373947_0517462 | 3300035725 | Bacteria | 811 |
| 1019 | Ga0373947_1093627 | 3300035725 | Bacteria | 543 |
| 1020 | Ga0373937_0065643 | 3300036401 | Bacteria | 3341 |
| 1021 | Ga0373937_0114836 | 3300036401 | Bacteria | 2506 |
| 1022 | Ga0373937_0124137 | 3300036401 | Bacteria | 2407 |
| 1023 | Ga0373937_0201678 | 3300036401 | Bacteria | 1870 |
| 1024 | Ga0373937_0397543 | 3300036401 | Bacteria | 1307 |
| 1025 | Ga0373925_0006124 | 3300037068 | Bacteria | 8887 |
| 1026 | Ga0373925_0014401 | 3300037068 | Bacteria | 5718 |
| 1027 | Ga0373925_0040917 | 3300037068 | Bacteria | 3433 |
| 1028 | Ga0373925_0460076 | 3300037068 | Bacteria | 1042 |
| 1029 | Ga0373925_0603063 | 3300037068 | Unclassified | 904 |
| 1030 | Ga0373925_0910866 | 3300037068 | Unclassified | 724 |
| 1031 | Ga0373925_1412547 | 3300037068 | Unclassified | 570 |
| 1032 | Ga0395899_0081216 | 3300037312 | Bacteria | 2359 |
| 1033 | Ga0395899_0549618 | 3300037312 | Bacteria | 742 |
| 1034 | Ga0395899_0845785 | 3300037312 | Unclassified | 562 |
| 1035 | Ga0395900_0002526 | 3300037418 | Bacteria | 20035 |
| 1036 | Ga0395900_0008031 | 3300037418 | Bacteria | 10861 |
| 1037 | Ga0395900_0232346 | 3300037418 | Bacteria | 1854 |
| 1038 | Ga0395900_1933523 | 3300037418 | Unclassified | 500 |
| 1039 | Ga0395898_0002044 | 3300037466 | Bacteria | 25218 |
| 1040 | Ga0395898_0041866 | 3300037466 | Bacteria | 4522 |
| 1041 | Ga0395898_0405534 | 3300037466 | Bacteria | 1300 |
| 1042 | Ga0395898_0580639 | 3300037466 | Bacteria | 1063 |
| 1043 | Ga0395898_0913905 | 3300037466 | Unclassified | 816 |
| 1044 | Ga0395905_0045531 | 3300037471 | Bacteria | 4115 |
| 1045 | Ga0395905_0389610 | 3300037471 | Bacteria | 1288 |
| 1046 | Ga0395905_0416146 | 3300037471 | Bacteria | 1240 |
| 1047 | Ga0395905_0703597 | 3300037471 | Bacteria | 913 |
| 1048 | Ga0436364_0440977 | 3300037853 | Bacteria | 999 |
| 1049 | Ga0436364_1193811 | 3300037853 | Bacteria | 3102 |
| 1050 | Ga0395901_0002964 | 3300038443 | Bacteria | 17124 |
| 1051 | Ga0395901_0039538 | 3300038443 | Bacteria | 4881 |
| 1052 | Ga0395901_0083535 | 3300038443 | Bacteria | 3338 |
| 1053 | Ga0395901_0280015 | 3300038443 | Bacteria | 1733 |
| 1054 | Ga0395901_0703660 | 3300038443 | Bacteria | 1008 |
| 1055 | Ga0436365_0026349 | 3300039437 | Bacteria | 2262 |
| 1056 | Ga0436365_1454817 | 3300039437 | Bacteria | 8544 |
| 1057 | Ga0436360_1356494 | 3300039438 | Unclassified | 538 |
| 1058 | Ga0436363_0428075 | 3300039450 | Bacteria | 713 |
| 1059 | Ga0436362_0051725 | 3300039453 | Bacteria | 2518 |
| 1060 | Ga0451795_0218717 | 3300041456 | Bacteria | 1245 |
| 1061 | Ga0451795_1070674 | 3300041456 | Unclassified | 508 |
| 1062 | Ga0451795_1097033 | 3300041456 | Bacteria | 1235 |
| 1063 | Ga0451798_0051088 | 3300041458 | Bacteria | 786 |
| 1064 | Ga0451800_0294886 | 3300041459 | Unclassified | 893 |
| 1065 | Ga0451802_1916692 | 3300041460 | Unclassified | 505 |
| 1066 | Ga0451807_0465582 | 3300041486 | Bacteria | 836 |
| 1067 | Ga0451807_2171196 | 3300041486 | Unclassified | 883 |
| 1068 | Ga0451837_0657191 | 3300041494 | Unclassified | 515 |
| 1069 | Ga0451839_0785113 | 3300041496 | Unclassified | 647 |
| 1070 | Ga0451855_0504270 | 3300041511 | Bacteria | 957 |
| 1071 | Ga0451855_1662967 | 3300041511 | Bacteria | 1322 |
| 1072 | Ga0451853_0537436 | 3300041512 | Bacteria | 1055 |
| 1073 | Ga0451853_0644242 | 3300041512 | Unclassified | 804 |
| 1074 | Ga0439448_0066736 | 3300042005 | Bacteria | 1195 |
| 1075 | Ga0439448_0090520 | 3300042005 | Bacteria | 1033 |
| 1076 | Ga0439451_017252 | 3300042009 | Bacteria | 1455 |
| 1077 | Ga0439464_0019868 | 3300042439 | Bacteria | 1836 |
| 1078 | Ga0439464_0127029 | 3300042439 | Bacteria | 788 |
| 1079 | Ga0439460_0120465 | 3300042461 | Unclassified | 858 |
| 1080 | Ga0451577_0003056 | 3300042876 | Bacteria | 19007 |
| 1081 | Ga0453683_0012218 | 3300044673 | Bacteria | 5632 |
| 1082 | Ga0453684_0033176 | 3300044712 | Bacteria | 7203 |
| 1083 | Ga0453684_0818663 | 3300044712 | Bacteria | 1003 |
| 1084 | Ga0453684_1160797 | 3300044712 | Unclassified | 813 |
| 1085 | Ga0451576_0000055 | 3300045051 | Bacteria | 304830 |
| 1086 | Ga0451576_0032997 | 3300045051 | Bacteria | 5505 |
| 1087 | Ga0451576_0230708 | 3300045051 | Bacteria | 1933 |
| 1088 | Ga0451576_0271845 | 3300045051 | Bacteria | 1772 |
| 1089 | Ga0451576_0289458 | 3300045051 | Bacteria | 1713 |
| 1090 | Ga0451576_0359913 | 3300045051 | Bacteria | 1524 |
| 1091 | Ga0466967_0032556 | 3300045976 | Bacteria | 4403 |
| 1092 | Ga0466967_0230794 | 3300045976 | Bacteria | 1762 |
| 1093 | Ga0495592_0013560 | 3300046454 | Bacteria | 6201 |
| 1094 | Ga0495603_0055534 | 3300046455 | Bacteria | 2346 |
| 1095 | Ga0495629_0008333 | 3300046459 | Bacteria | 7622 |
| 1096 | Ga0495629_0286104 | 3300046459 | Bacteria | 1130 |
| 1097 | Ga0495641_0080416 | 3300046461 | Bacteria | 1460 |
| 1098 | Ga0495651_0232273 | 3300046462 | Bacteria | 1269 |
| 1099 | Ga0495653_0463193 | 3300046463 | Unclassified | 795 |
| 1100 | Ga0495653_0692492 | 3300046463 | Unclassified | 619 |
| 1101 | Ga0495580_0064954 | 3300046472 | Bacteria | 2557 |
| 1102 | Ga0495580_0107757 | 3300046472 | Bacteria | 1935 |
| 1103 | Ga0495580_0165118 | 3300046472 | Bacteria | 1532 |
| 1104 | Ga0495580_0186167 | 3300046472 | Bacteria | 1433 |
| 1105 | Ga0495580_0319707 | 3300046472 | Bacteria | 1055 |
| 1106 | Ga0495582_0177182 | 3300046473 | Unclassified | 1214 |
| 1107 | Ga0495605_0241838 | 3300046474 | Unclassified | 775 |
| 1108 | Ga0495605_0492088 | 3300046474 | Unclassified | 502 |
| 1109 | Ga0495662_0069387 | 3300046476 | Bacteria | 1707 |
| 1110 | Ga0495664_0197075 | 3300046477 | Bacteria | 1221 |
| 1111 | Ga0495664_0202283 | 3300046477 | Bacteria | 1203 |
| 1112 | Ga0495584_0022505 | 3300046491 | Bacteria | 3197 |
| 1113 | Ga0495584_0532480 | 3300046491 | Unclassified | 599 |
| 1114 | Ga0495585_0274372 | 3300046492 | Bacteria | 835 |
| 1115 | Ga0495607_0294471 | 3300046501 | Bacteria | 766 |
| 1116 | Ga0495608_0655926 | 3300046511 | Unclassified | 627 |
| 1117 | Ga0495628_0040395 | 3300046516 | Bacteria | 3728 |
| 1118 | Ga0495628_0208490 | 3300046516 | Bacteria | 1470 |
| 1119 | Ga0495628_0528697 | 3300046516 | Bacteria | 849 |
| 1120 | Ga0495630_0017678 | 3300046517 | Bacteria | 5227 |
| 1121 | Ga0495630_0041206 | 3300046517 | Bacteria | 3448 |
| 1122 | Ga0495630_0228479 | 3300046517 | Unclassified | 1421 |
| 1123 | Ga0495630_0465867 | 3300046517 | Unclassified | 968 |
| 1124 | Ga0495631_0478114 | 3300046518 | Unclassified | 531 |
| 1125 | Ga0495637_0089666 | 3300046520 | Bacteria | 1215 |
| 1126 | Ga0495644_0227498 | 3300046523 | Bacteria | 722 |
| 1127 | Ga0495644_0449758 | 3300046523 | Unclassified | 513 |
| 1128 | Ga0495666_0100205 | 3300046526 | Bacteria | 1365 |
| 1129 | Ga0495642_0022869 | 3300046528 | Bacteria | 2465 |
| 1130 | Ga0495642_0222200 | 3300046528 | Bacteria | 825 |
| 1131 | Ga0495652_0045601 | 3300046529 | Bacteria | 3767 |
| 1132 | Ga0495652_1020926 | 3300046529 | Unclassified | 540 |
| 1133 | Ga0495665_0043688 | 3300046531 | Bacteria | 2383 |
| 1134 | Ga0495640_0432390 | 3300046533 | Unclassified | 805 |
| 1135 | Ga0495586_0014140 | 3300046535 | Bacteria | 4240 |
| 1136 | Ga0495587_0009500 | 3300046536 | Bacteria | 6231 |
| 1137 | Ga0495598_0000901 | 3300046537 | Bacteria | 5725 |
| 1138 | Ga0495598_0027087 | 3300046537 | Bacteria | 1578 |
| 1139 | Ga0495598_0048134 | 3300046537 | Bacteria | 1274 |
| 1140 | Ga0495598_0095720 | 3300046537 | Unclassified | 975 |
| 1141 | Ga0495621_0309943 | 3300046539 | Unclassified | 656 |
| 1142 | Ga0495597_0185047 | 3300046542 | Bacteria | 840 |
| 1143 | Ga0495645_0001076 | 3300046543 | Bacteria | 18525 |
| 1144 | Ga0495633_0154083 | 3300046558 | Bacteria | 1061 |
| 1145 | Ga0495667_0561934 | 3300046559 | Unclassified | 712 |
| 1146 | Ga0495656_0268106 | 3300046615 | Unclassified | 867 |
| 1147 | Ga0495635_0281409 | 3300046663 | Bacteria | 1117 |
| 1148 | Ga0495635_0394740 | 3300046663 | Unclassified | 919 |
| 1149 | Ga0495659_0087755 | 3300046664 | Bacteria | 1190 |
| 1150 | Ga0495659_0121259 | 3300046664 | Bacteria | 1030 |
| 1151 | Ga0495659_0129759 | 3300046664 | Bacteria | 999 |
| 1152 | Ga0495659_0247028 | 3300046664 | Bacteria | 743 |
| 1153 | Ga0495661_0227291 | 3300046665 | Bacteria | 964 |
| 1154 | Ga0495588_0066650 | 3300046674 | Bacteria | 1869 |
| 1155 | Ga0495588_0148087 | 3300046674 | Unclassified | 1241 |
| 1156 | Ga0495657_0218503 | 3300046675 | Bacteria | 1156 |
| 1157 | Ga0495657_0357846 | 3300046675 | Unclassified | 863 |
| 1158 | Ga0495599_0000317 | 3300046678 | Bacteria | 28802 |
| 1159 | Ga0495623_0000811 | 3300046679 | Bacteria | 21045 |
| 1160 | Ga0495646_0002940 | 3300046680 | Bacteria | 10561 |
| 1161 | Ga0495647_0028223 | 3300046681 | Bacteria | 2068 |
| 1162 | Ga0495647_0058248 | 3300046681 | Bacteria | 1518 |
| 1163 | Ga0495658_0129662 | 3300046683 | Bacteria | 1534 |
| 1164 | Ga0495658_0141734 | 3300046683 | Bacteria | 1470 |
| 1165 | Ga0495669_0009247 | 3300046684 | Bacteria | 4152 |
| 1166 | Ga0495669_0142072 | 3300046684 | Bacteria | 1133 |
| 1167 | Ga0495669_0385127 | 3300046684 | Unclassified | 679 |
| 1168 | Ga0495613_0124871 | 3300046689 | Bacteria | 1846 |
| 1169 | Ga0495613_0213064 | 3300046689 | Bacteria | 1358 |
| 1170 | Ga0495670_0321637 | 3300046691 | Unclassified | 831 |
| 1171 | Ga0495600_0196305 | 3300046809 | Bacteria | 1297 |
| 1172 | Ga0495581_0123308 | 3300047315 | Bacteria | 1508 |
| 1173 | Ga0495604_0053697 | 3300047317 | Bacteria | 3112 |
| 1174 | Ga0495604_0233324 | 3300047317 | Bacteria | 1261 |
| 1175 | Ga0495604_0276899 | 3300047317 | Bacteria | 1135 |
| 1176 | Ga0495604_0869028 | 3300047317 | Unclassified | 565 |
| 1177 | Ga0495636_0128954 | 3300047318 | Bacteria | 1124 |
| 1178 | Ga0495636_0136190 | 3300047318 | Bacteria | 1095 |
| 1179 | Ga0495674_0047362 | 3300047319 | Bacteria | 3813 |
| 1180 | Ga0495674_1186421 | 3300047319 | Unclassified | 577 |
| 1181 | Ga0495675_0002584 | 3300047444 | Bacteria | 10850 |
| 1182 | Ga0495675_0010133 | 3300047444 | Bacteria | 5878 |
| 1183 | Ga0495679_072938 | 3300047446 | Bacteria | 986 |
| 1184 | Ga0495681_0155566 | 3300047470 | Unclassified | 956 |
| 1185 | Ga0495684_0063571 | 3300047471 | Bacteria | 2805 |
| 1186 | Ga0495684_0441974 | 3300047471 | Unclassified | 905 |
| 1187 | Ga0495593_0125575 | 3300047673 | Bacteria | 1304 |
| 1188 | Ga0495602_0017278 | 3300048088 | Bacteria | 7234 |
| 1189 | Ga0495602_0319298 | 3300048088 | Unclassified | 1130 |
| 1190 | Ga0495614_0256744 | 3300048089 | Unclassified | 800 |
| 1191 | Ga0495626_0436823 | 3300048091 | Bacteria | 504 |
| 1192 | Ga0496100_0021201 | 3300048903 | Bacteria | 3910 |
| 1193 | Ga0496100_0156080 | 3300048903 | Bacteria | 1632 |
| 1194 | Ga0496101_0031362 | 3300048904 | Bacteria | 3735 |
| 1195 | Ga0496101_0033960 | 3300048904 | Bacteria | 3602 |
| 1196 | Ga0496101_0108830 | 3300048904 | Bacteria | 2084 |
| 1197 | Ga0496101_0332739 | 3300048904 | Bacteria | 1192 |
| 1198 | Ga0496101_0436945 | 3300048904 | Unclassified | 1032 |
| 1199 | Ga0496101_1349063 | 3300048904 | Unclassified | 557 |
| 1200 | Ga0496102_0009851 | 3300048905 | Bacteria | 8216 |
| 1201 | Ga0496102_0028763 | 3300048905 | Bacteria | 4968 |
| 1202 | Ga0496102_0035336 | 3300048905 | Bacteria | 4498 |
| 1203 | Ga0496102_0367403 | 3300048905 | Bacteria | 1354 |
| 1204 | Ga0496102_1084114 | 3300048905 | Unclassified | 721 |
| 1205 | Ga0496102_1138239 | 3300048905 | Unclassified | 700 |
| 1206 | Ga0496103_0011535 | 3300048906 | Bacteria | 5238 |
| 1207 | Ga0496103_0019686 | 3300048906 | Bacteria | 4052 |
| 1208 | Ga0496103_0191846 | 3300048906 | Bacteria | 1314 |
| 1209 | Ga0496104_0012446 | 3300048907 | Bacteria | 7651 |
| 1210 | Ga0496104_0072184 | 3300048907 | Bacteria | 3282 |
| 1211 | Ga0496104_0077845 | 3300048907 | Bacteria | 3160 |
| 1212 | Ga0496104_0159226 | 3300048907 | Bacteria | 2166 |
| 1213 | Ga0496104_0367572 | 3300048907 | Bacteria | 1351 |
| 1214 | Ga0496104_0403967 | 3300048907 | Bacteria | 1278 |
| 1215 | Ga0496104_0500938 | 3300048907 | Bacteria | 1126 |
| 1216 | Ga0496104_1370905 | 3300048907 | Unclassified | 610 |
| 1217 | Ga0496105_0044348 | 3300048908 | Bacteria | 3668 |
| 1218 | Ga0496105_0162019 | 3300048908 | Unclassified | 1836 |
| 1219 | Ga0496105_0168019 | 3300048908 | Bacteria | 1799 |
| 1220 | Ga0496105_0209619 | 3300048908 | Bacteria | 1589 |
| 1221 | Ga0496105_0334842 | 3300048908 | Bacteria | 1211 |
| 1222 | Ga0496106_0002174 | 3300048909 | Bacteria | 14655 |
| 1223 | Ga0496106_0023076 | 3300048909 | Bacteria | 4621 |
| 1224 | Ga0496106_0083615 | 3300048909 | Bacteria | 2455 |
| 1225 | Ga0496106_0281934 | 3300048909 | Bacteria | 1331 |
| 1226 | Ga0496106_0386891 | 3300048909 | Bacteria | 1124 |
| 1227 | Ga0496106_0695051 | 3300048909 | Unclassified | 811 |
| 1228 | Ga0496106_0954534 | 3300048909 | Unclassified | 676 |
| 1229 | Ga0496107_0018540 | 3300048910 | Bacteria | 4901 |
| 1230 | Ga0496107_0170479 | 3300048910 | Bacteria | 1615 |
| 1231 | Ga0496107_0211431 | 3300048910 | Bacteria | 1442 |
| 1232 | Ga0496107_0549569 | 3300048910 | Unclassified | 855 |
| 1233 | Ga0496107_1223414 | 3300048910 | Unclassified | 539 |
| 1234 | Ga0496108_0032258 | 3300048911 | Bacteria | 4350 |
| 1235 | Ga0496108_0042309 | 3300048911 | Bacteria | 3803 |
| 1236 | Ga0496108_0150540 | 3300048911 | Bacteria | 2008 |
| 1237 | Ga0496108_0202863 | 3300048911 | Bacteria | 1721 |
| 1238 | Ga0496108_0299120 | 3300048911 | Bacteria | 1402 |
| 1239 | Ga0496108_0455425 | 3300048911 | Bacteria | 1118 |
| 1240 | Ga0496108_0878263 | 3300048911 | Bacteria | 770 |
| 1241 | Ga0496109_0063355 | 3300048912 | Bacteria | 3382 |
| 1242 | Ga0496109_0080035 | 3300048912 | Bacteria | 3010 |
| 1243 | Ga0496109_0271092 | 3300048912 | Bacteria | 1599 |
| 1244 | Ga0496109_0293107 | 3300048912 | Bacteria | 1534 |
| 1245 | Ga0496109_0337800 | 3300048912 | Bacteria | 1422 |
| 1246 | Ga0496109_0396259 | 3300048912 | Bacteria | 1304 |
| 1247 | Ga0496109_0486714 | 3300048912 | Bacteria | 1165 |
| 1248 | Ga0496109_0534195 | 3300048912 | Bacteria | 1106 |
| 1249 | Ga0496110_0097184 | 3300048913 | Bacteria | 2639 |
| 1250 | Ga0496110_0171464 | 3300048913 | Bacteria | 1969 |
| 1251 | Ga0496110_0209515 | 3300048913 | Bacteria | 1772 |
| 1252 | Ga0496110_0325509 | 3300048913 | Bacteria | 1400 |
| 1253 | Ga0496110_0472005 | 3300048913 | Bacteria | 1143 |
| 1254 | Ga0496110_1014764 | 3300048913 | Bacteria | 737 |
| 1255 | Ga0496111_0184825 | 3300048914 | Bacteria | 1550 |
| 1256 | Ga0496111_0204705 | 3300048914 | Bacteria | 1466 |
| 1257 | Ga0496111_0362231 | 3300048914 | Bacteria | 1073 |
| 1258 | Ga0496111_0395934 | 3300048914 | Bacteria | 1021 |
| 1259 | Ga0496111_0440872 | 3300048914 | Unclassified | 961 |
| 1260 | Ga0496111_0626273 | 3300048914 | Unclassified | 786 |
| 1261 | Ga0496112_0017121 | 3300048915 | Bacteria | 6804 |
| 1262 | Ga0496112_0050307 | 3300048915 | Bacteria | 4086 |
| 1263 | Ga0496112_0087521 | 3300048915 | Bacteria | 3082 |
| 1264 | Ga0496112_0106562 | 3300048915 | Bacteria | 2773 |
| 1265 | Ga0496112_0141497 | 3300048915 | Bacteria | 2375 |
| 1266 | Ga0496112_0155440 | 3300048915 | Unclassified | 2254 |
| 1267 | Ga0496112_0180552 | 3300048915 | Bacteria | 2074 |
| 1268 | Ga0496112_0231179 | 3300048915 | Bacteria | 1804 |
| 1269 | Ga0496112_0426235 | 3300048915 | Bacteria | 1265 |
| 1270 | Ga0496112_0731749 | 3300048915 | Bacteria | 916 |
| 1271 | Ga0496112_0915914 | 3300048915 | Unclassified | 798 |
| 1272 | Ga0496112_1008795 | 3300048915 | Bacteria | 752 |
| 1273 | Ga0496112_1269759 | 3300048915 | Bacteria | 652 |
| 1274 | Ga0496113_0069914 | 3300048916 | Bacteria | 2667 |
| 1275 | Ga0496113_0140358 | 3300048916 | Bacteria | 1901 |
| 1276 | Ga0496113_0180835 | 3300048916 | Bacteria | 1672 |
| 1277 | Ga0496113_0519020 | 3300048916 | Bacteria | 956 |
| 1278 | Ga0496113_0714352 | 3300048916 | Unclassified | 799 |
| 1279 | Ga0496113_0925727 | 3300048916 | Unclassified | 689 |
| 1280 | Ga0496113_1075709 | 3300048916 | Unclassified | 631 |
| 1281 | Ga0496114_0012996 | 3300048917 | Bacteria | 6672 |
| 1282 | Ga0496114_0012997 | 3300048917 | Bacteria | 6672 |
| 1283 | Ga0496114_0591740 | 3300048917 | Bacteria | 978 |
| 1284 | Ga0496114_1344397 | 3300048917 | Unclassified | 602 |
| 1285 | Ga0496115_0002575 | 3300048918 | Bacteria | 13018 |
| 1286 | Ga0496115_0004314 | 3300048918 | Bacteria | 10290 |
| 1287 | Ga0496115_0009615 | 3300048918 | Bacteria | 7191 |
| 1288 | Ga0496115_0026271 | 3300048918 | Bacteria | 4543 |
| 1289 | Ga0496115_0091504 | 3300048918 | Bacteria | 2486 |
| 1290 | Ga0496115_0163516 | 3300048918 | Bacteria | 1840 |
| 1291 | Ga0496115_0674581 | 3300048918 | Bacteria | 815 |
| 1292 | Ga0501323_033420 | 3300049539 | Bacteria | 731 |
| 1293 | Ga0501036_1203504 | 3300049572 | Bacteria | 617 |
| 1294 | Ga0501038_0198598 | 3300049574 | Bacteria | 1611 |
| 1295 | Ga0501048_0931269 | 3300049582 | Bacteria | 625 |
| 1296 | Ga0501068_0554486 | 3300049584 | Unclassified | 747 |
| 1297 | Ga0501070_0658494 | 3300049586 | Unclassified | 831 |
| 1298 | Ga0501072_0079503 | 3300049588 | Bacteria | 2597 |
| 1299 | Ga0501073_0037486 | 3300049589 | Bacteria | 3442 |
| 1300 | Ga0501074_0067186 | 3300049590 | Bacteria | 2579 |
| 1301 | Ga0501075_0201190 | 3300049591 | Bacteria | 1519 |
| 1302 | Ga0501079_0039652 | 3300049741 | Bacteria | 3632 |
| 1303 | Ga0501080_0078950 | 3300049742 | Bacteria | 3060 |
| 1304 | Ga0501081_0042874 | 3300049743 | Bacteria | 3102 |
| 1305 | Ga0501269_026792 | 3300049766 | Bacteria | 730 |
| 1306 | nmdc:mga05p37_135223_c1 | 3300050507 | Bacteria | 3024 |
| 1307 | nmdc:mga05p37_140290_c1 | 3300050507 | Bacteria | 2961 |
| 1308 | nmdc:mga05p37_1701_c1 | 3300050507 | Bacteria | 25630 |
| 1309 | nmdc:mga05p37_468622_c1 | 3300050507 | Bacteria | 1454 |
| 1310 | nmdc:mga08y16_1151339_c1 | 3300050511 | Bacteria | 748 |
| 1311 | nmdc:mga08y16_1272337_c1 | 3300050511 | Bacteria | 703 |
| 1312 | nmdc:mga08y16_2132647_c1 | 3300050511 | Unclassified | 508 |
| 1313 | nmdc:mga08y16_724873_c1 | 3300050511 | Bacteria | 992 |
| 1314 | nmdc:mga08y16_786981_c1 | 3300050511 | Bacteria | 945 |
| 1315 | nmdc:mga0n895_15345_c1 | 3300050512 | Bacteria | 6981 |
| 1316 | nmdc:mga0n895_344747_c1 | 3300050512 | Bacteria | 1509 |
| 1317 | nmdc:mga0n895_507216_c1 | 3300050512 | Bacteria | 1215 |
| 1318 | nmdc:mga0n895_575194_c1 | 3300050512 | Bacteria | 1131 |
| 1319 | nmdc:mga0n895_764651_c1 | 3300050512 | Unclassified | 958 |
| 1320 | nmdc:mga0rr50_1043890_c1 | 3300050513 | Unclassified | 696 |
| 1321 | nmdc:mga0rr50_1337496_c1 | 3300050513 | Bacteria | 607 |
| 1322 | nmdc:mga0rr50_772511_c1 | 3300050513 | Bacteria | 820 |
| 1323 | nmdc:mga0rr50_968519_c1 | 3300050513 | Bacteria | 725 |
| 1324 | nmdc:mga08x19_576507_c1 | 3300050514 | Unclassified | 797 |
| 1325 | nmdc:mga08x19_80561_c1 | 3300050514 | Bacteria | 2137 |
| 1326 | nmdc:mga0a205_392963_c1 | 3300050515 | Bacteria | 1251 |
| 1327 | nmdc:mga0a205_442986_c1 | 3300050515 | Bacteria | 1159 |
| 1328 | nmdc:mga0a205_480816_c1 | 3300050515 | Bacteria | 1100 |
| 1329 | nmdc:mga0a205_8807_c1 | 3300050515 | Bacteria | 9192 |
| 1330 | Ga0495601_0001921 | 3300053077 | Bacteria | 11624 |
| 1331 | Ga0495601_0180268 | 3300053077 | Bacteria | 1381 |
| 1332 | Ga0495619_0108420 | 3300053085 | Bacteria | 1895 |
| 1333 | Ga0500643_172821 | 3300053087 | Unclassified | 579 |
| 1334 | Ga0500555_000015 | 3300053103 | Bacteria | 230204 |
| 1335 | Ga0500568_0043000 | 3300053139 | Bacteria | 1807 |
| 1336 | Ga0500616_0003906 | 3300053153 | Bacteria | 10963 |
| 1337 | Ga0500616_0006989 | 3300053153 | Bacteria | 7263 |
| 1338 | Ga0501084_0195523 | 3300054114 | Bacteria | 1706 |
| 1339 | Ga0501082_0025331 | 3300060353 | Bacteria | 5112 |
| 1340 | Ga0182008_10130751 | |||
| 1341 | SwRhRL2b_contig_3185009 | |||
| 1342 | 2214871332 | |||
| 1343 | JGI24035J14997_100183 | |||
| 1344 | JGI24746J21847_1007470 | |||
| 1345 | JGI24737J22298_10073669 | |||
| 1346 | JGI24748J21848_1058165 | |||
| 1347 | JGI24744J21845_10009043 | |||
| 1348 | JGI24035J26624_1000379 | |||
| 1349 | JGI24035J26624_1001833 | |||
| 1350 | JGI24035J26624_1006039 | |||
| 1351 | JGI24035J26624_1008033 | |||
| 1352 | JGI25406J46586_10000007 | |||
| 1353 | JGI25405J52794_10003510 | |||
| 1354 | JGI25405J52794_10007684 | |||
| 1355 | Ga0065714_10099910 | |||
| 1356 | Ga0065704_10002652 | |||
| 1357 | Ga0065704_10154003 | |||
| 1358 | Ga0065704_10172946 | |||
| 1359 | Ga0065704_10659453 | |||
| 1360 | Ga0065712_10006848 | |||
| 1361 | Ga0065712_10040837 | |||
| 1362 | Ga0065712_10070849 | |||
| 1363 | Ga0065712_10084132 | |||
| 1364 | Ga0065712_10088457 | |||
| 1365 | Ga0065712_10099828 | |||
| 1366 | Ga0065712_10108970 | |||
| 1367 | Ga0065712_10130323 | |||
| 1368 | Ga0065712_10325714 | |||
| 1369 | Ga0065712_10462430 | |||
| 1370 | Ga0065715_10005423 | |||
| 1371 | Ga0065715_10090524 | |||
| 1372 | Ga0065715_10114446 | |||
| 1373 | Ga0065715_10136006 | |||
| 1374 | Ga0065715_10159921 | |||
| 1375 | Ga0065715_10181691 | |||
| 1376 | Ga0065715_10222055 | |||
| 1377 | Ga0065715_10225288 | |||
| 1378 | Ga0065715_10242281 | |||
| 1379 | Ga0065715_10254589 | |||
| 1380 | Ga0065715_10334136 | |||
| 1381 | Ga0065715_10350677 | |||
| 1382 | Ga0065715_10427404 | |||
| 1383 | Ga0065707_10009888 | |||
| 1384 | Ga0065707_10233776 | |||
| 1385 | Ga0065707_10608558 | |||
| 1386 | Ga0070658_10080732 | |||
| 1387 | Ga0070658_10410039 | |||
| 1388 | Ga0070658_11783697 | |||
| 1389 | Ga0070676_10023857 | |||
| 1390 | Ga0070676_10032758 | |||
| 1391 | Ga0070676_10069962 | |||
| 1392 | Ga0070676_10108518 | |||
| 1393 | Ga0070676_10202196 | |||
| 1394 | Ga0070676_11182432 | |||
| 1395 | Ga0070683_100026491 | |||
| 1396 | Ga0070683_100054847 | |||
| 1397 | Ga0070683_100055457 | |||
| 1398 | Ga0070683_100495741 | |||
| 1399 | Ga0070683_100832067 | |||
| 1400 | Ga0070683_100899954 | |||
| 1401 | Ga0070690_100052450 | |||
| 1402 | Ga0070690_100056424 | |||
| 1403 | Ga0070690_100167796 | |||
| 1404 | Ga0070690_100399974 | |||
| 1405 | Ga0070670_100000833 | |||
| 1406 | Ga0070670_100003742 | |||
| 1407 | Ga0070670_100136296 | |||
| 1408 | Ga0070670_100620275 | |||
| 1409 | Ga0070670_100869512 | |||
| 1410 | Ga0070677_10137184 | |||
| 1411 | Ga0070677_10383944 | |||
| 1412 | Ga0068869_100113989 | |||
| 1413 | Ga0068869_100720816 | |||
| 1414 | Ga0068869_100930508 | |||
| 1415 | Ga0070666_10001876 | |||
| 1416 | Ga0070666_10002056 | |||
| 1417 | Ga0070666_10097738 | |||
| 1418 | Ga0070666_10121884 | |||
| 1419 | Ga0070666_10760310 | |||
| 1420 | Ga0070680_100100517 | |||
| 1421 | Ga0070680_100348965 | |||
| 1422 | Ga0070680_100488806 | |||
| 1423 | Ga0070682_100426049 | |||
| 1424 | Ga0068868_100031366 | |||
| 1425 | Ga0068868_100096533 | |||
| 1426 | Ga0068868_100199105 | |||
| 1427 | Ga0068868_100697156 | |||
| 1428 | Ga0068868_102359363 | |||
| 1429 | Ga0070660_100023190 | |||
| 1430 | Ga0070660_100378975 | |||
| 1431 | Ga0070660_100647314 | |||
| 1432 | Ga0070689_100021098 | |||
| 1433 | Ga0070689_100064515 | |||
| 1434 | Ga0070689_100100534 | |||
| 1435 | Ga0070689_100145272 | |||
| 1436 | Ga0070689_100273588 | |||
| 1437 | Ga0070689_100842260 | |||
| 1438 | Ga0070687_100000382 | |||
| 1439 | Ga0070687_100114661 | |||
| 1440 | Ga0070661_100062340 | |||
| 1441 | Ga0070661_100292077 | |||
| 1442 | Ga0070661_100393326 | |||
| 1443 | Ga0070661_100838629 | |||
| 1444 | Ga0070692_10001104 | |||
| 1445 | Ga0070692_10107559 | |||
| 1446 | Ga0070668_100000403 | |||
| 1447 | Ga0070668_100050196 | |||
| 1448 | Ga0070668_100050229 | |||
| 1449 | Ga0070668_100056885 | |||
| 1450 | Ga0070668_100056962 | |||
| 1451 | Ga0070668_100069825 | |||
| 1452 | Ga0070668_100135575 | |||
| 1453 | Ga0070668_100258296 | |||
| 1454 | Ga0070669_100002011 | |||
| 1455 | Ga0070669_100006097 | |||
| 1456 | Ga0070669_100125169 | |||
| 1457 | Ga0070669_100300055 | |||
| 1458 | Ga0070669_100483782 | |||
| 1459 | Ga0070669_100852327 | |||
| 1460 | Ga0070675_100004678 | |||
| 1461 | Ga0070675_100048534 | |||
| 1462 | Ga0070675_100083047 | |||
| 1463 | Ga0070675_100129528 | |||
| 1464 | Ga0070675_100135890 | |||
| 1465 | Ga0070675_100158863 | |||
| 1466 | Ga0070675_100200776 | |||
| 1467 | Ga0070675_100295769 | |||
| 1468 | Ga0070675_100429872 | |||
| 1469 | Ga0070675_100755041 | |||
| 1470 | Ga0070671_100000283 | |||
| 1471 | Ga0070671_100011134 | |||
| 1472 | Ga0070671_100042031 | |||
| 1473 | Ga0070671_100047998 | |||
| 1474 | Ga0070671_100054306 | |||
| 1475 | Ga0070671_100187898 | |||
| 1476 | Ga0070671_100286550 | |||
| 1477 | Ga0070671_100333656 | |||
| 1478 | Ga0070671_100614611 | |||
| 1479 | Ga0070671_100623853 | |||
| 1480 | Ga0070671_100853150 | |||
| 1481 | Ga0070674_100007500 | |||
| 1482 | Ga0070674_100064027 | |||
| 1483 | Ga0070674_100222619 | |||
| 1484 | Ga0070674_100376888 | |||
| 1485 | Ga0070673_100008141 | |||
| 1486 | Ga0070673_100014325 | |||
| 1487 | Ga0070673_100075213 | |||
| 1488 | Ga0070673_100163504 | |||
| 1489 | Ga0070673_100283494 | |||
| 1490 | Ga0070673_100476403 | |||
| 1491 | Ga0070688_100000733 | |||
| 1492 | Ga0070688_100001414 | |||
| 1493 | Ga0070688_100016452 | |||
| 1494 | Ga0070688_100054122 | |||
| 1495 | Ga0070688_100102629 | |||
| 1496 | Ga0070659_100001154 | |||
| 1497 | Ga0070659_100002483 | |||
| 1498 | Ga0070659_100117793 | |||
| 1499 | Ga0070659_100340292 | |||
| 1500 | Ga0070659_100981448 | |||
| 1501 | Ga0070659_101608257 | |||
| 1502 | Ga0070667_100004665 | |||
| 1503 | Ga0070667_100010004 | |||
| 1504 | Ga0070667_100320999 | |||
| 1505 | Ga0070667_100509990 | |||
| 1506 | Ga0070667_100821221 | |||
| 1507 | Ga0070667_101061349 | |||
| 1508 | Ga0070667_101517174 | |||
| 1509 | Ga0070709_10176197 | |||
| 1510 | Ga0070709_10246697 | |||
| 1511 | Ga0070709_11624732 | |||
| 1512 | Ga0070714_100207992 | |||
| 1513 | Ga0070714_100286340 | |||
| 1514 | Ga0070714_101115819 | |||
| 1515 | Ga0070714_102135992 | |||
| 1516 | Ga0070714_102328832 | |||
| 1517 | Ga0070713_100019600 | |||
| 1518 | Ga0070713_100040250 | |||
| 1519 | Ga0070713_100048466 | |||
| 1520 | Ga0070713_100182167 | |||
| 1521 | Ga0070713_100214091 | |||
| 1522 | Ga0070713_101066359 | |||
| 1523 | Ga0070713_102475417 | |||
| 1524 | Ga0070710_10048829 | |||
| 1525 | Ga0070710_10132576 | |||
| 1526 | Ga0070710_10214317 | |||
| 1527 | Ga0070710_10419844 | |||
| 1528 | Ga0070710_11209518 | |||
| 1529 | Ga0070701_10317022 | |||
| 1530 | Ga0070711_100006116 | |||
| 1531 | Ga0070711_100078511 | |||
| 1532 | Ga0070711_100112752 | |||
| 1533 | Ga0070711_100448438 | |||
| 1534 | Ga0070711_100619508 | |||
| 1535 | Ga0070711_101027982 | |||
| 1536 | Ga0070705_100075673 | |||
| 1537 | Ga0070705_100204996 | |||
| 1538 | Ga0070705_100232819 | |||
| 1539 | Ga0070705_101023435 | |||
| 1540 | Ga0070705_101065448 | |||
| 1541 | Ga0070700_100003660 | |||
| 1542 | Ga0070700_101249815 | |||
| 1543 | Ga0070694_100004904 | |||
| 1544 | Ga0070694_100087162 | |||
| 1545 | Ga0070694_100746208 | |||
| 1546 | Ga0070694_100750996 | |||
| 1547 | Ga0070708_100003581 | |||
| 1548 | Ga0070708_100036156 | |||
| 1549 | Ga0070708_100050882 | |||
| 1550 | Ga0070708_100053105 | |||
| 1551 | Ga0070708_100054749 | |||
| 1552 | Ga0070708_100057410 | |||
| 1553 | Ga0070708_100136047 | |||
| 1554 | Ga0070708_100141727 | |||
| 1555 | Ga0070708_100156410 | |||
| 1556 | Ga0070708_100261350 | |||
| 1557 | Ga0070708_100442592 | |||
| 1558 | Ga0070708_100566950 | |||
| 1559 | Ga0070708_101041682 | |||
| 1560 | Ga0070708_101158650 | |||
| 1561 | Ga0070708_102076977 | |||
| 1562 | Ga0070663_100100368 | |||
| 1563 | Ga0070663_100656577 | |||
| 1564 | Ga0070678_100001511 | |||
| 1565 | Ga0070678_100094691 | |||
| 1566 | Ga0070678_100236091 | |||
| 1567 | Ga0070678_100506587 | |||
| 1568 | Ga0070678_100806887 | |||
| 1569 | Ga0070678_101910917 | |||
| 1570 | Ga0070662_100004281 | |||
| 1571 | Ga0070662_100016152 | |||
| 1572 | Ga0070662_100091226 | |||
| 1573 | Ga0070662_100133833 | |||
| 1574 | Ga0070662_101404111 | |||
| 1575 | Ga0070681_10052300 | |||
| 1576 | Ga0068867_100044767 | |||
| 1577 | Ga0068867_100386194 | |||
| 1578 | Ga0070685_10106425 | |||
| 1579 | Ga0070685_10140714 | |||
| 1580 | Ga0070685_10208732 | |||
| 1581 | Ga0070685_10358273 | |||
| 1582 | Ga0070685_10367787 | |||
| 1583 | Ga0070685_10838743 | |||
| 1584 | Ga0070706_100006577 | |||
| 1585 | Ga0070706_100020444 | |||
| 1586 | Ga0070706_100020521 | |||
| 1587 | Ga0070706_100025982 | |||
| 1588 | Ga0070706_100137442 | |||
| 1589 | Ga0070706_100145108 | |||
| 1590 | Ga0070706_100302668 | |||
| 1591 | Ga0070706_100519386 | |||
| 1592 | Ga0070706_100676488 | |||
| 1593 | Ga0070706_102009540 | |||
| 1594 | Ga0070707_100000292 | |||
| 1595 | Ga0070707_100003721 | |||
| 1596 | Ga0070707_100016188 | |||
| 1597 | Ga0070707_100030502 | |||
| 1598 | Ga0070707_100032046 | |||
| 1599 | Ga0070707_100039193 | |||
| 1600 | Ga0070707_100063474 | |||
| 1601 | Ga0070707_100072311 | |||
| 1602 | Ga0070707_100081504 | |||
| 1603 | Ga0070707_100193267 | |||
| 1604 | Ga0070707_100320831 | |||
| 1605 | Ga0070707_100338980 | |||
| 1606 | Ga0070707_100342021 | |||
| 1607 | Ga0070707_100362651 | |||
| 1608 | Ga0070707_100453112 | |||
| 1609 | Ga0070707_100832304 | |||
| 1610 | Ga0070707_100956168 | |||
| 1611 | Ga0070707_101713715 | |||
| 1612 | Ga0070698_100001836 | |||
| 1613 | Ga0070698_100007384 | |||
| 1614 | Ga0070698_100022395 | |||
| 1615 | Ga0070698_100032196 | |||
| 1616 | Ga0070698_100329532 | |||
| 1617 | Ga0070698_100354407 | |||
| 1618 | Ga0070698_100661926 | |||
| 1619 | Ga0070698_100786651 | |||
| 1620 | Ga0070698_101504696 | |||
| 1621 | Ga0070699_100027581 | |||
| 1622 | Ga0070699_100036501 | |||
| 1623 | Ga0070699_100058834 | |||
| 1624 | Ga0070699_100176052 | |||
| 1625 | Ga0070699_100222626 | |||
| 1626 | Ga0070699_100509403 | |||
| 1627 | Ga0070699_100732863 | |||
| 1628 | Ga0070699_100739219 | |||
| 1629 | Ga0070699_100773376 | |||
| 1630 | Ga0070699_100870976 | |||
| 1631 | Ga0070679_100054949 | |||
| 1632 | Ga0070679_100649064 | |||
| 1633 | Ga0070684_100001312 | |||
| 1634 | Ga0070684_100029216 | |||
| 1635 | Ga0070684_100302970 | |||
| 1636 | Ga0070697_100000826 | |||
| 1637 | Ga0070697_100002201 | |||
| 1638 | Ga0070697_100002768 | |||
| 1639 | Ga0070697_100003773 | |||
| 1640 | Ga0070697_100005694 | |||
| 1641 | Ga0070697_100045125 | |||
| 1642 | Ga0070697_100057785 | |||
| 1643 | Ga0070697_100121642 | |||
| 1644 | Ga0070697_100124376 | |||
| 1645 | Ga0070697_100141887 | |||
| 1646 | Ga0070697_100214500 | |||
| 1647 | Ga0070697_100449182 | |||
| 1648 | Ga0070697_100500503 | |||
| 1649 | Ga0070697_100558094 | |||
| 1650 | Ga0070697_100596480 | |||
| 1651 | Ga0070697_100776024 | |||
| 1652 | Ga0068853_100107206 | |||
| 1653 | Ga0070672_100000353 | |||
| 1654 | Ga0070672_100004247 | |||
| 1655 | Ga0070672_100041736 | |||
| 1656 | Ga0070672_100136749 | |||
| 1657 | Ga0070672_100209084 | |||
| 1658 | Ga0070672_100958515 | |||
| 1659 | Ga0070672_101246723 | |||
| 1660 | Ga0070672_101436047 | |||
| 1661 | Ga0070686_100054207 | |||
| 1662 | Ga0070686_100126507 | |||
| 1663 | Ga0070695_100017240 | |||
| 1664 | Ga0070695_100073003 | |||
| 1665 | Ga0070695_100271901 | |||
| 1666 | Ga0070696_100012751 | |||
| 1667 | Ga0070696_100494645 | |||
| 1668 | Ga0070696_101568040 | |||
| 1669 | Ga0070693_100229378 | |||
| 1670 | Ga0070693_100415757 | |||
| 1671 | Ga0070693_100709430 | |||
| 1672 | Ga0070665_100008787 | |||
| 1673 | Ga0070665_100070912 | |||
| 1674 | Ga0070665_100114878 | |||
| 1675 | Ga0070665_100200931 | |||
| 1676 | Ga0070665_100234438 | |||
| 1677 | Ga0070665_100496622 | |||
| 1678 | Ga0070665_100965700 | |||
| 1679 | Ga0070665_101232371 | |||
| 1680 | Ga0070704_100029184 | |||
| 1681 | Ga0070704_100082187 | |||
| 1682 | Ga0070704_100273457 | |||
| 1683 | Ga0070704_100919742 | |||
| 1684 | Ga0068855_100308936 | |||
| 1685 | Ga0070664_100125926 | |||
| 1686 | Ga0070664_100182011 | |||
| 1687 | Ga0070664_100248105 | |||
| 1688 | Ga0070664_100301215 | |||
| 1689 | Ga0070664_100454291 | |||
| 1690 | Ga0068854_100608047 | |||
| 1691 | Ga0068856_100017528 | |||
| 1692 | Ga0068856_100456081 | |||
| 1693 | Ga0068856_100982990 | |||
| 1694 | Ga0070702_100018870 | |||
| 1695 | Ga0070702_100196422 | |||
| 1696 | Ga0070702_100671110 | |||
| 1697 | Ga0068852_100345260 | |||
| 1698 | Ga0068859_100077354 | |||
| 1699 | Ga0068859_100117580 | |||
| 1700 | Ga0068859_100586714 | |||
| 1701 | Ga0068859_100756896 | |||
| 1702 | Ga0068864_100285604 | |||
| 1703 | Ga0068864_100287593 | |||
| 1704 | Ga0068864_100347280 | |||
| 1705 | Ga0068864_100388810 | |||
| 1706 | Ga0068864_100919300 | |||
| 1707 | Ga0068864_102000274 | |||
| 1708 | Ga0068866_10177069 | |||
| 1709 | Ga0068866_10892409 | |||
| 1710 | Ga0068866_10906136 | |||
| 1711 | Ga0068861_100107874 | |||
| 1712 | Ga0068861_100158124 | |||
| 1713 | Ga0068861_100177914 | |||
| 1714 | Ga0068863_100007967 | |||
| 1715 | Ga0068863_100383370 | |||
| 1716 | Ga0068863_100590505 | |||
| 1717 | Ga0068863_100940299 | |||
| 1718 | Ga0068858_100052055 | |||
| 1719 | Ga0068858_100142777 | |||
| 1720 | Ga0068858_100224419 | |||
| 1721 | Ga0068858_100401480 | |||
| 1722 | Ga0068858_102243340 | |||
| 1723 | Ga0068858_102281690 | |||
| 1724 | Ga0068860_100010603 | |||
| 1725 | Ga0068860_100066467 | |||
| 1726 | Ga0068860_100108998 | |||
| 1727 | Ga0068860_100762370 | |||
| 1728 | Ga0068862_100003143 | |||
| 1729 | Ga0068862_100041432 | |||
| 1730 | Ga0068862_101002808 | |||
| 1731 | Ga0081455_10001399 | |||
| 1732 | Ga0081455_10021886 | |||
| 1733 | Ga0081455_10031292 | |||
| 1734 | Ga0081455_10031464 | |||
| 1735 | Ga0081455_10284179 | |||
| 1736 | Ga0081455_10288089 | |||
| 1737 | Ga0081455_10344702 | |||
| 1738 | Ga0081455_10648182 | |||
| 1739 | Ga0081538_10100476 | |||
| 1740 | Ga0081540_1000036 | |||
| 1741 | Ga0081540_1025675 | |||
| 1742 | Ga0081540_1065432 | |||
| 1743 | Ga0081539_10000014 | |||
| 1744 | Ga0081539_10001730 | |||
| 1745 | Ga0081539_10022038 | |||
| 1746 | Ga0081539_10030228 | |||
| 1747 | Ga0081539_10059040 | |||
| 1748 | Ga0081539_10113538 | |||
| 1749 | Ga0070717_10016944 | |||
| 1750 | Ga0070717_10027717 | |||
| 1751 | Ga0070717_10028090 | |||
| 1752 | Ga0070717_10037326 | |||
| 1753 | Ga0070717_10037361 | |||
| 1754 | Ga0070717_10410936 | |||
| 1755 | Ga0070717_10488751 | |||
| 1756 | Ga0070717_10992822 | |||
| 1757 | Ga0070715_10015930 | |||
| 1758 | Ga0070715_10059680 | |||
| 1759 | Ga0070715_10399498 | |||
| 1760 | Ga0070715_10401984 | |||
| 1761 | Ga0070716_100011207 | |||
| 1762 | Ga0070716_100199559 | |||
| 1763 | Ga0070716_100205703 | |||
| 1764 | Ga0070716_100304877 | |||
| 1765 | Ga0070716_100369139 | |||
| 1766 | Ga0070716_100649827 | |||
| 1767 | Ga0070716_100774044 | |||
| 1768 | Ga0070712_100023808 | |||
| 1769 | Ga0070712_100046609 | |||
| 1770 | Ga0070712_100049660 | |||
| 1771 | Ga0070712_100052822 | |||
| 1772 | Ga0070712_100093977 | |||
| 1773 | Ga0070712_100271568 | |||
| 1774 | Ga0070712_100357662 | |||
| 1775 | Ga0070712_100388371 | |||
| 1776 | Ga0070712_100401676 | |||
| 1777 | Ga0070712_100657490 | |||
| 1778 | Ga0070712_100932690 | |||
| 1779 | Ga0070712_101220012 | |||
| 1780 | Ga0070712_101321383 | |||
| 1781 | Ga0070712_101431055 | |||
| 1782 | Ga0097621_100014055 | |||
| 1783 | Ga0097621_100018403 | |||
| 1784 | Ga0097621_100024099 | |||
| 1785 | Ga0097621_100991687 | |||
| 1786 | Ga0068871_100084135 | |||
| 1787 | Ga0068871_100336065 | |||
| 1788 | Ga0068871_100727499 | |||
| 1789 | Ga0068871_100955037 | |||
| 1790 | Ga0075428_100093456 | |||
| 1791 | Ga0075428_100095839 | |||
| 1792 | Ga0075428_100416748 | |||
| 1793 | Ga0075430_100277403 | |||
| 1794 | Ga0075433_10196766 | |||
| 1795 | Ga0075433_10674838 | |||
| 1796 | Ga0075433_10827267 | |||
| 1797 | Ga0075433_11004728 | |||
| 1798 | Ga0075433_11475672 | |||
| 1799 | Ga0075434_100014841 | |||
| 1800 | Ga0075434_100147155 | |||
| 1801 | Ga0075434_100200364 | |||
| 1802 | Ga0075434_100540910 | |||
| 1803 | Ga0075434_100657972 | |||
| 1804 | Ga0075434_101028397 | |||
| 1805 | Ga0075434_101466271 | |||
| 1806 | Ga0068865_100017414 | |||
| 1807 | Ga0068865_100105971 | |||
| 1808 | Ga0068865_100149571 | |||
| 1809 | Ga0068865_100214443 | |||
| 1810 | Ga0068865_100831403 | |||
| 1811 | Ga0075436_100032597 | |||
| 1812 | Ga0075436_100370089 | |||
| 1813 | Ga0075436_100413342 | |||
| 1814 | Ga0075436_100922148 | |||
| 1815 | Ga0097620_100077352 | |||
| 1816 | Ga0097620_100117582 | |||
| 1817 | Ga0097620_100586684 | |||
| 1818 | Ga0097620_100756876 | |||
| 1819 | Ga0075435_100541635 | |||
| 1820 | Ga0075435_100651782 | |||
| 1821 | Ga0075435_101100459 | |||
| 1822 | Ga0099794_10020565 | |||
| 1823 | Ga0099794_10179950 | |||
| 1824 | Ga0099794_10470990 | |||
| 1825 | Ga0099794_10711006 | |||
| 1826 | Ga0099795_10341386 | |||
| 1827 | Ga0099795_10474030 | |||
| 1828 | Ga0105240_11673074 | |||
| 1829 | Ga0111539_10524306 | |||
| 1830 | Ga0111539_11803835 | |||
| 1831 | Ga0111539_12134840 | |||
| 1832 | Ga0111539_12893719 | |||
| 1833 | Ga0105245_10006614 | |||
| 1834 | Ga0105245_10030852 | |||
| 1835 | Ga0105245_10214619 | |||
| 1836 | Ga0105245_11624256 | |||
| 1837 | Ga0105247_10084384 | |||
| 1838 | Ga0105247_10731540 | |||
| 1839 | Ga0105247_11036774 | |||
| 1840 | Ga0114129_10001417 | |||
| 1841 | Ga0114129_10003445 | |||
| 1842 | Ga0114129_10032401 | |||
| 1843 | Ga0114129_10241662 | |||
| 1844 | Ga0114129_12192928 | |||
| 1845 | Ga0105243_10033332 | |||
| 1846 | Ga0105243_10331810 | |||
| 1847 | Ga0105243_10648599 | |||
| 1848 | Ga0105241_10713440 | |||
| 1849 | Ga0105242_10043482 | |||
| 1850 | Ga0105242_10167170 | |||
| 1851 | Ga0105242_10276372 | |||
| 1852 | Ga0105242_10875677 | |||
| 1853 | Ga0105242_10939690 | |||
| 1854 | Ga0105248_10321465 | |||
| 1855 | Ga0105237_10134456 | |||
| 1856 | Ga0105237_10225438 | |||
| 1857 | Ga0105238_11121242 | |||
| 1858 | Ga0105249_10007788 | |||
| 1859 | Ga0105249_10011097 | |||
| 1860 | Ga0105249_10431190 | |||
| 1861 | Ga0105249_11334773 | |||
| 1862 | Ga0099796_10005301 | |||
| 1863 | Ga0099796_10011175 | |||
| 1864 | Ga0099796_10103366 | |||
| 1865 | Ga0105239_10070002 | |||
| 1866 | Ga0105239_10100267 | |||
| 1867 | Ga0105239_10139759 | |||
| 1868 | Ga0105239_12151893 | |||
| 1869 | Ga0105246_10182706 | |||
| 1870 | Ga0105246_10383239 | |||
| 1871 | Ga0105246_12137735 | |||
| 1872 | Ga0157313_1005513 | |||
| 1873 | Ga0157315_1056796 | |||
| 1874 | Ga0157327_1046819 | |||
| 1875 | Ga0157373_10116401 | |||
| 1876 | Ga0157373_11545504 | |||
| 1877 | Ga0157371_10058341 | |||
| 1878 | Ga0157371_10323452 | |||
| 1879 | Ga0157370_11019409 | |||
| 1880 | Ga0157369_10182471 | |||
| 1881 | Ga0157374_10001473 | |||
| 1882 | Ga0157374_10005577 | |||
| 1883 | Ga0157374_10019745 | |||
| 1884 | Ga0157374_10033688 | |||
| 1885 | Ga0157374_10055882 | |||
| 1886 | Ga0157374_10120813 | |||
| 1887 | Ga0157374_10317951 | |||
| 1888 | Ga0157374_10431232 | |||
| 1889 | Ga0157374_10574067 | |||
| 1890 | Ga0157374_10996360 | |||
| 1891 | Ga0157374_11038725 | |||
| 1892 | Ga0157374_11350962 | |||
| 1893 | Ga0157374_12134377 | |||
| 1894 | Ga0157378_10005509 | |||
| 1895 | Ga0157378_10026553 | |||
| 1896 | Ga0157378_10043528 | |||
| 1897 | Ga0157378_10048884 | |||
| 1898 | Ga0157378_10058061 | |||
| 1899 | Ga0157378_10174062 | |||
| 1900 | Ga0157378_10191930 | |||
| 1901 | Ga0157378_10246614 | |||
| 1902 | Ga0157378_10326750 | |||
| 1903 | Ga0157378_10384057 | |||
| 1904 | Ga0157378_10409772 | |||
| 1905 | Ga0157378_10451731 | |||
| 1906 | Ga0157378_10529437 | |||
| 1907 | Ga0157378_10705913 | |||
| 1908 | Ga0157378_10799313 | |||
| 1909 | Ga0157378_11522416 | |||
| 1910 | Ga0157378_11702122 | |||
| 1911 | Ga0157378_12767619 | |||
| 1912 | Ga0163162_10003249 | |||
| 1913 | Ga0163162_10014121 | |||
| 1914 | Ga0163162_10017445 | |||
| 1915 | Ga0163162_10023520 | |||
| 1916 | Ga0163162_10034354 | |||
| 1917 | Ga0163162_10042501 | |||
| 1918 | Ga0163162_10086566 | |||
| 1919 | Ga0163162_10203836 | |||
| 1920 | Ga0163162_10224090 | |||
| 1921 | Ga0163162_10782207 | |||
| 1922 | Ga0157372_10037163 | |||
| 1923 | Ga0157372_10040369 | |||
| 1924 | Ga0157372_10167743 | |||
| 1925 | Ga0157372_10260634 | |||
| 1926 | Ga0157372_10837918 | |||
| 1927 | Ga0157372_11596687 | |||
| 1928 | Ga0157375_10000287 | |||
| 1929 | Ga0157375_10001868 | |||
| 1930 | Ga0157375_10007782 | |||
| 1931 | Ga0157375_10044228 | |||
| 1932 | Ga0157375_10082239 | |||
| 1933 | Ga0157375_10159468 | |||
| 1934 | Ga0157375_10368137 | |||
| 1935 | Ga0157375_10511654 | |||
| 1936 | Ga0157375_12062506 | |||
| 1937 | Ga0163163_10294276 | |||
| 1938 | Ga0163163_10297508 | |||
| 1939 | Ga0163163_10307094 | |||
| 1940 | Ga0163163_11108141 | |||
| 1941 | Ga0163163_11115034 | |||
| 1942 | Ga0182008_10063220 | |||
| 1943 | Ga0182008_10421309 | |||
| 1944 | Ga0157377_10013826 | |||
| 1945 | Ga0157377_10110643 | |||
| 1946 | Ga0157377_10369438 | |||
| 1947 | Ga0157377_10400617 | |||
| 1948 | Ga0157379_10005647 | |||
| 1949 | Ga0157379_10083913 | |||
| 1950 | Ga0157379_10421858 | |||
| 1951 | Ga0157379_10432610 | |||
| 1952 | Ga0157379_11264189 | |||
| 1953 | Ga0157376_10009509 | |||
| 1954 | Ga0157376_10149842 | |||
| 1955 | Ga0157376_10154833 | |||
| 1956 | Ga0157376_10164048 | |||
| 1957 | Ga0157376_10180657 | |||
| 1958 | Ga0157376_10349606 | |||
| 1959 | Ga0157376_10404419 | |||
| 1960 | Ga0157376_11853928 | |||
| 1961 | Ga0157376_12268419 | |||
| 1962 | Ga0163161_10046543 | |||
| 1963 | Ga0163161_10177049 | |||
| 1964 | Ga0163161_10302024 | |||
| 1965 | Ga0163161_10457796 | |||
| 1966 | Ga0163161_11290942 | |||
| 1967 | Ga0213874_10318189 | |||
| 1968 | Ga0213876_10006558 | |||
| 1969 | Ga0207666_1000898 | |||
| 1970 | Ga0207666_1002318 | |||
| 1971 | Ga0207666_1019393 | |||
| 1972 | Ga0207673_1000900 | |||
| 1973 | Ga0207673_1002318 | |||
| 1974 | Ga0207673_1008168 | |||
| 1975 | Ga0207673_1016725 | |||
| 1976 | Ga0207673_1032820 | |||
| 1977 | Ga0207697_10000010 | |||
| 1978 | Ga0207697_10000131 | |||
| 1979 | Ga0207697_10000495 | |||
| 1980 | Ga0207697_10002230 | |||
| 1981 | Ga0207697_10002322 | |||
| 1982 | Ga0207697_10013157 | |||
| 1983 | Ga0207697_10022681 | |||
| 1984 | Ga0207697_10260276 | |||
| 1985 | Ga0207653_10039724 | |||
| 1986 | Ga0207653_10050379 | |||
| 1987 | Ga0207692_10073082 | |||
| 1988 | Ga0207692_10167630 | |||
| 1989 | Ga0207692_10402536 | |||
| 1990 | Ga0207642_10079022 | |||
| 1991 | Ga0207642_10140377 | |||
| 1992 | Ga0207642_10190964 | |||
| 1993 | Ga0207642_10235101 | |||
| 1994 | Ga0207642_10813163 | |||
| 1995 | Ga0207710_10089084 | |||
| 1996 | Ga0207688_10001208 | |||
| 1997 | Ga0207688_10014566 | |||
| 1998 | Ga0207688_10076002 | |||
| 1999 | Ga0207688_10154580 | |||
| 2000 | Ga0207688_10214307 | |||
| 2001 | Ga0207680_10003944 | |||
| 2002 | Ga0207680_10025390 | |||
| 2003 | Ga0207680_10032106 | |||
| 2004 | Ga0207680_10113689 | |||
| 2005 | Ga0207680_10157831 | |||
| 2006 | Ga0207647_10122822 | |||
| 2007 | Ga0207647_10573618 | |||
| 2008 | Ga0207685_10003968 | |||
| 2009 | Ga0207685_10023055 | |||
| 2010 | Ga0207699_10008911 | |||
| 2011 | Ga0207699_10020861 | |||
| 2012 | Ga0207699_10205598 | |||
| 2013 | Ga0207699_10245878 | |||
| 2014 | Ga0207699_10354681 | |||
| 2015 | Ga0207645_10001786 | |||
| 2016 | Ga0207645_10002762 | |||
| 2017 | Ga0207645_10004253 | |||
| 2018 | Ga0207645_10004432 | |||
| 2019 | Ga0207645_10125827 | |||
| 2020 | Ga0207645_10241866 | |||
| 2021 | Ga0207645_10474049 | |||
| 2022 | Ga0207705_10629080 | |||
| 2023 | Ga0207705_10657783 | |||
| 2024 | Ga0207705_11370015 | |||
| 2025 | Ga0207684_10000028 | |||
| 2026 | Ga0207684_10003766 | |||
| 2027 | Ga0207684_10008671 | |||
| 2028 | Ga0207684_10011143 | |||
| 2029 | Ga0207684_10019695 | |||
| 2030 | Ga0207684_10030870 | |||
| 2031 | Ga0207684_10059810 | |||
| 2032 | Ga0207684_10072862 | |||
| 2033 | Ga0207684_10074641 | |||
| 2034 | Ga0207684_10248195 | |||
| 2035 | Ga0207684_10504496 | |||
| 2036 | Ga0207684_10507609 | |||
| 2037 | Ga0207684_10514905 | |||
| 2038 | Ga0207654_10853293 | |||
| 2039 | Ga0207654_11011087 | |||
| 2040 | Ga0207707_10035549 | |||
| 2041 | Ga0207671_10132187 | |||
| 2042 | Ga0207671_10203874 | |||
| 2043 | Ga0207693_10000889 | |||
| 2044 | Ga0207693_10006942 | |||
| 2045 | Ga0207693_10021211 | |||
| 2046 | Ga0207693_10035010 | |||
| 2047 | Ga0207693_10157817 | |||
| 2048 | Ga0207693_10167995 | |||
| 2049 | Ga0207693_10323521 | |||
| 2050 | Ga0207693_10339935 | |||
| 2051 | Ga0207693_10459107 | |||
| 2052 | Ga0207693_10463811 | |||
| 2053 | Ga0207693_10537288 | |||
| 2054 | Ga0207693_10665350 | |||
| 2055 | Ga0207693_10972828 | |||
| 2056 | Ga0207693_11034901 | |||
| 2057 | Ga0207663_10002290 | |||
| 2058 | Ga0207663_10071768 | |||
| 2059 | Ga0207663_10129162 | |||
| 2060 | Ga0207663_10742089 | |||
| 2061 | Ga0207663_10923940 | |||
| 2062 | Ga0207663_11460993 | |||
| 2063 | Ga0207660_10087575 | |||
| 2064 | Ga0207660_10605332 | |||
| 2065 | Ga0207662_10000699 | |||
| 2066 | Ga0207662_10163389 | |||
| 2067 | Ga0207662_10629477 | |||
| 2068 | Ga0207657_10073181 | |||
| 2069 | Ga0207657_10152237 | |||
| 2070 | Ga0207657_10347033 | |||
| 2071 | Ga0207657_10508684 | |||
| 2072 | Ga0207649_10201065 | |||
| 2073 | Ga0207649_10757870 | |||
| 2074 | Ga0207649_11133067 | |||
| 2075 | Ga0207652_10250204 | |||
| 2076 | Ga0207652_11358490 | |||
| 2077 | Ga0207646_10000191 | |||
| 2078 | Ga0207646_10001393 | |||
| 2079 | Ga0207646_10005640 | |||
| 2080 | Ga0207646_10005692 | |||
| 2081 | Ga0207646_10009621 | |||
| 2082 | Ga0207646_10010143 | |||
| 2083 | Ga0207646_10028198 | |||
| 2084 | Ga0207646_10065346 | |||
| 2085 | Ga0207646_10068226 | |||
| 2086 | Ga0207646_10073074 | |||
| 2087 | Ga0207646_10295729 | |||
| 2088 | Ga0207646_10346952 | |||
| 2089 | Ga0207646_10482144 | |||
| 2090 | Ga0207646_10507633 | |||
| 2091 | Ga0207646_10840249 | |||
| 2092 | Ga0207646_10849897 | |||
| 2093 | Ga0207681_10004055 | |||
| 2094 | Ga0207681_10069483 | |||
| 2095 | Ga0207681_10363047 | |||
| 2096 | Ga0207681_10437614 | |||
| 2097 | Ga0207650_10006836 | |||
| 2098 | Ga0207650_10007428 | |||
| 2099 | Ga0207650_10018287 | |||
| 2100 | Ga0207650_10140098 | |||
| 2101 | Ga0207650_10152097 | |||
| 2102 | Ga0207650_11259579 | |||
| 2103 | Ga0207659_10003512 | |||
| 2104 | Ga0207659_10045484 | |||
| 2105 | Ga0207659_10049761 | |||
| 2106 | Ga0207659_10054917 | |||
| 2107 | Ga0207659_10266888 | |||
| 2108 | Ga0207659_10843472 | |||
| 2109 | Ga0207659_11810958 | |||
| 2110 | Ga0207687_10109907 | |||
| 2111 | Ga0207687_10414708 | |||
| 2112 | Ga0207700_10022621 | |||
| 2113 | Ga0207700_10087236 | |||
| 2114 | Ga0207700_10145225 | |||
| 2115 | Ga0207700_10209424 | |||
| 2116 | Ga0207700_10532870 | |||
| 2117 | Ga0207700_10557764 | |||
| 2118 | Ga0207664_10120019 | |||
| 2119 | Ga0207664_10172266 | |||
| 2120 | Ga0207664_10207690 | |||
| 2121 | Ga0207664_10263641 | |||
| 2122 | Ga0207664_11315927 | |||
| 2123 | Ga0207644_10029826 | |||
| 2124 | Ga0207644_10035251 | |||
| 2125 | Ga0207644_10049869 | |||
| 2126 | Ga0207644_10092545 | |||
| 2127 | Ga0207644_10101578 | |||
| 2128 | Ga0207644_10112816 | |||
| 2129 | Ga0207644_10166997 | |||
| 2130 | Ga0207644_10187708 | |||
| 2131 | Ga0207644_10221395 | |||
| 2132 | Ga0207644_10515266 | |||
| 2133 | Ga0207644_10653564 | |||
| 2134 | Ga0207644_10783165 | |||
| 2135 | Ga0207644_10813221 | |||
| 2136 | Ga0207644_11332041 | |||
| 2137 | Ga0207690_10001098 | |||
| 2138 | Ga0207690_10191132 | |||
| 2139 | Ga0207690_10396035 | |||
| 2140 | Ga0207706_10008197 | |||
| 2141 | Ga0207706_10027339 | |||
| 2142 | Ga0207706_10070025 | |||
| 2143 | Ga0207706_10127775 | |||
| 2144 | Ga0207706_10287059 | |||
| 2145 | Ga0207706_10456723 | |||
| 2146 | Ga0207706_10588936 | |||
| 2147 | Ga0207706_10660496 | |||
| 2148 | Ga0207686_10913136 | |||
| 2149 | Ga0207709_10368837 | |||
| 2150 | Ga0207670_10009200 | |||
| 2151 | Ga0207670_10104247 | |||
| 2152 | Ga0207670_10131649 | |||
| 2153 | Ga0207670_10343447 | |||
| 2154 | Ga0207670_10348962 | |||
| 2155 | Ga0207670_10507031 | |||
| 2156 | Ga0207670_10706085 | |||
| 2157 | Ga0207669_10002532 | |||
| 2158 | Ga0207669_10011026 | |||
| 2159 | Ga0207669_10213532 | |||
| 2160 | Ga0207669_10585160 | |||
| 2161 | Ga0207669_10698358 | |||
| 2162 | Ga0207669_10811855 | |||
| 2163 | Ga0207669_11063791 | |||
| 2164 | Ga0207704_10122214 | |||
| 2165 | Ga0207704_10133056 | |||
| 2166 | Ga0207704_10183501 | |||
| 2167 | Ga0207704_10318899 | |||
| 2168 | Ga0207704_10331575 | |||
| 2169 | Ga0207704_11241883 | |||
| 2170 | Ga0207704_11945061 | |||
| 2171 | Ga0207665_10025655 | |||
| 2172 | Ga0207665_10048049 | |||
| 2173 | Ga0207665_10075192 | |||
| 2174 | Ga0207665_10089858 | |||
| 2175 | Ga0207665_10136465 | |||
| 2176 | Ga0207665_10194109 | |||
| 2177 | Ga0207665_10215560 | |||
| 2178 | Ga0207665_10263985 | |||
| 2179 | Ga0207691_10000142 | |||
| 2180 | Ga0207691_10000247 | |||
| 2181 | Ga0207691_10002644 | |||
| 2182 | Ga0207691_10016028 | |||
| 2183 | Ga0207691_10037047 | |||
| 2184 | Ga0207691_10253085 | |||
| 2185 | Ga0207691_10512972 | |||
| 2186 | Ga0207691_10775711 | |||
| 2187 | Ga0207711_10549769 | |||
| 2188 | Ga0207689_10009503 | |||
| 2189 | Ga0207689_10086541 | |||
| 2190 | Ga0207689_10468828 | |||
| 2191 | Ga0207689_10920703 | |||
| 2192 | Ga0207661_10031201 | |||
| 2193 | Ga0207661_10077884 | |||
| 2194 | Ga0207661_10124065 | |||
| 2195 | Ga0207661_10653381 | |||
| 2196 | Ga0207661_10803283 | |||
| 2197 | Ga0207679_10185257 | |||
| 2198 | Ga0207679_10282029 | |||
| 2199 | Ga0207679_11569338 | |||
| 2200 | Ga0207667_11021945 | |||
| 2201 | Ga0207651_10007253 | |||
| 2202 | Ga0207651_10027669 | |||
| 2203 | Ga0207651_10083018 | |||
| 2204 | Ga0207651_10197170 | |||
| 2205 | Ga0207651_10235820 | |||
| 2206 | Ga0207651_10245165 | |||
| 2207 | Ga0207651_10845199 | |||
| 2208 | Ga0207651_11832245 | |||
| 2209 | Ga0207712_10010310 | |||
| 2210 | Ga0207712_10328930 | |||
| 2211 | Ga0207712_10542551 | |||
| 2212 | Ga0207668_10009836 | |||
| 2213 | Ga0207668_10026495 | |||
| 2214 | Ga0207668_10052709 | |||
| 2215 | Ga0207668_11025480 | |||
| 2216 | Ga0207668_11310109 | |||
| 2217 | Ga0207640_10886173 | |||
| 2218 | Ga0207640_11451827 | |||
| 2219 | Ga0207658_10010242 | |||
| 2220 | Ga0207658_10014736 | |||
| 2221 | Ga0207658_10046961 | |||
| 2222 | Ga0207658_10338757 | |||
| 2223 | Ga0207658_10483665 | |||
| 2224 | Ga0207658_10708972 | |||
| 2225 | Ga0207658_10831112 | |||
| 2226 | Ga0207658_10889835 | |||
| 2227 | Ga0207658_12175480 | |||
| 2228 | Ga0207677_10008042 | |||
| 2229 | Ga0207677_10020703 | |||
| 2230 | Ga0207677_10109071 | |||
| 2231 | Ga0207677_10188958 | |||
| 2232 | Ga0207677_10650977 | |||
| 2233 | Ga0207677_10811172 | |||
| 2234 | Ga0207703_10003624 | |||
| 2235 | Ga0207703_10142997 | |||
| 2236 | Ga0207703_10309352 | |||
| 2237 | Ga0207703_10531807 | |||
| 2238 | Ga0207703_10584444 | |||
| 2239 | Ga0207703_10701560 | |||
| 2240 | Ga0207703_10989909 | |||
| 2241 | Ga0207639_10200729 | |||
| 2242 | Ga0207678_10020455 | |||
| 2243 | Ga0207678_10138642 | |||
| 2244 | Ga0207678_10246654 | |||
| 2245 | Ga0207708_10538280 | |||
| 2246 | Ga0207702_10038562 | |||
| 2247 | Ga0207702_11698650 | |||
| 2248 | Ga0207702_11966261 | |||
| 2249 | Ga0207641_10022387 | |||
| 2250 | Ga0207641_10436029 | |||
| 2251 | Ga0207648_10149163 | |||
| 2252 | Ga0207648_10179022 | |||
| 2253 | Ga0207648_10727172 | |||
| 2254 | Ga0207676_10474000 | |||
| 2255 | Ga0207676_10525676 | |||
| 2256 | Ga0207676_11029435 | |||
| 2257 | Ga0207676_11180751 | |||
| 2258 | Ga0207676_11311066 | |||
| 2259 | Ga0207675_100094187 | |||
| 2260 | Ga0207675_100119142 | |||
| 2261 | Ga0207675_100165775 | |||
| 2262 | Ga0207683_10006977 | |||
| 2263 | Ga0207683_10008842 | |||
| 2264 | Ga0207683_10009866 | |||
| 2265 | Ga0207683_10015583 | |||
| 2266 | Ga0207683_10872708 | |||
| 2267 | Ga0207683_11529710 | |||
| 2268 | Ga0207683_11711425 | |||
| 2269 | Ga0207698_10525239 | |||
| 2270 | Ga0209969_1030523 | |||
| 2271 | Ga0209967_1044749 | |||
| 2272 | Ga0209981_1058211 | |||
| 2273 | Ga0209984_1004426 | |||
| 2274 | Ga0209984_1037284 | |||
| 2275 | Ga0209999_1004693 | |||
| 2276 | Ga0209982_1046842 | |||
| 2277 | Ga0209970_1005891 | |||
| 2278 | Ga0209983_1000280 | |||
| 2279 | Ga0209588_1112866 | |||
| 2280 | Ga0209588_1142593 | |||
| 2281 | Ga0209588_1214259 | |||
| 2282 | Ga0209971_1000384 | |||
| 2283 | Ga0209971_1164380 | |||
| 2284 | Ga0209998_10026839 | |||
| 2285 | Ga0209974_10004420 | |||
| 2286 | Ga0209974_10023640 | |||
| 2287 | Ga0209974_10073397 | |||
| 2288 | Ga0207428_10252411 | |||
| 2289 | Ga0207428_10551247 | |||
| 2290 | Ga0268266_10004179 | |||
| 2291 | Ga0268266_10026994 | |||
| 2292 | Ga0268266_10076422 | |||
| 2293 | Ga0268266_10141029 | |||
| 2294 | Ga0268266_10219749 | |||
| 2295 | Ga0268266_10371687 | |||
| 2296 | Ga0268266_10395721 | |||
| 2297 | Ga0268266_11176992 | |||
| 2298 | Ga0268265_10044999 | |||
| 2299 | Ga0268265_10368503 | |||
| 2300 | Ga0268264_10001807 | |||
| 2301 | Ga0268264_10029276 | |||
| 2302 | Ga0268264_10149965 | |||
| 2303 | Ga0268264_10178518 | |||
| 2304 | Ga0268264_10521444 | |||
| 2305 | Ga0307513_10023335 | |||
| 2306 | Ga0307414_10460102 | |||
| 2307 | Ga0373930_0160298 | |||
| 2308 | Ga0373948_0190428 | |||
| 2309 | Ga0373959_0161854 | |||
| 2310 | Ga0373926_0025205 | |||
| 2311 | Ga0373926_0070283 | |||
| 2312 | Ga0373926_0077902 | |||
| 2313 | Ga0373940_0150688 | |||
| 2314 | Ga0373944_0061394 | |||
| 2315 | Ga0373944_0215748 | |||
| 2316 | Ga0373944_0253299 | |||
| 2317 | Ga0373951_0035882 | |||
| 2318 | Ga0373923_0090520 | |||
| 2319 | Ga0373932_0207585 | |||
| 2320 | Ga0373936_0311305 | |||
| 2321 | Ga0373936_0412525 | |||
| 2322 | Ga0373936_0487609 | |||
| 2323 | Ga0373939_0103156 | |||
| 2324 | Ga0373941_0205467 | |||
| 2325 | Ga0373945_0005962 | |||
| 2326 | Ga0373954_0021155 | |||
| 2327 | Ga0373956_0326539 | |||
| 2328 | Ga0373960_0090100 | |||
| 2329 | Ga0373943_0005531 | |||
| 2330 | Ga0373943_0057911 | |||
| 2331 | Ga0373943_0080926 | |||
| 2332 | Ga0373943_0235000 | |||
| 2333 | Ga0373943_0283262 | |||
| 2334 | Ga0373946_0045201 | |||
| 2335 | Ga0373946_0071572 | |||
| 2336 | Ga0373955_0619939 | |||
| 2337 | Ga0373955_0638582 | |||
| 2338 | Ga0373942_0339145 | |||
| 2339 | Ga0373961_0244091 | |||
| 2340 | Ga0373931_0108890 | |||
| 2341 | Ga0373931_0130279 | |||
| 2342 | Ga0373931_0149850 | |||
| 2343 | Ga0373931_0234351 | |||
| 2344 | Ga0373935_0031757 | |||
| 2345 | Ga0373935_0302849 | |||
| 2346 | Ga0373935_0314802 | |||
| 2347 | Ga0373935_0450838 | |||
| 2348 | Ga0373927_0031651 | |||
| 2349 | Ga0373927_0123175 | |||
| 2350 | Ga0373927_0176977 | |||
| 2351 | Ga0373927_0297200 | |||
| 2352 | Ga0373933_0052084 | |||
| 2353 | Ga0373947_0036106 | |||
| 2354 | Ga0373947_0054112 | |||
| 2355 | Ga0373947_0069919 | |||
| 2356 | Ga0373947_0099277 | |||
| 2357 | Ga0373947_0517462 | |||
| 2358 | Ga0373947_1093627 | |||
| 2359 | Ga0373937_0065643 | |||
| 2360 | Ga0373937_0114836 | |||
| 2361 | Ga0373937_0124137 | |||
| 2362 | Ga0373937_0201678 | |||
| 2363 | Ga0373937_0397543 | |||
| 2364 | Ga0373925_0006124 | |||
| 2365 | Ga0373925_0014401 | |||
| 2366 | Ga0373925_0040917 | |||
| 2367 | Ga0373925_0460076 | |||
| 2368 | Ga0373925_0603063 | |||
| 2369 | Ga0373925_0910866 | |||
| 2370 | Ga0373925_1412547 | |||
| 2371 | Ga0395899_0081216 | |||
| 2372 | Ga0395899_0549618 | |||
| 2373 | Ga0395899_0845785 | |||
| 2374 | Ga0395900_0002526 | |||
| 2375 | Ga0395900_0008031 | |||
| 2376 | Ga0395900_0232346 | |||
| 2377 | Ga0395900_1933523 | |||
| 2378 | Ga0395898_0002044 | |||
| 2379 | Ga0395898_0041866 | |||
| 2380 | Ga0395898_0405534 | |||
| 2381 | Ga0395898_0580639 | |||
| 2382 | Ga0395898_0913905 | |||
| 2383 | Ga0395905_0045531 | |||
| 2384 | Ga0395905_0389610 | |||
| 2385 | Ga0395905_0416146 | |||
| 2386 | Ga0395905_0703597 | |||
| 2387 | Ga0436364_0440977 | |||
| 2388 | Ga0436364_1193811 | |||
| 2389 | Ga0395901_0002964 | |||
| 2390 | Ga0395901_0039538 | |||
| 2391 | Ga0395901_0083535 | |||
| 2392 | Ga0395901_0280015 | |||
| 2393 | Ga0395901_0703660 | |||
| 2394 | Ga0436365_0026349 | |||
| 2395 | Ga0436365_1454817 | |||
| 2396 | Ga0436360_1356494 | |||
| 2397 | Ga0436363_0428075 | |||
| 2398 | Ga0436362_0051725 | |||
| 2399 | Ga0451795_0218717 | |||
| 2400 | Ga0451795_1070674 | |||
| 2401 | Ga0451795_1097033 | |||
| 2402 | Ga0451798_0051088 | |||
| 2403 | Ga0451800_0294886 | |||
| 2404 | Ga0451802_1916692 | |||
| 2405 | Ga0451807_0465582 | |||
| 2406 | Ga0451807_2171196 | |||
| 2407 | Ga0451837_0657191 | |||
| 2408 | Ga0451839_0785113 | |||
| 2409 | Ga0451855_0504270 | |||
| 2410 | Ga0451855_1662967 | |||
| 2411 | Ga0451853_0537436 | |||
| 2412 | Ga0451853_0644242 | |||
| 2413 | Ga0439448_0066736 | |||
| 2414 | Ga0439448_0090520 | |||
| 2415 | Ga0439451_017252 | |||
| 2416 | Ga0439464_0019868 | |||
| 2417 | Ga0439464_0127029 | |||
| 2418 | Ga0439460_0120465 | |||
| 2419 | Ga0451577_0003056 | |||
| 2420 | Ga0453683_0012218 | |||
| 2421 | Ga0453684_0033176 | |||
| 2422 | Ga0453684_0818663 | |||
| 2423 | Ga0453684_1160797 | |||
| 2424 | Ga0451576_0000055 | |||
| 2425 | Ga0451576_0032997 | |||
| 2426 | Ga0451576_0230708 | |||
| 2427 | Ga0451576_0271845 | |||
| 2428 | Ga0451576_0289458 | |||
| 2429 | Ga0451576_0359913 | |||
| 2430 | Ga0466967_0032556 | |||
| 2431 | Ga0466967_0230794 | |||
| 2432 | Ga0495592_0013560 | |||
| 2433 | Ga0495603_0055534 | |||
| 2434 | Ga0495629_0008333 | |||
| 2435 | Ga0495629_0286104 | |||
| 2436 | Ga0495641_0080416 | |||
| 2437 | Ga0495651_0232273 | |||
| 2438 | Ga0495653_0463193 | |||
| 2439 | Ga0495653_0692492 | |||
| 2440 | Ga0495580_0064954 | |||
| 2441 | Ga0495580_0107757 | |||
| 2442 | Ga0495580_0165118 | |||
| 2443 | Ga0495580_0186167 | |||
| 2444 | Ga0495580_0319707 | |||
| 2445 | Ga0495582_0177182 | |||
| 2446 | Ga0495605_0241838 | |||
| 2447 | Ga0495605_0492088 | |||
| 2448 | Ga0495662_0069387 | |||
| 2449 | Ga0495664_0197075 | |||
| 2450 | Ga0495664_0202283 | |||
| 2451 | Ga0495584_0022505 | |||
| 2452 | Ga0495584_0532480 | |||
| 2453 | Ga0495585_0274372 | |||
| 2454 | Ga0495607_0294471 | |||
| 2455 | Ga0495608_0655926 | |||
| 2456 | Ga0495628_0040395 | |||
| 2457 | Ga0495628_0208490 | |||
| 2458 | Ga0495628_0528697 | |||
| 2459 | Ga0495630_0017678 | |||
| 2460 | Ga0495630_0041206 | |||
| 2461 | Ga0495630_0228479 | |||
| 2462 | Ga0495630_0465867 | |||
| 2463 | Ga0495631_0478114 | |||
| 2464 | Ga0495637_0089666 | |||
| 2465 | Ga0495644_0227498 | |||
| 2466 | Ga0495644_0449758 | |||
| 2467 | Ga0495666_0100205 | |||
| 2468 | Ga0495642_0022869 | |||
| 2469 | Ga0495642_0222200 | |||
| 2470 | Ga0495652_0045601 | |||
| 2471 | Ga0495652_1020926 | |||
| 2472 | Ga0495665_0043688 | |||
| 2473 | Ga0495640_0432390 | |||
| 2474 | Ga0495586_0014140 | |||
| 2475 | Ga0495587_0009500 | |||
| 2476 | Ga0495598_0000901 | |||
| 2477 | Ga0495598_0027087 | |||
| 2478 | Ga0495598_0048134 | |||
| 2479 | Ga0495598_0095720 | |||
| 2480 | Ga0495621_0309943 | |||
| 2481 | Ga0495597_0185047 | |||
| 2482 | Ga0495645_0001076 | |||
| 2483 | Ga0495633_0154083 | |||
| 2484 | Ga0495667_0561934 | |||
| 2485 | Ga0495656_0268106 | |||
| 2486 | Ga0495635_0281409 | |||
| 2487 | Ga0495635_0394740 | |||
| 2488 | Ga0495659_0087755 | |||
| 2489 | Ga0495659_0121259 | |||
| 2490 | Ga0495659_0129759 | |||
| 2491 | Ga0495659_0247028 | |||
| 2492 | Ga0495661_0227291 | |||
| 2493 | Ga0495588_0066650 | |||
| 2494 | Ga0495588_0148087 | |||
| 2495 | Ga0495657_0218503 | |||
| 2496 | Ga0495657_0357846 | |||
| 2497 | Ga0495599_0000317 | |||
| 2498 | Ga0495623_0000811 | |||
| 2499 | Ga0495646_0002940 | |||
| 2500 | Ga0495647_0028223 | |||
| 2501 | Ga0495647_0058248 | |||
| 2502 | Ga0495658_0129662 | |||
| 2503 | Ga0495658_0141734 | |||
| 2504 | Ga0495669_0009247 | |||
| 2505 | Ga0495669_0142072 | |||
| 2506 | Ga0495669_0385127 | |||
| 2507 | Ga0495613_0124871 | |||
| 2508 | Ga0495613_0213064 | |||
| 2509 | Ga0495670_0321637 | |||
| 2510 | Ga0495600_0196305 | |||
| 2511 | Ga0495581_0123308 | |||
| 2512 | Ga0495604_0053697 | |||
| 2513 | Ga0495604_0233324 | |||
| 2514 | Ga0495604_0276899 | |||
| 2515 | Ga0495604_0869028 | |||
| 2516 | Ga0495636_0128954 | |||
| 2517 | Ga0495636_0136190 | |||
| 2518 | Ga0495674_0047362 | |||
| 2519 | Ga0495674_1186421 | |||
| 2520 | Ga0495675_0002584 | |||
| 2521 | Ga0495675_0010133 | |||
| 2522 | Ga0495679_072938 | |||
| 2523 | Ga0495681_0155566 | |||
| 2524 | Ga0495684_0063571 | |||
| 2525 | Ga0495684_0441974 | |||
| 2526 | Ga0495593_0125575 | |||
| 2527 | Ga0495602_0017278 | |||
| 2528 | Ga0495602_0319298 | |||
| 2529 | Ga0495614_0256744 | |||
| 2530 | Ga0495626_0436823 | |||
| 2531 | Ga0496100_0021201 | |||
| 2532 | Ga0496100_0156080 | |||
| 2533 | Ga0496101_0031362 | |||
| 2534 | Ga0496101_0033960 | |||
| 2535 | Ga0496101_0108830 | |||
| 2536 | Ga0496101_0332739 | |||
| 2537 | Ga0496101_0436945 | |||
| 2538 | Ga0496101_1349063 | |||
| 2539 | Ga0496102_0009851 | |||
| 2540 | Ga0496102_0028763 | |||
| 2541 | Ga0496102_0035336 | |||
| 2542 | Ga0496102_0367403 | |||
| 2543 | Ga0496102_1084114 | |||
| 2544 | Ga0496102_1138239 | |||
| 2545 | Ga0496103_0011535 | |||
| 2546 | Ga0496103_0019686 | |||
| 2547 | Ga0496103_0191846 | |||
| 2548 | Ga0496104_0012446 | |||
| 2549 | Ga0496104_0072184 | |||
| 2550 | Ga0496104_0077845 | |||
| 2551 | Ga0496104_0159226 | |||
| 2552 | Ga0496104_0367572 | |||
| 2553 | Ga0496104_0403967 | |||
| 2554 | Ga0496104_0500938 | |||
| 2555 | Ga0496104_1370905 | |||
| 2556 | Ga0496105_0044348 | |||
| 2557 | Ga0496105_0162019 | |||
| 2558 | Ga0496105_0168019 | |||
| 2559 | Ga0496105_0209619 | |||
| 2560 | Ga0496105_0334842 | |||
| 2561 | Ga0496106_0002174 | |||
| 2562 | Ga0496106_0023076 | |||
| 2563 | Ga0496106_0083615 | |||
| 2564 | Ga0496106_0281934 | |||
| 2565 | Ga0496106_0386891 | |||
| 2566 | Ga0496106_0695051 | |||
| 2567 | Ga0496106_0954534 | |||
| 2568 | Ga0496107_0018540 | |||
| 2569 | Ga0496107_0170479 | |||
| 2570 | Ga0496107_0211431 | |||
| 2571 | Ga0496107_0549569 | |||
| 2572 | Ga0496107_1223414 | |||
| 2573 | Ga0496108_0032258 | |||
| 2574 | Ga0496108_0042309 | |||
| 2575 | Ga0496108_0150540 | |||
| 2576 | Ga0496108_0202863 | |||
| 2577 | Ga0496108_0299120 | |||
| 2578 | Ga0496108_0455425 | |||
| 2579 | Ga0496108_0878263 | |||
| 2580 | Ga0496109_0063355 | |||
| 2581 | Ga0496109_0080035 | |||
| 2582 | Ga0496109_0271092 | |||
| 2583 | Ga0496109_0293107 | |||
| 2584 | Ga0496109_0337800 | |||
| 2585 | Ga0496109_0396259 | |||
| 2586 | Ga0496109_0486714 | |||
| 2587 | Ga0496109_0534195 | |||
| 2588 | Ga0496110_0097184 | |||
| 2589 | Ga0496110_0171464 | |||
| 2590 | Ga0496110_0209515 | |||
| 2591 | Ga0496110_0325509 | |||
| 2592 | Ga0496110_0472005 | |||
| 2593 | Ga0496110_1014764 | |||
| 2594 | Ga0496111_0184825 | |||
| 2595 | Ga0496111_0204705 | |||
| 2596 | Ga0496111_0362231 | |||
| 2597 | Ga0496111_0395934 | |||
| 2598 | Ga0496111_0440872 | |||
| 2599 | Ga0496111_0626273 | |||
| 2600 | Ga0496112_0017121 | |||
| 2601 | Ga0496112_0050307 | |||
| 2602 | Ga0496112_0087521 | |||
| 2603 | Ga0496112_0106562 | |||
| 2604 | Ga0496112_0141497 | |||
| 2605 | Ga0496112_0155440 | |||
| 2606 | Ga0496112_0180552 | |||
| 2607 | Ga0496112_0231179 | |||
| 2608 | Ga0496112_0426235 | |||
| 2609 | Ga0496112_0731749 | |||
| 2610 | Ga0496112_0915914 | |||
| 2611 | Ga0496112_1008795 | |||
| 2612 | Ga0496112_1269759 | |||
| 2613 | Ga0496113_0069914 | |||
| 2614 | Ga0496113_0140358 | |||
| 2615 | Ga0496113_0180835 | |||
| 2616 | Ga0496113_0519020 | |||
| 2617 | Ga0496113_0714352 | |||
| 2618 | Ga0496113_0925727 | |||
| 2619 | Ga0496113_1075709 | |||
| 2620 | Ga0496114_0012996 | |||
| 2621 | Ga0496114_0012997 | |||
| 2622 | Ga0496114_0591740 | |||
| 2623 | Ga0496114_1344397 | |||
| 2624 | Ga0496115_0002575 | |||
| 2625 | Ga0496115_0004314 | |||
| 2626 | Ga0496115_0009615 | |||
| 2627 | Ga0496115_0026271 | |||
| 2628 | Ga0496115_0091504 | |||
| 2629 | Ga0496115_0163516 | |||
| 2630 | Ga0496115_0674581 | |||
| 2631 | Ga0501323_033420 | |||
| 2632 | Ga0501036_1203504 | |||
| 2633 | Ga0501038_0198598 | |||
| 2634 | Ga0501048_0931269 | |||
| 2635 | Ga0501068_0554486 | |||
| 2636 | Ga0501070_0658494 | |||
| 2637 | Ga0501072_0079503 | |||
| 2638 | Ga0501073_0037486 | |||
| 2639 | Ga0501074_0067186 | |||
| 2640 | Ga0501075_0201190 | |||
| 2641 | Ga0501079_0039652 | |||
| 2642 | Ga0501080_0078950 | |||
| 2643 | Ga0501081_0042874 | |||
| 2644 | Ga0501269_026792 | |||
| 2645 | nmdc:mga05p37_135223_c1 | |||
| 2646 | nmdc:mga05p37_140290_c1 | |||
| 2647 | nmdc:mga05p37_1701_c1 | |||
| 2648 | nmdc:mga05p37_468622_c1 | |||
| 2649 | nmdc:mga08y16_1151339_c1 | |||
| 2650 | nmdc:mga08y16_1272337_c1 | |||
| 2651 | nmdc:mga08y16_2132647_c1 | |||
| 2652 | nmdc:mga08y16_724873_c1 | |||
| 2653 | nmdc:mga08y16_786981_c1 | |||
| 2654 | nmdc:mga0n895_15345_c1 | |||
| 2655 | nmdc:mga0n895_344747_c1 | |||
| 2656 | nmdc:mga0n895_507216_c1 | |||
| 2657 | nmdc:mga0n895_575194_c1 | |||
| 2658 | nmdc:mga0n895_764651_c1 | |||
| 2659 | nmdc:mga0rr50_1043890_c1 | |||
| 2660 | nmdc:mga0rr50_1337496_c1 | |||
| 2661 | nmdc:mga0rr50_772511_c1 | |||
| 2662 | nmdc:mga0rr50_968519_c1 | |||
| 2663 | nmdc:mga08x19_576507_c1 | |||
| 2664 | nmdc:mga08x19_80561_c1 | |||
| 2665 | nmdc:mga0a205_392963_c1 | |||
| 2666 | nmdc:mga0a205_442986_c1 | |||
| 2667 | nmdc:mga0a205_480816_c1 | |||
| 2668 | nmdc:mga0a205_8807_c1 | |||
| 2669 | Ga0495601_0001921 | |||
| 2670 | Ga0495601_0180268 | |||
| 2671 | Ga0495619_0108420 | |||
| 2672 | Ga0500643_172821 | |||
| 2673 | Ga0500555_000015 | |||
| 2674 | Ga0500568_0043000 | |||
| 2675 | Ga0500616_0003906 | |||
| 2676 | Ga0500616_0006989 | |||
| 2677 | Ga0501084_0195523 | |||
| 2678 | Ga0501082_0025331 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 8fmw-assembly1.cif.gz_H | the structure of a hibernating ribosome in the lyme disease pathogen | 0.969 | 3 | 132 |
| 5zeb-assembly1.cif.gz_h | m. smegmatis p/p state 70s ribosome structure | 0.9649 | 4 | 132 |
| 4pdb-assembly1.cif.gz_A | crystal structure of bacillus anthracis ribosomal protein s8 in complex with an rna aptamer | 0.96 | 5 | 132 |
| 7unu-assembly1.cif.gz_h | pseudomonas aeruginosa 70s ribosome initiation complex bound to compact if2-gdp (composite structure i-b) | 0.9563 | 3 | 132 |
| 8cwo-assembly1.cif.gz_H | cutibacterium acnes 30s ribosomal subunit with sarecycline bound, body domain only in the local refined map | 0.9547 | 3 | 132 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9804 | 76 | 132 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.976 | 76 | 132 | 3.30.1490.10 |
| 3uz6K02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.948 | 76 | 132 | 3.30.1490.10 |
| 3ofpH02 | Alpha Beta;2-Layer Sandwich;Dna Ligase; domain 1; | 0.9438 | 76 | 132 | 3.30.1490.10 |
| 3ofbH01 | Alpha Beta;2-Layer Sandwich;Ribosomal Protein S8; Chain: A, domain 1; | 0.9201 | 6 | 73 | 3.30.1370.30 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1V6DPD0-F1-model_v4 | deleted | 0.9942 | 65 | 132 |
|
| AF-A0A3D2E2Q9-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9927 | 71 | 132 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2V6HX14-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9924 | 17 | 116 |
GO:0003735
GO:0005737 GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2M7NWQ0-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9921 | 65 | 132 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |
| AF-A0A2V7XB09-F1-model_v4 | Small ribosomal subunit protein uS8 (30S ribosomal protein S8) | 0.9917 | 69 | 132 |
GO:0003735
GO:0005840 GO:0006412 GO:1990904 |