F493123

General Info

Members Datasets Scaffolds Average Seq Length
1336 383 1336 201

Family's Representative Sequence

Representative Sequence 3300049571|Ga0501034_0238848|Ga0501034_0238848_719_1360
Length 213
Sequence MAAKQSKKEGKGAEAQSAVEAPATPRLLERYKSTVLPHLRDKLGRANAMSLPRLTKIVVSMGVGSAVTEKKHMEEAVAALGVITGQKPAVCKSRHSISNFKLREGLEIGAKVTLRGPRMWEFMDRLIAIVLPRVRDFRGLNPNAFDGRGNYSLGLTEQLVFPEINPDKFTRTQGMNIAFITSTDSNDEGRELLRALGMPFRVEEGKNPKSPAA

Samples

Sample ID Description Type Environment
1 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
2 3300001976 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S7 Metagenome Rhizosphere
3 3300001978 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6 Metagenome Rhizosphere
4 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
5 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
6 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
7 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
8 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
9 3300004798 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - roots SR-2 (Metagenome Metatranscriptome) Metatranscriptome Unclassified
10 3300004799 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
11 3300004800 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
12 3300004803 Switchgrass rhizosphere and bulk soil microbial communities from Kellogg Biological Station, Michigan, USA for expression studies - soil CB-2 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
13 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
14 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
15 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
16 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
17 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
18 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
19 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
20 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
21 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
22 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
23 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
24 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
25 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
26 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
27 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
28 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
29 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
30 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
31 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
32 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
33 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
34 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
35 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
36 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
37 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
38 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
39 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
40 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
41 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
42 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
43 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
44 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
45 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
46 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
47 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
48 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
49 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
50 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
51 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
52 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
53 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
54 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
55 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
56 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
57 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
58 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
59 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
60 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
61 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
62 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
63 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
64 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
65 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
66 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
67 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
68 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
69 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
70 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
71 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
72 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
73 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
74 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
75 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
76 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
77 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
78 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
79 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
80 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
81 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
82 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
83 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
84 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
85 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
86 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
87 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
88 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
89 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
90 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
91 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
92 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
93 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
94 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
95 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
96 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
97 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
98 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
99 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
100 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
101 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
102 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
103 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
104 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
105 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
106 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
107 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
108 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
109 3300007265 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 Metagenome Rhizosphere
110 3300007788 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_2 Metagenome Rhizosphere
111 3300009092 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-4 metaG Metagenome Rhizosphere
112 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
113 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
114 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
115 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
116 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
117 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
118 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
119 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
120 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
121 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
122 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
123 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
124 3300010159 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_3 Metagenome Rhizosphere
125 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
126 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
127 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
128 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
129 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
130 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
131 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
132 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
133 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
134 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
135 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
136 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
137 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
138 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
139 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
140 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
141 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
142 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
143 3300019188 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZE2 metaT (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
144 3300021377 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 Metagenome Unclassified
145 3300021388 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 Metagenome Unclassified
146 3300022730 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU2 Metagenome Rhizosphere
147 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
148 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
149 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
211 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
213 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
217 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
218 3300028016 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE1 Metagenome Rhizosphere
219 3300028017 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE4 Metagenome Rhizosphere
220 3300028036 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE2 Metagenome Rhizosphere
221 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
222 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
225 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
226 3300030760 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI4 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
227 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
228 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
229 3300031239 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-24 metaG Metagenome Rhizosphere
230 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
231 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
232 3300031250 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-23 metaG Metagenome Rhizosphere
233 3300031251 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-16-21 metaG Metagenome Rhizosphere
234 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
235 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
236 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
237 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
238 3300031824 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-2 Metagenome Rhizosphere
239 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
240 3300031995 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-2 Metagenome Rhizosphere
241 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
242 3300032005 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-1 Metagenome Rhizosphere
243 3300032120 Metatranscriptome of spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZA5 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
244 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
245 3300033547 Spruce roots microbial communities from Maridalen valley, Oslo, Norway - NRE1 Metagenome Unclassified
246 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
247 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
248 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
249 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
250 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
251 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
252 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
253 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
254 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
255 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
256 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
257 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
258 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
259 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
260 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
261 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
262 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
263 3300035207 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_16 Metagenome Rhizosphere
264 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
265 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
266 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
267 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
268 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
269 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
270 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
271 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
272 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
273 3300036457 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZA5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
274 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
275 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
276 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
277 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
278 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
279 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
280 3300041496 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR17_4 MetaG Metagenome Unclassified
281 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
282 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
283 3300042005 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z062817_5216 Metagenome Rhizosphere
284 3300042008 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z062817_5219 Metagenome Rhizosphere
285 3300042012 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z062817_5213 Metagenome Rhizosphere
286 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
287 3300042139 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0727L_E14_072516_1442 Metagenome Rhizosphere
288 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
289 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
290 3300042533 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0826F_E14_072516_1472 Metagenome Rhizosphere
291 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
292 3300044673 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Bulk_9BB_GED Metagenome Rhizosphere
293 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
294 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
295 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
296 3300044706 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA3R Metagenome Rhizosphere
297 3300044712 Rhizosphere soil microbial communities from rice plants in Newark, Delaware, United States - Rhiz_9IH_GED Metagenome Rhizosphere
298 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
299 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
300 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
301 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
302 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
303 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
304 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
305 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
306 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
307 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
308 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
309 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
310 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
311 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
312 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
313 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
314 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
315 3300046522 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 rhizosphere Metagenome Rhizosphere
316 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
317 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
318 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
319 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
320 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
321 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
322 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
323 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
324 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
325 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
326 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
327 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
328 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
329 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
330 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
331 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
332 3300047318 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co1_6_4 rhizosphere Metagenome Rhizosphere
333 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
334 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
335 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
336 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
337 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
338 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
339 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
340 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
341 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
342 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
343 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
344 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
345 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
346 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
347 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
348 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
349 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
350 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
351 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
352 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
353 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
354 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
356 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
357 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
358 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
359 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
360 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
361 3300049759 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - C13_A_4_drought Metagenome Rhizosphere
362 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
363 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
364 3300050494 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 re-annotation Metagenome Endosphere
365 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
366 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
367 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
368 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
369 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
370 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
371 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
372 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
373 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
374 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
375 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
376 3300050516 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 re-annotation Metagenome Endosphere
377 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
378 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
379 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
380 3300053129 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 endosphere Metagenome Endosphere
381 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
382 3300059639 Metatranscriptome of rhizosphere soil microbial communities from Hall's panicgrass in greenhouse, Berkeley, CA, USA - 3R_CW_T1_R3 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
383 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.58
Metatranscriptomes 1.42
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.9
Nodule 0
Rhizoplane 4.79
Rhizosphere 93.56
Stem 0
Stem Tuber 0
Unclassified 0.75

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 MBSR1b_contig_11325966 2162886012 Bacteria 1441
2 JGI24752J21851_1000484 3300001976 Bacteria 5323
3 JGI24747J21853_1000395 3300001978 Bacteria 2628
4 JGI24747J21853_1000762 3300001978 Bacteria 2176
5 JGI24737J22298_10016993 3300001990 Bacteria 2346
6 JGI24750J21931_1036188 3300002070 Bacteria 738
7 JGI24748J21848_1001357 3300002074 Bacteria 2690
8 JGI24034J26672_10001629 3300002239 Bacteria 3004
9 JGI24751J29686_10001356 3300002459 Bacteria 5148
10 Ga0058859_11567801 3300004798 Bacteria 1235
11 Ga0058863_10034036 3300004799 Bacteria 1759
12 Ga0058861_10061116 3300004800 Bacteria 1260
13 Ga0058861_11712544 3300004800 Bacteria 669
14 Ga0058861_11825451 3300004800 Bacteria 1192
15 Ga0058862_12460894 3300004803 Bacteria 1440
16 Ga0058862_12823060 3300004803 Bacteria 1268
17 Ga0065704_10150289 3300005289 Bacteria 1435
18 Ga0065712_10007779 3300005290 Bacteria 2890
19 Ga0065715_10095964 3300005293 Bacteria 3972
20 Ga0065715_10278486 3300005293 Bacteria 1089
21 Ga0065715_10310247 3300005293 Bacteria 1022
22 Ga0065707_10193324 3300005295 Bacteria 1349
23 Ga0070658_10113543 3300005327 Bacteria 2246
24 Ga0070676_10009197 3300005328 Bacteria 5341
25 Ga0070676_10072855 3300005328 Bacteria 2066
26 Ga0070676_10108569 3300005328 Bacteria 1725
27 Ga0070683_100011087 3300005329 Bacteria 7771
28 Ga0070683_100014406 3300005329 Bacteria 6915
29 Ga0070683_100053730 3300005329 Bacteria 3733
30 Ga0070683_100167030 3300005329 Bacteria 2088
31 Ga0070683_100226293 3300005329 Bacteria 1777
32 Ga0070690_100000550 3300005330 Bacteria 18744
33 Ga0070690_100022065 3300005330 Bacteria 3893
34 Ga0070690_100182552 3300005330 Bacteria 1450
35 Ga0070670_100009055 3300005331 Bacteria 8505
36 Ga0070670_100015559 3300005331 Bacteria 6534
37 Ga0070670_100033183 3300005331 Bacteria 4447
38 Ga0070670_100322656 3300005331 Bacteria 1353
39 Ga0070677_10021297 3300005333 Bacteria 2376
40 Ga0070677_10269511 3300005333 Bacteria 853
41 Ga0068869_100001846 3300005334 Bacteria 12731
42 Ga0068869_100012003 3300005334 Bacteria 5703
43 Ga0068869_100014372 3300005334 Bacteria 5286
44 Ga0070666_10010107 3300005335 Bacteria 5893
45 Ga0070666_10010510 3300005335 Bacteria 5791
46 Ga0070666_10085344 3300005335 Bacteria 2162
47 Ga0070680_100073735 3300005336 Bacteria 2808
48 Ga0070680_100188040 3300005336 Bacteria 1740
49 Ga0070680_100347262 3300005336 Bacteria 1261
50 Ga0070682_100015238 3300005337 Bacteria 4452
51 Ga0070682_100060415 3300005337 Bacteria 2397
52 Ga0068868_100002791 3300005338 Bacteria 12099
53 Ga0068868_100012462 3300005338 Bacteria 6217
54 Ga0068868_100013462 3300005338 Bacteria 5997
55 Ga0068868_100018109 3300005338 Bacteria 5259
56 Ga0068868_100051789 3300005338 Bacteria 3231
57 Ga0068868_100081453 3300005338 Bacteria 2595
58 Ga0068868_100212391 3300005338 Bacteria 1618
59 Ga0068868_100232254 3300005338 Bacteria 1548
60 Ga0068868_100248963 3300005338 Bacteria 1495
61 Ga0070660_100006039 3300005339 Bacteria 8373
62 Ga0070660_100013792 3300005339 Bacteria 5813
63 Ga0070689_100172020 3300005340 Bacteria 1755
64 Ga0070689_100212287 3300005340 Bacteria 1585
65 Ga0070689_100860581 3300005340 Bacteria 800
66 Ga0070691_10027650 3300005341 Bacteria 2647
67 Ga0070691_10257775 3300005341 Bacteria 938
68 Ga0070661_100092200 3300005344 Bacteria 2244
69 Ga0070661_100151381 3300005344 Bacteria 1754
70 Ga0070661_100265313 3300005344 Bacteria 1328
71 Ga0070661_100370991 3300005344 Bacteria 1127
72 Ga0070692_10098229 3300005345 Bacteria 1601
73 Ga0070668_100006844 3300005347 Bacteria 8451
74 Ga0070668_100232473 3300005347 Bacteria 1525
75 Ga0070669_100007500 3300005353 Bacteria 7813
76 Ga0070675_100004817 3300005354 Bacteria 10298
77 Ga0070675_100084032 3300005354 Bacteria 2658
78 Ga0070671_100096110 3300005355 Bacteria 2484
79 Ga0070674_100005528 3300005356 Bacteria 7308
80 Ga0070674_100053133 3300005356 Bacteria 2796
81 Ga0070688_100036719 3300005365 Bacteria 2981
82 Ga0070688_100048827 3300005365 Bacteria 2631
83 Ga0070688_100237831 3300005365 Bacteria 1291
84 Ga0070659_100023105 3300005366 Bacteria 4754
85 Ga0070659_100200318 3300005366 Bacteria 1643
86 Ga0070667_100017909 3300005367 Bacteria 5871
87 Ga0070667_100292350 3300005367 Bacteria 1465
88 Ga0070709_10001304 3300005434 Bacteria 13588
89 Ga0070709_10002115 3300005434 Bacteria 10743
90 Ga0070709_10011840 3300005434 Bacteria 4870
91 Ga0070709_10030261 3300005434 Bacteria 3247
92 Ga0070709_10030364 3300005434 Bacteria 3242
93 Ga0070709_10053609 3300005434 Bacteria 2540
94 Ga0070709_10055745 3300005434 Bacteria 2497
95 Ga0070709_10060970 3300005434 Bacteria 2400
96 Ga0070709_10145020 3300005434 Bacteria 1635
97 Ga0070709_10238073 3300005434 Bacteria 1306
98 Ga0070709_10268501 3300005434 Bacteria 1235
99 Ga0070709_10286619 3300005434 Bacteria 1199
100 Ga0070709_10465504 3300005434 Bacteria 955
101 Ga0070714_100000096 3300005435 Bacteria 74616
102 Ga0070714_100010335 3300005435 Bacteria 7376
103 Ga0070714_100050607 3300005435 Bacteria 3540
104 Ga0070714_100092468 3300005435 Bacteria 2651
105 Ga0070714_100113339 3300005435 Bacteria 2404
106 Ga0070714_100140298 3300005435 Bacteria 2169
107 Ga0070714_100341565 3300005435 Bacteria 1404
108 Ga0070714_100357250 3300005435 Bacteria 1373
109 Ga0070714_100388424 3300005435 Bacteria 1317
110 Ga0070714_100439603 3300005435 Bacteria 1238
111 Ga0070714_100495294 3300005435 Bacteria 1165
112 Ga0070714_100930375 3300005435 Bacteria 844
113 Ga0070713_100003189 3300005436 Bacteria 10795
114 Ga0070713_100004545 3300005436 Bacteria 9350
115 Ga0070713_100007500 3300005436 Bacteria 7662
116 Ga0070713_100015219 3300005436 Bacteria 5738
117 Ga0070713_100017965 3300005436 Bacteria 5367
118 Ga0070713_100020716 3300005436 Bacteria 5046
119 Ga0070713_100072194 3300005436 Bacteria 2919
120 Ga0070713_100078060 3300005436 Bacteria 2817
121 Ga0070713_100081996 3300005436 Bacteria 2753
122 Ga0070713_100095999 3300005436 Bacteria 2558
123 Ga0070713_100096048 3300005436 Bacteria 2558
124 Ga0070713_100103869 3300005436 Bacteria 2466
125 Ga0070713_100148392 3300005436 Bacteria 2084
126 Ga0070713_100216112 3300005436 Bacteria 1738
127 Ga0070713_100220111 3300005436 Bacteria 1722
128 Ga0070713_100289077 3300005436 Bacteria 1506
129 Ga0070713_100384332 3300005436 Bacteria 1308
130 Ga0070713_100800449 3300005436 Bacteria 903
131 Ga0070713_100809415 3300005436 Bacteria 898
132 Ga0070713_101565227 3300005436 Bacteria 640
133 Ga0070710_10007025 3300005437 Bacteria 5433
134 Ga0070710_10035496 3300005437 Bacteria 2719
135 Ga0070710_10048515 3300005437 Bacteria 2372
136 Ga0070710_10075725 3300005437 Bacteria 1951
137 Ga0070710_10159991 3300005437 Bacteria 1396
138 Ga0070710_10200110 3300005437 Bacteria 1261
139 Ga0070701_10006922 3300005438 Bacteria 4804
140 Ga0070701_10057060 3300005438 Bacteria 2045
141 Ga0070711_100000191 3300005439 Bacteria 32562
142 Ga0070711_100001361 3300005439 Bacteria 13347
143 Ga0070711_100011497 3300005439 Bacteria 5500
144 Ga0070711_100014481 3300005439 Bacteria 4969
145 Ga0070711_100120873 3300005439 Bacteria 1937
146 Ga0070711_100142308 3300005439 Bacteria 1800
147 Ga0070711_100156742 3300005439 Bacteria 1722
148 Ga0070711_100268773 3300005439 Bacteria 1345
149 Ga0070711_100307946 3300005439 Bacteria 1262
150 Ga0070711_100369828 3300005439 Bacteria 1156
151 Ga0070711_100419793 3300005439 Bacteria 1090
152 Ga0070711_100470897 3300005439 Bacteria 1031
153 Ga0070711_100529994 3300005439 Bacteria 975
154 Ga0070705_100078070 3300005440 Bacteria 2024
155 Ga0070700_100021246 3300005441 Bacteria 3771
156 Ga0070694_100045069 3300005444 Bacteria 2954
157 Ga0070708_100000356 3300005445 Bacteria 34664
158 Ga0070708_100003510 3300005445 Bacteria 12276
159 Ga0070708_100003542 3300005445 Bacteria 12233
160 Ga0070708_100005470 3300005445 Bacteria 10070
161 Ga0070708_100015435 3300005445 Bacteria 6309
162 Ga0070708_100024232 3300005445 Bacteria 5173
163 Ga0070708_100036854 3300005445 Bacteria 4266
164 Ga0070708_100050730 3300005445 Bacteria 3674
165 Ga0070708_100164174 3300005445 Bacteria 2071
166 Ga0070708_100304336 3300005445 Bacteria 1501
167 Ga0070708_100470537 3300005445 Bacteria 1186
168 Ga0070663_100012382 3300005455 Bacteria 5395
169 Ga0070663_100031257 3300005455 Bacteria 3658
170 Ga0070663_100078211 3300005455 Bacteria 2424
171 Ga0070663_100383589 3300005455 Bacteria 1145
172 Ga0070678_100056347 3300005456 Bacteria 2874
173 Ga0070678_100296916 3300005456 Bacteria 1372
174 Ga0070678_100432412 3300005456 Bacteria 1149
175 Ga0070678_100840451 3300005456 Bacteria 836
176 Ga0070662_100005784 3300005457 Bacteria 7923
177 Ga0070662_100018068 3300005457 Bacteria 4765
178 Ga0070662_100134404 3300005457 Bacteria 1911
179 Ga0070681_10004001 3300005458 Bacteria 13903
180 Ga0070681_10029788 3300005458 Bacteria 5479
181 Ga0070681_10033193 3300005458 Bacteria 5181
182 Ga0070681_10048939 3300005458 Bacteria 4222
183 Ga0070681_10058143 3300005458 Bacteria 3847
184 Ga0070681_10109152 3300005458 Bacteria 2707
185 Ga0070681_10168689 3300005458 Bacteria 2111
186 Ga0070681_10286546 3300005458 Bacteria 1557
187 Ga0068867_100007176 3300005459 Bacteria 7874
188 Ga0068867_100015173 3300005459 Bacteria 5464
189 Ga0068867_100032550 3300005459 Bacteria 3771
190 Ga0068867_100052488 3300005459 Bacteria 3009
191 Ga0068867_100152499 3300005459 Bacteria 1816
192 Ga0070685_10004725 3300005466 Bacteria 6895
193 Ga0070685_10009457 3300005466 Bacteria 5038
194 Ga0070685_10059975 3300005466 Bacteria 2223
195 Ga0070685_10127213 3300005466 Bacteria 1589
196 Ga0070706_100000278 3300005467 Bacteria 62365
197 Ga0070706_100000514 3300005467 Bacteria 45375
198 Ga0070706_100014580 3300005467 Bacteria 7262
199 Ga0070706_100076041 3300005467 Bacteria 3108
200 Ga0070706_100115364 3300005467 Bacteria 2501
201 Ga0070707_100000662 3300005468 Bacteria 34318
202 Ga0070707_100005126 3300005468 Bacteria 12276
203 Ga0070707_100034957 3300005468 Bacteria 4792
204 Ga0070707_100040946 3300005468 Bacteria 4433
205 Ga0070707_100113490 3300005468 Bacteria 2629
206 Ga0070707_100318818 3300005468 Bacteria 1510
207 Ga0070707_100474050 3300005468 Bacteria 1213
208 Ga0070707_100503831 3300005468 Bacteria 1172
209 Ga0070707_100584232 3300005468 Unclassified 1079
210 Ga0070698_100002449 3300005471 Bacteria 20472
211 Ga0070698_100507868 3300005471 Bacteria 1143
212 Ga0070699_100000441 3300005518 Bacteria 39851
213 Ga0070699_100013805 3300005518 Bacteria 6949
214 Ga0070699_100040038 3300005518 Bacteria 4058
215 Ga0070699_100071504 3300005518 Bacteria 3017
216 Ga0070699_100321008 3300005518 Bacteria 1392
217 Ga0070679_100031685 3300005530 Bacteria 5226
218 Ga0070679_100051170 3300005530 Bacteria 4114
219 Ga0070679_100135498 3300005530 Bacteria 2444
220 Ga0070679_100298600 3300005530 Bacteria 1561
221 Ga0070679_100376336 3300005530 Bacteria 1367
222 Ga0070679_100451951 3300005530 Bacteria 1229
223 Ga0070679_100592171 3300005530 Bacteria 1052
224 Ga0070679_100644851 3300005530 Bacteria 1002
225 Ga0070679_101052599 3300005530 Bacteria 758
226 Ga0070684_100001423 3300005535 Bacteria 17232
227 Ga0070684_100015104 3300005535 Bacteria 6277
228 Ga0070684_100136802 3300005535 Bacteria 2214
229 Ga0070684_100158358 3300005535 Bacteria 2053
230 Ga0070684_100891523 3300005535 Bacteria 833
231 Ga0070697_100000975 3300005536 Bacteria 21592
232 Ga0070697_100000993 3300005536 Bacteria 21455
233 Ga0070697_100001451 3300005536 Bacteria 18044
234 Ga0070697_100005121 3300005536 Bacteria 10067
235 Ga0070697_100007786 3300005536 Bacteria 8337
236 Ga0070697_100008091 3300005536 Bacteria 8200
237 Ga0070697_100010485 3300005536 Bacteria 7232
238 Ga0070697_100016797 3300005536 Bacteria 5757
239 Ga0070697_100062782 3300005536 Bacteria 3032
240 Ga0070697_100081875 3300005536 Bacteria 2660
241 Ga0070697_100087566 3300005536 Bacteria 2571
242 Ga0070697_100445202 3300005536 Bacteria 1128
243 Ga0068853_100008308 3300005539 Bacteria 8336
244 Ga0068853_100158771 3300005539 Bacteria 2039
245 Ga0068853_100238624 3300005539 Bacteria 1665
246 Ga0068853_100477114 3300005539 Bacteria 1175
247 Ga0068853_100972961 3300005539 Bacteria 816
248 Ga0070672_100022245 3300005543 Bacteria 4652
249 Ga0070672_100040143 3300005543 Bacteria 3589
250 Ga0070686_100032760 3300005544 Bacteria 3188
251 Ga0070686_100036509 3300005544 Bacteria 3043
252 Ga0070686_100107346 3300005544 Bacteria 1896
253 Ga0070695_100040849 3300005545 Bacteria 2938
254 Ga0070695_100203574 3300005545 Bacteria 1416
255 Ga0070696_100108905 3300005546 Bacteria 1993
256 Ga0070696_100202266 3300005546 Bacteria 1483
257 Ga0070696_100388748 3300005546 Bacteria 1089
258 Ga0070693_100020180 3300005547 Bacteria 3510
259 Ga0070693_100047613 3300005547 Bacteria 2440
260 Ga0070693_100112718 3300005547 Bacteria 1675
261 Ga0070693_100154942 3300005547 Bacteria 1454
262 Ga0070665_100072424 3300005548 Bacteria 3454
263 Ga0070665_100086273 3300005548 Bacteria 3144
264 Ga0070665_100637333 3300005548 Bacteria 1079
265 Ga0070704_100206371 3300005549 Bacteria 1589
266 Ga0068855_100005681 3300005563 Bacteria 15239
267 Ga0068855_100020061 3300005563 Bacteria 8027
268 Ga0068855_100025561 3300005563 Bacteria 7062
269 Ga0068855_100088860 3300005563 Bacteria 3568
270 Ga0068855_100644621 3300005563 Bacteria 1138
271 Ga0070664_100045861 3300005564 Bacteria 3691
272 Ga0070664_100054311 3300005564 Bacteria 3398
273 Ga0070664_100057624 3300005564 Bacteria 3302
274 Ga0070664_100074814 3300005564 Bacteria 2907
275 Ga0070664_100654639 3300005564 Bacteria 976
276 Ga0068857_100001133 3300005577 Bacteria 20806
277 Ga0068857_100001398 3300005577 Bacteria 19047
278 Ga0068857_100051265 3300005577 Bacteria 3661
279 Ga0068857_100171142 3300005577 Bacteria 1974
280 Ga0068854_100065777 3300005578 Bacteria 2636
281 Ga0068854_100080136 3300005578 Bacteria 2409
282 Ga0068854_100093571 3300005578 Bacteria 2240
283 Ga0068854_100344020 3300005578 Bacteria 1219
284 Ga0068854_100556477 3300005578 Bacteria 974
285 Ga0068854_101038293 3300005578 Bacteria 727
286 Ga0068856_100004687 3300005614 Bacteria 13570
287 Ga0068856_100005788 3300005614 Bacteria 12182
288 Ga0068856_100005938 3300005614 Bacteria 12020
289 Ga0068856_100014911 3300005614 Bacteria 7502
290 Ga0068856_100044555 3300005614 Bacteria 4366
291 Ga0068856_100046667 3300005614 Bacteria 4266
292 Ga0068856_100087365 3300005614 Bacteria 3099
293 Ga0068856_100224332 3300005614 Bacteria 1894
294 Ga0068856_100231154 3300005614 Bacteria 1865
295 Ga0068856_100245813 3300005614 Bacteria 1804
296 Ga0068856_100388304 3300005614 Bacteria 1415
297 Ga0070702_100005684 3300005615 Bacteria 5838
298 Ga0070702_100571212 3300005615 Bacteria 843
299 Ga0068852_100001223 3300005616 Bacteria 17089
300 Ga0068852_100018187 3300005616 Bacteria 5533
301 Ga0068852_100051789 3300005616 Bacteria 3525
302 Ga0068852_100154743 3300005616 Bacteria 2135
303 Ga0068859_100004997 3300005617 Bacteria 13466
304 Ga0068859_100010649 3300005617 Bacteria 9255
305 Ga0068859_100025042 3300005617 Bacteria 5990
306 Ga0068859_100122147 3300005617 Bacteria 2671
307 Ga0068864_100008706 3300005618 Bacteria 8371
308 Ga0068864_100098522 3300005618 Bacteria 2589
309 Ga0068864_100125973 3300005618 Bacteria 2295
310 Ga0068864_100248185 3300005618 Bacteria 1651
311 Ga0068864_100736143 3300005618 Bacteria 965
312 Ga0068864_101090888 3300005618 Bacteria 794
313 Ga0068866_10002246 3300005718 Bacteria 8007
314 Ga0068866_10007588 3300005718 Bacteria 4548
315 Ga0068866_10099015 3300005718 Bacteria 1605
316 Ga0068861_100006422 3300005719 Bacteria 8008
317 Ga0068851_10001352 3300005834 Bacteria 10700
318 Ga0068851_10101620 3300005834 Bacteria 1526
319 Ga0068851_10341582 3300005834 Bacteria 869
320 Ga0068870_10008477 3300005840 Bacteria 4626
321 Ga0068863_100020461 3300005841 Bacteria 6323
322 Ga0068863_100093282 3300005841 Bacteria 2857
323 Ga0068863_101062493 3300005841 Bacteria 813
324 Ga0068858_100011628 3300005842 Bacteria 8303
325 Ga0068858_100059426 3300005842 Bacteria 3533
326 Ga0068858_100073301 3300005842 Bacteria 3178
327 Ga0068858_100351075 3300005842 Bacteria 1413
328 Ga0068860_100018016 3300005843 Bacteria 6877
329 Ga0068860_100038574 3300005843 Bacteria 4570
330 Ga0068860_100110176 3300005843 Bacteria 2631
331 Ga0068860_100135707 3300005843 Bacteria 2363
332 Ga0068860_100160986 3300005843 Bacteria 2164
333 Ga0068860_100220571 3300005843 Bacteria 1841
334 Ga0081455_10311710 3300005937 Bacteria 1124
335 Ga0081540_1062142 3300005983 Bacteria 1776
336 Ga0070717_10002614 3300006028 Bacteria 12700
337 Ga0070717_10006770 3300006028 Bacteria 8457
338 Ga0070717_10007864 3300006028 Bacteria 7938
339 Ga0070717_10011095 3300006028 Bacteria 6830
340 Ga0070717_10016092 3300006028 Bacteria 5792
341 Ga0070717_10038572 3300006028 Bacteria 3884
342 Ga0070717_10100016 3300006028 Bacteria 2461
343 Ga0070717_10132139 3300006028 Bacteria 2147
344 Ga0070717_10145282 3300006028 Bacteria 2048
345 Ga0070717_10168646 3300006028 Bacteria 1903
346 Ga0070717_10169776 3300006028 Bacteria 1897
347 Ga0070717_10200011 3300006028 Bacteria 1750
348 Ga0070717_10277900 3300006028 Bacteria 1485
349 Ga0070717_10323214 3300006028 Bacteria 1375
350 Ga0070717_10354964 3300006028 Bacteria 1311
351 Ga0070717_10468550 3300006028 Bacteria 1137
352 Ga0070717_10540690 3300006028 Bacteria 1055
353 Ga0070717_10811465 3300006028 Bacteria 851
354 Ga0075365_10106101 3300006038 Bacteria 1927
355 Ga0075368_10014567 3300006042 Bacteria 2906
356 Ga0075364_10040659 3300006051 Bacteria 3016
357 Ga0070715_10055410 3300006163 Bacteria 1721
358 Ga0070715_10362751 3300006163 Bacteria 795
359 Ga0070715_10387717 3300006163 Bacteria 773
360 Ga0070716_100002371 3300006173 Bacteria 8670
361 Ga0070716_100004160 3300006173 Bacteria 6876
362 Ga0070716_100005022 3300006173 Bacteria 6377
363 Ga0070716_100008488 3300006173 Bacteria 5097
364 Ga0070716_100011992 3300006173 Bacteria 4380
365 Ga0070716_100067235 3300006173 Bacteria 2093
366 Ga0070716_100109217 3300006173 Bacteria 1711
367 Ga0070716_100168187 3300006173 Bacteria 1428
368 Ga0070716_100175834 3300006173 Bacteria 1401
369 Ga0070716_100209778 3300006173 Bacteria 1301
370 Ga0070716_100369486 3300006173 Bacteria 1021
371 Ga0070716_100401927 3300006173 Bacteria 985
372 Ga0070712_100001135 3300006175 Bacteria 16046
373 Ga0070712_100002103 3300006175 Bacteria 12240
374 Ga0070712_100003121 3300006175 Bacteria 10220
375 Ga0070712_100014016 3300006175 Bacteria 5137
376 Ga0070712_100026733 3300006175 Bacteria 3848
377 Ga0070712_100039318 3300006175 Bacteria 3237
378 Ga0070712_100041417 3300006175 Bacteria 3163
379 Ga0070712_100086068 3300006175 Bacteria 2290
380 Ga0070712_100100963 3300006175 Bacteria 2133
381 Ga0070712_100274186 3300006175 Bacteria 1356
382 Ga0070712_100541554 3300006175 Bacteria 980
383 Ga0070712_100738822 3300006175 Bacteria 841
384 Ga0070712_100828512 3300006175 Bacteria 795
385 Ga0075362_10006435 3300006177 Bacteria 4379
386 Ga0097621_100003981 3300006237 Bacteria 10236
387 Ga0097621_100004769 3300006237 Bacteria 9487
388 Ga0097621_100004937 3300006237 Bacteria 9353
389 Ga0097621_100088363 3300006237 Bacteria 2589
390 Ga0097621_100109209 3300006237 Bacteria 2336
391 Ga0097621_100211017 3300006237 Bacteria 1689
392 Ga0097621_100369486 3300006237 Bacteria 1279
393 Ga0097621_100371706 3300006237 Bacteria 1275
394 Ga0097621_100451474 3300006237 Bacteria 1158
395 Ga0097621_100776403 3300006237 Bacteria 886
396 Ga0068871_100002434 3300006358 Bacteria 12720
397 Ga0068871_100005622 3300006358 Bacteria 8792
398 Ga0068871_100016771 3300006358 Bacteria 5527
399 Ga0068871_100017519 3300006358 Bacteria 5423
400 Ga0068871_100025434 3300006358 Bacteria 4606
401 Ga0068871_100082335 3300006358 Bacteria 2668
402 Ga0068871_100092902 3300006358 Bacteria 2517
403 Ga0068871_100302811 3300006358 Bacteria 1403
404 Ga0068871_100825683 3300006358 Bacteria 856
405 Ga0075428_100098566 3300006844 Bacteria 3186
406 Ga0075431_100763335 3300006847 Bacteria 942
407 Ga0075433_10004383 3300006852 Bacteria 10975
408 Ga0075433_10169475 3300006852 Bacteria 1943
409 Ga0075433_10212326 3300006852 Bacteria 1720
410 Ga0075433_10809527 3300006852 Bacteria 818
411 Ga0075434_100000230 3300006871 Bacteria 38508
412 Ga0075434_100058482 3300006871 Bacteria 3831
413 Ga0075434_100081416 3300006871 Bacteria 3235
414 Ga0075434_100214171 3300006871 Bacteria 1946
415 Ga0075434_100442008 3300006871 Bacteria 1322
416 Ga0075429_100070647 3300006880 Bacteria 3040
417 Ga0075429_100338234 3300006880 Bacteria 1317
418 Ga0068865_100002949 3300006881 Bacteria 10144
419 Ga0068865_100004898 3300006881 Bacteria 8092
420 Ga0068865_100051635 3300006881 Bacteria 2847
421 Ga0068865_100100288 3300006881 Bacteria 2118
422 Ga0075436_100000510 3300006914 Bacteria 25141
423 Ga0075436_100014515 3300006914 Bacteria 5397
424 Ga0075436_100029891 3300006914 Bacteria 3748
425 Ga0075436_100063069 3300006914 Bacteria 2561
426 Ga0075436_100344733 3300006914 Bacteria 1073
427 Ga0097620_100004997 3300006931 Bacteria 13466
428 Ga0097620_100010649 3300006931 Bacteria 9255
429 Ga0097620_100025042 3300006931 Bacteria 5990
430 Ga0097620_100122145 3300006931 Bacteria 2671
431 Ga0075435_100000389 3300007076 Bacteria 26853
432 Ga0075435_100044730 3300007076 Bacteria 3547
433 Ga0075435_100143992 3300007076 Bacteria 2001
434 Ga0075435_100661447 3300007076 Bacteria 907
435 Ga0099794_10196239 3300007265 Bacteria 1033
436 Ga0099795_10017664 3300007788 Bacteria 2278
437 Ga0105250_10058196 3300009092 Bacteria 1551
438 Ga0105240_10035504 3300009093 Bacteria 6424
439 Ga0105240_10053543 3300009093 Bacteria 5065
440 Ga0105240_10101266 3300009093 Bacteria 3504
441 Ga0105240_10171261 3300009093 Bacteria 2571
442 Ga0105240_10178722 3300009093 Bacteria 2506
443 Ga0105240_10211363 3300009093 Bacteria 2267
444 Ga0105240_10223171 3300009093 Bacteria 2194
445 Ga0105240_10374848 3300009093 Bacteria 1608
446 Ga0105240_10375212 3300009093 Bacteria 1607
447 Ga0105240_10402706 3300009093 Bacteria 1541
448 Ga0105240_10414243 3300009093 Bacteria 1515
449 Ga0105240_10459536 3300009093 Bacteria 1423
450 Ga0105240_10699647 3300009093 Bacteria 1106
451 Ga0111539_10021708 3300009094 Bacteria 7895
452 Ga0105245_10005029 3300009098 Bacteria 11625
453 Ga0105245_10052071 3300009098 Bacteria 3671
454 Ga0105245_10119830 3300009098 Bacteria 2457
455 Ga0105245_10195389 3300009098 Bacteria 1940
456 Ga0105245_10199811 3300009098 Bacteria 1919
457 Ga0105245_10341154 3300009098 Bacteria 1482
458 Ga0105245_10469873 3300009098 Unclassified 1269
459 Ga0105245_11135397 3300009098 Bacteria 828
460 Ga0105247_10006156 3300009101 Bacteria 7452
461 Ga0105247_10048806 3300009101 Bacteria 2600
462 Ga0105247_10315739 3300009101 Bacteria 1089
463 Ga0114129_10003061 3300009147 Bacteria 23447
464 Ga0114129_10195930 3300009147 Bacteria 2740
465 Ga0105243_10081667 3300009148 Bacteria 2640
466 Ga0105241_10043666 3300009174 Bacteria 3395
467 Ga0105241_10057747 3300009174 Bacteria 2978
468 Ga0105241_10147872 3300009174 Bacteria 1919
469 Ga0105241_10169458 3300009174 Bacteria 1802
470 Ga0105241_10193390 3300009174 Bacteria 1694
471 Ga0105242_10005427 3300009176 Bacteria 9860
472 Ga0105242_10039591 3300009176 Bacteria 3795
473 Ga0105242_10061446 3300009176 Bacteria 3090
474 Ga0105242_10086432 3300009176 Bacteria 2632
475 Ga0105242_10268480 3300009176 Bacteria 1544
476 Ga0105242_10272746 3300009176 Bacteria 1533
477 Ga0105248_10019482 3300009177 Bacteria 7508
478 Ga0105248_10038960 3300009177 Bacteria 5321
479 Ga0105248_10110411 3300009177 Bacteria 3101
480 Ga0105248_10146565 3300009177 Bacteria 2664
481 Ga0105248_11102617 3300009177 Bacteria 897
482 Ga0105237_10065790 3300009545 Bacteria 3620
483 Ga0105237_10325100 3300009545 Bacteria 1542
484 Ga0105237_10686317 3300009545 Bacteria 1031
485 Ga0105237_10768186 3300009545 Bacteria 970
486 Ga0105238_10010449 3300009551 Bacteria 9317
487 Ga0105238_10019367 3300009551 Bacteria 6931
488 Ga0105238_10330845 3300009551 Bacteria 1510
489 Ga0105238_10541210 3300009551 Bacteria 1168
490 Ga0105238_10572234 3300009551 Bacteria 1135
491 Ga0105249_10025713 3300009553 Bacteria 5302
492 Ga0105249_10067050 3300009553 Bacteria 3305
493 Ga0105249_10131116 3300009553 Bacteria 2393
494 Ga0099796_10010934 3300010159 Bacteria 2514
495 Ga0099796_10033840 3300010159 Bacteria 1684
496 Ga0099796_10108234 3300010159 Bacteria 1055
497 Ga0105239_10048572 3300010375 Bacteria 4653
498 Ga0105239_10056460 3300010375 Bacteria 4307
499 Ga0105239_10091452 3300010375 Bacteria 3358
500 Ga0105239_10197083 3300010375 Bacteria 2255
501 Ga0105239_10466555 3300010375 Bacteria 1433
502 Ga0105239_10508857 3300010375 Bacteria 1369
503 Ga0105239_10529207 3300010375 Bacteria 1341
504 Ga0105246_10002877 3300011119 Bacteria 10417
505 Ga0105246_10070927 3300011119 Bacteria 2452
506 Ga0105246_10096279 3300011119 Bacteria 2145
507 Ga0157373_10001758 3300013100 Bacteria 16488
508 Ga0157373_10001852 3300013100 Bacteria 16057
509 Ga0157371_10002134 3300013102 Bacteria 19252
510 Ga0157371_10014695 3300013102 Bacteria 5893
511 Ga0157371_10064436 3300013102 Bacteria 2597
512 Ga0157371_10069917 3300013102 Bacteria 2485
513 Ga0157370_10115216 3300013104 Bacteria 2511
514 Ga0157370_10167276 3300013104 Bacteria 2044
515 Ga0157370_10294069 3300013104 Bacteria 1500
516 Ga0157370_10534189 3300013104 Bacteria 1076
517 Ga0157370_10747602 3300013104 Bacteria 891
518 Ga0157369_10002709 3300013105 Bacteria 21141
519 Ga0157369_10007208 3300013105 Bacteria 12815
520 Ga0157369_10015406 3300013105 Bacteria 8617
521 Ga0157369_10024569 3300013105 Bacteria 6699
522 Ga0157369_10026263 3300013105 Bacteria 6461
523 Ga0157369_10043759 3300013105 Bacteria 4879
524 Ga0157369_10067149 3300013105 Bacteria 3857
525 Ga0157369_10147068 3300013105 Bacteria 2491
526 Ga0157369_10249242 3300013105 Bacteria 1854
527 Ga0157374_10002644 3300013296 Bacteria 15089
528 Ga0157374_10004729 3300013296 Bacteria 11421
529 Ga0157374_10012759 3300013296 Bacteria 7322
530 Ga0157374_10029721 3300013296 Bacteria 4954
531 Ga0157374_10041968 3300013296 Bacteria 4219
532 Ga0157374_10051381 3300013296 Bacteria 3836
533 Ga0157374_10110444 3300013296 Bacteria 2644
534 Ga0157374_10191404 3300013296 Bacteria 2001
535 Ga0157374_10261321 3300013296 Bacteria 1705
536 Ga0157378_10000411 3300013297 Bacteria 42281
537 Ga0157378_10007199 3300013297 Bacteria 9719
538 Ga0157378_10010602 3300013297 Bacteria 8055
539 Ga0157378_10010748 3300013297 Bacteria 8001
540 Ga0157378_10013971 3300013297 Bacteria 7025
541 Ga0157378_10039105 3300013297 Bacteria 4206
542 Ga0157378_10077880 3300013297 Bacteria 2989
543 Ga0157378_10293421 3300013297 Bacteria 1571
544 Ga0163162_10008327 3300013306 Bacteria 10114
545 Ga0163162_10015114 3300013306 Bacteria 7537
546 Ga0163162_10023491 3300013306 Bacteria 6084
547 Ga0163162_10069694 3300013306 Bacteria 3568
548 Ga0163162_10073001 3300013306 Bacteria 3486
549 Ga0163162_10156515 3300013306 Bacteria 2399
550 Ga0163162_10167742 3300013306 Bacteria 2319
551 Ga0163162_10216485 3300013306 Bacteria 2045
552 Ga0157372_10002154 3300013307 Bacteria 21421
553 Ga0157372_10003780 3300013307 Bacteria 16254
554 Ga0157372_10006080 3300013307 Bacteria 12828
555 Ga0157372_10006630 3300013307 Bacteria 12325
556 Ga0157372_10009005 3300013307 Bacteria 10610
557 Ga0157372_10044504 3300013307 Bacteria 4919
558 Ga0157372_10053770 3300013307 Bacteria 4490
559 Ga0157372_10098312 3300013307 Bacteria 3339
560 Ga0157372_10175031 3300013307 Bacteria 2484
561 Ga0157372_10212800 3300013307 Bacteria 2240
562 Ga0157372_10362203 3300013307 Bacteria 1690
563 Ga0157372_10549179 3300013307 Bacteria 1347
564 Ga0157375_10012035 3300013308 Bacteria 7661
565 Ga0157375_10284760 3300013308 Bacteria 1816
566 Ga0157375_10303793 3300013308 Bacteria 1759
567 Ga0157375_10887317 3300013308 Bacteria 1036
568 Ga0163163_10001073 3300014325 Bacteria 23224
569 Ga0163163_10079257 3300014325 Bacteria 3283
570 Ga0163163_10121904 3300014325 Bacteria 2641
571 Ga0163163_10137549 3300014325 Bacteria 2484
572 Ga0163163_10227951 3300014325 Bacteria 1912
573 Ga0163163_10556824 3300014325 Bacteria 1209
574 Ga0157380_10050387 3300014326 Bacteria 3289
575 Ga0157380_10404357 3300014326 Bacteria 1296
576 Ga0157377_10000768 3300014745 Bacteria 13272
577 Ga0157379_10004402 3300014968 Bacteria 12067
578 Ga0157379_10005366 3300014968 Bacteria 11017
579 Ga0157379_10041991 3300014968 Bacteria 4082
580 Ga0157379_10088209 3300014968 Bacteria 2781
581 Ga0157379_10147388 3300014968 Bacteria 2123
582 Ga0157376_10007676 3300014969 Bacteria 7726
583 Ga0157376_10013365 3300014969 Bacteria 6123
584 Ga0157376_10025636 3300014969 Bacteria 4646
585 Ga0157376_10036861 3300014969 Bacteria 3964
586 Ga0157376_10075865 3300014969 Bacteria 2870
587 Ga0157376_10091716 3300014969 Bacteria 2632
588 Ga0157376_10114376 3300014969 Bacteria 2381
589 Ga0157376_10203430 3300014969 Bacteria 1824
590 Ga0157376_10338380 3300014969 Bacteria 1436
591 Ga0157376_10991254 3300014969 Bacteria 862
592 Ga0182007_10019430 3300015262 Bacteria 2443
593 Ga0163161_10001969 3300017792 Bacteria 14895
594 Ga0163161_10233312 3300017792 Bacteria 1429
595 Ga0163161_11024364 3300017792 Bacteria 706
596 Ga0184599_114597 3300019188 Bacteria 4434
597 Ga0213874_10051537 3300021377 Bacteria 1264
598 Ga0213875_10050957 3300021388 Bacteria 1939
599 Ga0224570_100075 3300022730 Bacteria 5599
600 Ga0224572_1003107 3300024225 Bacteria 2773
601 Ga0224572_1008452 3300024225 Bacteria 1903
602 Ga0224572_1013004 3300024225 Bacteria 1586
603 Ga0224572_1022921 3300024225 Bacteria 1199
604 Ga0228598_1000213 3300024227 Bacteria 10848
605 Ga0228598_1007358 3300024227 Bacteria 2243
606 Ga0207697_10014009 3300025315 Bacteria 3338
607 Ga0207656_10031911 3300025321 Bacteria 2185
608 Ga0207656_10092827 3300025321 Bacteria 1372
609 Ga0207656_10121061 3300025321 Bacteria 1218
610 Ga0207682_10055544 3300025893 Bacteria 1647
611 Ga0207692_10016155 3300025898 Bacteria 3298
612 Ga0207692_10016902 3300025898 Bacteria 3243
613 Ga0207692_10022746 3300025898 Bacteria 2889
614 Ga0207692_10097905 3300025898 Bacteria 1604
615 Ga0207692_10193896 3300025898 Bacteria 1191
616 Ga0207692_10207217 3300025898 Bacteria 1156
617 Ga0207692_10550070 3300025898 Bacteria 737
618 Ga0207642_10006053 3300025899 Bacteria 3998
619 Ga0207642_10161413 3300025899 Bacteria 1204
620 Ga0207710_10053659 3300025900 Bacteria 1814
621 Ga0207710_10100710 3300025900 Bacteria 1362
622 Ga0207710_10168783 3300025900 Bacteria 1069
623 Ga0207688_10002923 3300025901 Bacteria 9297
624 Ga0207688_10095550 3300025901 Bacteria 1711
625 Ga0207680_10001756 3300025903 Bacteria 10229
626 Ga0207680_10010187 3300025903 Bacteria 4693
627 Ga0207680_10088204 3300025903 Bacteria 1966
628 Ga0207647_10001343 3300025904 Bacteria 18910
629 Ga0207647_10010629 3300025904 Bacteria 6492
630 Ga0207685_10003422 3300025905 Bacteria 3856
631 Ga0207685_10114299 3300025905 Bacteria 1175
632 Ga0207699_10001057 3300025906 Bacteria 13000
633 Ga0207699_10023897 3300025906 Bacteria 3333
634 Ga0207699_10034176 3300025906 Bacteria 2881
635 Ga0207699_10058686 3300025906 Bacteria 2303
636 Ga0207699_10070796 3300025906 Bacteria 2130
637 Ga0207699_10205665 3300025906 Unclassified 1336
638 Ga0207699_10243258 3300025906 Bacteria 1237
639 Ga0207699_10313131 3300025906 Bacteria 1099
640 Ga0207699_10319026 3300025906 Bacteria 1089
641 Ga0207645_10001180 3300025907 Bacteria 21585
642 Ga0207645_10011941 3300025907 Bacteria 5910
643 Ga0207645_10380991 3300025907 Bacteria 947
644 Ga0207643_10001067 3300025908 Bacteria 16207
645 Ga0207643_10003060 3300025908 Bacteria 8992
646 Ga0207705_10172360 3300025909 Bacteria 1630
647 Ga0207684_10000614 3300025910 Bacteria 42486
648 Ga0207684_10001048 3300025910 Bacteria 30878
649 Ga0207684_10003017 3300025910 Bacteria 16680
650 Ga0207684_10100158 3300025910 Bacteria 2476
651 Ga0207654_10004384 3300025911 Bacteria 7113
652 Ga0207654_10209827 3300025911 Bacteria 1287
653 Ga0207654_10366741 3300025911 Bacteria 995
654 Ga0207654_10404551 3300025911 Bacteria 950
655 Ga0207707_10003207 3300025912 Bacteria 14523
656 Ga0207707_10015255 3300025912 Bacteria 6690
657 Ga0207707_10022616 3300025912 Bacteria 5497
658 Ga0207707_10155824 3300025912 Bacteria 1998
659 Ga0207707_10266517 3300025912 Bacteria 1485
660 Ga0207695_10007039 3300025913 Bacteria 14431
661 Ga0207695_10008453 3300025913 Bacteria 12891
662 Ga0207695_10075177 3300025913 Bacteria 3438
663 Ga0207695_10103382 3300025913 Bacteria 2840
664 Ga0207695_10150276 3300025913 Bacteria 2268
665 Ga0207695_10165626 3300025913 Bacteria 2139
666 Ga0207695_10198657 3300025913 Bacteria 1920
667 Ga0207695_10337283 3300025913 Bacteria 1396
668 Ga0207695_10340761 3300025913 Bacteria 1387
669 Ga0207695_10609660 3300025913 Bacteria 973
670 Ga0207671_10047140 3300025914 Bacteria 3190
671 Ga0207671_10077830 3300025914 Bacteria 2483
672 Ga0207671_10166467 3300025914 Bacteria 1710
673 Ga0207671_10193281 3300025914 Bacteria 1587
674 Ga0207693_10000026 3300025915 Bacteria 122717
675 Ga0207693_10000922 3300025915 Bacteria 26418
676 Ga0207693_10001260 3300025915 Bacteria 22561
677 Ga0207693_10004232 3300025915 Bacteria 12174
678 Ga0207693_10010928 3300025915 Bacteria 7357
679 Ga0207693_10022595 3300025915 Bacteria 4997
680 Ga0207693_10024361 3300025915 Bacteria 4802
681 Ga0207693_10031599 3300025915 Bacteria 4183
682 Ga0207693_10115876 3300025915 Bacteria 2104
683 Ga0207693_10145995 3300025915 Bacteria 1860
684 Ga0207693_10174165 3300025915 Bacteria 1693
685 Ga0207693_10189476 3300025915 Bacteria 1619
686 Ga0207693_10205304 3300025915 Bacteria 1549
687 Ga0207693_10259317 3300025915 Bacteria 1363
688 Ga0207693_10593817 3300025915 Bacteria 862
689 Ga0207663_10002471 3300025916 Bacteria 8903
690 Ga0207663_10003762 3300025916 Bacteria 7481
691 Ga0207663_10009591 3300025916 Bacteria 5123
692 Ga0207663_10010349 3300025916 Bacteria 4960
693 Ga0207663_10038998 3300025916 Bacteria 2875
694 Ga0207663_10082228 3300025916 Bacteria 2112
695 Ga0207663_10102123 3300025916 Bacteria 1928
696 Ga0207663_10200306 3300025916 Bacteria 1440
697 Ga0207663_10296082 3300025916 Bacteria 1207
698 Ga0207663_10376464 3300025916 Bacteria 1081
699 Ga0207660_10105591 3300025917 Bacteria 2111
700 Ga0207660_10339532 3300025917 Bacteria 1202
701 Ga0207660_10572029 3300025917 Bacteria 919
702 Ga0207662_10003831 3300025918 Bacteria 7818
703 Ga0207662_10170949 3300025918 Bacteria 1393
704 Ga0207657_10004069 3300025919 Bacteria 15518
705 Ga0207657_10006426 3300025919 Bacteria 12189
706 Ga0207649_10001087 3300025920 Bacteria 16517
707 Ga0207649_10045098 3300025920 Bacteria 2701
708 Ga0207649_10168412 3300025920 Bacteria 1524
709 Ga0207649_10196985 3300025920 Bacteria 1420
710 Ga0207652_10018101 3300025921 Bacteria 5776
711 Ga0207652_10029215 3300025921 Bacteria 4607
712 Ga0207652_10394062 3300025921 Bacteria 1250
713 Ga0207652_10507206 3300025921 Bacteria 1086
714 Ga0207652_10971682 3300025921 Bacteria 747
715 Ga0207646_10001230 3300025922 Bacteria 32163
716 Ga0207646_10004899 3300025922 Bacteria 14334
717 Ga0207646_10032205 3300025922 Bacteria 4744
718 Ga0207646_10035586 3300025922 Bacteria 4497
719 Ga0207646_10099345 3300025922 Bacteria 2608
720 Ga0207646_10117634 3300025922 Bacteria 2387
721 Ga0207646_10130926 3300025922 Bacteria 2258
722 Ga0207646_10131348 3300025922 Bacteria 2254
723 Ga0207646_10222371 3300025922 Bacteria 1706
724 Ga0207646_10271182 3300025922 Bacteria 1534
725 Ga0207646_11034925 3300025922 Bacteria 724
726 Ga0207681_10009111 3300025923 Bacteria 6063
727 Ga0207681_10228624 3300025923 Bacteria 1443
728 Ga0207694_10000718 3300025924 Bacteria 29747
729 Ga0207694_10061850 3300025924 Bacteria 2914
730 Ga0207694_10063949 3300025924 Bacteria 2866
731 Ga0207694_10078228 3300025924 Bacteria 2592
732 Ga0207694_10585217 3300025924 Bacteria 938
733 Ga0207694_10624129 3300025924 Bacteria 907
734 Ga0207650_10000152 3300025925 Bacteria 83134
735 Ga0207650_10029576 3300025925 Bacteria 3939
736 Ga0207650_10325658 3300025925 Bacteria 1259
737 Ga0207659_10003498 3300025926 Bacteria 9434
738 Ga0207659_10076951 3300025926 Bacteria 2454
739 Ga0207687_10010238 3300025927 Bacteria 6126
740 Ga0207687_10028606 3300025927 Bacteria 3745
741 Ga0207687_10042103 3300025927 Bacteria 3139
742 Ga0207687_10163010 3300025927 Bacteria 1713
743 Ga0207687_10164055 3300025927 Bacteria 1708
744 Ga0207687_10232652 3300025927 Bacteria 1456
745 Ga0207700_10004917 3300025928 Bacteria 7939
746 Ga0207700_10007967 3300025928 Bacteria 6524
747 Ga0207700_10011563 3300025928 Bacteria 5635
748 Ga0207700_10014117 3300025928 Bacteria 5224
749 Ga0207700_10029324 3300025928 Bacteria 3881
750 Ga0207700_10037540 3300025928 Bacteria 3509
751 Ga0207700_10043503 3300025928 Bacteria 3299
752 Ga0207700_10065442 3300025928 Bacteria 2773
753 Ga0207700_10085030 3300025928 Bacteria 2482
754 Ga0207700_10089201 3300025928 Bacteria 2430
755 Ga0207700_10096495 3300025928 Bacteria 2347
756 Ga0207700_10136466 3300025928 Bacteria 2010
757 Ga0207700_10255874 3300025928 Bacteria 1497
758 Ga0207700_10374034 3300025928 Bacteria 1245
759 Ga0207700_10400758 3300025928 Bacteria 1202
760 Ga0207700_10414976 3300025928 Bacteria 1181
761 Ga0207700_10905890 3300025928 Bacteria 789
762 Ga0207700_11000723 3300025928 Bacteria 748
763 Ga0207700_11007362 3300025928 Bacteria 745
764 Ga0207664_10000087 3300025929 Bacteria 88607
765 Ga0207664_10001347 3300025929 Bacteria 16145
766 Ga0207664_10032903 3300025929 Bacteria 3978
767 Ga0207664_10066125 3300025929 Bacteria 2897
768 Ga0207664_10214208 3300025929 Bacteria 1668
769 Ga0207664_10261810 3300025929 Bacteria 1513
770 Ga0207664_10336482 3300025929 Bacteria 1334
771 Ga0207664_10400121 3300025929 Bacteria 1221
772 Ga0207664_10431424 3300025929 Bacteria 1175
773 Ga0207664_10562910 3300025929 Bacteria 1023
774 Ga0207664_10854851 3300025929 Bacteria 818
775 Ga0207664_10902541 3300025929 Bacteria 793
776 Ga0207664_10986459 3300025929 Bacteria 755
777 Ga0207644_10003335 3300025931 Bacteria 10358
778 Ga0207644_10091436 3300025931 Bacteria 2269
779 Ga0207690_10007754 3300025932 Bacteria 6372
780 Ga0207690_10710865 3300025932 Bacteria 826
781 Ga0207706_10000740 3300025933 Bacteria 34067
782 Ga0207706_10005096 3300025933 Bacteria 12268
783 Ga0207706_10037828 3300025933 Bacteria 4283
784 Ga0207706_10160402 3300025933 Bacteria 1977
785 Ga0207706_10245396 3300025933 Bacteria 1565
786 Ga0207686_10060923 3300025934 Bacteria 2391
787 Ga0207686_10278057 3300025934 Bacteria 1235
788 Ga0207686_10668641 3300025934 Bacteria 823
789 Ga0207709_10020843 3300025935 Bacteria 3703
790 Ga0207670_10003610 3300025936 Bacteria 8207
791 Ga0207670_10105048 3300025936 Bacteria 2024
792 Ga0207669_10019910 3300025937 Bacteria 3505
793 Ga0207704_10038213 3300025938 Bacteria 2781
794 Ga0207704_10048090 3300025938 Bacteria 2555
795 Ga0207704_10157540 3300025938 Bacteria 1611
796 Ga0207665_10001798 3300025939 Bacteria 14443
797 Ga0207665_10002747 3300025939 Bacteria 11804
798 Ga0207665_10003202 3300025939 Bacteria 10970
799 Ga0207665_10029458 3300025939 Bacteria 3629
800 Ga0207665_10042845 3300025939 Bacteria 3026
801 Ga0207665_10047169 3300025939 Bacteria 2887
802 Ga0207665_10064712 3300025939 Bacteria 2485
803 Ga0207665_10069492 3300025939 Bacteria 2402
804 Ga0207665_10132565 3300025939 Bacteria 1771
805 Ga0207665_10142212 3300025939 Bacteria 1712
806 Ga0207665_10161747 3300025939 Bacteria 1611
807 Ga0207665_10161782 3300025939 Bacteria 1611
808 Ga0207665_10176634 3300025939 Bacteria 1545
809 Ga0207665_10190292 3300025939 Bacteria 1490
810 Ga0207691_10000308 3300025940 Bacteria 48637
811 Ga0207691_10026413 3300025940 Bacteria 5448
812 Ga0207711_10003068 3300025941 Bacteria 14584
813 Ga0207711_10013154 3300025941 Bacteria 6872
814 Ga0207711_10028516 3300025941 Bacteria 4698
815 Ga0207711_10047959 3300025941 Bacteria 3654
816 Ga0207711_10109439 3300025941 Bacteria 2455
817 Ga0207689_10000618 3300025942 Bacteria 33979
818 Ga0207689_10005608 3300025942 Bacteria 11183
819 Ga0207689_10012098 3300025942 Bacteria 7389
820 Ga0207689_10013637 3300025942 Bacteria 6929
821 Ga0207689_10075543 3300025942 Bacteria 2770
822 Ga0207661_10005431 3300025944 Bacteria 8980
823 Ga0207661_10092768 3300025944 Bacteria 2518
824 Ga0207661_10097453 3300025944 Bacteria 2462
825 Ga0207661_10193239 3300025944 Bacteria 1785
826 Ga0207679_10000298 3300025945 Bacteria 37205
827 Ga0207679_10010869 3300025945 Bacteria 5869
828 Ga0207679_10373068 3300025945 Bacteria 1249
829 Ga0207679_10721935 3300025945 Bacteria 905
830 Ga0207667_10003757 3300025949 Bacteria 18704
831 Ga0207667_10012686 3300025949 Bacteria 9684
832 Ga0207667_10042321 3300025949 Bacteria 4842
833 Ga0207667_10051011 3300025949 Bacteria 4363
834 Ga0207667_10055132 3300025949 Bacteria 4180
835 Ga0207667_10170748 3300025949 Bacteria 2235
836 Ga0207667_10245178 3300025949 Bacteria 1833
837 Ga0207667_10417790 3300025949 Bacteria 1365
838 Ga0207667_10627187 3300025949 Bacteria 1082
839 Ga0207651_10003558 3300025960 Bacteria 7657
840 Ga0207651_10018159 3300025960 Bacteria 4178
841 Ga0207651_10167924 3300025960 Bacteria 1727
842 Ga0207712_10026658 3300025961 Bacteria 3853
843 Ga0207712_10050229 3300025961 Bacteria 2911
844 Ga0207668_10003732 3300025972 Bacteria 8962
845 Ga0207668_10022020 3300025972 Bacteria 4072
846 Ga0207640_10006598 3300025981 Bacteria 6372
847 Ga0207640_10024440 3300025981 Bacteria 3645
848 Ga0207640_10104563 3300025981 Bacteria 1993
849 Ga0207640_10150496 3300025981 Bacteria 1709
850 Ga0207658_10003391 3300025986 Bacteria 11277
851 Ga0207658_10011883 3300025986 Bacteria 5935
852 Ga0207658_10051397 3300025986 Bacteria 3037
853 Ga0207677_10003373 3300026023 Bacteria 8452
854 Ga0207677_10006103 3300026023 Bacteria 6577
855 Ga0207677_10007921 3300026023 Bacteria 5908
856 Ga0207677_10035230 3300026023 Bacteria 3249
857 Ga0207677_10206809 3300026023 Bacteria 1564
858 Ga0207677_10362653 3300026023 Bacteria 1218
859 Ga0207677_10696160 3300026023 Bacteria 901
860 Ga0207703_10003490 3300026035 Bacteria 13160
861 Ga0207703_10007555 3300026035 Bacteria 8621
862 Ga0207703_10037962 3300026035 Bacteria 3840
863 Ga0207703_10062296 3300026035 Bacteria 3056
864 Ga0207703_10207926 3300026035 Bacteria 1743
865 Ga0207703_10261314 3300026035 Bacteria 1565
866 Ga0207703_10284931 3300026035 Bacteria 1502
867 Ga0207639_10003445 3300026041 Bacteria 10647
868 Ga0207639_10072514 3300026041 Bacteria 2696
869 Ga0207639_10108868 3300026041 Bacteria 2254
870 Ga0207639_10111302 3300026041 Bacteria 2232
871 Ga0207639_10472514 3300026041 Bacteria 1142
872 Ga0207639_11180001 3300026041 Bacteria 718
873 Ga0207678_10001612 3300026067 Bacteria 20753
874 Ga0207678_10003018 3300026067 Bacteria 15226
875 Ga0207708_10012290 3300026075 Bacteria 6381
876 Ga0207702_10000089 3300026078 Bacteria 105440
877 Ga0207702_10001884 3300026078 Bacteria 20534
878 Ga0207702_10003851 3300026078 Bacteria 13535
879 Ga0207702_10015006 3300026078 Bacteria 6425
880 Ga0207702_10096326 3300026078 Bacteria 2602
881 Ga0207702_10098318 3300026078 Bacteria 2577
882 Ga0207702_10288039 3300026078 Bacteria 1555
883 Ga0207702_10378624 3300026078 Bacteria 1360
884 Ga0207702_10788157 3300026078 Bacteria 939
885 Ga0207641_10000052 3300026088 Bacteria 173672
886 Ga0207641_10023752 3300026088 Bacteria 5052
887 Ga0207641_10149740 3300026088 Bacteria 2112
888 Ga0207641_11048549 3300026088 Bacteria 813
889 Ga0207648_10001820 3300026089 Bacteria 23335
890 Ga0207648_10003962 3300026089 Bacteria 15393
891 Ga0207648_10038306 3300026089 Bacteria 4219
892 Ga0207648_10046214 3300026089 Bacteria 3817
893 Ga0207648_10182551 3300026089 Bacteria 1857
894 Ga0207648_10202079 3300026089 Bacteria 1762
895 Ga0207648_10243298 3300026089 Bacteria 1602
896 Ga0207676_10000176 3300026095 Bacteria 56110
897 Ga0207676_10012745 3300026095 Bacteria 6032
898 Ga0207676_10041621 3300026095 Bacteria 3528
899 Ga0207676_10165194 3300026095 Bacteria 1922
900 Ga0207676_10566243 3300026095 Bacteria 1087
901 Ga0207676_10815209 3300026095 Bacteria 911
902 Ga0207674_10000561 3300026116 Bacteria 48618
903 Ga0207674_10018522 3300026116 Bacteria 7566
904 Ga0207674_10022993 3300026116 Bacteria 6686
905 Ga0207674_10025597 3300026116 Bacteria 6287
906 Ga0207674_10027883 3300026116 Bacteria 5966
907 Ga0207675_100002488 3300026118 Bacteria 18245
908 Ga0207675_100005443 3300026118 Bacteria 12201
909 Ga0207675_100403034 3300026118 Bacteria 1348
910 Ga0207683_10001978 3300026121 Bacteria 18120
911 Ga0207683_10393610 3300026121 Bacteria 1274
912 Ga0207683_10405142 3300026121 Bacteria 1255
913 Ga0207698_10073933 3300026142 Bacteria 2716
914 Ga0207698_10091285 3300026142 Bacteria 2493
915 Ga0207698_10181348 3300026142 Bacteria 1865
916 Ga0207698_10554861 3300026142 Bacteria 1127
917 Ga0209813_10015663 3300027866 Bacteria 2058
918 Ga0207428_10000032 3300027907 Bacteria 232162
919 Ga0265354_1006270 3300028016 Bacteria 1184
920 Ga0265356_1000279 3300028017 Bacteria 9531
921 Ga0265355_1001396 3300028036 Bacteria 1561
922 Ga0268266_10001266 3300028379 Bacteria 30870
923 Ga0268266_10043350 3300028379 Bacteria 3845
924 Ga0268266_10049418 3300028379 Bacteria 3607
925 Ga0268265_10008088 3300028380 Bacteria 7106
926 Ga0268265_10164421 3300028380 Bacteria 1889
927 Ga0268265_10170582 3300028380 Bacteria 1859
928 Ga0268264_10005269 3300028381 Bacteria 10950
929 Ga0268264_10022839 3300028381 Bacteria 5104
930 Ga0268264_10045417 3300028381 Bacteria 3647
931 Ga0268264_10096016 3300028381 Bacteria 2566
932 Ga0268264_10105174 3300028381 Bacteria 2461
933 Ga0268264_10143337 3300028381 Bacteria 2133
934 Ga0265336_10071061 3300028666 Bacteria 1040
935 Ga0265338_10002857 3300028800 Bacteria 25250
936 Ga0265338_10006873 3300028800 Bacteria 14325
937 Ga0265338_10163360 3300028800 Bacteria 1717
938 Ga0265338_10177573 3300028800 Bacteria 1626
939 Ga0265338_10187382 3300028800 Bacteria 1571
940 Ga0265338_10491826 3300028800 Bacteria 864
941 Ga0265762_1000677 3300030760 Bacteria 5998
942 Ga0265762_1001564 3300030760 Bacteria 4163
943 Ga0265762_1004618 3300030760 Bacteria 2463
944 Ga0265762_1004830 3300030760 Bacteria 2413
945 Ga0265762_1073797 3300030760 Bacteria 720
946 Ga0265760_10000694 3300031090 Bacteria 9605
947 Ga0265760_10008145 3300031090 Bacteria 2995
948 Ga0265760_10062066 3300031090 Bacteria 1137
949 Ga0265330_10006073 3300031235 Bacteria 5983
950 Ga0265328_10014015 3300031239 Bacteria 3163
951 Ga0265325_10023495 3300031241 Bacteria 3364
952 Ga0265325_10060205 3300031241 Bacteria 1929
953 Ga0265339_10002352 3300031249 Bacteria 13585
954 Ga0265339_10019630 3300031249 Bacteria 3965
955 Ga0265331_10066103 3300031250 Bacteria 1699
956 Ga0265327_10007434 3300031251 Bacteria 8453
957 Ga0265316_10012614 3300031344 Bacteria 7566
958 Ga0265316_10017308 3300031344 Bacteria 6237
959 Ga0265314_10003075 3300031711 Bacteria 16448
960 Ga0265314_10013145 3300031711 Bacteria 6707
961 Ga0265314_10084790 3300031711 Bacteria 2079
962 Ga0265342_10008579 3300031712 Bacteria 7308
963 Ga0307405_10017376 3300031731 Bacteria 3946
964 Ga0307405_10074291 3300031731 Bacteria 2198
965 Ga0307413_10340626 3300031824 Bacteria 1153
966 Ga0307410_10009896 3300031852 Bacteria 5375
967 Ga0307410_10151445 3300031852 Bacteria 1727
968 Ga0307409_100015644 3300031995 Bacteria 4986
969 Ga0307409_100153797 3300031995 Bacteria 2001
970 Ga0307416_100028546 3300032002 Bacteria 4151
971 Ga0307416_100645819 3300032002 Bacteria 1142
972 Ga0307411_10123813 3300032005 Bacteria 1876
973 Ga0307411_10179471 3300032005 Bacteria 1605
974 Ga0316053_100087 3300032120 Bacteria 2942
975 Ga0307415_100011074 3300032126 Bacteria 5141
976 Ga0307415_100197190 3300032126 Bacteria 1594
977 Ga0307415_100294502 3300032126 Bacteria 1341
978 Ga0316212_1006537 3300033547 Bacteria 1689
979 Ga0373930_0068756 3300034816 Bacteria 802
980 Ga0373926_0015455 3300035083 Bacteria 2603
981 Ga0373929_0010305 3300035085 Bacteria 1746
982 Ga0373934_0064886 3300035086 Bacteria 1458
983 Ga0373934_0092690 3300035086 Bacteria 1218
984 Ga0373934_0099462 3300035086 Bacteria 1176
985 Ga0373944_0036201 3300035089 Bacteria 1507
986 Ga0373944_0101984 3300035089 Bacteria 970
987 Ga0373949_0030352 3300035090 Bacteria 1285
988 Ga0373923_0009501 3300035111 Bacteria 3511
989 Ga0373923_0016587 3300035111 Bacteria 2801
990 Ga0373923_0212827 3300035111 Bacteria 896
991 Ga0373923_0270804 3300035111 Bacteria 799
992 Ga0373923_0293849 3300035111 Bacteria 768
993 Ga0373936_0002329 3300035113 Bacteria 7114
994 Ga0373936_0016372 3300035113 Bacteria 2853
995 Ga0373936_0026016 3300035113 Bacteria 2291
996 Ga0373936_0038606 3300035113 Bacteria 1909
997 Ga0373936_0116750 3300035113 Bacteria 1137
998 Ga0373939_0117597 3300035114 Bacteria 934
999 Ga0373941_0022587 3300035115 Bacteria 1787
1000 Ga0373945_0012830 3300035116 Bacteria 2789
1001 Ga0373945_0031816 3300035116 Bacteria 1866
1002 Ga0373945_0033929 3300035116 Bacteria 1816
1003 Ga0373945_0079724 3300035116 Bacteria 1252
1004 Ga0373945_0146083 3300035116 Bacteria 956
1005 Ga0373953_0074376 3300035117 Unclassified 1405
1006 Ga0373956_0220770 3300035119 Bacteria 900
1007 Ga0373957_0037499 3300035120 Bacteria 1811
1008 Ga0373957_0058851 3300035120 Bacteria 1485
1009 Ga0373943_0000086 3300035170 Bacteria 33418
1010 Ga0373943_0041324 3300035170 Bacteria 2229
1011 Ga0373943_0073222 3300035170 Bacteria 1739
1012 Ga0373946_0032271 3300035171 Bacteria 2102
1013 Ga0373946_0117612 3300035171 Bacteria 1210
1014 Ga0373946_0150761 3300035171 Bacteria 1085
1015 Ga0373946_0290107 3300035171 Bacteria 807
1016 Ga0373955_0096768 3300035172 Bacteria 1689
1017 Ga0373942_0008131 3300035207 Bacteria 2440
1018 Ga0373961_0015362 3300035241 Bacteria 1957
1019 Ga0316574_0101806 3300035398 Unclassified 1839
1020 Ga0373924_0000242 3300035410 Bacteria 16693
1021 Ga0373924_0010177 3300035410 Bacteria 3462
1022 Ga0373924_0013446 3300035410 Bacteria 3076
1023 Ga0373924_0025321 3300035410 Bacteria 2346
1024 Ga0373924_0169987 3300035410 Bacteria 958
1025 Ga0373924_0204468 3300035410 Bacteria 871
1026 Ga0373924_0262937 3300035410 Unclassified 765
1027 Ga0373931_0016212 3300035691 Bacteria 3665
1028 Ga0373931_0036963 3300035691 Bacteria 2548
1029 Ga0373931_0050834 3300035691 Bacteria 2206
1030 Ga0373931_0136968 3300035691 Bacteria 1414
1031 Ga0373931_0167149 3300035691 Bacteria 1293
1032 Ga0373931_0175225 3300035691 Bacteria 1266
1033 Ga0373931_0549488 3300035691 Bacteria 750
1034 Ga0373935_0008998 3300035692 Bacteria 5975
1035 Ga0373935_0011881 3300035692 Bacteria 5231
1036 Ga0373935_0030527 3300035692 Bacteria 3341
1037 Ga0373935_0038747 3300035692 Bacteria 2985
1038 Ga0373935_0097966 3300035692 Bacteria 1929
1039 Ga0373935_0101228 3300035692 Bacteria 1900
1040 Ga0373935_0148989 3300035692 Bacteria 1586
1041 Ga0373935_0175676 3300035692 Bacteria 1468
1042 Ga0373935_0190760 3300035692 Bacteria 1411
1043 Ga0373927_0028973 3300035695 Bacteria 3609
1044 Ga0373927_0045440 3300035695 Bacteria 2841
1045 Ga0373927_0063047 3300035695 Bacteria 2397
1046 Ga0373927_0063842 3300035695 Bacteria 2382
1047 Ga0373927_0075671 3300035695 Bacteria 2180
1048 Ga0373927_0113650 3300035695 Bacteria 1764
1049 Ga0373927_0127025 3300035695 Bacteria 1665
1050 Ga0373927_0552897 3300035695 Bacteria 761
1051 Ga0373933_0007220 3300035724 Bacteria 6056
1052 Ga0373933_0045505 3300035724 Bacteria 2602
1053 Ga0373933_0173925 3300035724 Bacteria 1371
1054 Ga0373933_0185287 3300035724 Bacteria 1329
1055 Ga0373933_0390012 3300035724 Bacteria 908
1056 Ga0373947_0004951 3300035725 Bacteria 7791
1057 Ga0373947_0020057 3300035725 Bacteria 3858
1058 Ga0373947_0040269 3300035725 Bacteria 2782
1059 Ga0373947_0050791 3300035725 Bacteria 2493
1060 Ga0373947_0074112 3300035725 Bacteria 2093
1061 Ga0373947_0499021 3300035725 Bacteria 827
1062 Ga0373937_0000317 3300036401 Bacteria 45743
1063 Ga0373937_0037183 3300036401 Bacteria 4436
1064 Ga0373937_0038004 3300036401 Bacteria 4388
1065 Ga0373937_0096763 3300036401 Unclassified 2738
1066 Ga0373937_0212850 3300036401 Bacteria 1819
1067 Ga0373937_0229401 3300036401 Bacteria 1748
1068 Ga0373937_0342483 3300036401 Bacteria 1416
1069 Ga0373937_0398035 3300036401 Bacteria 1307
1070 Ga0373937_0472973 3300036401 Bacteria 1190
1071 Ga0373937_0478995 3300036401 Bacteria 1182
1072 Ga0373937_0490195 3300036401 Bacteria 1167
1073 Ga0373937_0558661 3300036401 Bacteria 1087
1074 Ga0373937_0561672 3300036401 Bacteria 1084
1075 Ga0265778_000084 3300036457 Bacteria 5781
1076 Ga0373925_0003717 3300037068 Bacteria 11714
1077 Ga0373925_0010801 3300037068 Bacteria 6620
1078 Ga0373925_0012340 3300037068 Bacteria 6185
1079 Ga0373925_0052704 3300037068 Bacteria 3040
1080 Ga0373925_0053657 3300037068 Bacteria 3014
1081 Ga0373925_0077587 3300037068 Bacteria 2522
1082 Ga0373925_0234377 3300037068 Bacteria 1468
1083 Ga0373925_0449076 3300037068 Bacteria 1055
1084 Ga0395900_0823478 3300037418 Bacteria 855
1085 Ga0436364_0274090 3300037853 Bacteria 847
1086 Ga0436364_1407027 3300037853 Bacteria 23679
1087 Ga0436365_0473506 3300039437 Bacteria 2284
1088 Ga0436363_0628682 3300039450 Unclassified 1639
1089 Ga0436363_1519336 3300039450 Bacteria 3260
1090 Ga0436362_0984659 3300039453 Bacteria 927
1091 Ga0451839_0485878 3300041496 Bacteria 779
1092 Ga0439441_037037 3300042001 Bacteria 966
1093 Ga0439443_010525 3300042003 Bacteria 1341
1094 Ga0439448_0002852 3300042005 Bacteria 4731
1095 Ga0439450_003413 3300042008 Bacteria 2624
1096 Ga0439455_0005315 3300042012 Bacteria 2608
1097 Ga0439463_002436 3300042016 Bacteria 4738
1098 Ga0450904_005858 3300042139 Bacteria 1234
1099 Ga0450905_014730 3300042142 Bacteria 1116
1100 Ga0439460_0007380 3300042461 Bacteria 2746
1101 Ga0450901_005107 3300042533 Bacteria 1351
1102 Ga0451577_0000325 3300042876 Bacteria 89199
1103 Ga0451577_0091291 3300042876 Bacteria 2718
1104 Ga0451577_0181937 3300042876 Bacteria 1895
1105 Ga0451577_0780850 3300042876 Bacteria 863
1106 Ga0453683_0139682 3300044673 Bacteria 1528
1107 Ga0466966_0267868 3300044684 Bacteria 1028
1108 Ga0466961_0203592 3300044693 Bacteria 1223
1109 Ga0466963_0020285 3300044694 Bacteria 4179
1110 Ga0466963_0075184 3300044694 Bacteria 2279
1111 Ga0466963_0108792 3300044694 Bacteria 1901
1112 Ga0466964_0021515 3300044706 Bacteria 2495
1113 Ga0466964_0390134 3300044706 Bacteria 725
1114 Ga0453684_0000951 3300044712 Bacteria 95417
1115 Ga0453684_0377372 3300044712 Bacteria 1593
1116 Ga0453684_0974171 3300044712 Bacteria 903
1117 Ga0466957_0133223 3300044842 Bacteria 1595
1118 Ga0466957_0183167 3300044842 Bacteria 1369
1119 Ga0466959_0038701 3300045049 Bacteria 3524
1120 Ga0466959_0049616 3300045049 Bacteria 3084
1121 Ga0451576_0010556 3300045051 Bacteria 10579
1122 Ga0451576_0079386 3300045051 Bacteria 3414
1123 Ga0466958_0070120 3300045836 Bacteria 2144
1124 Ga0466958_0673017 3300045836 Bacteria 674
1125 Ga0466967_0004406 3300045976 Bacteria 9486
1126 Ga0466967_0200269 3300045976 Bacteria 1891
1127 Ga0466967_0280594 3300045976 Bacteria 1598
1128 Ga0466967_0469506 3300045976 Bacteria 1231
1129 Ga0466967_0635933 3300045976 Bacteria 1054
1130 Ga0466967_0755444 3300045976 Bacteria 964
1131 Ga0495603_0084135 3300046455 Bacteria 1863
1132 Ga0495603_0303002 3300046455 Bacteria 918
1133 Ga0495603_0332897 3300046455 Bacteria 871
1134 Ga0495629_0038029 3300046459 Bacteria 3391
1135 Ga0495629_0467911 3300046459 Bacteria 852
1136 Ga0495651_0014848 3300046462 Bacteria 6022
1137 Ga0495651_0131652 3300046462 Bacteria 1825
1138 Ga0495651_0142835 3300046462 Bacteria 1734
1139 Ga0495653_0308398 3300046463 Bacteria 1030
1140 Ga0495580_0001845 3300046472 Bacteria 18638
1141 Ga0495580_0005545 3300046472 Bacteria 10406
1142 Ga0495580_0005972 3300046472 Bacteria 9975
1143 Ga0495580_0006027 3300046472 Bacteria 9927
1144 Ga0495580_0015039 3300046472 Bacteria 5855
1145 Ga0495580_0019875 3300046472 Bacteria 4980
1146 Ga0495580_0023848 3300046472 Bacteria 4486
1147 Ga0495580_0043132 3300046472 Bacteria 3211
1148 Ga0495580_0061984 3300046472 Bacteria 2624
1149 Ga0495580_0069818 3300046472 Bacteria 2454
1150 Ga0495580_0072549 3300046472 Bacteria 2404
1151 Ga0495580_0075926 3300046472 Bacteria 2344
1152 Ga0495580_0092371 3300046472 Bacteria 2106
1153 Ga0495580_0171853 3300046472 Bacteria 1498
1154 Ga0495580_0232317 3300046472 Bacteria 1266
1155 Ga0495580_0232372 3300046472 Bacteria 1266
1156 Ga0495580_0261389 3300046472 Bacteria 1184
1157 Ga0495580_0288472 3300046472 Bacteria 1119
1158 Ga0495580_0306376 3300046472 Bacteria 1081
1159 Ga0495580_0716347 3300046472 Bacteria 654
1160 Ga0495582_0004179 3300046473 Bacteria 8118
1161 Ga0495582_0005180 3300046473 Bacteria 7292
1162 Ga0495582_0053130 3300046473 Bacteria 2234
1163 Ga0495582_0100948 3300046473 Bacteria 1615
1164 Ga0495582_0133871 3300046473 Bacteria 1401
1165 Ga0495639_0026063 3300046475 Bacteria 2582
1166 Ga0495639_0109177 3300046475 Bacteria 1311
1167 Ga0495662_0037715 3300046476 Bacteria 2335
1168 Ga0495664_0216411 3300046477 Bacteria 1160
1169 Ga0495608_0061373 3300046511 Bacteria 2472
1170 Ga0495628_0156798 3300046516 Bacteria 1731
1171 Ga0495630_0055452 3300046517 Bacteria 2970
1172 Ga0495630_0073982 3300046517 Bacteria 2566
1173 Ga0495630_0147073 3300046517 Bacteria 1792
1174 Ga0495630_0322815 3300046517 Bacteria 1180
1175 Ga0495643_0000013 3300046522 Bacteria 315700
1176 Ga0495652_0174175 3300046529 Bacteria 1658
1177 Ga0495665_0000974 3300046531 Bacteria 15176
1178 Ga0495665_0034039 3300046531 Bacteria 2724
1179 Ga0495665_0097095 3300046531 Bacteria 1547
1180 Ga0495640_0086402 3300046533 Bacteria 2077
1181 Ga0495640_0143771 3300046533 Bacteria 1536
1182 Ga0495586_0031648 3300046535 Bacteria 2835
1183 Ga0495586_0248925 3300046535 Bacteria 1014
1184 Ga0495667_0005206 3300046559 Bacteria 8791
1185 Ga0495667_0514000 3300046559 Bacteria 750
1186 Ga0495635_0076863 3300046663 Bacteria 2288
1187 Ga0495635_0313971 3300046663 Bacteria 1050
1188 Ga0495635_0387125 3300046663 Bacteria 930
1189 Ga0495659_0079620 3300046664 Bacteria 1241
1190 Ga0495588_0215146 3300046674 Bacteria 1015
1191 Ga0495657_0010611 3300046675 Bacteria 6925
1192 Ga0495623_0055744 3300046679 Bacteria 2490
1193 Ga0495623_0076747 3300046679 Unclassified 2073
1194 Ga0495647_0037668 3300046681 Bacteria 1826
1195 Ga0495647_0113103 3300046681 Bacteria 1135
1196 Ga0495658_0047423 3300046683 Bacteria 2420
1197 Ga0495658_0057732 3300046683 Bacteria 2218
1198 Ga0495658_0058830 3300046683 Bacteria 2199
1199 Ga0495658_0454314 3300046683 Bacteria 818
1200 Ga0495669_0032404 3300046684 Bacteria 2297
1201 Ga0495613_0011311 3300046689 Bacteria 6629
1202 Ga0495624_0101200 3300046690 Bacteria 1774
1203 Ga0495624_0119551 3300046690 Bacteria 1619
1204 Ga0495624_0425499 3300046690 Bacteria 796
1205 Ga0495581_0348665 3300047315 Bacteria 864
1206 Ga0495636_0000151 3300047318 Bacteria 27652
1207 Ga0495674_0017348 3300047319 Bacteria 6699
1208 Ga0495674_0073854 3300047319 Bacteria 2938
1209 Ga0495674_0102394 3300047319 Bacteria 2435
1210 Ga0495674_0257624 3300047319 Bacteria 1434
1211 Ga0495674_0329763 3300047319 Bacteria 1242
1212 Ga0495674_0415282 3300047319 Bacteria 1085
1213 Ga0495676_0092680 3300047321 Bacteria 2255
1214 Ga0495676_0315544 3300047321 Bacteria 1051
1215 Ga0495675_0190047 3300047444 Bacteria 1254
1216 Ga0495675_0221069 3300047444 Bacteria 1146
1217 Ga0495684_0163430 3300047471 Bacteria 1660
1218 Ga0495684_0311111 3300047471 Bacteria 1129
1219 Ga0495602_0233538 3300048088 Bacteria 1380
1220 Ga0495602_0332606 3300048088 Bacteria 1101
1221 Ga0495602_0596302 3300048088 Bacteria 760
1222 Ga0495602_0642460 3300048088 Bacteria 725
1223 Ga0495614_0011701 3300048089 Bacteria 3858
1224 Ga0495614_0126938 3300048089 Bacteria 1127
1225 Ga0496100_0034832 3300048903 Bacteria 3163
1226 Ga0496101_0171006 3300048904 Bacteria 1670
1227 Ga0496102_0024941 3300048905 Bacteria 5319
1228 Ga0496102_0055166 3300048905 Bacteria 3624
1229 Ga0496102_0076516 3300048905 Bacteria 3079
1230 Ga0496102_0382548 3300048905 Bacteria 1324
1231 Ga0496103_0014605 3300048906 Bacteria 4666
1232 Ga0496103_0306049 3300048906 Bacteria 1022
1233 Ga0496104_0038623 3300048907 Bacteria 4468
1234 Ga0496104_0045605 3300048907 Bacteria 4124
1235 Ga0496104_0055994 3300048907 Bacteria 3728
1236 Ga0496104_0182133 3300048907 Bacteria 2011
1237 Ga0496104_0189057 3300048907 Bacteria 1970
1238 Ga0496104_0199048 3300048907 Bacteria 1915
1239 Ga0496104_0206189 3300048907 Bacteria 1877
1240 Ga0496104_0226563 3300048907 Bacteria 1781
1241 Ga0496104_0294219 3300048907 Bacteria 1536
1242 Ga0496104_0706861 3300048907 Bacteria 916
1243 Ga0496105_0001128 3300048908 Bacteria 18606
1244 Ga0496105_0059685 3300048908 Bacteria 3147
1245 Ga0496106_0030822 3300048909 Bacteria 3998
1246 Ga0496106_0370341 3300048909 Bacteria 1151
1247 Ga0496106_0510540 3300048909 Bacteria 965
1248 Ga0496107_0051715 3300048910 Bacteria 2964
1249 Ga0496107_0080779 3300048910 Bacteria 2371
1250 Ga0496107_0264002 3300048910 Bacteria 1281
1251 Ga0496107_0448561 3300048910 Bacteria 958
1252 Ga0496108_0000242 3300048911 Bacteria 48793
1253 Ga0496108_0101714 3300048911 Bacteria 2452
1254 Ga0496108_0218452 3300048911 Bacteria 1656
1255 Ga0496109_0000120 3300048912 Bacteria 81828
1256 Ga0496109_0120903 3300048912 Bacteria 2440
1257 Ga0496109_0318675 3300048912 Bacteria 1467
1258 Ga0496109_1301944 3300048912 Bacteria 663
1259 Ga0496110_0000795 3300048913 Bacteria 22036
1260 Ga0496110_0174308 3300048913 Bacteria 1952
1261 Ga0496110_0197095 3300048913 Bacteria 1829
1262 Ga0496110_0302084 3300048913 Unclassified 1458
1263 Ga0496110_0368735 3300048913 Bacteria 1308
1264 Ga0496112_0000198 3300048915 Bacteria 39413
1265 Ga0496112_0000784 3300048915 Bacteria 22427
1266 Ga0496112_0003360 3300048915 Bacteria 13207
1267 Ga0496112_0006971 3300048915 Bacteria 9976
1268 Ga0496112_0010121 3300048915 Bacteria 8540
1269 Ga0496112_0011423 3300048915 Bacteria 8109
1270 Ga0496112_0023010 3300048915 Bacteria 5946
1271 Ga0496112_0064736 3300048915 Bacteria 3608
1272 Ga0496112_0074996 3300048915 Bacteria 3345
1273 Ga0496112_0380191 3300048915 Bacteria 1353
1274 Ga0496112_0403082 3300048915 Bacteria 1307
1275 Ga0496112_0489665 3300048915 Bacteria 1166
1276 Ga0496112_0690633 3300048915 Bacteria 949
1277 Ga0496113_0000111 3300048916 Bacteria 35094
1278 Ga0496113_0005436 3300048916 Bacteria 7942
1279 Ga0496113_0090255 3300048916 Bacteria 2360
1280 Ga0496113_0109542 3300048916 Bacteria 2148
1281 Ga0496113_0155607 3300048916 Bacteria 1805
1282 Ga0496114_0015090 3300048917 Bacteria 6212
1283 Ga0496114_0239924 3300048917 Bacteria 1594
1284 Ga0496115_0046543 3300048918 Bacteria 3467
1285 Ga0496115_0082823 3300048918 Bacteria 2614
1286 Ga0496115_0147877 3300048918 Bacteria 1939
1287 Ga0496115_0156001 3300048918 Bacteria 1886
1288 Ga0496115_0173065 3300048918 Bacteria 1785
1289 Ga0501034_0140313 3300049571 Bacteria 2397
1290 Ga0501034_0238848 3300049571 Bacteria 1764
1291 Ga0501072_0428026 3300049588 Bacteria 1049
1292 Ga0501073_0029956 3300049589 Bacteria 3887
1293 Ga0501075_0160589 3300049591 Bacteria 1715
1294 Ga0501077_0045895 3300049593 Bacteria 2776
1295 Ga0501080_0186404 3300049742 Bacteria 1908
1296 Ga0501083_0373573 3300049744 Bacteria 927
1297 Ga0501262_020972 3300049759 Bacteria 895
1298 nmdc:mga00v17_93625_c1 3300050491 Bacteria 1677
1299 nmdc:mga0k408_2813_c1 3300050493 Bacteria 9240
1300 nmdc:mga06z11_29773_c1 3300050494 Bacteria 2634
1301 nmdc:mga04h51_47084_c1 3300050495 Bacteria 1432
1302 nmdc:mga07m45_24306_c1 3300050496 Bacteria 3317
1303 nmdc:mga05p37_32654_c1 3300050507 Bacteria 5821
1304 nmdc:mga05p37_4213_c1 3300050507 Bacteria 16803
1305 nmdc:mga09592_152621_c1 3300050508 Bacteria 1993
1306 nmdc:mga09592_183977_c1 3300050508 Bacteria 1808
1307 nmdc:mga0qj67_418941_c1 3300050509 Bacteria 1080
1308 nmdc:mga06r32_72276_c1 3300050510 Bacteria 3340
1309 nmdc:mga08y16_4339_c1 3300050511 Bacteria 14819
1310 nmdc:mga0n895_344_c1 3300050512 Bacteria 31117
1311 nmdc:mga0n895_361774_c1 3300050512 Bacteria 1469
1312 nmdc:mga0n895_420510_c1 3300050512 Bacteria 1351
1313 nmdc:mga0n895_54090_c1 3300050512 Bacteria 3947
1314 nmdc:mga0n895_794644_c1 3300050512 Bacteria 937
1315 nmdc:mga0rr50_304164_c1 3300050513 Bacteria 1334
1316 nmdc:mga0rr50_38765_c1 3300050513 Bacteria 3451
1317 nmdc:mga0rr50_654810_c1 3300050513 Bacteria 896
1318 nmdc:mga0rr50_872_c1 3300050513 Bacteria 16295
1319 nmdc:mga08x19_12623_c1 3300050514 Bacteria 5095
1320 nmdc:mga08x19_160854_c1 3300050514 Bacteria 1098
1321 nmdc:mga08x19_210437_c1 3300050514 Bacteria 1335
1322 nmdc:mga08x19_3391_c1 3300050514 Bacteria 9503
1323 nmdc:mga08x19_95920_c1 3300050514 Bacteria 1963
1324 nmdc:mga08x19_982620_c1 3300050514 Bacteria 600
1325 nmdc:mga0a205_287176_c1 3300050515 Bacteria 1520
1326 nmdc:mga0a205_427100_c1 3300050515 Bacteria 1187
1327 nmdc:mga0a205_7367_c1 3300050515 Bacteria 9965
1328 nmdc:mga0sz30_105058_c1 3300050516 Bacteria 1235
1329 Ga0495601_0047993 3300053077 Bacteria 2689
1330 Ga0495601_0135402 3300053077 Bacteria 1606
1331 Ga0495612_0044598 3300053078 Bacteria 1815
1332 Ga0495619_0139568 3300053085 Bacteria 1668
1333 Ga0500628_000317 3300053129 Bacteria 9252
1334 Ga0501084_0032147 3300054114 Bacteria 4389
1335 Ga0587062_013706 3300059639 Bacteria 1060
1336 Ga0501082_0188449 3300060353 Bacteria 1795

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300005340 Ga0070689_100860581 Ga0070689_1008605812 164
2 3300013297 Ga0157378_10293421 Ga0157378_102934211 179
3 3300049571 Ga0501034_0140313 Ga0501034_0140313_739_1296 179
4 3300013296 Ga0157374_10261321 Ga0157374_102613212 180
5 3300036401 Ga0373937_0478995 Ga0373937_0478995_149_784 181
6 3300050515 nmdc:mga0a205_427100_c1 nmdc:mga0a205_427100_c1_187_762 181
7 3300006177 Ga0075362_10006435 Ga0075362_100064357 182
8 3300006844 Ga0075428_100098566 Ga0075428_1000985664 182
9 3300006880 Ga0075429_100338234 Ga0075429_1003382343 182
10 3300009147 Ga0114129_10003061 Ga0114129_1000306124 182
11 3300014969 Ga0157376_10025636 Ga0157376_100256362 182
12 3300041496 Ga0451839_0485878 Ga0451839_0485878_60_701 182
13 3300050507 nmdc:mga05p37_4213_c1 nmdc:mga05p37_4213_c1_9920_10480 182
14 3300050508 nmdc:mga09592_152621_c1 nmdc:mga09592_152621_c1_684_1244 182
15 3300050509 nmdc:mga0qj67_418941_c1 nmdc:mga0qj67_418941_c1_229_993 182
16 3300005434 Ga0070709_10002115 Ga0070709_1000211510 183
17 3300005435 Ga0070714_100113339 Ga0070714_1001133393 183
18 3300005436 Ga0070713_100020716 Ga0070713_1000207168 183
19 3300006028 Ga0070717_10132139 Ga0070717_101321394 183
20 3300006038 Ga0075365_10106101 Ga0075365_101061012 183
21 3300006042 Ga0075368_10014567 Ga0075368_100145674 183
22 3300006051 Ga0075364_10040659 Ga0075364_100406596 183
23 3300006173 Ga0070716_100067235 Ga0070716_1000672352 183
24 3300006880 Ga0075429_100070647 Ga0075429_1000706473 183
25 3300006914 Ga0075436_100014515 Ga0075436_1000145158 183
26 3300009094 Ga0111539_10021708 Ga0111539_1002170812 183
27 3300025898 Ga0207692_10097905 Ga0207692_100979052 183
28 3300025906 Ga0207699_10023897 Ga0207699_100238977 183
29 3300025928 Ga0207700_10029324 Ga0207700_100293246 183
30 3300025929 Ga0207664_10001347 Ga0207664_1000134711 183
31 3300025933 Ga0207706_10037828 Ga0207706_100378283 183
32 3300025939 Ga0207665_10142212 Ga0207665_101422122 183
33 3300027866 Ga0209813_10015663 Ga0209813_100156631 183
34 3300027907 Ga0207428_10000032 Ga0207428_10000032220 183
35 3300050491 nmdc:mga00v17_93625_c1 nmdc:mga00v17_93625_c1_120_884 183
36 3300050493 nmdc:mga0k408_2813_c1 nmdc:mga0k408_2813_c1_6323_7087 183
37 3300050494 nmdc:mga06z11_29773_c1 nmdc:mga06z11_29773_c1_1586_2350 183
38 3300050495 nmdc:mga04h51_47084_c1 nmdc:mga04h51_47084_c1_153_917 183
39 3300050496 nmdc:mga07m45_24306_c1 nmdc:mga07m45_24306_c1_1012_1776 183
40 3300050508 nmdc:mga09592_183977_c1 nmdc:mga09592_183977_c1_767_1531 183
41 3300050510 nmdc:mga06r32_72276_c1 nmdc:mga06r32_72276_c1_1716_2474 183
42 3300050511 nmdc:mga08y16_4339_c1 nmdc:mga08y16_4339_c1_6452_7216 183
43 3300050514 nmdc:mga08x19_12623_c1 nmdc:mga08x19_12623_c1_4241_4861 183
44 3300004800 Ga0058861_10061116 Ga0058861_100611162 184
45 3300005336 Ga0070680_100347262 Ga0070680_1003472621 184
46 3300005436 Ga0070713_100216112 Ga0070713_1002161122 184
47 3300005458 Ga0070681_10109152 Ga0070681_101091522 184
48 3300005530 Ga0070679_100051170 Ga0070679_1000511703 184
49 3300005536 Ga0070697_100007786 Ga0070697_1000077868 184
50 3300005546 Ga0070696_100202266 Ga0070696_1002022662 184
51 3300005546 Ga0070696_100388748 Ga0070696_1003887482 184
52 3300006847 Ga0075431_100763335 Ga0075431_1007633352 184
53 3300007076 Ga0075435_100661447 Ga0075435_1006614472 184
54 3300009147 Ga0114129_10195930 Ga0114129_101959305 184
55 3300010159 Ga0099796_10010934 Ga0099796_100109343 184
56 3300013104 Ga0157370_10167276 Ga0157370_101672762 184
57 3300013306 Ga0163162_10156515 Ga0163162_101565156 184
58 3300026089 Ga0207648_10243298 Ga0207648_102432982 184
59 3300031251 Ga0265327_10007434 Ga0265327_1000743411 184
60 3300042876 Ga0451577_0000325 Ga0451577_0000325_990_1634 184
61 3300044673 Ga0453683_0139682 Ga0453683_0139682_334_978 184
62 3300044712 Ga0453684_0000951 Ga0453684_0000951_87388_88032 184
63 3300045051 Ga0451576_0010556 Ga0451576_0010556_2421_3065 184
64 3300050514 nmdc:mga08x19_982620_c1 nmdc:mga08x19_982620_c1_11_568 184
65 3300004799 Ga0058863_10034036 Ga0058863_100340363 185
66 3300005329 Ga0070683_100167030 Ga0070683_1001670304 185
67 3300005329 Ga0070683_100226293 Ga0070683_1002262933 185
68 3300005338 Ga0068868_100212391 Ga0068868_1002123912 185
69 3300005434 Ga0070709_10268501 Ga0070709_102685012 185
70 3300005436 Ga0070713_100384332 Ga0070713_1003843323 185
71 3300005436 Ga0070713_100809415 Ga0070713_1008094151 185
72 3300005436 Ga0070713_101565227 Ga0070713_1015652271 185
73 3300005439 Ga0070711_100156742 Ga0070711_1001567422 185
74 3300005439 Ga0070711_100529994 Ga0070711_1005299941 185
75 3300005458 Ga0070681_10286546 Ga0070681_102865462 185
76 3300005535 Ga0070684_100158358 Ga0070684_1001583581 185
77 3300005539 Ga0068853_100972961 Ga0068853_1009729612 185
78 3300005547 Ga0070693_100112718 Ga0070693_1001127181 185
79 3300005564 Ga0070664_100654639 Ga0070664_1006546392 185
80 3300005578 Ga0068854_100556477 Ga0068854_1005564772 185
81 3300005614 Ga0068856_100044555 Ga0068856_1000445554 185
82 3300005834 Ga0068851_10341582 Ga0068851_103415822 185
83 3300006163 Ga0070715_10362751 Ga0070715_103627511 185
84 3300006173 Ga0070716_100369486 Ga0070716_1003694862 185
85 3300006175 Ga0070712_100039318 Ga0070712_1000393183 185
86 3300006871 Ga0075434_100442008 Ga0075434_1004420082 185
87 3300009093 Ga0105240_10171261 Ga0105240_101712613 185
88 3300009093 Ga0105240_10223171 Ga0105240_102231712 185
89 3300009098 Ga0105245_10119830 Ga0105245_101198304 185
90 3300009098 Ga0105245_10469873 Ga0105245_104698732 185
91 3300009174 Ga0105241_10147872 Ga0105241_101478723 185
92 3300009176 Ga0105242_10061446 Ga0105242_100614463 185
93 3300009551 Ga0105238_10330845 Ga0105238_103308452 185
94 3300009551 Ga0105238_10541210 Ga0105238_105412102 185
95 3300009551 Ga0105238_10572234 Ga0105238_105722342 185
96 3300010375 Ga0105239_10529207 Ga0105239_105292072 185
97 3300025321 Ga0207656_10092827 Ga0207656_100928271 185
98 3300025898 Ga0207692_10550070 Ga0207692_105500701 185
99 3300025906 Ga0207699_10313131 Ga0207699_103131312 185
100 3300025911 Ga0207654_10404551 Ga0207654_104045511 185
101 3300025913 Ga0207695_10165626 Ga0207695_101656263 185
102 3300025915 Ga0207693_10174165 Ga0207693_101741652 185
103 3300025915 Ga0207693_10189476 Ga0207693_101894762 185
104 3300025916 Ga0207663_10038998 Ga0207663_100389982 185
105 3300025916 Ga0207663_10296082 Ga0207663_102960821 185
106 3300025920 Ga0207649_10196985 Ga0207649_101969852 185
107 3300025921 Ga0207652_10971682 Ga0207652_109716821 185
108 3300025924 Ga0207694_10061850 Ga0207694_100618506 185
109 3300025924 Ga0207694_10078228 Ga0207694_100782283 185
110 3300025927 Ga0207687_10028606 Ga0207687_100286063 185
111 3300025928 Ga0207700_10043503 Ga0207700_100435034 185
112 3300025928 Ga0207700_10414976 Ga0207700_104149761 185
113 3300025928 Ga0207700_10905890 Ga0207700_109058901 185
114 3300025928 Ga0207700_11000723 Ga0207700_110007231 185
115 3300025929 Ga0207664_10986459 Ga0207664_109864591 185
116 3300025939 Ga0207665_10042845 Ga0207665_100428454 185
117 3300025944 Ga0207661_10097453 Ga0207661_100974533 185
118 3300025949 Ga0207667_10042321 Ga0207667_100423219 185
119 3300026023 Ga0207677_10696160 Ga0207677_106961601 185
120 3300026041 Ga0207639_10072514 Ga0207639_100725142 185
121 3300035086 Ga0373934_0064886 Ga0373934_0064886_772_1329 185
122 3300035089 Ga0373944_0101984 Ga0373944_0101984_113_670 185
123 3300035111 Ga0373923_0016587 Ga0373923_0016587_489_1046 185
124 3300035111 Ga0373923_0212827 Ga0373923_0212827_311_868 185
125 3300035113 Ga0373936_0038606 Ga0373936_0038606_1197_1754 185
126 3300035116 Ga0373945_0033929 Ga0373945_0033929_573_1130 185
127 3300035116 Ga0373945_0146083 Ga0373945_0146083_284_841 185
128 3300035119 Ga0373956_0220770 Ga0373956_0220770_300_857 185
129 3300035120 Ga0373957_0037499 Ga0373957_0037499_1191_1748 185
130 3300035170 Ga0373943_0041324 Ga0373943_0041324_437_994 185
131 3300035171 Ga0373946_0032271 Ga0373946_0032271_1078_1635 185
132 3300035172 Ga0373955_0096768 Ga0373955_0096768_357_914 185
133 3300035410 Ga0373924_0000242 Ga0373924_0000242_7543_8100 185
134 3300035410 Ga0373924_0013446 Ga0373924_0013446_485_1042 185
135 3300035692 Ga0373935_0038747 Ga0373935_0038747_433_990 185
136 3300035692 Ga0373935_0148989 Ga0373935_0148989_34_591 185
137 3300035692 Ga0373935_0190760 Ga0373935_0190760_116_673 185
138 3300035695 Ga0373927_0028973 Ga0373927_0028973_380_937 185
139 3300035724 Ga0373933_0185287 Ga0373933_0185287_404_961 185
140 3300035725 Ga0373947_0074112 Ga0373947_0074112_433_990 185
141 3300036401 Ga0373937_0000317 Ga0373937_0000317_23964_24521 185
142 3300036401 Ga0373937_0472973 Ga0373937_0472973_381_938 185
143 3300036401 Ga0373937_0558661 Ga0373937_0558661_119_676 185
144 3300037068 Ga0373925_0003717 Ga0373925_0003717_4909_5466 185
145 3300037068 Ga0373925_0449076 Ga0373925_0449076_473_1030 185
146 3300045976 Ga0466967_0280594 Ga0466967_0280594_115_672 185
147 3300046455 Ga0495603_0303002 Ga0495603_0303002_230_787 185
148 3300046462 Ga0495651_0014848 Ga0495651_0014848_1232_1789 185
149 3300046462 Ga0495651_0131652 Ga0495651_0131652_1140_1697 185
150 3300046472 Ga0495580_0043132 Ga0495580_0043132_2064_2621 185
151 3300046472 Ga0495580_0716347 Ga0495580_0716347_13_630 185
152 3300046473 Ga0495582_0053130 Ga0495582_0053130_992_1549 185
153 3300046475 Ga0495639_0109177 Ga0495639_0109177_556_1113 185
154 3300046516 Ga0495628_0156798 Ga0495628_0156798_1057_1614 185
155 3300046517 Ga0495630_0322815 Ga0495630_0322815_312_869 185
156 3300046522 Ga0495643_0000013 Ga0495643_0000013_71154_71759 185
157 3300046529 Ga0495652_0174175 Ga0495652_0174175_115_672 185
158 3300046531 Ga0495665_0034039 Ga0495665_0034039_225_782 185
159 3300046679 Ga0495623_0055744 Ga0495623_0055744_1565_2122 185
160 3300046683 Ga0495658_0047423 Ga0495658_0047423_1321_1878 185
161 3300046690 Ga0495624_0119551 Ga0495624_0119551_746_1303 185
162 3300047315 Ga0495581_0348665 Ga0495581_0348665_120_677 185
163 3300047318 Ga0495636_0000151 Ga0495636_0000151_9593_10156 185
164 3300047319 Ga0495674_0257624 Ga0495674_0257624_236_793 185
165 3300047319 Ga0495674_0415282 Ga0495674_0415282_157_720 185
166 3300047321 Ga0495676_0315544 Ga0495676_0315544_480_1037 185
167 3300047444 Ga0495675_0221069 Ga0495675_0221069_499_1056 185
168 3300048088 Ga0495602_0642460 Ga0495602_0642460_154_711 185
169 3300048089 Ga0495614_0011701 Ga0495614_0011701_2013_2570 185
170 3300048906 Ga0496103_0014605 Ga0496103_0014605_1569_2126 185
171 3300048907 Ga0496104_0199048 Ga0496104_0199048_471_1028 185
172 3300048907 Ga0496104_0226563 Ga0496104_0226563_960_1517 185
173 3300048908 Ga0496105_0001128 Ga0496105_0001128_4556_5113 185
174 3300048913 Ga0496110_0197095 Ga0496110_0197095_106_663 185
175 3300048913 Ga0496110_0302084 Ga0496110_0302084_317_874 185
176 3300048915 Ga0496112_0000784 Ga0496112_0000784_5594_6151 185
177 3300048915 Ga0496112_0380191 Ga0496112_0380191_92_649 185
178 3300048915 Ga0496112_0690633 Ga0496112_0690633_215_772 185
179 3300048916 Ga0496113_0005436 Ga0496113_0005436_6113_6670 185
180 3300048916 Ga0496113_0109542 Ga0496113_0109542_67_624 185
181 3300050512 nmdc:mga0n895_361774_c1 nmdc:mga0n895_361774_c1_551_1108 185
182 3300059639 Ga0587062_013706 Ga0587062_013706_348_920 185
183 3300005468 Ga0070707_100503831 Ga0070707_1005038311 186
184 3300013104 Ga0157370_10115216 Ga0157370_101152164 186
185 3300025922 Ga0207646_11034925 Ga0207646_110349251 186
186 3300045976 Ga0466967_0755444 Ga0466967_0755444_139_759 186
187 3300048915 Ga0496112_0011423 Ga0496112_0011423_6019_6594 186
188 3300053129 Ga0500628_000317 Ga0500628_000317_1993_2601 186
189 3300004800 Ga0058861_11712544 Ga0058861_117125441 187
190 3300004800 Ga0058861_11825451 Ga0058861_118254512 187
191 3300004803 Ga0058862_12460894 Ga0058862_124608942 187
192 3300005293 Ga0065715_10310247 Ga0065715_103102472 187
193 3300005329 Ga0070683_100014406 Ga0070683_10001440613 187
194 3300005330 Ga0070690_100182552 Ga0070690_1001825522 187
195 3300005331 Ga0070670_100009055 Ga0070670_10000905511 187
196 3300005331 Ga0070670_100322656 Ga0070670_1003226562 187
197 3300005334 Ga0068869_100012003 Ga0068869_1000120031 187
198 3300005336 Ga0070680_100073735 Ga0070680_1000737354 187
199 3300005338 Ga0068868_100232254 Ga0068868_1002322542 187
200 3300005340 Ga0070689_100212287 Ga0070689_1002122873 187
201 3300005341 Ga0070691_10257775 Ga0070691_102577752 187
202 3300005440 Ga0070705_100078070 Ga0070705_1000780703 187
203 3300005456 Ga0070678_100840451 Ga0070678_1008404511 187
204 3300005457 Ga0070662_100134404 Ga0070662_1001344043 187
205 3300005458 Ga0070681_10029788 Ga0070681_100297886 187
206 3300005458 Ga0070681_10058143 Ga0070681_100581431 187
207 3300005459 Ga0068867_100032550 Ga0068867_1000325506 187
208 3300005530 Ga0070679_100031685 Ga0070679_1000316855 187
209 3300005530 Ga0070679_100451951 Ga0070679_1004519512 187
210 3300005535 Ga0070684_100136802 Ga0070684_1001368023 187
211 3300005563 Ga0068855_100088860 Ga0068855_1000888603 187
212 3300005564 Ga0070664_100074814 Ga0070664_1000748143 187
213 3300005577 Ga0068857_100001398 Ga0068857_1000013989 187
214 3300005578 Ga0068854_100093571 Ga0068854_1000935714 187
215 3300005617 Ga0068859_100004997 Ga0068859_10000499711 187
216 3300005618 Ga0068864_100008706 Ga0068864_1000087068 187
217 3300005842 Ga0068858_100073301 Ga0068858_1000733013 187
218 3300006237 Ga0097621_100109209 Ga0097621_1001092094 187
219 3300006358 Ga0068871_100017519 Ga0068871_1000175199 187
220 3300006871 Ga0075434_100214171 Ga0075434_1002141714 187
221 3300006881 Ga0068865_100100288 Ga0068865_1001002883 187
222 3300006931 Ga0097620_100004997 Ga0097620_10000499711 187
223 3300007076 Ga0075435_100044730 Ga0075435_1000447305 187
224 3300009093 Ga0105240_10699647 Ga0105240_106996471 187
225 3300009098 Ga0105245_10341154 Ga0105245_103411543 187
226 3300009176 Ga0105242_10272746 Ga0105242_102727463 187
227 3300010375 Ga0105239_10197083 Ga0105239_101970834 187
228 3300011119 Ga0105246_10096279 Ga0105246_100962794 187
229 3300013102 Ga0157371_10069917 Ga0157371_100699173 187
230 3300013296 Ga0157374_10004729 Ga0157374_1000472913 187
231 3300013297 Ga0157378_10007199 Ga0157378_1000719914 187
232 3300013307 Ga0157372_10006630 Ga0157372_1000663015 187
233 3300021388 Ga0213875_10050957 Ga0213875_100509574 187
234 3300025899 Ga0207642_10161413 Ga0207642_101614131 187
235 3300025912 Ga0207707_10022616 Ga0207707_100226167 187
236 3300025912 Ga0207707_10155824 Ga0207707_101558242 187
237 3300025913 Ga0207695_10609660 Ga0207695_106096602 187
238 3300025914 Ga0207671_10193281 Ga0207671_101932813 187
239 3300025917 Ga0207660_10572029 Ga0207660_105720292 187
240 3300025921 Ga0207652_10018101 Ga0207652_100181018 187
241 3300025921 Ga0207652_10029215 Ga0207652_100292159 187
242 3300025925 Ga0207650_10325658 Ga0207650_103256582 187
243 3300025927 Ga0207687_10232652 Ga0207687_102326522 187
244 3300025929 Ga0207664_10336482 Ga0207664_103364822 187
245 3300025933 Ga0207706_10245396 Ga0207706_102453962 187
246 3300025934 Ga0207686_10668641 Ga0207686_106686411 187
247 3300025936 Ga0207670_10105048 Ga0207670_101050483 187
248 3300025938 Ga0207704_10048090 Ga0207704_100480905 187
249 3300025942 Ga0207689_10013637 Ga0207689_100136377 187
250 3300025944 Ga0207661_10092768 Ga0207661_100927682 187
251 3300025945 Ga0207679_10010869 Ga0207679_100108693 187
252 3300025949 Ga0207667_10051011 Ga0207667_100510119 187
253 3300025960 Ga0207651_10167924 Ga0207651_101679244 187
254 3300025981 Ga0207640_10006598 Ga0207640_100065988 187
255 3300026023 Ga0207677_10206809 Ga0207677_102068092 187
256 3300026035 Ga0207703_10062296 Ga0207703_100622967 187
257 3300026078 Ga0207702_10098318 Ga0207702_100983183 187
258 3300026089 Ga0207648_10202079 Ga0207648_102020793 187
259 3300026095 Ga0207676_10012745 Ga0207676_100127459 187
260 3300026116 Ga0207674_10025597 Ga0207674_1002559712 187
261 3300036401 Ga0373937_0037183 Ga0373937_0037183_3570_4247 187
262 3300036401 Ga0373937_0096763 Ga0373937_0096763_1208_1771 187
263 3300037853 Ga0436364_1407027 Ga0436364_1407027_11269_11859 187
264 3300042001 Ga0439441_037037 Ga0439441_037037_262_831 187
265 3300042003 Ga0439443_010525 Ga0439443_010525_619_1188 187
266 3300042005 Ga0439448_0002852 Ga0439448_0002852_981_1550 187
267 3300042008 Ga0439450_003413 Ga0439450_003413_1781_2350 187
268 3300042012 Ga0439455_0005315 Ga0439455_0005315_214_783 187
269 3300042016 Ga0439463_002436 Ga0439463_002436_988_1557 187
270 3300042139 Ga0450904_005858 Ga0450904_005858_151_720 187
271 3300042142 Ga0450905_014730 Ga0450905_014730_318_887 187
272 3300042461 Ga0439460_0007380 Ga0439460_0007380_1652_2221 187
273 3300042533 Ga0450901_005107 Ga0450901_005107_542_1111 187
274 3300042876 Ga0451577_0091291 Ga0451577_0091291_547_1122 187
275 3300044712 Ga0453684_0974171 Ga0453684_0974171_95_670 187
276 3300048915 Ga0496112_0064736 Ga0496112_0064736_2062_2625 187
277 3300048916 Ga0496113_0155607 Ga0496113_0155607_814_1377 187
278 3300050516 nmdc:mga0sz30_105058_c1 nmdc:mga0sz30_105058_c1_228_992 187
279 3300005536 Ga0070697_100000975 Ga0070697_10000097514 188
280 3300006852 Ga0075433_10809527 Ga0075433_108095272 188
281 3300006871 Ga0075434_100058482 Ga0075434_1000584825 188
282 3300006914 Ga0075436_100063069 Ga0075436_1000630693 188
283 3300017792 Ga0163161_10233312 Ga0163161_102333123 188
284 3300042876 Ga0451577_0780850 Ga0451577_0780850_64_717 188
285 3300044706 Ga0466964_0390134 Ga0466964_0390134_68_688 188
286 3300050507 nmdc:mga05p37_32654_c1 nmdc:mga05p37_32654_c1_4815_5408 188
287 3300050512 nmdc:mga0n895_420510_c1 nmdc:mga0n895_420510_c1_483_1079 188
288 3300050512 nmdc:mga0n895_794644_c1 nmdc:mga0n895_794644_c1_311_907 188
289 3300050513 nmdc:mga0rr50_304164_c1 nmdc:mga0rr50_304164_c1_288_884 188
290 3300050514 nmdc:mga08x19_210437_c1 nmdc:mga08x19_210437_c1_177_773 188
291 3300005441 Ga0070700_100021246 Ga0070700_1000212466 189
292 3300005445 Ga0070708_100470537 Ga0070708_1004705372 189
293 3300005536 Ga0070697_100062782 Ga0070697_1000627825 189
294 3300006358 Ga0068871_100302811 Ga0068871_1003028112 189
295 3300010375 Ga0105239_10056460 Ga0105239_100564606 189
296 3300013297 Ga0157378_10077880 Ga0157378_100778801 189
297 3300025922 Ga0207646_10032205 Ga0207646_100322059 189
298 3300025942 Ga0207689_10005608 Ga0207689_1000560813 189
299 3300026089 Ga0207648_10038306 Ga0207648_100383066 189
300 3300026116 Ga0207674_10022993 Ga0207674_1002299310 189
301 3300035398 Ga0316574_0101806 Ga0316574_0101806_1183_1803 189
302 3300045976 Ga0466967_0004406 Ga0466967_0004406_4699_5325 189
303 3300005340 Ga0070689_100172020 Ga0070689_1001720204 190
304 3300005937 Ga0081455_10311710 Ga0081455_103117102 190
305 3300005983 Ga0081540_1062142 Ga0081540_10621423 190
306 3300006173 Ga0070716_100168187 Ga0070716_1001681872 190
307 3300006881 Ga0068865_100002949 Ga0068865_10000294915 190
308 3300025918 Ga0207662_10003831 Ga0207662_1000383111 190
309 3300025939 Ga0207665_10190292 Ga0207665_101902922 190
310 3300044694 Ga0466963_0075184 Ga0466963_0075184_238_867 190
311 3300045976 Ga0466967_0469506 Ga0466967_0469506_254_883 190
312 3300046684 Ga0495669_0032404 Ga0495669_0032404_10_774 190
313 3300005536 Ga0070697_100016797 Ga0070697_1000167977 191
314 3300009098 Ga0105245_11135397 Ga0105245_111353971 191
315 3300014969 Ga0157376_10991254 Ga0157376_109912541 191
316 3300025916 Ga0207663_10376464 Ga0207663_103764642 191
317 3300028800 Ga0265338_10006873 Ga0265338_1000687315 191
318 3300031239 Ga0265328_10014015 Ga0265328_100140152 191
319 3300031249 Ga0265339_10002352 Ga0265339_1000235216 191
320 3300031344 Ga0265316_10012614 Ga0265316_1001261410 191
321 3300035691 Ga0373931_0549488 Ga0373931_0549488_23_649 191
322 3300046472 Ga0495580_0232372 Ga0495580_0232372_390_1019 191
323 3300048907 Ga0496104_0706861 Ga0496104_0706861_221_847 191
324 3300005328 Ga0070676_10108569 Ga0070676_101085694 192
325 3300005354 Ga0070675_100084032 Ga0070675_1000840322 192
326 3300005365 Ga0070688_100036719 Ga0070688_1000367194 192
327 3300005367 Ga0070667_100017909 Ga0070667_1000179099 192
328 3300005434 Ga0070709_10145020 Ga0070709_101450203 192
329 3300005436 Ga0070713_100007500 Ga0070713_10000750013 192
330 3300005437 Ga0070710_10048515 Ga0070710_100485153 192
331 3300005438 Ga0070701_10006922 Ga0070701_100069222 192
332 3300005439 Ga0070711_100120873 Ga0070711_1001208733 192
333 3300005444 Ga0070694_100045069 Ga0070694_1000450695 192
334 3300005445 Ga0070708_100015435 Ga0070708_10001543510 192
335 3300005455 Ga0070663_100078211 Ga0070663_1000782113 192
336 3300005456 Ga0070678_100432412 Ga0070678_1004324123 192
337 3300005459 Ga0068867_100015173 Ga0068867_1000151738 192
338 3300005466 Ga0070685_10004725 Ga0070685_100047254 192
339 3300005468 Ga0070707_100034957 Ga0070707_1000349576 192
340 3300005543 Ga0070672_100022245 Ga0070672_1000222456 192
341 3300005544 Ga0070686_100032760 Ga0070686_1000327606 192
342 3300005545 Ga0070695_100040849 Ga0070695_1000408494 192
343 3300005548 Ga0070665_100072424 Ga0070665_1000724244 192
344 3300005549 Ga0070704_100206371 Ga0070704_1002063711 192
345 3300005615 Ga0070702_100005684 Ga0070702_1000056849 192
346 3300005617 Ga0068859_100122147 Ga0068859_1001221474 192
347 3300005718 Ga0068866_10007588 Ga0068866_100075884 192
348 3300005843 Ga0068860_100038574 Ga0068860_1000385746 192
349 3300006028 Ga0070717_10007864 Ga0070717_100078646 192
350 3300006358 Ga0068871_100092902 Ga0068871_1000929022 192
351 3300006871 Ga0075434_100081416 Ga0075434_1000814166 192
352 3300006914 Ga0075436_100344733 Ga0075436_1003447331 192
353 3300006931 Ga0097620_100122145 Ga0097620_1001221454 192
354 3300009098 Ga0105245_10199811 Ga0105245_101998114 192
355 3300009148 Ga0105243_10081667 Ga0105243_100816675 192
356 3300009176 Ga0105242_10005427 Ga0105242_1000542715 192
357 3300009177 Ga0105248_10110411 Ga0105248_101104113 192
358 3300009553 Ga0105249_10131116 Ga0105249_101311165 192
359 3300011119 Ga0105246_10070927 Ga0105246_100709274 192
360 3300013105 Ga0157369_10002709 Ga0157369_1000270911 192
361 3300013306 Ga0163162_10023491 Ga0163162_100234917 192
362 3300013308 Ga0157375_10012035 Ga0157375_100120359 192
363 3300014326 Ga0157380_10050387 Ga0157380_100503877 192
364 3300014968 Ga0157379_10041991 Ga0157379_100419916 192
365 3300025898 Ga0207692_10207217 Ga0207692_102072173 192
366 3300025900 Ga0207710_10168783 Ga0207710_101687832 192
367 3300025907 Ga0207645_10011941 Ga0207645_100119416 192
368 3300025908 Ga0207643_10003060 Ga0207643_100030606 192
369 3300025916 Ga0207663_10102123 Ga0207663_101021233 192
370 3300025922 Ga0207646_10117634 Ga0207646_101176343 192
371 3300025926 Ga0207659_10076951 Ga0207659_100769513 192
372 3300025927 Ga0207687_10164055 Ga0207687_101640551 192
373 3300025928 Ga0207700_10011563 Ga0207700_100115634 192
374 3300025935 Ga0207709_10020843 Ga0207709_100208436 192
375 3300025940 Ga0207691_10026413 Ga0207691_100264139 192
376 3300025941 Ga0207711_10047959 Ga0207711_100479597 192
377 3300025942 Ga0207689_10012098 Ga0207689_100120984 192
378 3300025960 Ga0207651_10018159 Ga0207651_100181597 192
379 3300025986 Ga0207658_10011883 Ga0207658_100118836 192
380 3300026035 Ga0207703_10037962 Ga0207703_100379623 192
381 3300026075 Ga0207708_10012290 Ga0207708_100122907 192
382 3300026088 Ga0207641_10149740 Ga0207641_101497405 192
383 3300026089 Ga0207648_10001820 Ga0207648_1000182015 192
384 3300026095 Ga0207676_10165194 Ga0207676_101651944 192
385 3300026118 Ga0207675_100002488 Ga0207675_10000248820 192
386 3300026121 Ga0207683_10405142 Ga0207683_104051422 192
387 3300028379 Ga0268266_10043350 Ga0268266_100433504 192
388 3300028380 Ga0268265_10164421 Ga0268265_101644212 192
389 3300028381 Ga0268264_10022839 Ga0268264_100228398 192
390 3300035241 Ga0373961_0015362 Ga0373961_0015362_807_1562 192
391 3300045049 Ga0466959_0049616 Ga0466959_0049616_1589_2215 192
392 3300050512 nmdc:mga0n895_54090_c1 nmdc:mga0n895_54090_c1_2616_3242 192
393 3300050513 nmdc:mga0rr50_38765_c1 nmdc:mga0rr50_38765_c1_1064_1690 192
394 3300005335 Ga0070666_10085344 Ga0070666_100853442 193
395 3300005338 Ga0068868_100002791 Ga0068868_10000279111 193
396 3300005435 Ga0070714_100050607 Ga0070714_1000506077 193
397 3300005436 Ga0070713_100081996 Ga0070713_1000819964 193
398 3300005445 Ga0070708_100050730 Ga0070708_1000507306 193
399 3300005468 Ga0070707_100584232 Ga0070707_1005842321 193
400 3300005536 Ga0070697_100010485 Ga0070697_10001048510 193
401 3300005539 Ga0068853_100238624 Ga0068853_1002386242 193
402 3300005547 Ga0070693_100020180 Ga0070693_1000201804 193
403 3300005563 Ga0068855_100025561 Ga0068855_10002556110 193
404 3300005578 Ga0068854_100080136 Ga0068854_1000801365 193
405 3300005578 Ga0068854_100344020 Ga0068854_1003440202 193
406 3300005578 Ga0068854_101038293 Ga0068854_1010382931 193
407 3300005614 Ga0068856_100231154 Ga0068856_1002311543 193
408 3300005616 Ga0068852_100018187 Ga0068852_1000181873 193
409 3300005618 Ga0068864_101090888 Ga0068864_1010908881 193
410 3300005834 Ga0068851_10101620 Ga0068851_101016202 193
411 3300005843 Ga0068860_100135707 Ga0068860_1001357072 193
412 3300006028 Ga0070717_10168646 Ga0070717_101686462 193
413 3300006237 Ga0097621_100004937 Ga0097621_1000049373 193
414 3300006358 Ga0068871_100005622 Ga0068871_1000056224 193
415 3300009176 Ga0105242_10039591 Ga0105242_100395917 193
416 3300010375 Ga0105239_10466555 Ga0105239_104665551 193
417 3300013104 Ga0157370_10294069 Ga0157370_102940691 193
418 3300013105 Ga0157369_10067149 Ga0157369_100671495 193
419 3300013296 Ga0157374_10191404 Ga0157374_101914042 193
420 3300013297 Ga0157378_10000411 Ga0157378_1000041141 193
421 3300013306 Ga0163162_10167742 Ga0163162_101677423 193
422 3300013308 Ga0157375_10284760 Ga0157375_102847603 193
423 3300014969 Ga0157376_10036861 Ga0157376_100368616 193
424 3300021377 Ga0213874_10051537 Ga0213874_100515371 193
425 3300025903 Ga0207680_10088204 Ga0207680_100882043 193
426 3300025913 Ga0207695_10008453 Ga0207695_100084537 193
427 3300025914 Ga0207671_10077830 Ga0207671_100778303 193
428 3300025922 Ga0207646_10222371 Ga0207646_102223711 193
429 3300025924 Ga0207694_10585217 Ga0207694_105852172 193
430 3300025928 Ga0207700_10007967 Ga0207700_100079679 193
431 3300025929 Ga0207664_10032903 Ga0207664_100329038 193
432 3300025934 Ga0207686_10278057 Ga0207686_102780572 193
433 3300025981 Ga0207640_10104563 Ga0207640_101045632 193
434 3300026023 Ga0207677_10003373 Ga0207677_100033733 193
435 3300026041 Ga0207639_10472514 Ga0207639_104725141 193
436 3300026095 Ga0207676_10815209 Ga0207676_108152091 193
437 3300026118 Ga0207675_100403034 Ga0207675_1004030342 193
438 3300026142 Ga0207698_10073933 Ga0207698_100739335 193
439 3300028381 Ga0268264_10045417 Ga0268264_100454174 193
440 3300039450 Ga0436363_1519336 Ga0436363_1519336_485_1162 193
441 3300049591 Ga0501075_0160589 Ga0501075_0160589_876_1550 193
442 3300060353 Ga0501082_0188449 Ga0501082_0188449_61_735 193
443 3300005434 Ga0070709_10011840 Ga0070709_100118401 194
444 3300005435 Ga0070714_100341565 Ga0070714_1003415652 194
445 3300005436 Ga0070713_100078060 Ga0070713_1000780605 194
446 3300005437 Ga0070710_10159991 Ga0070710_101599912 194
447 3300005445 Ga0070708_100000356 Ga0070708_10000035615 194
448 3300005467 Ga0070706_100000514 Ga0070706_10000051415 194
449 3300005468 Ga0070707_100000662 Ga0070707_1000006627 194
450 3300005468 Ga0070707_100318818 Ga0070707_1003188181 194
451 3300005518 Ga0070699_100040038 Ga0070699_1000400387 194
452 3300005536 Ga0070697_100008091 Ga0070697_1000080917 194
453 3300006028 Ga0070717_10011095 Ga0070717_1001109510 194
454 3300006028 Ga0070717_10016092 Ga0070717_100160923 194
455 3300006028 Ga0070717_10323214 Ga0070717_103232142 194
456 3300006173 Ga0070716_100004160 Ga0070716_1000041603 194
457 3300006175 Ga0070712_100026733 Ga0070712_1000267334 194
458 3300006852 Ga0075433_10169475 Ga0075433_101694751 194
459 3300006914 Ga0075436_100000510 Ga0075436_10000051024 194
460 3300007076 Ga0075435_100143992 Ga0075435_1001439924 194
461 3300013307 Ga0157372_10098312 Ga0157372_100983125 194
462 3300025898 Ga0207692_10016155 Ga0207692_100161556 194
463 3300025910 Ga0207684_10000614 Ga0207684_1000061443 194
464 3300025915 Ga0207693_10031599 Ga0207693_100315996 194
465 3300025922 Ga0207646_10004899 Ga0207646_100048997 194
466 3300025922 Ga0207646_10099345 Ga0207646_100993452 194
467 3300025928 Ga0207700_10037540 Ga0207700_100375403 194
468 3300025939 Ga0207665_10001798 Ga0207665_1000179811 194
469 3300028016 Ga0265354_1006270 Ga0265354_10062701 194
470 3300035089 Ga0373944_0036201 Ga0373944_0036201_411_1043 194
471 3300035113 Ga0373936_0016372 Ga0373936_0016372_1942_2574 194
472 3300035113 Ga0373936_0116750 Ga0373936_0116750_417_1049 194
473 3300035116 Ga0373945_0079724 Ga0373945_0079724_508_1140 194
474 3300035171 Ga0373946_0117612 Ga0373946_0117612_507_1139 194
475 3300035171 Ga0373946_0290107 Ga0373946_0290107_49_678 194
476 3300035692 Ga0373935_0008998 Ga0373935_0008998_4203_4835 194
477 3300035695 Ga0373927_0045440 Ga0373927_0045440_840_1472 194
478 3300035695 Ga0373927_0063842 Ga0373927_0063842_566_1195 194
479 3300035725 Ga0373947_0040269 Ga0373947_0040269_977_1609 194
480 3300037068 Ga0373925_0010801 Ga0373925_0010801_4369_4998 194
481 3300037068 Ga0373925_0012340 Ga0373925_0012340_4482_5114 194
482 3300044684 Ga0466966_0267868 Ga0466966_0267868_374_997 194
483 3300046472 Ga0495580_0005972 Ga0495580_0005972_7864_8496 194
484 3300046472 Ga0495580_0023848 Ga0495580_0023848_1941_2567 194
485 3300046472 Ga0495580_0061984 Ga0495580_0061984_663_1289 194
486 3300046472 Ga0495580_0092371 Ga0495580_0092371_56_685 194
487 3300046473 Ga0495582_0005180 Ga0495582_0005180_5849_6481 194
488 3300046475 Ga0495639_0026063 Ga0495639_0026063_1454_2086 194
489 3300046531 Ga0495665_0000974 Ga0495665_0000974_7229_7861 194
490 3300046663 Ga0495635_0313971 Ga0495635_0313971_410_1039 194
491 3300046683 Ga0495658_0058830 Ga0495658_0058830_510_1142 194
492 3300047319 Ga0495674_0329763 Ga0495674_0329763_150_776 194
493 3300048089 Ga0495614_0126938 Ga0495614_0126938_361_987 194
494 3300048907 Ga0496104_0294219 Ga0496104_0294219_791_1423 194
495 3300048915 Ga0496112_0003360 Ga0496112_0003360_10284_10913 194
496 3300049571 Ga0501034_0238848 Ga0501034_0238848_719_1360 194
497 3300049742 Ga0501080_0186404 Ga0501080_0186404_761_1402 194
498 3300050514 nmdc:mga08x19_95920_c1 nmdc:mga08x19_95920_c1_606_1238 194
499 3300050515 nmdc:mga0a205_287176_c1 nmdc:mga0a205_287176_c1_455_1078 194
500 3300005614 Ga0068856_100005938 Ga0068856_10000593816 195
501 3300006852 Ga0075433_10212326 Ga0075433_102123264 195
502 3300009093 Ga0105240_10375212 Ga0105240_103752122 195
503 3300013307 Ga0157372_10044504 Ga0157372_100445042 195
504 3300026078 Ga0207702_10788157 Ga0207702_107881572 195
505 3300031711 Ga0265314_10084790 Ga0265314_100847902 195
506 3300005618 Ga0068864_100736143 Ga0068864_1007361431 196
507 3300005841 Ga0068863_101062493 Ga0068863_1010624931 196
508 3300006175 Ga0070712_100041417 Ga0070712_1000414172 196
509 3300013308 Ga0157375_10887317 Ga0157375_108873172 196
510 3300014325 Ga0163163_10227951 Ga0163163_102279513 196
511 3300025915 Ga0207693_10010928 Ga0207693_100109288 196
512 3300025916 Ga0207663_10082228 Ga0207663_100822282 196
513 3300025929 Ga0207664_10902541 Ga0207664_109025411 196
514 3300026088 Ga0207641_11048549 Ga0207641_110485491 196
515 3300026095 Ga0207676_10566243 Ga0207676_105662432 196
516 3300035117 Ga0373953_0074376 Ga0373953_0074376_436_1104 196
517 3300035410 Ga0373924_0204468 Ga0373924_0204468_173_841 196
518 3300036401 Ga0373937_0038004 Ga0373937_0038004_2487_3155 196
519 3300044693 Ga0466961_0203592 Ga0466961_0203592_509_1132 196
520 3300044694 Ga0466963_0020285 Ga0466963_0020285_84_707 196
521 3300044706 Ga0466964_0021515 Ga0466964_0021515_879_1502 196
522 3300045049 Ga0466959_0038701 Ga0466959_0038701_1553_2176 196
523 3300045836 Ga0466958_0070120 Ga0466958_0070120_314_937 196
524 3300045976 Ga0466967_0200269 Ga0466967_0200269_440_1063 196
525 3300046455 Ga0495603_0332897 Ga0495603_0332897_23_694 196
526 3300046459 Ga0495629_0467911 Ga0495629_0467911_43_714 196
527 3300046463 Ga0495653_0308398 Ga0495653_0308398_272_940 196
528 3300046472 Ga0495580_0171853 Ga0495580_0171853_16_687 196
529 3300046473 Ga0495582_0100948 Ga0495582_0100948_441_1112 196
530 3300046511 Ga0495608_0061373 Ga0495608_0061373_1105_1773 196
531 3300046559 Ga0495667_0005206 Ga0495667_0005206_1238_1906 196
532 3300046663 Ga0495635_0076863 Ga0495635_0076863_525_1193 196
533 3300046675 Ga0495657_0010611 Ga0495657_0010611_2778_3446 196
534 3300046681 Ga0495647_0037668 Ga0495647_0037668_228_899 196
535 3300047471 Ga0495684_0311111 Ga0495684_0311111_301_972 196
536 3300053085 Ga0495619_0139568 Ga0495619_0139568_569_1237 196
537 3300006028 Ga0070717_10811465 Ga0070717_108114651 197
538 3300013307 Ga0157372_10549179 Ga0157372_105491793 197
539 3300014325 Ga0163163_10556824 Ga0163163_105568242 197
540 3300014969 Ga0157376_10091716 Ga0157376_100917161 197
541 3300046472 Ga0495580_0261389 Ga0495580_0261389_242_865 197
542 3300005344 Ga0070661_100265313 Ga0070661_1002653131 198
543 3300005435 Ga0070714_100357250 Ga0070714_1003572502 198
544 3300005458 Ga0070681_10048939 Ga0070681_100489396 198
545 3300005563 Ga0068855_100644621 Ga0068855_1006446211 198
546 3300005614 Ga0068856_100005788 Ga0068856_10000578817 198
547 3300006173 Ga0070716_100401927 Ga0070716_1004019272 198
548 3300006175 Ga0070712_100541554 Ga0070712_1005415542 198
549 3300009093 Ga0105240_10414243 Ga0105240_104142431 198
550 3300009174 Ga0105241_10193390 Ga0105241_101933902 198
551 3300013100 Ga0157373_10001852 Ga0157373_1000185216 198
552 3300013105 Ga0157369_10015406 Ga0157369_100154061 198
553 3300013296 Ga0157374_10051381 Ga0157374_100513816 198
554 3300025911 Ga0207654_10004384 Ga0207654_1000438411 198
555 3300025913 Ga0207695_10337283 Ga0207695_103372831 198
556 3300025949 Ga0207667_10417790 Ga0207667_104177901 198
557 3300026078 Ga0207702_10015006 Ga0207702_100150066 198
558 3300031852 Ga0307410_10151445 Ga0307410_101514452 198
559 3300031995 Ga0307409_100153797 Ga0307409_1001537972 198
560 3300032002 Ga0307416_100028546 Ga0307416_1000285466 198
561 3300032005 Ga0307411_10123813 Ga0307411_101238133 198
562 3300032126 Ga0307415_100197190 Ga0307415_1001971902 198
563 3300032126 Ga0307415_100294502 Ga0307415_1002945023 198
564 3300035691 Ga0373931_0036963 Ga0373931_0036963_1884_2513 198
565 3300048907 Ga0496104_0045605 Ga0496104_0045605_3092_3697 198
566 3300048915 Ga0496112_0010121 Ga0496112_0010121_3925_4530 198
567 3300005436 Ga0070713_100220111 Ga0070713_1002201113 199
568 3300005456 Ga0070678_100296916 Ga0070678_1002969161 199
569 3300006852 Ga0075433_10004383 Ga0075433_1000438310 199
570 3300006871 Ga0075434_100000230 Ga0075434_10000023015 199
571 3300006914 Ga0075436_100029891 Ga0075436_1000298917 199
572 3300007076 Ga0075435_100000389 Ga0075435_10000038915 199
573 3300025915 Ga0207693_10145995 Ga0207693_101459951 199
574 3300025933 Ga0207706_10160402 Ga0207706_101604024 199
575 3300031731 Ga0307405_10074291 Ga0307405_100742912 199
576 3300042876 Ga0451577_0181937 Ga0451577_0181937_1058_1705 199
577 3300044712 Ga0453684_0377372 Ga0453684_0377372_495_1142 199
578 3300045051 Ga0451576_0079386 Ga0451576_0079386_1373_2020 199
579 3300050512 nmdc:mga0n895_344_c1 nmdc:mga0n895_344_c1_4156_4779 199
580 3300050513 nmdc:mga0rr50_872_c1 nmdc:mga0rr50_872_c1_8922_9545 199
581 3300050514 nmdc:mga08x19_3391_c1 nmdc:mga08x19_3391_c1_437_1060 199
582 3300050515 nmdc:mga0a205_7367_c1 nmdc:mga0a205_7367_c1_6703_7326 199
583 3300035692 Ga0373935_0101228 Ga0373935_0101228_137_754 200
584 3300039450 Ga0436363_0628682 Ga0436363_0628682_912_1544 200
585 3300039453 Ga0436362_0984659 Ga0436362_0984659_114_737 200
586 3300046459 Ga0495629_0038029 Ga0495629_0038029_1589_2260 200
587 3300046476 Ga0495662_0037715 Ga0495662_0037715_902_1573 200
588 3300046535 Ga0495586_0031648 Ga0495586_0031648_284_955 200
589 3300046683 Ga0495658_0454314 Ga0495658_0454314_65_736 200
590 3300046689 Ga0495613_0011311 Ga0495613_0011311_2465_3136 200
591 3300047319 Ga0495674_0017348 Ga0495674_0017348_5498_6169 200
592 3300005434 Ga0070709_10030261 Ga0070709_100302616 201
593 3300005436 Ga0070713_100003189 Ga0070713_10000318915 201
594 3300005437 Ga0070710_10035496 Ga0070710_100354962 201
595 3300005439 Ga0070711_100001361 Ga0070711_10000136110 201
596 3300005547 Ga0070693_100154942 Ga0070693_1001549422 201
597 3300006028 Ga0070717_10038572 Ga0070717_100385725 201
598 3300006173 Ga0070716_100002371 Ga0070716_10000237110 201
599 3300006175 Ga0070712_100003121 Ga0070712_10000312115 201
600 3300024225 Ga0224572_1008452 Ga0224572_10084522 201
601 3300025898 Ga0207692_10022746 Ga0207692_100227464 201
602 3300025905 Ga0207685_10114299 Ga0207685_101142991 201
603 3300025915 Ga0207693_10001260 Ga0207693_1000126021 201
604 3300025916 Ga0207663_10009591 Ga0207663_100095919 201
605 3300025928 Ga0207700_10004917 Ga0207700_100049176 201
606 3300025928 Ga0207700_10136466 Ga0207700_101364663 201
607 3300025939 Ga0207665_10002747 Ga0207665_1000274711 201
608 3300028666 Ga0265336_10071061 Ga0265336_100710611 201
609 3300028800 Ga0265338_10177573 Ga0265338_101775731 201
610 3300028800 Ga0265338_10187382 Ga0265338_101873822 201
611 3300028800 Ga0265338_10491826 Ga0265338_104918261 201
612 3300030760 Ga0265762_1073797 Ga0265762_10737971 201
613 3300031241 Ga0265325_10023495 Ga0265325_100234954 201
614 3300031241 Ga0265325_10060205 Ga0265325_100602051 201
615 3300031249 Ga0265339_10019630 Ga0265339_100196305 201
616 3300031250 Ga0265331_10066103 Ga0265331_100661034 201
617 3300031711 Ga0265314_10013145 Ga0265314_100131459 201
618 3300031712 Ga0265342_10008579 Ga0265342_100085797 201
619 3300031731 Ga0307405_10017376 Ga0307405_100173767 201
620 3300031824 Ga0307413_10340626 Ga0307413_103406261 201
621 3300031852 Ga0307410_10009896 Ga0307410_100098965 201
622 3300031995 Ga0307409_100015644 Ga0307409_1000156441 201
623 3300032002 Ga0307416_100645819 Ga0307416_1006458192 201
624 3300032005 Ga0307411_10179471 Ga0307411_101794713 201
625 3300032126 Ga0307415_100011074 Ga0307415_1000110742 201
626 3300035086 Ga0373934_0092690 Ga0373934_0092690_508_1125 201
627 3300035116 Ga0373945_0031816 Ga0373945_0031816_1230_1847 201
628 3300035410 Ga0373924_0025321 Ga0373924_0025321_451_1068 201
629 3300035692 Ga0373935_0097966 Ga0373935_0097966_471_1088 201
630 3300035695 Ga0373927_0063047 Ga0373927_0063047_1452_2069 201
631 3300035724 Ga0373933_0045505 Ga0373933_0045505_470_1087 201
632 3300035725 Ga0373947_0050791 Ga0373947_0050791_537_1154 201
633 3300037068 Ga0373925_0234377 Ga0373925_0234377_516_1133 201
634 3300044842 Ga0466957_0183167 Ga0466957_0183167_322_1011 201
635 3300046472 Ga0495580_0001845 Ga0495580_0001845_10559_11176 201
636 3300046473 Ga0495582_0004179 Ga0495582_0004179_3846_4463 201
637 3300046477 Ga0495664_0216411 Ga0495664_0216411_15_632 201
638 3300046517 Ga0495630_0147073 Ga0495630_0147073_1101_1718 201
639 3300046531 Ga0495665_0097095 Ga0495665_0097095_369_986 201
640 3300046683 Ga0495658_0057732 Ga0495658_0057732_274_891 201
641 3300047319 Ga0495674_0102394 Ga0495674_0102394_775_1392 201
642 3300047321 Ga0495676_0092680 Ga0495676_0092680_275_892 201
643 3300048907 Ga0496104_0182133 Ga0496104_0182133_1055_1672 201
644 3300048918 Ga0496115_0147877 Ga0496115_0147877_1277_1894 201
645 3300049759 Ga0501262_020972 Ga0501262_020972_13_696 201
646 3300053077 Ga0495601_0047993 Ga0495601_0047993_941_1558 201
647 3300005435 Ga0070714_100000096 Ga0070714_10000009669 202
648 3300005435 Ga0070714_100495294 Ga0070714_1004952942 202
649 3300005439 Ga0070711_100014481 Ga0070711_1000144814 202
650 3300005439 Ga0070711_100369828 Ga0070711_1003698282 202
651 3300005445 Ga0070708_100036854 Ga0070708_1000368542 202
652 3300005467 Ga0070706_100076041 Ga0070706_1000760413 202
653 3300005468 Ga0070707_100474050 Ga0070707_1004740502 202
654 3300005518 Ga0070699_100321008 Ga0070699_1003210081 202
655 3300006028 Ga0070717_10100016 Ga0070717_101000165 202
656 3300006028 Ga0070717_10169776 Ga0070717_101697763 202
657 3300006028 Ga0070717_10468550 Ga0070717_104685502 202
658 3300006173 Ga0070716_100109217 Ga0070716_1001092173 202
659 3300007788 Ga0099795_10017664 Ga0099795_100176643 202
660 3300010159 Ga0099796_10108234 Ga0099796_101082342 202
661 3300019188 Ga0184599_114597 Ga0184599_1145978 202
662 3300022730 Ga0224570_100075 Ga0224570_1000753 202
663 3300024225 Ga0224572_1013004 Ga0224572_10130043 202
664 3300024225 Ga0224572_1022921 Ga0224572_10229211 202
665 3300024227 Ga0228598_1007358 Ga0228598_10073585 202
666 3300025910 Ga0207684_10100158 Ga0207684_101001581 202
667 3300025916 Ga0207663_10010349 Ga0207663_100103497 202
668 3300025922 Ga0207646_10271182 Ga0207646_102711823 202
669 3300025929 Ga0207664_10000087 Ga0207664_1000008778 202
670 3300025929 Ga0207664_10431424 Ga0207664_104314242 202
671 3300025939 Ga0207665_10161782 Ga0207665_101617823 202
672 3300028017 Ga0265356_1000279 Ga0265356_100027914 202
673 3300028800 Ga0265338_10002857 Ga0265338_1000285715 202
674 3300028800 Ga0265338_10163360 Ga0265338_101633602 202
675 3300030760 Ga0265762_1000677 Ga0265762_10006775 202
676 3300031090 Ga0265760_10000694 Ga0265760_100006947 202
677 3300031090 Ga0265760_10062066 Ga0265760_100620661 202
678 3300031235 Ga0265330_10006073 Ga0265330_100060736 202
679 3300032120 Ga0316053_100087 Ga0316053_1000874 202
680 3300033547 Ga0316212_1006537 Ga0316212_10065373 202
681 3300035083 Ga0373926_0015455 Ga0373926_0015455_1952_2572 202
682 3300035111 Ga0373923_0009501 Ga0373923_0009501_1967_2587 202
683 3300035111 Ga0373923_0293849 Ga0373923_0293849_102_722 202
684 3300035113 Ga0373936_0002329 Ga0373936_0002329_2767_3387 202
685 3300035116 Ga0373945_0012830 Ga0373945_0012830_913_1533 202
686 3300035120 Ga0373957_0058851 Ga0373957_0058851_742_1362 202
687 3300035170 Ga0373943_0000086 Ga0373943_0000086_617_1237 202
688 3300035410 Ga0373924_0010177 Ga0373924_0010177_1074_1694 202
689 3300035410 Ga0373924_0262937 Ga0373924_0262937_128_748 202
690 3300035692 Ga0373935_0011881 Ga0373935_0011881_481_1101 202
691 3300035692 Ga0373935_0175676 Ga0373935_0175676_366_986 202
692 3300035724 Ga0373933_0007220 Ga0373933_0007220_752_1372 202
693 3300035724 Ga0373933_0390012 Ga0373933_0390012_83_703 202
694 3300035725 Ga0373947_0004951 Ga0373947_0004951_3272_3892 202
695 3300036401 Ga0373937_0229401 Ga0373937_0229401_136_756 202
696 3300036401 Ga0373937_0342483 Ga0373937_0342483_547_1167 202
697 3300036401 Ga0373937_0398035 Ga0373937_0398035_645_1265 202
698 3300046517 Ga0495630_0055452 Ga0495630_0055452_454_1074 202
699 3300046517 Ga0495630_0073982 Ga0495630_0073982_545_1165 202
700 3300046533 Ga0495640_0086402 Ga0495640_0086402_28_648 202
701 3300046535 Ga0495586_0248925 Ga0495586_0248925_282_902 202
702 3300046690 Ga0495624_0101200 Ga0495624_0101200_984_1604 202
703 3300046690 Ga0495624_0425499 Ga0495624_0425499_97_717 202
704 3300047319 Ga0495674_0073854 Ga0495674_0073854_1010_1630 202
705 3300047471 Ga0495684_0163430 Ga0495684_0163430_186_806 202
706 3300048088 Ga0495602_0596302 Ga0495602_0596302_106_726 202
707 3300005338 Ga0068868_100248963 Ga0068868_1002489632 203
708 3300005344 Ga0070661_100151381 Ga0070661_1001513813 203
709 3300005434 Ga0070709_10001304 Ga0070709_100013048 203
710 3300005434 Ga0070709_10030364 Ga0070709_100303644 203
711 3300005434 Ga0070709_10053609 Ga0070709_100536092 203
712 3300005434 Ga0070709_10238073 Ga0070709_102380732 203
713 3300005436 Ga0070713_100004545 Ga0070713_1000045452 203
714 3300005436 Ga0070713_100103869 Ga0070713_1001038693 203
715 3300005439 Ga0070711_100011497 Ga0070711_1000114979 203
716 3300005439 Ga0070711_100470897 Ga0070711_1004708972 203
717 3300005445 Ga0070708_100003510 Ga0070708_1000035109 203
718 3300005445 Ga0070708_100024232 Ga0070708_1000242327 203
719 3300005458 Ga0070681_10033193 Ga0070681_100331937 203
720 3300005458 Ga0070681_10168689 Ga0070681_101686894 203
721 3300005467 Ga0070706_100014580 Ga0070706_1000145807 203
722 3300005468 Ga0070707_100005126 Ga0070707_1000051269 203
723 3300005468 Ga0070707_100040946 Ga0070707_1000409463 203
724 3300005471 Ga0070698_100002449 Ga0070698_10000244915 203
725 3300005518 Ga0070699_100000441 Ga0070699_10000044110 203
726 3300005518 Ga0070699_100013805 Ga0070699_1000138053 203
727 3300005530 Ga0070679_100644851 Ga0070679_1006448512 203
728 3300005535 Ga0070684_100891523 Ga0070684_1008915231 203
729 3300005536 Ga0070697_100001451 Ga0070697_10000145119 203
730 3300005536 Ga0070697_100005121 Ga0070697_10000512114 203
731 3300005548 Ga0070665_100637333 Ga0070665_1006373332 203
732 3300005614 Ga0068856_100014911 Ga0068856_10001491110 203
733 3300005614 Ga0068856_100245813 Ga0068856_1002458132 203
734 3300005614 Ga0068856_100388304 Ga0068856_1003883042 203
735 3300005841 Ga0068863_100020461 Ga0068863_10002046110 203
736 3300006028 Ga0070717_10200011 Ga0070717_102000113 203
737 3300006028 Ga0070717_10277900 Ga0070717_102779003 203
738 3300006028 Ga0070717_10354964 Ga0070717_103549642 203
739 3300006028 Ga0070717_10540690 Ga0070717_105406901 203
740 3300006163 Ga0070715_10387717 Ga0070715_103877171 203
741 3300006173 Ga0070716_100008488 Ga0070716_1000084884 203
742 3300006173 Ga0070716_100011992 Ga0070716_1000119926 203
743 3300006173 Ga0070716_100175834 Ga0070716_1001758343 203
744 3300006175 Ga0070712_100001135 Ga0070712_10000113519 203
745 3300006175 Ga0070712_100086068 Ga0070712_1000860685 203
746 3300006175 Ga0070712_100100963 Ga0070712_1001009631 203
747 3300006237 Ga0097621_100369486 Ga0097621_1003694862 203
748 3300006237 Ga0097621_100371706 Ga0097621_1003717062 203
749 3300006358 Ga0068871_100016771 Ga0068871_1000167717 203
750 3300009093 Ga0105240_10374848 Ga0105240_103748482 203
751 3300009093 Ga0105240_10459536 Ga0105240_104595362 203
752 3300009098 Ga0105245_10195389 Ga0105245_101953893 203
753 3300009101 Ga0105247_10048806 Ga0105247_100488063 203
754 3300009174 Ga0105241_10169458 Ga0105241_101694582 203
755 3300009177 Ga0105248_11102617 Ga0105248_111026171 203
756 3300009545 Ga0105237_10686317 Ga0105237_106863171 203
757 3300013296 Ga0157374_10041968 Ga0157374_100419681 203
758 3300013297 Ga0157378_10010748 Ga0157378_1001074810 203
759 3300013306 Ga0163162_10008327 Ga0163162_100083275 203
760 3300013307 Ga0157372_10175031 Ga0157372_101750312 203
761 3300014325 Ga0163163_10121904 Ga0163163_101219043 203
762 3300014968 Ga0157379_10147388 Ga0157379_101473881 203
763 3300017792 Ga0163161_11024364 Ga0163161_110243641 203
764 3300025906 Ga0207699_10001057 Ga0207699_100010578 203
765 3300025906 Ga0207699_10058686 Ga0207699_100586861 203
766 3300025906 Ga0207699_10205665 Ga0207699_102056652 203
767 3300025910 Ga0207684_10001048 Ga0207684_1000104813 203
768 3300025911 Ga0207654_10366741 Ga0207654_103667411 203
769 3300025912 Ga0207707_10266517 Ga0207707_102665172 203
770 3300025915 Ga0207693_10000026 Ga0207693_1000002679 203
771 3300025915 Ga0207693_10004232 Ga0207693_1000423214 203
772 3300025915 Ga0207693_10024361 Ga0207693_100243615 203
773 3300025915 Ga0207693_10593817 Ga0207693_105938171 203
774 3300025916 Ga0207663_10003762 Ga0207663_100037629 203
775 3300025922 Ga0207646_10001230 Ga0207646_1000123015 203
776 3300025922 Ga0207646_10035586 Ga0207646_100355863 203
777 3300025924 Ga0207694_10624129 Ga0207694_106241291 203
778 3300025927 Ga0207687_10163010 Ga0207687_101630102 203
779 3300025928 Ga0207700_10085030 Ga0207700_100850301 203
780 3300025928 Ga0207700_11007362 Ga0207700_110073621 203
781 3300025939 Ga0207665_10029458 Ga0207665_100294583 203
782 3300025939 Ga0207665_10047169 Ga0207665_100471696 203
783 3300025939 Ga0207665_10132565 Ga0207665_101325654 203
784 3300025939 Ga0207665_10161747 Ga0207665_101617471 203
785 3300025949 Ga0207667_10170748 Ga0207667_101707483 203
786 3300026023 Ga0207677_10362653 Ga0207677_103626531 203
787 3300026078 Ga0207702_10003851 Ga0207702_1000385110 203
788 3300026078 Ga0207702_10288039 Ga0207702_102880392 203
789 3300026078 Ga0207702_10378624 Ga0207702_103786243 203
790 3300026088 Ga0207641_10023752 Ga0207641_100237522 203
791 3300035410 Ga0373924_0169987 Ga0373924_0169987_223_846 203
792 3300035695 Ga0373927_0552897 Ga0373927_0552897_49_675 203
793 3300035725 Ga0373947_0499021 Ga0373947_0499021_28_651 203
794 3300036401 Ga0373937_0561672 Ga0373937_0561672_90_710 203
795 3300037068 Ga0373925_0077587 Ga0373925_0077587_18_635 203
796 3300037418 Ga0395900_0823478 Ga0395900_0823478_72_695 203
797 3300044694 Ga0466963_0108792 Ga0466963_0108792_290_919 203
798 3300044842 Ga0466957_0133223 Ga0466957_0133223_110_739 203
799 3300046455 Ga0495603_0084135 Ga0495603_0084135_333_953 203
800 3300046472 Ga0495580_0005545 Ga0495580_0005545_8684_9301 203
801 3300046472 Ga0495580_0006027 Ga0495580_0006027_4005_4628 203
802 3300046472 Ga0495580_0072549 Ga0495580_0072549_951_1571 203
803 3300046533 Ga0495640_0143771 Ga0495640_0143771_24_644 203
804 3300046559 Ga0495667_0514000 Ga0495667_0514000_97_717 203
805 3300046663 Ga0495635_0387125 Ga0495635_0387125_147_767 203
806 3300046664 Ga0495659_0079620 Ga0495659_0079620_48_668 203
807 3300046674 Ga0495588_0215146 Ga0495588_0215146_189_806 203
808 3300046681 Ga0495647_0113103 Ga0495647_0113103_502_1125 203
809 3300048904 Ga0496101_0171006 Ga0496101_0171006_554_1174 203
810 3300048905 Ga0496102_0382548 Ga0496102_0382548_607_1227 203
811 3300048907 Ga0496104_0189057 Ga0496104_0189057_856_1476 203
812 3300048908 Ga0496105_0059685 Ga0496105_0059685_322_942 203
813 3300048909 Ga0496106_0510540 Ga0496106_0510540_46_666 203
814 3300048910 Ga0496107_0448561 Ga0496107_0448561_251_871 203
815 3300048911 Ga0496108_0101714 Ga0496108_0101714_462_1082 203
816 3300048912 Ga0496109_1301944 Ga0496109_1301944_25_645 203
817 3300048915 Ga0496112_0074996 Ga0496112_0074996_202_822 203
818 3300048915 Ga0496112_0489665 Ga0496112_0489665_198_821 203
819 3300048917 Ga0496114_0015090 Ga0496114_0015090_5160_5780 203
820 3300048918 Ga0496115_0082823 Ga0496115_0082823_251_871 203
821 3300048918 Ga0496115_0173065 Ga0496115_0173065_599_1222 203
822 3300053077 Ga0495601_0135402 Ga0495601_0135402_156_776 203
823 3300004798 Ga0058859_11567801 Ga0058859_115678011 204
824 3300005290 Ga0065712_10007779 Ga0065712_100077794 204
825 3300005293 Ga0065715_10278486 Ga0065715_102784862 204
826 3300005328 Ga0070676_10072855 Ga0070676_100728553 204
827 3300005330 Ga0070690_100022065 Ga0070690_1000220656 204
828 3300005333 Ga0070677_10269511 Ga0070677_102695111 204
829 3300005334 Ga0068869_100001846 Ga0068869_10000184618 204
830 3300005334 Ga0068869_100014372 Ga0068869_1000143728 204
831 3300005335 Ga0070666_10010107 Ga0070666_100101071 204
832 3300005337 Ga0070682_100015238 Ga0070682_1000152383 204
833 3300005338 Ga0068868_100018109 Ga0068868_1000181096 204
834 3300005339 Ga0070660_100013792 Ga0070660_1000137922 204
835 3300005341 Ga0070691_10027650 Ga0070691_100276503 204
836 3300005344 Ga0070661_100370991 Ga0070661_1003709912 204
837 3300005347 Ga0070668_100232473 Ga0070668_1002324732 204
838 3300005356 Ga0070674_100053133 Ga0070674_1000531334 204
839 3300005365 Ga0070688_100237831 Ga0070688_1002378312 204
840 3300005366 Ga0070659_100200318 Ga0070659_1002003181 204
841 3300005367 Ga0070667_100292350 Ga0070667_1002923502 204
842 3300005434 Ga0070709_10060970 Ga0070709_100609704 204
843 3300005434 Ga0070709_10286619 Ga0070709_102866192 204
844 3300005435 Ga0070714_100388424 Ga0070714_1003884241 204
845 3300005436 Ga0070713_100096048 Ga0070713_1000960481 204
846 3300005436 Ga0070713_100289077 Ga0070713_1002890771 204
847 3300005437 Ga0070710_10007025 Ga0070710_100070254 204
848 3300005439 Ga0070711_100000191 Ga0070711_10000019128 204
849 3300005439 Ga0070711_100307946 Ga0070711_1003079462 204
850 3300005445 Ga0070708_100005470 Ga0070708_10000547014 204
851 3300005445 Ga0070708_100164174 Ga0070708_1001641744 204
852 3300005445 Ga0070708_100304336 Ga0070708_1003043362 204
853 3300005455 Ga0070663_100031257 Ga0070663_1000312576 204
854 3300005457 Ga0070662_100005784 Ga0070662_10000578410 204
855 3300005459 Ga0068867_100052488 Ga0068867_1000524882 204
856 3300005466 Ga0070685_10059975 Ga0070685_100599754 204
857 3300005466 Ga0070685_10127213 Ga0070685_101272133 204
858 3300005467 Ga0070706_100000278 Ga0070706_10000027815 204
859 3300005468 Ga0070707_100113490 Ga0070707_1001134903 204
860 3300005471 Ga0070698_100507868 Ga0070698_1005078681 204
861 3300005518 Ga0070699_100071504 Ga0070699_1000715042 204
862 3300005530 Ga0070679_100298600 Ga0070679_1002986002 204
863 3300005535 Ga0070684_100015104 Ga0070684_1000151046 204
864 3300005536 Ga0070697_100000993 Ga0070697_10000099320 204
865 3300005536 Ga0070697_100445202 Ga0070697_1004452022 204
866 3300005539 Ga0068853_100158771 Ga0068853_1001587714 204
867 3300005544 Ga0070686_100036509 Ga0070686_1000365095 204
868 3300005544 Ga0070686_100107346 Ga0070686_1001073461 204
869 3300005545 Ga0070695_100203574 Ga0070695_1002035742 204
870 3300005546 Ga0070696_100108905 Ga0070696_1001089051 204
871 3300005548 Ga0070665_100086273 Ga0070665_1000862737 204
872 3300005564 Ga0070664_100057624 Ga0070664_1000576244 204
873 3300005577 Ga0068857_100171142 Ga0068857_1001711422 204
874 3300005614 Ga0068856_100224332 Ga0068856_1002243321 204
875 3300005615 Ga0070702_100571212 Ga0070702_1005712121 204
876 3300005616 Ga0068852_100051789 Ga0068852_1000517892 204
877 3300005617 Ga0068859_100010649 Ga0068859_10001064910 204
878 3300005617 Ga0068859_100025042 Ga0068859_1000250424 204
879 3300005618 Ga0068864_100248185 Ga0068864_1002481851 204
880 3300005718 Ga0068866_10099015 Ga0068866_100990153 204
881 3300005842 Ga0068858_100011628 Ga0068858_1000116283 204
882 3300005842 Ga0068858_100059426 Ga0068858_1000594267 204
883 3300005843 Ga0068860_100018016 Ga0068860_10001801612 204
884 3300005843 Ga0068860_100220571 Ga0068860_1002205713 204
885 3300006028 Ga0070717_10006770 Ga0070717_100067703 204
886 3300006175 Ga0070712_100002103 Ga0070712_1000021038 204
887 3300006237 Ga0097621_100211017 Ga0097621_1002110173 204
888 3300006237 Ga0097621_100776403 Ga0097621_1007764031 204
889 3300006358 Ga0068871_100082335 Ga0068871_1000823351 204
890 3300006358 Ga0068871_100825683 Ga0068871_1008256832 204
891 3300006881 Ga0068865_100051635 Ga0068865_1000516353 204
892 3300006931 Ga0097620_100010649 Ga0097620_10001064910 204
893 3300006931 Ga0097620_100025042 Ga0097620_1000250424 204
894 3300007265 Ga0099794_10196239 Ga0099794_101962392 204
895 3300009093 Ga0105240_10101266 Ga0105240_101012664 204
896 3300009101 Ga0105247_10315739 Ga0105247_103157392 204
897 3300009174 Ga0105241_10043666 Ga0105241_100436662 204
898 3300009176 Ga0105242_10268480 Ga0105242_102684802 204
899 3300009177 Ga0105248_10146565 Ga0105248_101465651 204
900 3300009545 Ga0105237_10065790 Ga0105237_100657902 204
901 3300009551 Ga0105238_10019367 Ga0105238_100193677 204
902 3300009553 Ga0105249_10067050 Ga0105249_100670506 204
903 3300010159 Ga0099796_10033840 Ga0099796_100338402 204
904 3300010375 Ga0105239_10091452 Ga0105239_100914525 204
905 3300010375 Ga0105239_10508857 Ga0105239_105088571 204
906 3300013102 Ga0157371_10014695 Ga0157371_100146953 204
907 3300013104 Ga0157370_10747602 Ga0157370_107476021 204
908 3300013105 Ga0157369_10024569 Ga0157369_1002456913 204
909 3300013105 Ga0157369_10043759 Ga0157369_100437597 204
910 3300013296 Ga0157374_10012759 Ga0157374_100127599 204
911 3300013306 Ga0163162_10069694 Ga0163162_100696947 204
912 3300013306 Ga0163162_10073001 Ga0163162_100730012 204
913 3300013307 Ga0157372_10212800 Ga0157372_102128005 204
914 3300014325 Ga0163163_10137549 Ga0163163_101375493 204
915 3300014968 Ga0157379_10004402 Ga0157379_1000440213 204
916 3300014968 Ga0157379_10088209 Ga0157379_100882093 204
917 3300014969 Ga0157376_10114376 Ga0157376_101143764 204
918 3300014969 Ga0157376_10203430 Ga0157376_102034304 204
919 3300025321 Ga0207656_10121061 Ga0207656_101210611 204
920 3300025898 Ga0207692_10016902 Ga0207692_100169024 204
921 3300025900 Ga0207710_10100710 Ga0207710_101007102 204
922 3300025901 Ga0207688_10095550 Ga0207688_100955502 204
923 3300025903 Ga0207680_10010187 Ga0207680_100101878 204
924 3300025904 Ga0207647_10010629 Ga0207647_100106297 204
925 3300025906 Ga0207699_10034176 Ga0207699_100341761 204
926 3300025906 Ga0207699_10243258 Ga0207699_102432581 204
927 3300025907 Ga0207645_10380991 Ga0207645_103809911 204
928 3300025910 Ga0207684_10003017 Ga0207684_1000301717 204
929 3300025911 Ga0207654_10209827 Ga0207654_102098271 204
930 3300025912 Ga0207707_10015255 Ga0207707_100152556 204
931 3300025913 Ga0207695_10007039 Ga0207695_1000703920 204
932 3300025914 Ga0207671_10047140 Ga0207671_100471405 204
933 3300025914 Ga0207671_10166467 Ga0207671_101664671 204
934 3300025915 Ga0207693_10000922 Ga0207693_1000092230 204
935 3300025915 Ga0207693_10205304 Ga0207693_102053042 204
936 3300025916 Ga0207663_10002471 Ga0207663_100024713 204
937 3300025917 Ga0207660_10339532 Ga0207660_103395321 204
938 3300025919 Ga0207657_10006426 Ga0207657_1000642611 204
939 3300025920 Ga0207649_10045098 Ga0207649_100450983 204
940 3300025923 Ga0207681_10228624 Ga0207681_102286241 204
941 3300025924 Ga0207694_10063949 Ga0207694_100639494 204
942 3300025927 Ga0207687_10042103 Ga0207687_100421031 204
943 3300025928 Ga0207700_10255874 Ga0207700_102558741 204
944 3300025928 Ga0207700_10374034 Ga0207700_103740341 204
945 3300025928 Ga0207700_10400758 Ga0207700_104007581 204
946 3300025929 Ga0207664_10854851 Ga0207664_108548511 204
947 3300025932 Ga0207690_10710865 Ga0207690_107108651 204
948 3300025933 Ga0207706_10005096 Ga0207706_1000509615 204
949 3300025938 Ga0207704_10038213 Ga0207704_100382132 204
950 3300025939 Ga0207665_10064712 Ga0207665_100647123 204
951 3300025941 Ga0207711_10013154 Ga0207711_100131541 204
952 3300025941 Ga0207711_10109439 Ga0207711_101094395 204
953 3300025942 Ga0207689_10075543 Ga0207689_100755431 204
954 3300025945 Ga0207679_10721935 Ga0207679_107219351 204
955 3300025949 Ga0207667_10245178 Ga0207667_102451781 204
956 3300025949 Ga0207667_10627187 Ga0207667_106271871 204
957 3300025961 Ga0207712_10026658 Ga0207712_100266587 204
958 3300025972 Ga0207668_10022020 Ga0207668_100220201 204
959 3300025981 Ga0207640_10150496 Ga0207640_101504962 204
960 3300025986 Ga0207658_10051397 Ga0207658_100513975 204
961 3300026035 Ga0207703_10003490 Ga0207703_1000349011 204
962 3300026035 Ga0207703_10284931 Ga0207703_102849313 204
963 3300026041 Ga0207639_10108868 Ga0207639_101088682 204
964 3300026041 Ga0207639_11180001 Ga0207639_111800011 204
965 3300026067 Ga0207678_10001612 Ga0207678_100016122 204
966 3300026089 Ga0207648_10046214 Ga0207648_100462147 204
967 3300026116 Ga0207674_10018522 Ga0207674_100185221 204
968 3300026142 Ga0207698_10181348 Ga0207698_101813483 204
969 3300026142 Ga0207698_10554861 Ga0207698_105548611 204
970 3300028036 Ga0265355_1001396 Ga0265355_10013962 204
971 3300028379 Ga0268266_10049418 Ga0268266_100494181 204
972 3300028380 Ga0268265_10170582 Ga0268265_101705821 204
973 3300028381 Ga0268264_10143337 Ga0268264_101433371 204
974 3300030760 Ga0265762_1001564 Ga0265762_10015645 204
975 3300030760 Ga0265762_1004618 Ga0265762_10046182 204
976 3300030760 Ga0265762_1004830 Ga0265762_10048303 204
977 3300031090 Ga0265760_10008145 Ga0265760_100081456 204
978 3300031344 Ga0265316_10017308 Ga0265316_1001730812 204
979 3300031711 Ga0265314_10003075 Ga0265314_1000307513 204
980 3300034816 Ga0373930_0068756 Ga0373930_0068756_45_668 204
981 3300035085 Ga0373929_0010305 Ga0373929_0010305_989_1612 204
982 3300035090 Ga0373949_0030352 Ga0373949_0030352_15_638 204
983 3300035114 Ga0373939_0117597 Ga0373939_0117597_115_738 204
984 3300035115 Ga0373941_0022587 Ga0373941_0022587_1020_1643 204
985 3300035207 Ga0373942_0008131 Ga0373942_0008131_958_1581 204
986 3300035691 Ga0373931_0050834 Ga0373931_0050834_1243_1866 204
987 3300035691 Ga0373931_0167149 Ga0373931_0167149_85_708 204
988 3300035691 Ga0373931_0175225 Ga0373931_0175225_89_712 204
989 3300035695 Ga0373927_0075671 Ga0373927_0075671_463_1089 204
990 3300035695 Ga0373927_0127025 Ga0373927_0127025_466_1089 204
991 3300036457 Ga0265778_000084 Ga0265778_000084_2549_3178 204
992 3300037068 Ga0373925_0052704 Ga0373925_0052704_298_924 204
993 3300046472 Ga0495580_0069818 Ga0495580_0069818_784_1410 204
994 3300046473 Ga0495582_0133871 Ga0495582_0133871_244_870 204
995 3300046679 Ga0495623_0076747 Ga0495623_0076747_652_1275 204
996 3300048906 Ga0496103_0306049 Ga0496103_0306049_285_908 204
997 3300048907 Ga0496104_0055994 Ga0496104_0055994_1488_2111 204
998 3300048907 Ga0496104_0206189 Ga0496104_0206189_878_1501 204
999 3300048909 Ga0496106_0370341 Ga0496106_0370341_137_760 204
1000 3300048910 Ga0496107_0080779 Ga0496107_0080779_960_1583 204
1001 3300048912 Ga0496109_0318675 Ga0496109_0318675_610_1233 204
1002 3300048913 Ga0496110_0174308 Ga0496110_0174308_969_1592 204
1003 3300048915 Ga0496112_0023010 Ga0496112_0023010_3389_4012 204
1004 3300048915 Ga0496112_0403082 Ga0496112_0403082_441_1064 204
1005 3300048916 Ga0496113_0090255 Ga0496113_0090255_834_1457 204
1006 3300050513 nmdc:mga0rr50_654810_c1 nmdc:mga0rr50_654810_c1_260_883 204
1007 3300050514 nmdc:mga08x19_160854_c1 nmdc:mga08x19_160854_c1_234_857 204
1008 2162886012 MBSR1b_contig_11325966 MBSR1b_0303.00004430 205
1009 3300001976 JGI24752J21851_1000484 JGI24752J21851_10004847 205
1010 3300001978 JGI24747J21853_1000395 JGI24747J21853_10003953 205
1011 3300001978 JGI24747J21853_1000762 JGI24747J21853_10007624 205
1012 3300001990 JGI24737J22298_10016993 JGI24737J22298_100169933 205
1013 3300002070 JGI24750J21931_1036188 JGI24750J21931_10361881 205
1014 3300002074 JGI24748J21848_1001357 JGI24748J21848_10013572 205
1015 3300002239 JGI24034J26672_10001629 JGI24034J26672_100016293 205
1016 3300002459 JGI24751J29686_10001356 JGI24751J29686_100013565 205
1017 3300004803 Ga0058862_12823060 Ga0058862_128230603 205
1018 3300005289 Ga0065704_10150289 Ga0065704_101502893 205
1019 3300005293 Ga0065715_10095964 Ga0065715_100959646 205
1020 3300005295 Ga0065707_10193324 Ga0065707_101933242 205
1021 3300005327 Ga0070658_10113543 Ga0070658_101135433 205
1022 3300005328 Ga0070676_10009197 Ga0070676_100091977 205
1023 3300005329 Ga0070683_100011087 Ga0070683_1000110879 205
1024 3300005329 Ga0070683_100053730 Ga0070683_1000537304 205
1025 3300005330 Ga0070690_100000550 Ga0070690_10000055015 205
1026 3300005331 Ga0070670_100015559 Ga0070670_1000155599 205
1027 3300005331 Ga0070670_100033183 Ga0070670_1000331834 205
1028 3300005333 Ga0070677_10021297 Ga0070677_100212972 205
1029 3300005335 Ga0070666_10010510 Ga0070666_100105109 205
1030 3300005336 Ga0070680_100188040 Ga0070680_1001880404 205
1031 3300005337 Ga0070682_100060415 Ga0070682_1000604152 205
1032 3300005338 Ga0068868_100012462 Ga0068868_1000124629 205
1033 3300005338 Ga0068868_100013462 Ga0068868_1000134621 205
1034 3300005338 Ga0068868_100051789 Ga0068868_1000517892 205
1035 3300005338 Ga0068868_100081453 Ga0068868_1000814531 205
1036 3300005339 Ga0070660_100006039 Ga0070660_10000603912 205
1037 3300005344 Ga0070661_100092200 Ga0070661_1000922003 205
1038 3300005345 Ga0070692_10098229 Ga0070692_100982292 205
1039 3300005347 Ga0070668_100006844 Ga0070668_10000684415 205
1040 3300005353 Ga0070669_100007500 Ga0070669_10000750012 205
1041 3300005354 Ga0070675_100004817 Ga0070675_1000048173 205
1042 3300005355 Ga0070671_100096110 Ga0070671_1000961103 205
1043 3300005356 Ga0070674_100005528 Ga0070674_1000055286 205
1044 3300005365 Ga0070688_100048827 Ga0070688_1000488273 205
1045 3300005366 Ga0070659_100023105 Ga0070659_1000231054 205
1046 3300005434 Ga0070709_10055745 Ga0070709_100557451 205
1047 3300005434 Ga0070709_10465504 Ga0070709_104655042 205
1048 3300005435 Ga0070714_100010335 Ga0070714_1000103357 205
1049 3300005435 Ga0070714_100092468 Ga0070714_1000924685 205
1050 3300005435 Ga0070714_100140298 Ga0070714_1001402982 205
1051 3300005435 Ga0070714_100439603 Ga0070714_1004396032 205
1052 3300005435 Ga0070714_100930375 Ga0070714_1009303751 205
1053 3300005436 Ga0070713_100015219 Ga0070713_1000152198 205
1054 3300005436 Ga0070713_100017965 Ga0070713_1000179656 205
1055 3300005436 Ga0070713_100072194 Ga0070713_1000721944 205
1056 3300005436 Ga0070713_100095999 Ga0070713_1000959993 205
1057 3300005436 Ga0070713_100148392 Ga0070713_1001483922 205
1058 3300005436 Ga0070713_100800449 Ga0070713_1008004492 205
1059 3300005437 Ga0070710_10075725 Ga0070710_100757253 205
1060 3300005437 Ga0070710_10200110 Ga0070710_102001101 205
1061 3300005438 Ga0070701_10057060 Ga0070701_100570605 205
1062 3300005439 Ga0070711_100142308 Ga0070711_1001423083 205
1063 3300005439 Ga0070711_100268773 Ga0070711_1002687732 205
1064 3300005439 Ga0070711_100419793 Ga0070711_1004197932 205
1065 3300005445 Ga0070708_100003542 Ga0070708_10000354210 205
1066 3300005455 Ga0070663_100012382 Ga0070663_1000123829 205
1067 3300005455 Ga0070663_100383589 Ga0070663_1003835891 205
1068 3300005456 Ga0070678_100056347 Ga0070678_1000563473 205
1069 3300005457 Ga0070662_100018068 Ga0070662_1000180688 205
1070 3300005458 Ga0070681_10004001 Ga0070681_1000400115 205
1071 3300005459 Ga0068867_100007176 Ga0068867_1000071764 205
1072 3300005459 Ga0068867_100152499 Ga0068867_1001524992 205
1073 3300005466 Ga0070685_10009457 Ga0070685_100094574 205
1074 3300005467 Ga0070706_100115364 Ga0070706_1001153642 205
1075 3300005530 Ga0070679_100135498 Ga0070679_1001354985 205
1076 3300005530 Ga0070679_100376336 Ga0070679_1003763362 205
1077 3300005530 Ga0070679_100592171 Ga0070679_1005921711 205
1078 3300005530 Ga0070679_101052599 Ga0070679_1010525991 205
1079 3300005535 Ga0070684_100001423 Ga0070684_1000014233 205
1080 3300005536 Ga0070697_100081875 Ga0070697_1000818754 205
1081 3300005536 Ga0070697_100087566 Ga0070697_1000875662 205
1082 3300005539 Ga0068853_100008308 Ga0068853_1000083083 205
1083 3300005539 Ga0068853_100477114 Ga0068853_1004771142 205
1084 3300005543 Ga0070672_100040143 Ga0070672_1000401433 205
1085 3300005547 Ga0070693_100047613 Ga0070693_1000476133 205
1086 3300005563 Ga0068855_100005681 Ga0068855_1000056819 205
1087 3300005563 Ga0068855_100020061 Ga0068855_10002006115 205
1088 3300005564 Ga0070664_100045861 Ga0070664_1000458612 205
1089 3300005564 Ga0070664_100054311 Ga0070664_1000543114 205
1090 3300005577 Ga0068857_100001133 Ga0068857_1000011337 205
1091 3300005577 Ga0068857_100051265 Ga0068857_1000512655 205
1092 3300005578 Ga0068854_100065777 Ga0068854_1000657773 205
1093 3300005614 Ga0068856_100004687 Ga0068856_10000468710 205
1094 3300005614 Ga0068856_100046667 Ga0068856_1000466676 205
1095 3300005614 Ga0068856_100087365 Ga0068856_1000873656 205
1096 3300005616 Ga0068852_100001223 Ga0068852_10000122317 205
1097 3300005616 Ga0068852_100154743 Ga0068852_1001547432 205
1098 3300005618 Ga0068864_100098522 Ga0068864_1000985224 205
1099 3300005618 Ga0068864_100125973 Ga0068864_1001259733 205
1100 3300005718 Ga0068866_10002246 Ga0068866_100022464 205
1101 3300005719 Ga0068861_100006422 Ga0068861_10000642211 205
1102 3300005834 Ga0068851_10001352 Ga0068851_1000135216 205
1103 3300005840 Ga0068870_10008477 Ga0068870_100084778 205
1104 3300005841 Ga0068863_100093282 Ga0068863_1000932822 205
1105 3300005842 Ga0068858_100351075 Ga0068858_1003510752 205
1106 3300005843 Ga0068860_100110176 Ga0068860_1001101763 205
1107 3300005843 Ga0068860_100160986 Ga0068860_1001609862 205
1108 3300006028 Ga0070717_10002614 Ga0070717_100026146 205
1109 3300006028 Ga0070717_10145282 Ga0070717_101452823 205
1110 3300006163 Ga0070715_10055410 Ga0070715_100554101 205
1111 3300006173 Ga0070716_100005022 Ga0070716_1000050227 205
1112 3300006173 Ga0070716_100209778 Ga0070716_1002097782 205
1113 3300006175 Ga0070712_100014016 Ga0070712_1000140164 205
1114 3300006175 Ga0070712_100274186 Ga0070712_1002741862 205
1115 3300006175 Ga0070712_100738822 Ga0070712_1007388221 205
1116 3300006175 Ga0070712_100828512 Ga0070712_1008285122 205
1117 3300006237 Ga0097621_100003981 Ga0097621_10000398110 205
1118 3300006237 Ga0097621_100004769 Ga0097621_1000047695 205
1119 3300006237 Ga0097621_100088363 Ga0097621_1000883633 205
1120 3300006237 Ga0097621_100451474 Ga0097621_1004514741 205
1121 3300006358 Ga0068871_100002434 Ga0068871_10000243410 205
1122 3300006358 Ga0068871_100025434 Ga0068871_1000254346 205
1123 3300006881 Ga0068865_100004898 Ga0068865_10000489815 205
1124 3300009092 Ga0105250_10058196 Ga0105250_100581961 205
1125 3300009093 Ga0105240_10035504 Ga0105240_1003550410 205
1126 3300009093 Ga0105240_10053543 Ga0105240_100535433 205
1127 3300009093 Ga0105240_10178722 Ga0105240_101787224 205
1128 3300009093 Ga0105240_10211363 Ga0105240_102113635 205
1129 3300009093 Ga0105240_10402706 Ga0105240_104027062 205
1130 3300009098 Ga0105245_10005029 Ga0105245_1000502916 205
1131 3300009098 Ga0105245_10052071 Ga0105245_100520713 205
1132 3300009101 Ga0105247_10006156 Ga0105247_1000615613 205
1133 3300009174 Ga0105241_10057747 Ga0105241_100577473 205
1134 3300009176 Ga0105242_10086432 Ga0105242_100864326 205
1135 3300009177 Ga0105248_10019482 Ga0105248_100194828 205
1136 3300009177 Ga0105248_10038960 Ga0105248_100389607 205
1137 3300009545 Ga0105237_10325100 Ga0105237_103251002 205
1138 3300009545 Ga0105237_10768186 Ga0105237_107681862 205
1139 3300009551 Ga0105238_10010449 Ga0105238_100104499 205
1140 3300009553 Ga0105249_10025713 Ga0105249_100257135 205
1141 3300010375 Ga0105239_10048572 Ga0105239_100485724 205
1142 3300011119 Ga0105246_10002877 Ga0105246_100028777 205
1143 3300013100 Ga0157373_10001758 Ga0157373_1000175815 205
1144 3300013102 Ga0157371_10002134 Ga0157371_1000213418 205
1145 3300013102 Ga0157371_10064436 Ga0157371_100644361 205
1146 3300013104 Ga0157370_10534189 Ga0157370_105341892 205
1147 3300013105 Ga0157369_10007208 Ga0157369_1000720810 205
1148 3300013105 Ga0157369_10026263 Ga0157369_1002626310 205
1149 3300013105 Ga0157369_10147068 Ga0157369_101470683 205
1150 3300013105 Ga0157369_10249242 Ga0157369_102492422 205
1151 3300013296 Ga0157374_10002644 Ga0157374_1000264410 205
1152 3300013296 Ga0157374_10029721 Ga0157374_100297212 205
1153 3300013296 Ga0157374_10110444 Ga0157374_101104443 205
1154 3300013297 Ga0157378_10010602 Ga0157378_100106027 205
1155 3300013297 Ga0157378_10013971 Ga0157378_100139714 205
1156 3300013297 Ga0157378_10039105 Ga0157378_100391053 205
1157 3300013306 Ga0163162_10015114 Ga0163162_100151147 205
1158 3300013306 Ga0163162_10216485 Ga0163162_102164851 205
1159 3300013307 Ga0157372_10002154 Ga0157372_1000215419 205
1160 3300013307 Ga0157372_10003780 Ga0157372_1000378013 205
1161 3300013307 Ga0157372_10006080 Ga0157372_1000608010 205
1162 3300013307 Ga0157372_10009005 Ga0157372_1000900515 205
1163 3300013307 Ga0157372_10053770 Ga0157372_100537702 205
1164 3300013307 Ga0157372_10362203 Ga0157372_103622033 205
1165 3300013308 Ga0157375_10303793 Ga0157375_103037932 205
1166 3300014325 Ga0163163_10001073 Ga0163163_1000107315 205
1167 3300014325 Ga0163163_10079257 Ga0163163_100792575 205
1168 3300014326 Ga0157380_10404357 Ga0157380_104043572 205
1169 3300014745 Ga0157377_10000768 Ga0157377_1000076812 205
1170 3300014968 Ga0157379_10005366 Ga0157379_100053667 205
1171 3300014969 Ga0157376_10007676 Ga0157376_100076766 205
1172 3300014969 Ga0157376_10013365 Ga0157376_100133657 205
1173 3300014969 Ga0157376_10075865 Ga0157376_100758655 205
1174 3300014969 Ga0157376_10338380 Ga0157376_103383801 205
1175 3300015262 Ga0182007_10019430 Ga0182007_100194302 205
1176 3300017792 Ga0163161_10001969 Ga0163161_1000196915 205
1177 3300024225 Ga0224572_1003107 Ga0224572_10031074 205
1178 3300024227 Ga0228598_1000213 Ga0228598_10002133 205
1179 3300025315 Ga0207697_10014009 Ga0207697_100140092 205
1180 3300025321 Ga0207656_10031911 Ga0207656_100319111 205
1181 3300025893 Ga0207682_10055544 Ga0207682_100555441 205
1182 3300025898 Ga0207692_10193896 Ga0207692_101938961 205
1183 3300025899 Ga0207642_10006053 Ga0207642_100060533 205
1184 3300025900 Ga0207710_10053659 Ga0207710_100536592 205
1185 3300025901 Ga0207688_10002923 Ga0207688_1000292315 205
1186 3300025903 Ga0207680_10001756 Ga0207680_100017566 205
1187 3300025904 Ga0207647_10001343 Ga0207647_100013439 205
1188 3300025905 Ga0207685_10003422 Ga0207685_100034228 205
1189 3300025906 Ga0207699_10070796 Ga0207699_100707963 205
1190 3300025906 Ga0207699_10319026 Ga0207699_103190261 205
1191 3300025907 Ga0207645_10001180 Ga0207645_1000118020 205
1192 3300025908 Ga0207643_10001067 Ga0207643_1000106716 205
1193 3300025909 Ga0207705_10172360 Ga0207705_101723603 205
1194 3300025912 Ga0207707_10003207 Ga0207707_1000320717 205
1195 3300025913 Ga0207695_10075177 Ga0207695_100751776 205
1196 3300025913 Ga0207695_10103382 Ga0207695_101033825 205
1197 3300025913 Ga0207695_10150276 Ga0207695_101502762 205
1198 3300025913 Ga0207695_10198657 Ga0207695_101986573 205
1199 3300025913 Ga0207695_10340761 Ga0207695_103407613 205
1200 3300025915 Ga0207693_10022595 Ga0207693_100225959 205
1201 3300025915 Ga0207693_10115876 Ga0207693_101158762 205
1202 3300025915 Ga0207693_10259317 Ga0207693_102593172 205
1203 3300025916 Ga0207663_10200306 Ga0207663_102003061 205
1204 3300025917 Ga0207660_10105591 Ga0207660_101055912 205
1205 3300025918 Ga0207662_10170949 Ga0207662_101709492 205
1206 3300025919 Ga0207657_10004069 Ga0207657_1000406915 205
1207 3300025920 Ga0207649_10001087 Ga0207649_1000108715 205
1208 3300025920 Ga0207649_10168412 Ga0207649_101684121 205
1209 3300025921 Ga0207652_10394062 Ga0207652_103940622 205
1210 3300025921 Ga0207652_10507206 Ga0207652_105072062 205
1211 3300025922 Ga0207646_10130926 Ga0207646_101309263 205
1212 3300025922 Ga0207646_10131348 Ga0207646_101313481 205
1213 3300025923 Ga0207681_10009111 Ga0207681_100091113 205
1214 3300025924 Ga0207694_10000718 Ga0207694_1000071811 205
1215 3300025925 Ga0207650_10000152 Ga0207650_1000015265 205
1216 3300025925 Ga0207650_10029576 Ga0207650_100295767 205
1217 3300025926 Ga0207659_10003498 Ga0207659_100034985 205
1218 3300025927 Ga0207687_10010238 Ga0207687_100102389 205
1219 3300025928 Ga0207700_10014117 Ga0207700_100141178 205
1220 3300025928 Ga0207700_10065442 Ga0207700_100654426 205
1221 3300025928 Ga0207700_10089201 Ga0207700_100892013 205
1222 3300025928 Ga0207700_10096495 Ga0207700_100964952 205
1223 3300025929 Ga0207664_10066125 Ga0207664_100661252 205
1224 3300025929 Ga0207664_10214208 Ga0207664_102142082 205
1225 3300025929 Ga0207664_10261810 Ga0207664_102618103 205
1226 3300025929 Ga0207664_10400121 Ga0207664_104001212 205
1227 3300025929 Ga0207664_10562910 Ga0207664_105629102 205
1228 3300025931 Ga0207644_10003335 Ga0207644_100033357 205
1229 3300025931 Ga0207644_10091436 Ga0207644_100914364 205
1230 3300025932 Ga0207690_10007754 Ga0207690_100077549 205
1231 3300025933 Ga0207706_10000740 Ga0207706_1000074015 205
1232 3300025934 Ga0207686_10060923 Ga0207686_100609232 205
1233 3300025936 Ga0207670_10003610 Ga0207670_100036108 205
1234 3300025937 Ga0207669_10019910 Ga0207669_100199104 205
1235 3300025938 Ga0207704_10157540 Ga0207704_101575403 205
1236 3300025939 Ga0207665_10003202 Ga0207665_1000320215 205
1237 3300025939 Ga0207665_10069492 Ga0207665_100694922 205
1238 3300025939 Ga0207665_10176634 Ga0207665_101766341 205
1239 3300025940 Ga0207691_10000308 Ga0207691_1000030840 205
1240 3300025941 Ga0207711_10003068 Ga0207711_1000306816 205
1241 3300025941 Ga0207711_10028516 Ga0207711_100285161 205
1242 3300025942 Ga0207689_10000618 Ga0207689_1000061815 205
1243 3300025944 Ga0207661_10005431 Ga0207661_1000543115 205
1244 3300025944 Ga0207661_10193239 Ga0207661_101932394 205
1245 3300025945 Ga0207679_10000298 Ga0207679_1000029815 205
1246 3300025945 Ga0207679_10373068 Ga0207679_103730683 205
1247 3300025949 Ga0207667_10003757 Ga0207667_1000375710 205
1248 3300025949 Ga0207667_10012686 Ga0207667_100126866 205
1249 3300025949 Ga0207667_10055132 Ga0207667_100551323 205
1250 3300025960 Ga0207651_10003558 Ga0207651_100035587 205
1251 3300025961 Ga0207712_10050229 Ga0207712_100502291 205
1252 3300025972 Ga0207668_10003732 Ga0207668_1000373215 205
1253 3300025981 Ga0207640_10024440 Ga0207640_100244404 205
1254 3300025986 Ga0207658_10003391 Ga0207658_1000339116 205
1255 3300026023 Ga0207677_10006103 Ga0207677_1000610312 205
1256 3300026023 Ga0207677_10007921 Ga0207677_100079213 205
1257 3300026023 Ga0207677_10035230 Ga0207677_100352301 205
1258 3300026035 Ga0207703_10007555 Ga0207703_1000755511 205
1259 3300026035 Ga0207703_10207926 Ga0207703_102079263 205
1260 3300026035 Ga0207703_10261314 Ga0207703_102613142 205
1261 3300026041 Ga0207639_10003445 Ga0207639_1000344515 205
1262 3300026041 Ga0207639_10111302 Ga0207639_101113025 205
1263 3300026067 Ga0207678_10003018 Ga0207678_1000301815 205
1264 3300026078 Ga0207702_10000089 Ga0207702_1000008995 205
1265 3300026078 Ga0207702_10001884 Ga0207702_1000188421 205
1266 3300026078 Ga0207702_10096326 Ga0207702_100963262 205
1267 3300026088 Ga0207641_10000052 Ga0207641_1000005215 205
1268 3300026089 Ga0207648_10003962 Ga0207648_1000396215 205
1269 3300026089 Ga0207648_10182551 Ga0207648_101825513 205
1270 3300026095 Ga0207676_10000176 Ga0207676_1000017646 205
1271 3300026095 Ga0207676_10041621 Ga0207676_100416212 205
1272 3300026116 Ga0207674_10000561 Ga0207674_1000056140 205
1273 3300026116 Ga0207674_10027883 Ga0207674_100278839 205
1274 3300026118 Ga0207675_100005443 Ga0207675_10000544317 205
1275 3300026121 Ga0207683_10001978 Ga0207683_1000197818 205
1276 3300026121 Ga0207683_10393610 Ga0207683_103936102 205
1277 3300026142 Ga0207698_10091285 Ga0207698_100912854 205
1278 3300028379 Ga0268266_10001266 Ga0268266_1000126632 205
1279 3300028380 Ga0268265_10008088 Ga0268265_100080882 205
1280 3300028381 Ga0268264_10005269 Ga0268264_100052697 205
1281 3300028381 Ga0268264_10096016 Ga0268264_100960162 205
1282 3300028381 Ga0268264_10105174 Ga0268264_101051746 205
1283 3300035086 Ga0373934_0099462 Ga0373934_0099462_30_656 205
1284 3300035111 Ga0373923_0270804 Ga0373923_0270804_111_755 205
1285 3300035113 Ga0373936_0026016 Ga0373936_0026016_768_1397 205
1286 3300035170 Ga0373943_0073222 Ga0373943_0073222_107_736 205
1287 3300035171 Ga0373946_0150761 Ga0373946_0150761_226_855 205
1288 3300035691 Ga0373931_0016212 Ga0373931_0016212_1512_2138 205
1289 3300035691 Ga0373931_0136968 Ga0373931_0136968_405_1031 205
1290 3300035692 Ga0373935_0030527 Ga0373935_0030527_2346_2990 205
1291 3300035695 Ga0373927_0113650 Ga0373927_0113650_881_1504 205
1292 3300035724 Ga0373933_0173925 Ga0373933_0173925_613_1239 205
1293 3300035725 Ga0373947_0020057 Ga0373947_0020057_1534_2163 205
1294 3300036401 Ga0373937_0212850 Ga0373937_0212850_313_951 205
1295 3300036401 Ga0373937_0490195 Ga0373937_0490195_331_957 205
1296 3300037068 Ga0373925_0053657 Ga0373925_0053657_516_1145 205
1297 3300037853 Ga0436364_0274090 Ga0436364_0274090_197_820 205
1298 3300039437 Ga0436365_0473506 Ga0436365_0473506_1018_1641 205
1299 3300045836 Ga0466958_0673017 Ga0466958_0673017_22_651 205
1300 3300045976 Ga0466967_0635933 Ga0466967_0635933_362_985 205
1301 3300046462 Ga0495651_0142835 Ga0495651_0142835_576_1202 205
1302 3300046472 Ga0495580_0015039 Ga0495580_0015039_4825_5451 205
1303 3300046472 Ga0495580_0019875 Ga0495580_0019875_3644_4285 205
1304 3300046472 Ga0495580_0075926 Ga0495580_0075926_1592_2218 205
1305 3300046472 Ga0495580_0232317 Ga0495580_0232317_521_1150 205
1306 3300046472 Ga0495580_0288472 Ga0495580_0288472_344_967 205
1307 3300046472 Ga0495580_0306376 Ga0495580_0306376_75_707 205
1308 3300047444 Ga0495675_0190047 Ga0495675_0190047_618_1244 205
1309 3300048088 Ga0495602_0233538 Ga0495602_0233538_433_1077 205
1310 3300048088 Ga0495602_0332606 Ga0495602_0332606_124_750 205
1311 3300048903 Ga0496100_0034832 Ga0496100_0034832_941_1558 205
1312 3300048905 Ga0496102_0024941 Ga0496102_0024941_2528_3145 205
1313 3300048905 Ga0496102_0055166 Ga0496102_0055166_1085_1714 205
1314 3300048905 Ga0496102_0076516 Ga0496102_0076516_1569_2195 205
1315 3300048907 Ga0496104_0038623 Ga0496104_0038623_777_1403 205
1316 3300048909 Ga0496106_0030822 Ga0496106_0030822_2290_2907 205
1317 3300048910 Ga0496107_0051715 Ga0496107_0051715_434_1051 205
1318 3300048910 Ga0496107_0264002 Ga0496107_0264002_623_1255 205
1319 3300048911 Ga0496108_0000242 Ga0496108_0000242_7019_7636 205
1320 3300048911 Ga0496108_0218452 Ga0496108_0218452_507_1133 205
1321 3300048912 Ga0496109_0000120 Ga0496109_0000120_5644_6261 205
1322 3300048912 Ga0496109_0120903 Ga0496109_0120903_243_869 205
1323 3300048913 Ga0496110_0000795 Ga0496110_0000795_6880_7497 205
1324 3300048913 Ga0496110_0368735 Ga0496110_0368735_74_706 205
1325 3300048915 Ga0496112_0000198 Ga0496112_0000198_30910_31527 205
1326 3300048915 Ga0496112_0006971 Ga0496112_0006971_2441_3067 205
1327 3300048916 Ga0496113_0000111 Ga0496113_0000111_27631_28248 205
1328 3300048917 Ga0496114_0239924 Ga0496114_0239924_933_1550 205
1329 3300048918 Ga0496115_0046543 Ga0496115_0046543_2250_2867 205
1330 3300048918 Ga0496115_0156001 Ga0496115_0156001_16_642 205
1331 3300049588 Ga0501072_0428026 Ga0501072_0428026_184_861 205
1332 3300049589 Ga0501073_0029956 Ga0501073_0029956_958_1602 205
1333 3300049593 Ga0501077_0045895 Ga0501077_0045895_1100_1744 205
1334 3300049744 Ga0501083_0373573 Ga0501083_0373573_214_843 205
1335 3300053078 Ga0495612_0044598 Ga0495612_0044598_220_846 205
1336 3300054114 Ga0501084_0032147 Ga0501084_0032147_2468_3112 205

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00281

Ribosomal_L5

Ribosomal protein L5

47

103

0.99

PF00673

Ribosomal_L5_C

ribosomal L5P family C-terminus

107

200

0.99

Structural Annotation

Top 5 Hits

ID Description Score Start End
5ns3-assembly1.cif.gz_B crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9731 30 204
5ns4-assembly1.cif.gz_A crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9712 30 204
5ns3-assembly1.cif.gz_A crystal structures of cy5 cyanine fluorophores stacked onto the end of double-stranded rna 0.9652 30 204
5ns4-assembly2.cif.gz_B crystal structures of cy3 cyanine fluorophores stacked onto the end of double-stranded rna 0.9642 30 204
8ceu-assembly1.cif.gz_f retapamulin and capreomycin bound to the 50s subunit 0.9641 30 203
ID Description Score Start End Superfamily
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.955 29 204 3.30.1440.10
4warF00 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9446 29 204 3.30.1440.10
af_P36519_120_288_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9302 52 203 3.30.1440.10
af_A0A1D8PHY2_119_286_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9231 50 205 3.30.1440.10
af_O14337_108_278_3.30.1440.10 Alpha Beta;2-Layer Sandwich;50s Ribosomal Protein L5; Chain: A,;Ribosomal protein L5 0.9177 48 203 3.30.1440.10
ID Description Score Start End GO Terms
AF-A0A7C7UBM4-F1-model_v4 50S ribosomal protein L5 0.989 28 150 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-W1XH22-F1-model_v4 50S ribosomal protein L5 0.9883 54 140 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3D1GU08-F1-model_v4 50S ribosomal protein L5 0.9866 26 132 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A3C1DEH0-F1-model_v4 50S ribosomal protein L5 0.9865 26 142 GO:0003735
GO:0005840
GO:0006412
GO:1990904
AF-A0A7V0PTD6-F1-model_v4 50S ribosomal protein L5 0.9862 28 128 GO:0003735
GO:0005840
GO:0006412
GO:1990904

Feature Viewer

pLDDT pTM Quality
74.22 0.7 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map