F493092

General Info

Members Datasets Scaffolds Average Seq Length
1333 452 1317 244

Family's Representative Sequence

Representative Sequence 3300025907|Ga0207645_10125706|Ga0207645_101257061
Length 275
Sequence MSPLLHVSNISKRFGGFVALDGIELEVQPGERVGLIGPNGSGKSTLVNCICGALQNEQGSVHFDGHAMDGLAAHERTHRGLARSFQLPRPFVSLNLADNLRVPMLYTVHKRSGPLHADSVDARCVELLRLVGLDQKARHMPRDLTQVEMRKLELARAVAAEPKLLIADESMAGLSHSEIEDILTLLKQLNERGITVILIEHIMSAVMSFSQRLVVLVSGKKIADGKPDDADIVAQRTERIDDRALIEAPVLHHGPAVRENRIVRMHHAFRLPCRA

Samples

Sample ID Description Type Environment
1 2838675328 Agrobacterium radiobacter SEMIA 410 Isolate Nodule
2 2838714209 Agrobacterium radiobacter SEMIA 435 Isolate Nodule
3 2838719591 Agrobacterium radiobacter SEMIA 436 Isolate Nodule
4 2838724970 Agrobacterium radiobacter SEMIA 437 Isolate Nodule
5 2841846520 Agrobacterium radiobacter SEMIA 440 Isolate Nodule
6 2842124991 Agrobacterium radiobacter SEMIA 434 Isolate Nodule
7 2842130223 Agrobacterium radiobacter SEMIA 441 Isolate Nodule
8 2842152218 Agrobacterium radiobacter SEMIA 457 Isolate Nodule
9 2842170452 Agrobacterium radiobacter SEMIA 461 Isolate Nodule
10 2842175837 Agrobacterium radiobacter SEMIA 462 Isolate Nodule
11 2842187318 Agrobacterium radiobacter SEMIA 464 Isolate Nodule
12 2842211629 Agrobacterium radiobacter SEMIA 472 Isolate Nodule
13 2842224351 Agrobacterium radiobacter SEMIA 480 Isolate Nodule
14 2919114240 Agrobacterium tumefaciens 1457 Isolate Rhizosphere
15 2926754445 Agrobacterium radiobacter SLBN-94 Isolate Rhizosphere
16 2933006813 Rhizobium sp. SEMIA 439 Isolate Unclassified
17 3300001430 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 Metagenome Rhizosphere
18 3300001915 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C7 Metagenome Rhizosphere
19 3300001977 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5 Metagenome Rhizosphere
20 3300001990 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3 Metagenome Rhizosphere
21 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
22 3300002070 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4 Metagenome Rhizosphere
23 3300002074 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S1 Metagenome Rhizosphere
24 3300002075 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4 Metagenome Rhizosphere
25 3300002076 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3 Metagenome Rhizosphere
26 3300002077 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3 Metagenome Rhizosphere
27 3300002126 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 Metagenome Rhizosphere
28 3300002155 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX- M7 Metagenome Rhizosphere
29 3300002244 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M1 Metagenome Rhizosphere
30 3300003203 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
31 3300003323 Sugarcane root Sample H1 Metagenome Unclassified
32 3300003373 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
33 3300003659 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
34 3300003911 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
35 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
36 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
37 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
38 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
39 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
40 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
41 3300005333 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG Metagenome Rhizosphere
42 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
43 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
44 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
45 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
46 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
47 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
48 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
49 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
50 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
51 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
52 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
53 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
54 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
55 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
56 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
57 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
58 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
59 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
60 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
61 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
62 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
63 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
64 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
65 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
66 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
67 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
68 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
69 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
70 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
71 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
72 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
73 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
74 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
75 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
76 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
77 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
78 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
79 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
80 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
81 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
82 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
83 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
84 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
85 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
86 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
87 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
88 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
89 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
90 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
91 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
92 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
93 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
94 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
95 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
96 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
97 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
98 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
99 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
100 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
101 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
102 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
103 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
104 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
105 3300005983 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S2T1R1 Metagenome Rhizosphere
106 3300005985 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S4T2R2 Metagenome Rhizosphere
107 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
108 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
109 3300006042 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 Metagenome Endosphere
110 3300006048 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-3 Metagenome Endosphere
111 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
112 3300006058 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 Metagenome Rhizosphere
113 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
114 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
115 3300006177 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 Metagenome Endosphere
116 3300006178 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-2 Metagenome Endosphere
117 3300006186 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-4 Metagenome Endosphere
118 3300006194 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 Metagenome Rhizosphere
119 3300006195 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 Metagenome Endosphere
120 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
121 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
122 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
123 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
124 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
125 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
126 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
127 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
128 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
129 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
130 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
131 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
132 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
133 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
134 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
135 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
136 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
137 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
138 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
139 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
140 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
141 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
142 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
143 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
144 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
145 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
146 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
147 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
148 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
149 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
150 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
151 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
152 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
153 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
154 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
155 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
156 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
157 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
158 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
159 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
160 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
161 3300021384 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 Metagenome Unclassified
162 3300021441 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 Metagenome Rhizosphere
163 3300024225 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU5 Metagenome Rhizosphere
164 3300024227 Spruce rhizosphere microbial communities from Bohemian Forest, Czech Republic - CZU4 Metagenome Rhizosphere
165 3300025271 Switchgrass rhizosphere bulk soil microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025290 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with spike-in - S5 (version 2) Metagenome Rhizosphere
167 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025885 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025905 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
197 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
198 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
199 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
202 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
203 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
204 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
205 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
207 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
210 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
211 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
212 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
215 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
216 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
217 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
218 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
219 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
220 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
221 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
222 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
223 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
224 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
225 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
226 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
227 3300027617 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M2 S AM (SPAdes) (version 2) Metagenome Rhizosphere
228 3300027695 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Rhizosphere soil Co-N PM (SPAdes) (version 2) Metagenome Rhizosphere
229 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
230 3300027866 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 (SPAdes) (version 2) Metagenome Endosphere
231 3300027876 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Inoculated plant M3 S PM (SPAdes) (version 2) Metagenome Rhizosphere
232 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
233 3300028023 Rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZE5 Metagenome Rhizosphere
234 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
235 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
236 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
237 3300028573 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-20-23 metaG Metagenome Rhizosphere
238 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
239 3300030763 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI5 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
240 3300031090 Metatranscriptome of rhizosphere microbial communities from Maridalen valley, Oslo, Norway - NZI1 (Metagenome Metatranscriptome) Metatranscriptome Rhizosphere
241 3300031235 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-19-19 metaG Metagenome Rhizosphere
242 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
243 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
244 3300031249 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-19 metaG Metagenome Rhizosphere
245 3300031456 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 15_EM Metagenome Unclassified
246 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
247 3300031711 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-26 metaG Metagenome Rhizosphere
248 3300031712 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB3-27 metaG Metagenome Rhizosphere
249 3300031730 Populus trichocarpa ectomycorrhiza microbial communities from riparian zone in the Pacific Northwest, United States - 19_EM Metagenome Unclassified
250 3300034816 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_3 Metagenome Rhizosphere
251 3300034820 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_2 Metagenome Rhizosphere
252 3300034957 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_2 Metagenome Rhizosphere
253 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
254 3300035085 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_2 Metagenome Rhizosphere
255 3300035086 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_4 Metagenome Rhizosphere
256 3300035088 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_4 Metagenome Rhizosphere
257 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
258 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
259 3300035092 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_11 Metagenome Rhizosphere
260 3300035111 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_11 Metagenome Rhizosphere
261 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
262 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
263 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
264 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
265 3300035118 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_2 Metagenome Rhizosphere
266 3300035119 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_4 Metagenome Rhizosphere
267 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
268 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
269 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
270 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
271 3300035242 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_11 Metagenome Rhizosphere
272 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
273 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
274 3300035692 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_11 Metagenome Rhizosphere
275 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
276 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
277 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
278 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
279 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
280 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
281 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
282 3300037588 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_160517rA Metagenome Rhizosphere
283 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
284 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
285 3300039438 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R1 v2 Metagenome Rhizosphere
286 3300039447 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R2 v2 Metagenome Rhizosphere
287 3300039450 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R7 v2 Metagenome Unclassified
288 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
289 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
290 3300042001 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512LE14Z081617_5542 Metagenome Rhizosphere
291 3300042003 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821FE14Z081617_5551 Metagenome Rhizosphere
292 3300042016 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0512FE14Z071817_5357 Metagenome Rhizosphere
293 3300042156 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0116WE14Z082817_5593 Metagenome Rhizosphere
294 3300042157 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0311LE14Z062817_5210 Metagenome Rhizosphere
295 3300042436 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z081617_5520 Metagenome Rhizosphere
296 3300042461 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612LE14Z071817_5366 Metagenome Rhizosphere
297 3300042532 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0126L_E14_070516_92 Metagenome Rhizosphere
298 3300042993 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0821LE14Z071817_5372 Metagenome Rhizosphere
299 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
300 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
301 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
302 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
303 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
304 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
305 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
306 3300046452 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-351-Co3_11_46 rhizosphere Metagenome Rhizosphere
307 3300046453 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-388-Co3_8_57 rhizosphere Metagenome Rhizosphere
308 3300046454 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL2_38_5 rhizosphere Metagenome Rhizosphere
309 3300046455 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL1_26_33 rhizosphere Metagenome Rhizosphere
310 3300046457 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co2_50_25 rhizosphere Metagenome Rhizosphere
311 3300046458 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co3_19_46 rhizosphere Metagenome Rhizosphere
312 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
313 3300046460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co3_31_37 rhizosphere Metagenome Rhizosphere
314 3300046461 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL3_80_19 rhizosphere Metagenome Rhizosphere
315 3300046462 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-86-CL2_69_17 rhizosphere Metagenome Rhizosphere
316 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
317 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
318 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
319 3300046474 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co1_31_6 rhizosphere Metagenome Rhizosphere
320 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
321 3300046476 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-905-CL1_32_20 rhizosphere Metagenome Rhizosphere
322 3300046477 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL1_23_5 rhizosphere Metagenome Rhizosphere
323 3300046491 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co2_41_23 rhizosphere Metagenome Rhizosphere
324 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
325 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
326 3300046501 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-307-Co3_27_41 rhizosphere Metagenome Rhizosphere
327 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
328 3300046514 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL2_44_14 rhizosphere Metagenome Rhizosphere
329 3300046516 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL1_35_3 rhizosphere Metagenome Rhizosphere
330 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
331 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
332 3300046520 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-833-Co2_47_23 rhizosphere Metagenome Rhizosphere
333 3300046525 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co1_23_6 rhizosphere Metagenome Rhizosphere
334 3300046526 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL1_25_23 rhizosphere Metagenome Rhizosphere
335 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
336 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
337 3300046533 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL2_37_16 rhizosphere Metagenome Rhizosphere
338 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
339 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
340 3300046537 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-234-Co3_21_62 rhizosphere Metagenome Rhizosphere
341 3300046539 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-360-Co3_13_34 rhizosphere Metagenome Rhizosphere
342 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
343 3300046557 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 rhizosphere Metagenome Rhizosphere
344 3300046558 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co3_6_53 rhizosphere Metagenome Rhizosphere
345 3300046559 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-4579-CL2_50_20 rhizosphere Metagenome Rhizosphere
346 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
347 3300046642 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL2_42_16 rhizosphere Metagenome Rhizosphere
348 3300046663 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-833-CL3_77_6 rhizosphere Metagenome Rhizosphere
349 3300046664 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co1_5_9 rhizosphere Metagenome Rhizosphere
350 3300046665 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-904-Co3_16_51 rhizosphere Metagenome Rhizosphere
351 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
352 3300046675 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL2_57_20 rhizosphere Metagenome Rhizosphere
353 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
354 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
355 3300046680 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL2_38_7 rhizosphere Metagenome Rhizosphere
356 3300046681 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL3_83_27 rhizosphere Metagenome Rhizosphere
357 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
358 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
359 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
360 3300046692 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 rhizosphere Metagenome Rhizosphere
361 3300046794 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-133-Co1_27_3 rhizosphere Metagenome Rhizosphere
362 3300046809 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL2_67_23 rhizosphere Metagenome Rhizosphere
363 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
364 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
365 3300047319 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL1_34_16 rhizosphere Metagenome Rhizosphere
366 3300047320 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 rhizosphere Metagenome Rhizosphere
367 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
368 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
369 3300047444 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL2_56_12 rhizosphere Metagenome Rhizosphere
370 3300047445 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co1_16_8 rhizosphere Metagenome Rhizosphere
371 3300047447 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWD-24-1-Co1_7_5 rhizosphere Metagenome Rhizosphere
372 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
373 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
374 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
375 3300048089 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL3_84_27 rhizosphere Metagenome Rhizosphere
376 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
377 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
378 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
379 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
380 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
381 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
382 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
383 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
384 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
385 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
386 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
387 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
388 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
389 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
390 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
391 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
392 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
393 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
394 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
395 3300049571 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_01 Metagenome Rhizosphere
396 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
397 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
398 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
399 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
400 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
401 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
402 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
403 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
404 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
405 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
406 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
407 3300049583 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_01 Metagenome Rhizosphere
408 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
409 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
410 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
411 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
412 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
413 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
414 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
415 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
416 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
417 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
418 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
419 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
420 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
421 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
422 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
423 3300049823 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_02 Metagenome Rhizosphere
424 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
425 3300050489 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-2 re-annotation Metagenome Endosphere
426 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
427 3300050493 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-1 re-annotation Metagenome Endosphere
428 3300050495 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-3 re-annotation Metagenome Endosphere
429 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
430 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
431 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
432 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
433 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
434 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
435 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
436 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
437 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
438 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
439 3300053078 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL1_27_10 rhizosphere Metagenome Rhizosphere
440 3300053083 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co2_58_19 rhizosphere Metagenome Rhizosphere
441 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
442 3300053085 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-360-CL3_72_12 rhizosphere Metagenome Rhizosphere
443 3300053088 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co1_37_5 endosphere Metagenome Endosphere
444 3300053093 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co2_62_24 endosphere Metagenome Endosphere
445 3300053094 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 endosphere Metagenome Endosphere
446 3300053119 Root microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL1_25_34 endosphere Metagenome Endosphere
447 3300053131 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-9591-Co3_35_48 endosphere Metagenome Endosphere
448 3300053153 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co2_60_28 endosphere Metagenome Endosphere
449 3300053730 Root microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-7986-Co2_68_28 endosphere Metagenome Endosphere
450 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
451 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
452 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 98.65
Metatranscriptomes 0.15
Isolates 1.2

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 2.85
Nodule 0.98
Rhizoplane 7.5
Rhizosphere 87.7
Stem 0
Stem Tuber 0
Unclassified 0.98

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 JGI24032J14994_100963 3300001430 Bacteria 1370
2 JGI24741J21665_1012966 3300001915 Bacteria 1421
3 JGI24746J21847_1024205 3300001977 Bacteria 842
4 JGI24737J22298_10000343 3300001990 Bacteria 15615
5 JGI24743J22301_10003444 3300001991 Bacteria 2503
6 JGI24750J21931_1002404 3300002070 Bacteria 2255
7 JGI24748J21848_1001218 3300002074 Bacteria 2812
8 JGI24738J21930_10000219 3300002075 Bacteria 15450
9 JGI24749J21850_1000319 3300002076 Bacteria 7363
10 JGI24744J21845_10004555 3300002077 Bacteria 2865
11 JGI24744J21845_10004689 3300002077 Bacteria 2824
12 JGI24035J26624_1000193 3300002126 Bacteria 5587
13 JGI24033J26618_1000254 3300002155 Bacteria 5930
14 JGI24742J22300_10000563 3300002244 Bacteria 5578
15 JGI24742J22300_10017014 3300002244 Bacteria 1228
16 JGI25406J46586_10007775 3300003203 Bacteria 4876
17 rootH1_10081664 3300003323 Bacteria 1601
18 JGI25407J50210_10029444 3300003373 Bacteria 1423
19 JGI25404J52841_10003386 3300003659 Bacteria 3147
20 JGI25405J52794_10003907 3300003911 Bacteria 2640
21 JGI25405J52794_10028521 3300003911 Bacteria 1153
22 Ga0065712_10025030 3300005290 Bacteria 2059
23 Ga0065715_10044697 3300005293 Bacteria 1041
24 Ga0065715_10049495 3300005293 Bacteria 1395
25 Ga0065715_10093306 3300005293 Bacteria 4729
26 Ga0070658_10301684 3300005327 Bacteria 1366
27 Ga0070683_100001967 3300005329 Bacteria 16094
28 Ga0070683_100074779 3300005329 Bacteria 3164
29 Ga0070683_100163838 3300005329 Bacteria 2109
30 Ga0070683_100284676 3300005329 Bacteria 1573
31 Ga0070690_100000854 3300005330 Bacteria 15470
32 Ga0070690_100111302 3300005330 Bacteria 1827
33 Ga0070670_100002178 3300005331 Bacteria 16098
34 Ga0070670_100007686 3300005331 Bacteria 9163
35 Ga0070670_100088865 3300005331 Bacteria 2656
36 Ga0070670_100091746 3300005331 Bacteria 2612
37 Ga0070670_100162184 3300005331 Bacteria 1938
38 Ga0070677_10000486 3300005333 Bacteria 13653
39 Ga0070666_10036756 3300005335 Bacteria 3253
40 Ga0070666_10185972 3300005335 Bacteria 1458
41 Ga0070666_10219793 3300005335 Bacteria 1340
42 Ga0070680_100006836 3300005336 Bacteria 8694
43 Ga0070680_100083682 3300005336 Bacteria 2635
44 Ga0070680_100127729 3300005336 Bacteria 2125
45 Ga0070680_100260841 3300005336 Bacteria 1466
46 Ga0070680_100272143 3300005336 Bacteria 1434
47 Ga0070682_100001998 3300005337 Bacteria 11377
48 Ga0070682_100108008 3300005337 Bacteria 1849
49 Ga0068868_100011568 3300005338 Bacteria 6427
50 Ga0068868_100091469 3300005338 Bacteria 2451
51 Ga0068868_100340113 3300005338 Bacteria 1283
52 Ga0070660_100001923 3300005339 Bacteria 14314
53 Ga0070689_100001902 3300005340 Bacteria 13496
54 Ga0070689_100002706 3300005340 Bacteria 11605
55 Ga0070689_100028076 3300005340 Bacteria 4250
56 Ga0070689_100074758 3300005340 Bacteria 2651
57 Ga0070687_100000334 3300005343 Bacteria 16027
58 Ga0070687_100157131 3300005343 Bacteria 1341
59 Ga0070687_100166370 3300005343 Bacteria 1308
60 Ga0070661_100033673 3300005344 Bacteria 3712
61 Ga0070661_100254527 3300005344 Bacteria 1356
62 Ga0070661_100323061 3300005344 Bacteria 1206
63 Ga0070692_10000022 3300005345 Bacteria 31371
64 Ga0070692_10287006 3300005345 Bacteria 1000
65 Ga0070668_100000947 3300005347 Bacteria 20237
66 Ga0070668_100151059 3300005347 Bacteria 1878
67 Ga0070668_100197024 3300005347 Bacteria 1652
68 Ga0070669_100009110 3300005353 Bacteria 7074
69 Ga0070669_100268686 3300005353 Bacteria 1363
70 Ga0070669_100341474 3300005353 Bacteria 1214
71 Ga0070675_100001735 3300005354 Bacteria 16095
72 Ga0070675_100058680 3300005354 Bacteria 3174
73 Ga0070675_100220808 3300005354 Bacteria 1650
74 Ga0070675_100553471 3300005354 Bacteria 1040
75 Ga0070671_100001490 3300005355 Bacteria 17502
76 Ga0070671_100034879 3300005355 Bacteria 4166
77 Ga0070671_100071257 3300005355 Bacteria 2901
78 Ga0070671_100079633 3300005355 Bacteria 2739
79 Ga0070671_100220122 3300005355 Bacteria 1610
80 Ga0070674_100196552 3300005356 Bacteria 1555
81 Ga0070674_100324377 3300005356 Bacteria 1236
82 Ga0070674_100331382 3300005356 Bacteria 1223
83 Ga0070674_100609455 3300005356 Bacteria 923
84 Ga0070673_100156083 3300005364 Bacteria 1937
85 Ga0070688_100000196 3300005365 Bacteria 32063
86 Ga0070688_100018218 3300005365 Bacteria 4047
87 Ga0070688_100458218 3300005365 Bacteria 954
88 Ga0070659_100001661 3300005366 Bacteria 15993
89 Ga0070659_100074146 3300005366 Bacteria 2710
90 Ga0070659_100258399 3300005366 Bacteria 1445
91 Ga0070667_100001157 3300005367 Bacteria 23956
92 Ga0070667_100014232 3300005367 Bacteria 6572
93 Ga0070667_100081667 3300005367 Bacteria 2766
94 Ga0070667_100231853 3300005367 Bacteria 1646
95 Ga0070709_10013778 3300005434 Bacteria 4555
96 Ga0070709_10016416 3300005434 Bacteria 4226
97 Ga0070709_10079636 3300005434 Bacteria 2134
98 Ga0070709_10080089 3300005434 Bacteria 2129
99 Ga0070709_10325790 3300005434 Bacteria 1129
100 Ga0070709_10453505 3300005434 Bacteria 966
101 Ga0070714_100065673 3300005435 Bacteria 3126
102 Ga0070714_100091577 3300005435 Bacteria 2664
103 Ga0070714_100125857 3300005435 Bacteria 2285
104 Ga0070714_100162151 3300005435 Bacteria 2023
105 Ga0070714_100311339 3300005435 Bacteria 1470
106 Ga0070713_100007912 3300005436 Bacteria 7504
107 Ga0070713_100075416 3300005436 Bacteria 2860
108 Ga0070713_100207680 3300005436 Bacteria 1771
109 Ga0070710_10009968 3300005437 Bacteria 4658
110 Ga0070710_10032321 3300005437 Bacteria 2834
111 Ga0070710_10083894 3300005437 Bacteria 1866
112 Ga0070701_10002605 3300005438 Bacteria 6985
113 Ga0070701_10005183 3300005438 Bacteria 5357
114 Ga0070711_100031105 3300005439 Bacteria 3540
115 Ga0070711_100044159 3300005439 Bacteria 3023
116 Ga0070711_100062336 3300005439 Bacteria 2598
117 Ga0070711_100064164 3300005439 Bacteria 2566
118 Ga0070711_100159121 3300005439 Bacteria 1711
119 Ga0070711_100172665 3300005439 Bacteria 1649
120 Ga0070705_100003300 3300005440 Bacteria 7928
121 Ga0070705_100114065 3300005440 Bacteria 1732
122 Ga0070705_100245500 3300005440 Bacteria 1254
123 Ga0070700_100085331 3300005441 Bacteria 2048
124 Ga0070700_100596852 3300005441 Bacteria 864
125 Ga0070694_100005857 3300005444 Bacteria 7456
126 Ga0070708_100363709 3300005445 Bacteria 1364
127 Ga0070663_100007452 3300005455 Bacteria 6657
128 Ga0070663_100040726 3300005455 Bacteria 3255
129 Ga0070663_100120940 3300005455 Bacteria 1978
130 Ga0070678_100013322 3300005456 Bacteria 5150
131 Ga0070678_100067495 3300005456 Bacteria 2662
132 Ga0070678_100153890 3300005456 Bacteria 1855
133 Ga0070678_100307875 3300005456 Bacteria 1348
134 Ga0070662_100011859 3300005457 Bacteria 5763
135 Ga0070662_100040314 3300005457 Bacteria 3324
136 Ga0070662_100089049 3300005457 Bacteria 2314
137 Ga0070681_10000884 3300005458 Bacteria 25290
138 Ga0070681_10025427 3300005458 Bacteria 5955
139 Ga0070681_10068522 3300005458 Bacteria 3514
140 Ga0070681_10074842 3300005458 Bacteria 3347
141 Ga0070681_10312438 3300005458 Bacteria 1481
142 Ga0068867_100000744 3300005459 Bacteria 21853
143 Ga0068867_100084281 3300005459 Bacteria 2401
144 Ga0068867_100299538 3300005459 Bacteria 1325
145 Ga0070685_10001903 3300005466 Bacteria 10850
146 Ga0070685_10232332 3300005466 Bacteria 1214
147 Ga0070685_10398413 3300005466 Bacteria 953
148 Ga0070679_100016345 3300005530 Bacteria 7154
149 Ga0070679_100044032 3300005530 Bacteria 4446
150 Ga0070679_100167832 3300005530 Bacteria 2168
151 Ga0070679_100174098 3300005530 Bacteria 2125
152 Ga0070679_100455717 3300005530 Bacteria 1223
153 Ga0070679_100512351 3300005530 Bacteria 1144
154 Ga0070684_100028411 3300005535 Bacteria 4732
155 Ga0070684_100207066 3300005535 Bacteria 1788
156 Ga0070697_100033622 3300005536 Bacteria 4130
157 Ga0070697_100477183 3300005536 Bacteria 1089
158 Ga0068853_100004568 3300005539 Bacteria 10737
159 Ga0068853_100621256 3300005539 Bacteria 1027
160 Ga0070672_100001256 3300005543 Bacteria 15606
161 Ga0070672_100036343 3300005543 Bacteria 3752
162 Ga0070672_100272487 3300005543 Bacteria 1429
163 Ga0070672_100374021 3300005543 Bacteria 1218
164 Ga0070686_100000931 3300005544 Bacteria 16827
165 Ga0070686_100257933 3300005544 Bacteria 1276
166 Ga0070686_100312680 3300005544 Bacteria 1169
167 Ga0070686_100347046 3300005544 Bacteria 1114
168 Ga0070695_100001091 3300005545 Bacteria 14845
169 Ga0070696_100107647 3300005546 Bacteria 2005
170 Ga0070696_100133955 3300005546 Bacteria 1805
171 Ga0070693_100054819 3300005547 Bacteria 2294
172 Ga0070693_100072109 3300005547 Bacteria 2037
173 Ga0070665_100060023 3300005548 Bacteria 3812
174 Ga0070665_100104073 3300005548 Bacteria 2841
175 Ga0070665_100119266 3300005548 Bacteria 2640
176 Ga0070665_100274222 3300005548 Bacteria 1688
177 Ga0070665_100330198 3300005548 Bacteria 1530
178 Ga0070665_100605349 3300005548 Bacteria 1109
179 Ga0070704_100000586 3300005549 Bacteria 17523
180 Ga0070704_100240320 3300005549 Bacteria 1482
181 Ga0068855_100007540 3300005563 Bacteria 13162
182 Ga0068855_100178113 3300005563 Bacteria 2404
183 Ga0070664_100009220 3300005564 Bacteria 8012
184 Ga0070664_100083451 3300005564 Bacteria 2757
185 Ga0070664_100280331 3300005564 Bacteria 1503
186 Ga0070664_100364938 3300005564 Bacteria 1316
187 Ga0070664_100569054 3300005564 Bacteria 1049
188 Ga0068857_100004156 3300005577 Bacteria 12195
189 Ga0068854_100007843 3300005578 Bacteria 6831
190 Ga0068854_100112363 3300005578 Bacteria 2057
191 Ga0070702_100017341 3300005615 Bacteria 3712
192 Ga0070702_100018538 3300005615 Bacteria 3613
193 Ga0070702_100042202 3300005615 Bacteria 2563
194 Ga0068852_100001321 3300005616 Bacteria 16607
195 Ga0068859_100003378 3300005617 Bacteria 16230
196 Ga0068859_100028616 3300005617 Bacteria 5587
197 Ga0068859_100064865 3300005617 Bacteria 3685
198 Ga0068859_100459111 3300005617 Bacteria 1370
199 Ga0068864_100020286 3300005618 Bacteria 5560
200 Ga0068864_100032658 3300005618 Bacteria 4423
201 Ga0068864_100086947 3300005618 Bacteria 2751
202 Ga0068864_100148927 3300005618 Bacteria 2118
203 Ga0068866_10000805 3300005718 Bacteria 13998
204 Ga0068866_10025366 3300005718 Bacteria 2786
205 Ga0068866_10161551 3300005718 Bacteria 1307
206 Ga0068861_100010705 3300005719 Bacteria 6373
207 Ga0068861_100106078 3300005719 Bacteria 2244
208 Ga0068861_100184414 3300005719 Bacteria 1739
209 Ga0068861_100294189 3300005719 Bacteria 1403
210 Ga0068851_10035522 3300005834 Bacteria 2492
211 Ga0068851_10058442 3300005834 Bacteria 1971
212 Ga0068870_10000414 3300005840 Bacteria 16043
213 Ga0068870_10007043 3300005840 Bacteria 4992
214 Ga0068863_100009723 3300005841 Bacteria 9382
215 Ga0068863_100079796 3300005841 Bacteria 3099
216 Ga0068858_100002675 3300005842 Bacteria 17941
217 Ga0068858_100111126 3300005842 Bacteria 2559
218 Ga0068858_100257420 3300005842 Bacteria 1658
219 Ga0068860_100054689 3300005843 Bacteria 3794
220 Ga0068860_100127879 3300005843 Bacteria 2436
221 Ga0068860_100459535 3300005843 Bacteria 1267
222 Ga0068862_100001659 3300005844 Bacteria 20231
223 Ga0068862_100484115 3300005844 Bacteria 1172
224 Ga0081455_10006153 3300005937 Bacteria 12947
225 Ga0081455_10019331 3300005937 Bacteria 6447
226 Ga0081455_10031401 3300005937 Bacteria 4807
227 Ga0081455_10123144 3300005937 Bacteria 2040
228 Ga0081538_10003643 3300005981 Bacteria 14481
229 Ga0081538_10019476 3300005981 Bacteria 5041
230 Ga0081538_10101443 3300005981 Bacteria 1448
231 Ga0081540_1000229 3300005983 Bacteria 58563
232 Ga0081540_1004582 3300005983 Bacteria 10469
233 Ga0081540_1005337 3300005983 Bacteria 9617
234 Ga0081539_10001225 3300005985 Bacteria 45858
235 Ga0070717_10014612 3300006028 Bacteria 6047
236 Ga0075365_10041567 3300006038 Bacteria 3004
237 Ga0075365_10042236 3300006038 Bacteria 2980
238 Ga0075365_10151434 3300006038 Bacteria 1613
239 Ga0075365_10210986 3300006038 Bacteria 1361
240 Ga0075365_10228270 3300006038 Bacteria 1306
241 Ga0075368_10027359 3300006042 Bacteria 2199
242 Ga0075368_10059404 3300006042 Bacteria 1529
243 Ga0075363_100022308 3300006048 Bacteria 3199
244 Ga0075363_100056553 3300006048 Bacteria 2103
245 Ga0075363_100194167 3300006048 Bacteria 1158
246 Ga0075364_10096142 3300006051 Bacteria 1970
247 Ga0075364_10293488 3300006051 Bacteria 1107
248 Ga0075364_10423000 3300006051 Bacteria 909
249 Ga0075432_10003064 3300006058 Bacteria 5631
250 Ga0075432_10054910 3300006058 Bacteria 1411
251 Ga0070715_10219505 3300006163 Bacteria 977
252 Ga0070712_100004179 3300006175 Bacteria 8882
253 Ga0070712_100022333 3300006175 Bacteria 4168
254 Ga0070712_100041408 3300006175 Bacteria 3163
255 Ga0070712_100150566 3300006175 Bacteria 1786
256 Ga0070712_100223810 3300006175 Bacteria 1491
257 Ga0075362_10010411 3300006177 Bacteria 3630
258 Ga0075362_10075904 3300006177 Bacteria 1542
259 Ga0075362_10165381 3300006177 Bacteria 1067
260 Ga0075367_10014656 3300006178 Bacteria 4245
261 Ga0075367_10075823 3300006178 Bacteria 2029
262 Ga0075367_10115737 3300006178 Bacteria 1649
263 Ga0075367_10152143 3300006178 Bacteria 1436
264 Ga0075369_10110302 3300006186 Bacteria 1239
265 Ga0075427_10005535 3300006194 Bacteria 1803
266 Ga0075366_10004424 3300006195 Bacteria 7541
267 Ga0097621_100000432 3300006237 Bacteria 29159
268 Ga0097621_100045500 3300006237 Bacteria 3545
269 Ga0097621_100140217 3300006237 Bacteria 2065
270 Ga0075370_10002383 3300006353 Bacteria 8699
271 Ga0068871_100059160 3300006358 Bacteria 3122
272 Ga0068871_100139402 3300006358 Bacteria 2061
273 Ga0068871_100296337 3300006358 Bacteria 1418
274 Ga0068871_100476848 3300006358 Bacteria 1122
275 Ga0068871_100547467 3300006358 Bacteria 1048
276 Ga0075428_100011046 3300006844 Bacteria 10044
277 Ga0075428_100014981 3300006844 Bacteria 8618
278 Ga0075428_100047216 3300006844 Bacteria 4730
279 Ga0075428_100113955 3300006844 Bacteria 2946
280 Ga0075428_100214741 3300006844 Bacteria 2078
281 Ga0075428_100386666 3300006844 Bacteria 1500
282 Ga0075430_100000312 3300006846 Bacteria 34556
283 Ga0075430_100244476 3300006846 Bacteria 1487
284 Ga0075431_100001045 3300006847 Bacteria 24701
285 Ga0075431_100005224 3300006847 Bacteria 12791
286 Ga0075431_100024225 3300006847 Bacteria 6216
287 Ga0075431_100157437 3300006847 Bacteria 2337
288 Ga0075431_100291859 3300006847 Bacteria 1649
289 Ga0075431_100404160 3300006847 Bacteria 1366
290 Ga0075433_10000217 3300006852 Bacteria 32575
291 Ga0075434_100000482 3300006871 Bacteria 29922
292 Ga0075434_100002518 3300006871 Bacteria 16154
293 Ga0075434_100111741 3300006871 Bacteria 2744
294 Ga0075434_100173756 3300006871 Bacteria 2174
295 Ga0075434_100337034 3300006871 Bacteria 1529
296 Ga0075434_100760601 3300006871 Bacteria 986
297 Ga0075429_100005381 3300006880 Bacteria 11016
298 Ga0075429_100009838 3300006880 Bacteria 8290
299 Ga0068865_100000989 3300006881 Bacteria 16275
300 Ga0068865_100039551 3300006881 Bacteria 3200
301 Ga0068865_100078150 3300006881 Bacteria 2366
302 Ga0068865_100374512 3300006881 Bacteria 1160
303 Ga0075436_100036229 3300006914 Bacteria 3405
304 Ga0075436_100150280 3300006914 Bacteria 1639
305 Ga0075436_100268874 3300006914 Bacteria 1217
306 Ga0097620_100003378 3300006931 Bacteria 16230
307 Ga0097620_100028617 3300006931 Bacteria 5587
308 Ga0097620_100064874 3300006931 Bacteria 3685
309 Ga0097620_100459100 3300006931 Bacteria 1370
310 Ga0075435_100004247 3300007076 Bacteria 9839
311 Ga0075435_100064584 3300007076 Bacteria 2975
312 Ga0075435_100156388 3300007076 Bacteria 1918
313 Ga0075435_100338575 3300007076 Bacteria 1289
314 Ga0075435_100363937 3300007076 Bacteria 1241
315 Ga0075435_100465792 3300007076 Bacteria 1091
316 Ga0105240_10020505 3300009093 Bacteria 8813
317 Ga0105240_10827192 3300009093 Bacteria 1001
318 Ga0111539_10000725 3300009094 Bacteria 42875
319 Ga0111539_10001938 3300009094 Bacteria 27600
320 Ga0111539_10006634 3300009094 Bacteria 14909
321 Ga0111539_10126030 3300009094 Bacteria 3000
322 Ga0111539_10214376 3300009094 Bacteria 2243
323 Ga0111539_10614778 3300009094 Bacteria 1266
324 Ga0105245_10000534 3300009098 Bacteria 34896
325 Ga0105245_10003999 3300009098 Bacteria 13100
326 Ga0105245_10058895 3300009098 Bacteria 3458
327 Ga0105245_10062920 3300009098 Bacteria 3349
328 Ga0105247_10002155 3300009101 Bacteria 13586
329 Ga0105247_10022098 3300009101 Bacteria 3829
330 Ga0105247_10027047 3300009101 Bacteria 3469
331 Ga0105247_10027549 3300009101 Bacteria 3436
332 Ga0105247_10064224 3300009101 Bacteria 2280
333 Ga0114129_10000227 3300009147 Bacteria 62698
334 Ga0114129_10079730 3300009147 Bacteria 4552
335 Ga0114129_10120350 3300009147 Bacteria 3615
336 Ga0114129_10136923 3300009147 Bacteria 3359
337 Ga0105243_10216409 3300009148 Bacteria 1690
338 Ga0105241_10176943 3300009174 Bacteria 1766
339 Ga0105241_10588827 3300009174 Bacteria 1003
340 Ga0105242_10047117 3300009176 Bacteria 3499
341 Ga0105248_10081604 3300009177 Bacteria 3635
342 Ga0105248_10081747 3300009177 Bacteria 3632
343 Ga0105248_10973582 3300009177 Bacteria 958
344 Ga0105237_10037364 3300009545 Bacteria 4909
345 Ga0105238_10014485 3300009551 Bacteria 7973
346 Ga0105238_10670928 3300009551 Bacteria 1048
347 Ga0105238_10685324 3300009551 Bacteria 1036
348 Ga0105238_10888632 3300009551 Bacteria 909
349 Ga0105249_10500055 3300009553 Bacteria 1261
350 Ga0105239_10132832 3300010375 Bacteria 2770
351 Ga0105239_10194102 3300010375 Bacteria 2273
352 Ga0105239_10400794 3300010375 Bacteria 1552
353 Ga0105239_10539416 3300010375 Bacteria 1328
354 Ga0105246_10026146 3300011119 Bacteria 3809
355 Ga0105246_10150284 3300011119 Bacteria 1762
356 Ga0105246_10280601 3300011119 Bacteria 1336
357 Ga0157373_10064644 3300013100 Bacteria 2590
358 Ga0157373_10136668 3300013100 Bacteria 1723
359 Ga0157373_10555723 3300013100 Unclassified 833
360 Ga0157371_10008779 3300013102 Bacteria 8015
361 Ga0157370_10140653 3300013104 Bacteria 2249
362 Ga0157369_10789287 3300013105 Bacteria 976
363 Ga0157374_10056887 3300013296 Bacteria 3652
364 Ga0157374_10060577 3300013296 Bacteria 3542
365 Ga0157378_10030576 3300013297 Bacteria 4759
366 Ga0157378_10398433 3300013297 Bacteria 1356
367 Ga0157378_10568043 3300013297 Bacteria 1142
368 Ga0163162_10003671 3300013306 Bacteria 14720
369 Ga0163162_10141913 3300013306 Bacteria 2516
370 Ga0157372_10003634 3300013307 Bacteria 16595
371 Ga0157372_10071371 3300013307 Bacteria 3911
372 Ga0157372_10336143 3300013307 Bacteria 1759
373 Ga0157375_10039882 3300013308 Bacteria 4522
374 Ga0163163_10007527 3300014325 Bacteria 9614
375 Ga0163163_10040807 3300014325 Bacteria 4535
376 Ga0163163_10122290 3300014325 Bacteria 2637
377 Ga0163163_10533361 3300014325 Bacteria 1236
378 Ga0157380_10000558 3300014326 Bacteria 22893
379 Ga0157380_10241836 3300014326 Bacteria 1628
380 Ga0157379_10003079 3300014968 Bacteria 14099
381 Ga0157379_10060634 3300014968 Bacteria 3382
382 Ga0157379_10200901 3300014968 Bacteria 1803
383 Ga0157379_10259238 3300014968 Bacteria 1580
384 Ga0157379_10304189 3300014968 Bacteria 1454
385 Ga0157379_10317670 3300014968 Bacteria 1422
386 Ga0157376_10035816 3300014969 Bacteria 4016
387 Ga0157376_10072080 3300014969 Bacteria 2937
388 Ga0157376_10111487 3300014969 Bacteria 2409
389 Ga0163161_10512083 3300017792 Bacteria 979
390 Ga0213876_10049768 3300021384 Bacteria 2214
391 Ga0213871_10010264 3300021441 Bacteria 2120
392 Ga0224572_1002117 3300024225 Bacteria 3136
393 Ga0224572_1031639 3300024225 Bacteria 1009
394 Ga0228598_1001587 3300024227 Bacteria 4978
395 Ga0207666_1000030 3300025271 Bacteria 31103
396 Ga0207673_1000218 3300025290 Bacteria 5768
397 Ga0207697_10000225 3300025315 Bacteria 30578
398 Ga0207653_10008797 3300025885 Bacteria 3148
399 Ga0207682_10000009 3300025893 Bacteria 86366
400 Ga0207682_10004092 3300025893 Bacteria 6192
401 Ga0207692_10004511 3300025898 Bacteria 5520
402 Ga0207692_10006797 3300025898 Bacteria 4652
403 Ga0207692_10103085 3300025898 Bacteria 1570
404 Ga0207692_10270000 3300025898 Bacteria 1025
405 Ga0207692_10364174 3300025898 Bacteria 894
406 Ga0207642_10002006 3300025899 Bacteria 6280
407 Ga0207642_10011215 3300025899 Bacteria 3188
408 Ga0207710_10004015 3300025900 Bacteria 6482
409 Ga0207710_10035278 3300025900 Bacteria 2201
410 Ga0207710_10091839 3300025900 Bacteria 1422
411 Ga0207688_10000060 3300025901 Bacteria 40194
412 Ga0207688_10000186 3300025901 Bacteria 27430
413 Ga0207688_10041998 3300025901 Bacteria 2545
414 Ga0207680_10008720 3300025903 Bacteria 4994
415 Ga0207680_10018727 3300025903 Bacteria 3689
416 Ga0207680_10140594 3300025903 Bacteria 1600
417 Ga0207647_10000172 3300025904 Bacteria 51724
418 Ga0207647_10051248 3300025904 Bacteria 2552
419 Ga0207685_10033222 3300025905 Bacteria 1863
420 Ga0207685_10131792 3300025905 Bacteria 1110
421 Ga0207699_10043766 3300025906 Bacteria 2603
422 Ga0207699_10115162 3300025906 Bacteria 1729
423 Ga0207699_10251218 3300025906 Bacteria 1219
424 Ga0207699_10410186 3300025906 Bacteria 966
425 Ga0207645_10014552 3300025907 Bacteria 5263
426 Ga0207645_10125706 3300025907 Bacteria 1667
427 Ga0207643_10000244 3300025908 Bacteria 37860
428 Ga0207643_10002007 3300025908 Bacteria 11233
429 Ga0207643_10048340 3300025908 Bacteria 2409
430 Ga0207654_10488595 3300025911 Bacteria 868
431 Ga0207707_10003182 3300025912 Bacteria 14574
432 Ga0207707_10278683 3300025912 Bacteria 1448
433 Ga0207695_10036880 3300025913 Bacteria 5279
434 Ga0207695_10127645 3300025913 Bacteria 2504
435 Ga0207695_10556979 3300025913 Bacteria 1028
436 Ga0207695_10574261 3300025913 Bacteria 1009
437 Ga0207671_10003102 3300025914 Bacteria 16915
438 Ga0207671_10141865 3300025914 Bacteria 1851
439 Ga0207693_10003429 3300025915 Bacteria 13527
440 Ga0207693_10017687 3300025915 Bacteria 5684
441 Ga0207693_10028141 3300025915 Bacteria 4440
442 Ga0207693_10037919 3300025915 Bacteria 3797
443 Ga0207693_10049890 3300025915 Bacteria 3287
444 Ga0207693_10063636 3300025915 Bacteria 2890
445 Ga0207693_10073159 3300025915 Bacteria 2683
446 Ga0207693_10180624 3300025915 Bacteria 1660
447 Ga0207693_10331250 3300025915 Bacteria 1192
448 Ga0207693_10488167 3300025915 Bacteria 962
449 Ga0207663_10047758 3300025916 Bacteria 2645
450 Ga0207663_10093253 3300025916 Bacteria 2004
451 Ga0207663_10234972 3300025916 Bacteria 1341
452 Ga0207663_10289541 3300025916 Bacteria 1220
453 Ga0207663_10476693 3300025916 Bacteria 966
454 Ga0207663_10599980 3300025916 Bacteria 865
455 Ga0207660_10000179 3300025917 Bacteria 40457
456 Ga0207660_10021494 3300025917 Bacteria 4339
457 Ga0207660_10039415 3300025917 Bacteria 3302
458 Ga0207660_10067189 3300025917 Bacteria 2596
459 Ga0207660_10215521 3300025917 Bacteria 1505
460 Ga0207662_10000025 3300025918 Bacteria 70078
461 Ga0207662_10002485 3300025918 Bacteria 9261
462 Ga0207662_10010856 3300025918 Bacteria 5035
463 Ga0207657_10001867 3300025919 Bacteria 22796
464 Ga0207657_10028043 3300025919 Bacteria 5145
465 Ga0207657_10055032 3300025919 Bacteria 3438
466 Ga0207649_10000693 3300025920 Bacteria 22200
467 Ga0207649_10194317 3300025920 Bacteria 1429
468 Ga0207652_10002825 3300025921 Bacteria 14578
469 Ga0207652_10056325 3300025921 Bacteria 3384
470 Ga0207652_10210773 3300025921 Bacteria 1749
471 Ga0207681_10031992 3300025923 Bacteria 3440
472 Ga0207681_10517965 3300025923 Bacteria 978
473 Ga0207694_10058150 3300025924 Bacteria 3007
474 Ga0207694_10336648 3300025924 Bacteria 1247
475 Ga0207694_10532240 3300025924 Bacteria 985
476 Ga0207650_10005265 3300025925 Bacteria 8822
477 Ga0207650_10038889 3300025925 Bacteria 3476
478 Ga0207650_10113403 3300025925 Bacteria 2101
479 Ga0207650_10314125 3300025925 Bacteria 1282
480 Ga0207650_10394724 3300025925 Bacteria 1144
481 Ga0207659_10000283 3300025926 Bacteria 30879
482 Ga0207659_10134966 3300025926 Bacteria 1909
483 Ga0207659_10249286 3300025926 Bacteria 1440
484 Ga0207687_10011022 3300025927 Bacteria 5908
485 Ga0207687_10022241 3300025927 Bacteria 4218
486 Ga0207687_10093143 3300025927 Bacteria 2202
487 Ga0207687_10513179 3300025927 Bacteria 1002
488 Ga0207700_10009461 3300025928 Bacteria 6090
489 Ga0207700_10100526 3300025928 Bacteria 2305
490 Ga0207664_10056771 3300025929 Bacteria 3110
491 Ga0207664_10094460 3300025929 Bacteria 2458
492 Ga0207664_10100435 3300025929 Bacteria 2389
493 Ga0207664_10109506 3300025929 Bacteria 2295
494 Ga0207644_10017604 3300025931 Bacteria 4830
495 Ga0207644_10027313 3300025931 Bacteria 3942
496 Ga0207644_10043634 3300025931 Bacteria 3183
497 Ga0207644_10083701 3300025931 Bacteria 2363
498 Ga0207644_10153807 3300025931 Bacteria 1782
499 Ga0207644_10379239 3300025931 Bacteria 1153
500 Ga0207690_10000808 3300025932 Bacteria 20084
501 Ga0207690_10098288 3300025932 Bacteria 2084
502 Ga0207690_10146626 3300025932 Bacteria 1746
503 Ga0207690_10173578 3300025932 Bacteria 1617
504 Ga0207706_10000734 3300025933 Bacteria 34159
505 Ga0207706_10007571 3300025933 Bacteria 10043
506 Ga0207706_10020218 3300025933 Bacteria 5984
507 Ga0207706_10075807 3300025933 Bacteria 2958
508 Ga0207686_10006259 3300025934 Bacteria 6402
509 Ga0207686_10057242 3300025934 Bacteria 2453
510 Ga0207686_10226400 3300025934 Bacteria 1353
511 Ga0207709_10009900 3300025935 Bacteria 5250
512 Ga0207709_10082053 3300025935 Bacteria 2081
513 Ga0207670_10016339 3300025936 Bacteria 4458
514 Ga0207670_10106021 3300025936 Bacteria 2015
515 Ga0207670_10294838 3300025936 Bacteria 1268
516 Ga0207669_10000204 3300025937 Bacteria 27121
517 Ga0207669_10033098 3300025937 Bacteria 2912
518 Ga0207669_10075088 3300025937 Bacteria 2140
519 Ga0207704_10000130 3300025938 Bacteria 41287
520 Ga0207704_10006237 3300025938 Bacteria 5545
521 Ga0207704_10140792 3300025938 Bacteria 1687
522 Ga0207704_10169858 3300025938 Bacteria 1563
523 Ga0207704_10344674 3300025938 Bacteria 1158
524 Ga0207691_10000309 3300025940 Bacteria 48592
525 Ga0207691_10008010 3300025940 Bacteria 10157
526 Ga0207691_10010685 3300025940 Bacteria 8811
527 Ga0207691_10164297 3300025940 Bacteria 1946
528 Ga0207711_10021915 3300025941 Bacteria 5338
529 Ga0207711_10024232 3300025941 Bacteria 5079
530 Ga0207711_10043967 3300025941 Bacteria 3812
531 Ga0207711_10275722 3300025941 Bacteria 1548
532 Ga0207689_10000893 3300025942 Bacteria 28654
533 Ga0207689_10013137 3300025942 Bacteria 7067
534 Ga0207661_10009141 3300025944 Bacteria 7104
535 Ga0207661_10035580 3300025944 Bacteria 3882
536 Ga0207661_10492969 3300025944 Bacteria 1119
537 Ga0207679_10000128 3300025945 Bacteria 61823
538 Ga0207679_10078420 3300025945 Bacteria 2516
539 Ga0207667_10025198 3300025949 Bacteria 6516
540 Ga0207651_10007318 3300025960 Bacteria 5869
541 Ga0207651_10415088 3300025960 Bacteria 1148
542 Ga0207651_10584841 3300025960 Bacteria 974
543 Ga0207640_10289236 3300025981 Bacteria 1291
544 Ga0207658_10027814 3300025986 Bacteria 3977
545 Ga0207658_10093741 3300025986 Bacteria 2335
546 Ga0207658_10265832 3300025986 Bacteria 1464
547 Ga0207658_10539492 3300025986 Bacteria 1043
548 Ga0207677_10007755 3300026023 Bacteria 5958
549 Ga0207677_10021647 3300026023 Bacteria 3933
550 Ga0207677_10124468 3300026023 Bacteria 1945
551 Ga0207677_10158017 3300026023 Bacteria 1758
552 Ga0207703_10024451 3300026035 Bacteria 4752
553 Ga0207703_10028219 3300026035 Bacteria 4422
554 Ga0207703_10382891 3300026035 Bacteria 1301
555 Ga0207639_10002888 3300026041 Bacteria 11550
556 Ga0207639_10222772 3300026041 Bacteria 1630
557 Ga0207678_10000759 3300026067 Bacteria 29491
558 Ga0207678_10154943 3300026067 Bacteria 1956
559 Ga0207678_10391743 3300026067 Bacteria 1202
560 Ga0207708_10000391 3300026075 Bacteria 34446
561 Ga0207708_10003429 3300026075 Bacteria 11685
562 Ga0207702_10012125 3300026078 Bacteria 7169
563 Ga0207641_10025266 3300026088 Bacteria 4898
564 Ga0207641_10051093 3300026088 Bacteria 3500
565 Ga0207641_10052682 3300026088 Bacteria 3447
566 Ga0207648_10000862 3300026089 Bacteria 34173
567 Ga0207648_10004301 3300026089 Bacteria 14673
568 Ga0207648_10036835 3300026089 Bacteria 4309
569 Ga0207648_10116285 3300026089 Bacteria 2350
570 Ga0207676_10014556 3300026095 Bacteria 5662
571 Ga0207676_10028765 3300026095 Bacteria 4155
572 Ga0207676_10032956 3300026095 Bacteria 3910
573 Ga0207676_10170304 3300026095 Bacteria 1896
574 Ga0207676_10175058 3300026095 Bacteria 1873
575 Ga0207674_10000806 3300026116 Bacteria 40763
576 Ga0207674_10033472 3300026116 Bacteria 5380
577 Ga0207674_10165477 3300026116 Bacteria 2166
578 Ga0207675_100000637 3300026118 Bacteria 34408
579 Ga0207675_100129487 3300026118 Bacteria 2392
580 Ga0207675_100163025 3300026118 Bacteria 2128
581 Ga0207675_100932735 3300026118 Bacteria 885
582 Ga0207683_10000330 3300026121 Bacteria 43106
583 Ga0207683_10004948 3300026121 Bacteria 11462
584 Ga0207683_10005418 3300026121 Bacteria 10931
585 Ga0207683_10017988 3300026121 Bacteria 6027
586 Ga0207683_10026333 3300026121 Bacteria 5019
587 Ga0210002_1000486 3300027617 Bacteria 5396
588 Ga0209966_1007500 3300027695 Bacteria 1915
589 Ga0209998_10000253 3300027717 Bacteria 17553
590 Ga0209998_10002914 3300027717 Bacteria 3830
591 Ga0209813_10064051 3300027866 Bacteria 1181
592 Ga0209974_10000230 3300027876 Bacteria 18079
593 Ga0207428_10000164 3300027907 Bacteria 91968
594 Ga0207428_10000815 3300027907 Bacteria 35204
595 Ga0207428_10004757 3300027907 Bacteria 12834
596 Ga0207428_10069927 3300027907 Bacteria 2760
597 Ga0265357_1000317 3300028023 Bacteria 2578
598 Ga0268266_10003098 3300028379 Bacteria 16939
599 Ga0268266_10127050 3300028379 Bacteria 2276
600 Ga0268266_10372010 3300028379 Bacteria 1346
601 Ga0268266_10462497 3300028379 Bacteria 1207
602 Ga0268266_10544815 3300028379 Bacteria 1111
603 Ga0268265_10004750 3300028380 Bacteria 9366
604 Ga0268264_10013527 3300028381 Bacteria 6721
605 Ga0268264_10411106 3300028381 Bacteria 1303
606 Ga0265334_10095520 3300028573 Bacteria 1081
607 Ga0265338_10024025 3300028800 Bacteria 6240
608 Ga0265338_10060542 3300028800 Bacteria 3326
609 Ga0265338_10157163 3300028800 Bacteria 1760
610 Ga0265763_1006724 3300030763 Bacteria 995
611 Ga0265760_10051922 3300031090 Bacteria 1235
612 Ga0265330_10011398 3300031235 Bacteria 4172
613 Ga0265325_10000442 3300031241 Bacteria 29810
614 Ga0265325_10000474 3300031241 Bacteria 29121
615 Ga0265325_10052918 3300031241 Bacteria 2083
616 Ga0265325_10158698 3300031241 Bacteria 1065
617 Ga0265340_10025842 3300031247 Bacteria 2971
618 Ga0265340_10045473 3300031247 Bacteria 2144
619 Ga0265339_10000047 3300031249 Bacteria 110601
620 Ga0265339_10077972 3300031249 Bacteria 1755
621 Ga0307513_10003997 3300031456 Bacteria 19790
622 Ga0265313_10000069 3300031595 Bacteria 100065
623 Ga0265313_10000305 3300031595 Bacteria 53305
624 Ga0265313_10007720 3300031595 Bacteria 7283
625 Ga0265313_10011147 3300031595 Bacteria 5605
626 Ga0265314_10001589 3300031711 Bacteria 24969
627 Ga0265314_10034545 3300031711 Bacteria 3695
628 Ga0265342_10011844 3300031712 Bacteria 5939
629 Ga0265342_10077212 3300031712 Bacteria 1929
630 Ga0307516_10108311 3300031730 Bacteria 2586
631 Ga0373930_0018187 3300034816 Bacteria 1348
632 Ga0373959_0007119 3300034820 Bacteria 1875
633 Ga0373938_0069830 3300034957 Bacteria 838
634 Ga0373926_0008281 3300035083 Bacteria 3459
635 Ga0373926_0063446 3300035083 Bacteria 1349
636 Ga0373926_0077638 3300035083 Bacteria 1225
637 Ga0373929_0002082 3300035085 Bacteria 3721
638 Ga0373934_0014951 3300035086 Bacteria 2942
639 Ga0373934_0016360 3300035086 Bacteria 2820
640 Ga0373934_0053230 3300035086 Bacteria 1605
641 Ga0373934_0077057 3300035086 Bacteria 1337
642 Ga0373940_0001141 3300035088 Bacteria 4645
643 Ga0373944_0001954 3300035089 Bacteria 5222
644 Ga0373944_0019742 3300035089 Bacteria 1936
645 Ga0373944_0030103 3300035089 Bacteria 1627
646 Ga0373944_0047260 3300035089 Bacteria 1348
647 Ga0373949_0002607 3300035090 Bacteria 4565
648 Ga0373952_0000397 3300035092 Bacteria 7450
649 Ga0373923_0054373 3300035111 Bacteria 1685
650 Ga0373923_0055992 3300035111 Bacteria 1664
651 Ga0373936_0022805 3300035113 Bacteria 2438
652 Ga0373936_0112127 3300035113 Bacteria 1159
653 Ga0373939_0002797 3300035114 Bacteria 4092
654 Ga0373945_0012790 3300035116 Bacteria 2793
655 Ga0373945_0020194 3300035116 Bacteria 2278
656 Ga0373945_0027803 3300035116 Bacteria 1977
657 Ga0373945_0035082 3300035116 Bacteria 1791
658 Ga0373953_0013298 3300035117 Bacteria 2937
659 Ga0373953_0026974 3300035117 Bacteria 2204
660 Ga0373953_0036517 3300035117 Bacteria 1936
661 Ga0373953_0041742 3300035117 Bacteria 1826
662 Ga0373953_0076451 3300035117 Bacteria 1387
663 Ga0373954_0004874 3300035118 Bacteria 5791
664 Ga0373954_0008018 3300035118 Bacteria 4627
665 Ga0373954_0009199 3300035118 Bacteria 4347
666 Ga0373954_0025645 3300035118 Bacteria 2697
667 Ga0373956_0015678 3300035119 Bacteria 3176
668 Ga0373956_0027317 3300035119 Bacteria 2477
669 Ga0373956_0045362 3300035119 Bacteria 1961
670 Ga0373956_0053846 3300035119 Bacteria 1812
671 Ga0373957_0000227 3300035120 Bacteria 14093
672 Ga0373957_0017699 3300035120 Bacteria 2487
673 Ga0373943_0002664 3300035170 Bacteria 8126
674 Ga0373943_0029181 3300035170 Bacteria 2605
675 Ga0373943_0122435 3300035170 Bacteria 1383
676 Ga0373943_0126532 3300035170 Bacteria 1363
677 Ga0373946_0015674 3300035171 Bacteria 2877
678 Ga0373946_0030378 3300035171 Bacteria 2156
679 Ga0373955_0001227 3300035172 Bacteria 10900
680 Ga0373955_0002716 3300035172 Bacteria 7748
681 Ga0373955_0019472 3300035172 Bacteria 3393
682 Ga0373955_0022212 3300035172 Bacteria 3215
683 Ga0373955_0169822 3300035172 Bacteria 1290
684 Ga0373962_0000571 3300035242 Bacteria 8330
685 Ga0373924_0008569 3300035410 Bacteria 3722
686 Ga0373924_0024554 3300035410 Bacteria 2376
687 Ga0373924_0183910 3300035410 Bacteria 920
688 Ga0373931_0032571 3300035691 Bacteria 2698
689 Ga0373931_0034336 3300035691 Bacteria 2632
690 Ga0373931_0039031 3300035691 Bacteria 2487
691 Ga0373931_0058991 3300035691 Bacteria 2063
692 Ga0373931_0086997 3300035691 Bacteria 1735
693 Ga0373931_0197279 3300035691 Bacteria 1200
694 Ga0373935_0007892 3300035692 Bacteria 6385
695 Ga0373935_0009246 3300035692 Bacteria 5899
696 Ga0373935_0015088 3300035692 Bacteria 4665
697 Ga0373935_0032021 3300035692 Bacteria 3266
698 Ga0373935_0121101 3300035692 Bacteria 1748
699 Ga0373927_0000709 3300035695 Bacteria 25539
700 Ga0373927_0002902 3300035695 Bacteria 12469
701 Ga0373927_0004582 3300035695 Bacteria 9650
702 Ga0373927_0014291 3300035695 Bacteria 5260
703 Ga0373927_0031311 3300035695 Bacteria 3467
704 Ga0373927_0031918 3300035695 Bacteria 3431
705 Ga0373927_0062975 3300035695 Bacteria 2398
706 Ga0373927_0075971 3300035695 Bacteria 2176
707 Ga0373927_0250132 3300035695 Bacteria 1165
708 Ga0373933_0000770 3300035724 Bacteria 19591
709 Ga0373933_0005841 3300035724 Bacteria 6693
710 Ga0373933_0009529 3300035724 Bacteria 5304
711 Ga0373933_0050777 3300035724 Bacteria 2477
712 Ga0373947_0010593 3300035725 Bacteria 5289
713 Ga0373947_0028814 3300035725 Bacteria 3256
714 Ga0373947_0034893 3300035725 Bacteria 2976
715 Ga0373947_0061881 3300035725 Bacteria 2276
716 Ga0373947_0066242 3300035725 Bacteria 2204
717 Ga0373937_0001549 3300036401 Bacteria 19309
718 Ga0373937_0002009 3300036401 Bacteria 16986
719 Ga0373937_0040363 3300036401 Bacteria 4254
720 Ga0373937_0053069 3300036401 Bacteria 3718
721 Ga0373937_0065756 3300036401 Bacteria 3338
722 Ga0373937_0462176 3300036401 Bacteria 1205
723 Ga0373937_1044532 3300036401 Bacteria 766
724 Ga0316582_0005151 3300036647 Bacteria 6690
725 Ga0373925_0001095 3300037068 Bacteria 24265
726 Ga0373925_0009269 3300037068 Bacteria 7163
727 Ga0373925_0076284 3300037068 Bacteria 2541
728 Ga0373925_0077677 3300037068 Bacteria 2520
729 Ga0373925_0160146 3300037068 Bacteria 1772
730 Ga0395898_0204484 3300037466 Bacteria 1884
731 Ga0316581_0083955 3300037588 Bacteria 980
732 Ga0436364_0508282 3300037853 Bacteria 3501
733 Ga0436364_0871221 3300037853 Bacteria 968
734 Ga0436365_0161216 3300039437 Bacteria 1372
735 Ga0436365_0239293 3300039437 Bacteria 16184
736 Ga0436365_1534371 3300039437 Bacteria 6832
737 Ga0436365_1566633 3300039437 Bacteria 1536
738 Ga0436365_1745913 3300039437 Bacteria 1200
739 Ga0436360_0259210 3300039438 Bacteria 2239
740 Ga0436360_0682985 3300039438 Bacteria 981
741 Ga0436360_0787757 3300039438 Bacteria 1285
742 Ga0436360_0906691 3300039438 Bacteria 1379
743 Ga0436360_1311043 3300039438 Bacteria 5219
744 Ga0436361_1005552 3300039447 Bacteria 10424
745 Ga0436363_0461379 3300039450 Bacteria 3372
746 Ga0436362_0392492 3300039453 Bacteria 1934
747 Ga0439453_0000384 3300041408 Bacteria 4720
748 Ga0439441_006240 3300042001 Bacteria 1883
749 Ga0439441_009085 3300042001 Bacteria 1638
750 Ga0439443_002564 3300042003 Bacteria 2186
751 Ga0439463_015138 3300042016 Bacteria 1907
752 Ga0439446_0103735 3300042156 Bacteria 902
753 Ga0439458_0018270 3300042157 Bacteria 1606
754 Ga0439435_0066074 3300042436 Bacteria 1062
755 Ga0439460_0015122 3300042461 Bacteria 2038
756 Ga0450893_0008740 3300042532 Bacteria 1651
757 Ga0439440_0019896 3300042993 Bacteria 1502
758 Ga0466966_0027189 3300044684 Bacteria 3731
759 Ga0466966_0374481 3300044684 Bacteria 855
760 Ga0466963_0058061 3300044694 Bacteria 2579
761 Ga0466971_0037480 3300044719 Bacteria 2173
762 Ga0466957_0059806 3300044842 Bacteria 2336
763 Ga0466959_0005881 3300045049 Bacteria 8449
764 Ga0451576_0209012 3300045051 Bacteria 2038
765 Ga0466958_0007033 3300045836 Bacteria 6156
766 Ga0495617_049798 3300046452 Bacteria 1394
767 Ga0495627_064297 3300046453 Bacteria 1080
768 Ga0495592_0005984 3300046454 Bacteria 9045
769 Ga0495592_0006852 3300046454 Bacteria 8508
770 Ga0495592_0007886 3300046454 Bacteria 7982
771 Ga0495592_0020684 3300046454 Bacteria 5007
772 Ga0495592_0106171 3300046454 Bacteria 1994
773 Ga0495592_0141761 3300046454 Bacteria 1671
774 Ga0495592_0158559 3300046454 Bacteria 1559
775 Ga0495603_0003970 3300046455 Bacteria 8812
776 Ga0495603_0094984 3300046455 Bacteria 1742
777 Ga0495603_0154811 3300046455 Bacteria 1330
778 Ga0495590_0144363 3300046457 Bacteria 860
779 Ga0495591_048921 3300046458 Bacteria 1163
780 Ga0495629_0006249 3300046459 Bacteria 8841
781 Ga0495629_0009599 3300046459 Bacteria 7069
782 Ga0495629_0020177 3300046459 Bacteria 4758
783 Ga0495629_0047995 3300046459 Bacteria 2994
784 Ga0495629_0185097 3300046459 Bacteria 1442
785 Ga0495629_0385437 3300046459 Bacteria 953
786 Ga0495638_0194863 3300046460 Bacteria 1147
787 Ga0495641_0015534 3300046461 Bacteria 4057
788 Ga0495641_0023614 3300046461 Bacteria 3050
789 Ga0495641_0029893 3300046461 Bacteria 2619
790 Ga0495641_0073660 3300046461 Bacteria 1532
791 Ga0495651_0001457 3300046462 Bacteria 18309
792 Ga0495651_0002845 3300046462 Bacteria 13396
793 Ga0495651_0020550 3300046462 Bacteria 5127
794 Ga0495651_0055920 3300046462 Bacteria 3031
795 Ga0495651_0165052 3300046462 Bacteria 1583
796 Ga0495651_0279448 3300046462 Bacteria 1129
797 Ga0495653_0001457 3300046463 Bacteria 18457
798 Ga0495653_0001646 3300046463 Bacteria 17542
799 Ga0495653_0006997 3300046463 Bacteria 9255
800 Ga0495653_0011975 3300046463 Bacteria 7083
801 Ga0495653_0212928 3300046463 Bacteria 1304
802 Ga0495653_0246603 3300046463 Bacteria 1187
803 Ga0495580_0058441 3300046472 Bacteria 2712
804 Ga0495580_0108843 3300046472 Bacteria 1924
805 Ga0495580_0235526 3300046472 Bacteria 1256
806 Ga0495580_0621425 3300046472 Bacteria 712
807 Ga0495582_0002745 3300046473 Bacteria 9828
808 Ga0495582_0017002 3300046473 Bacteria 3982
809 Ga0495582_0263160 3300046473 Bacteria 989
810 Ga0495605_0131484 3300046474 Bacteria 1129
811 Ga0495639_0015188 3300046475 Bacteria 3337
812 Ga0495639_0092624 3300046475 Bacteria 1419
813 Ga0495639_0149698 3300046475 Bacteria 1125
814 Ga0495639_0180159 3300046475 Bacteria 1028
815 Ga0495662_0001545 3300046476 Bacteria 11440
816 Ga0495662_0038969 3300046476 Bacteria 2296
817 Ga0495662_0101721 3300046476 Bacteria 1405
818 Ga0495662_0219702 3300046476 Bacteria 937
819 Ga0495664_0009700 3300046477 Bacteria 5392
820 Ga0495664_0035691 3300046477 Bacteria 2929
821 Ga0495664_0043326 3300046477 Bacteria 2666
822 Ga0495664_0051466 3300046477 Bacteria 2445
823 Ga0495664_0188731 3300046477 Bacteria 1250
824 Ga0495584_0063859 3300046491 Bacteria 1851
825 Ga0495584_0138016 3300046491 Bacteria 1238
826 Ga0495585_0016258 3300046492 Bacteria 4311
827 Ga0495585_0147346 3300046492 Bacteria 1229
828 Ga0495594_0010912 3300046499 Bacteria 4717
829 Ga0495594_0023234 3300046499 Bacteria 3321
830 Ga0495594_0031041 3300046499 Bacteria 2895
831 Ga0495594_0294637 3300046499 Bacteria 924
832 Ga0495607_0068028 3300046501 Bacteria 1999
833 Ga0495608_0002194 3300046511 Bacteria 14100
834 Ga0495608_0002362 3300046511 Bacteria 13588
835 Ga0495608_0013615 3300046511 Bacteria 5642
836 Ga0495608_0185091 3300046511 Bacteria 1316
837 Ga0495618_0002260 3300046514 Bacteria 12488
838 Ga0495618_0002528 3300046514 Bacteria 11713
839 Ga0495618_0031740 3300046514 Bacteria 3306
840 Ga0495618_0039445 3300046514 Bacteria 2968
841 Ga0495618_0055437 3300046514 Bacteria 2510
842 Ga0495618_0106327 3300046514 Bacteria 1797
843 Ga0495618_0151254 3300046514 Bacteria 1482
844 Ga0495628_0001326 3300046516 Bacteria 22701
845 Ga0495628_0001767 3300046516 Bacteria 19677
846 Ga0495628_0007617 3300046516 Bacteria 9356
847 Ga0495628_0385609 3300046516 Bacteria 1025
848 Ga0495630_0009151 3300046517 Bacteria 7124
849 Ga0495630_0031233 3300046517 Bacteria 3965
850 Ga0495630_0171813 3300046517 Bacteria 1651
851 Ga0495630_0232488 3300046517 Bacteria 1408
852 Ga0495630_0234734 3300046517 Bacteria 1401
853 Ga0495630_0581551 3300046517 Bacteria 858
854 Ga0495631_0093058 3300046518 Bacteria 1298
855 Ga0495637_0046486 3300046520 Bacteria 1836
856 Ga0495663_0007691 3300046525 Bacteria 2981
857 Ga0495666_0017207 3300046526 Bacteria 3600
858 Ga0495666_0209080 3300046526 Bacteria 895
859 Ga0495652_0001117 3300046529 Bacteria 30393
860 Ga0495652_0006045 3300046529 Bacteria 11322
861 Ga0495652_0008381 3300046529 Bacteria 9439
862 Ga0495652_0017281 3300046529 Bacteria 6438
863 Ga0495652_0339911 3300046529 Bacteria 1079
864 Ga0495665_0002705 3300046531 Bacteria 9559
865 Ga0495665_0079827 3300046531 Bacteria 1721
866 Ga0495665_0094785 3300046531 Bacteria 1567
867 Ga0495665_0096655 3300046531 Bacteria 1551
868 Ga0495665_0134051 3300046531 Bacteria 1296
869 Ga0495665_0155233 3300046531 Bacteria 1194
870 Ga0495640_0000643 3300046533 Bacteria 25833
871 Ga0495640_0004495 3300046533 Bacteria 11121
872 Ga0495640_0008299 3300046533 Bacteria 8143
873 Ga0495640_0023100 3300046533 Bacteria 4539
874 Ga0495640_0065176 3300046533 Bacteria 2460
875 Ga0495640_0207845 3300046533 Bacteria 1238
876 Ga0495640_0237932 3300046533 Bacteria 1143
877 Ga0495640_0280070 3300046533 Bacteria 1038
878 Ga0495586_0009695 3300046535 Bacteria 5128
879 Ga0495586_0026940 3300046535 Bacteria 3076
880 Ga0495587_0002652 3300046536 Bacteria 11952
881 Ga0495587_0005531 3300046536 Bacteria 8244
882 Ga0495587_0057592 3300046536 Bacteria 2284
883 Ga0495587_0155572 3300046536 Bacteria 1302
884 Ga0495598_0018175 3300046537 Bacteria 1823
885 Ga0495621_0192707 3300046539 Bacteria 817
886 Ga0495645_0001639 3300046543 Bacteria 15179
887 Ga0495645_0003190 3300046543 Bacteria 11112
888 Ga0495645_0022506 3300046543 Bacteria 4560
889 Ga0495645_0042462 3300046543 Bacteria 3315
890 Ga0495622_0040898 3300046557 Bacteria 2156
891 Ga0495633_0067210 3300046558 Bacteria 1674
892 Ga0495633_0084221 3300046558 Bacteria 1479
893 Ga0495667_0001890 3300046559 Bacteria 13905
894 Ga0495667_0005963 3300046559 Bacteria 8239
895 Ga0495667_0037515 3300046559 Bacteria 3229
896 Ga0495667_0042664 3300046559 Bacteria 3008
897 Ga0495667_0060106 3300046559 Bacteria 2493
898 Ga0495667_0088242 3300046559 Bacteria 2010
899 Ga0495656_0003447 3300046615 Bacteria 5347
900 Ga0495656_0026584 3300046615 Bacteria 2305
901 Ga0495634_0012116 3300046642 Bacteria 6248
902 Ga0495634_0018062 3300046642 Bacteria 5025
903 Ga0495634_0018938 3300046642 Bacteria 4895
904 Ga0495634_0033844 3300046642 Bacteria 3509
905 Ga0495634_0038180 3300046642 Bacteria 3275
906 Ga0495634_0101360 3300046642 Bacteria 1860
907 Ga0495634_0116846 3300046642 Bacteria 1711
908 Ga0495635_0000337 3300046663 Bacteria 30021
909 Ga0495635_0001865 3300046663 Bacteria 14269
910 Ga0495635_0006483 3300046663 Bacteria 8162
911 Ga0495635_0016846 3300046663 Bacteria 5104
912 Ga0495635_0076773 3300046663 Bacteria 2289
913 Ga0495635_0080514 3300046663 Bacteria 2229
914 Ga0495635_0163615 3300046663 Bacteria 1514
915 Ga0495659_0005965 3300046664 Bacteria 3853
916 Ga0495659_0221563 3300046664 Bacteria 781
917 Ga0495661_0065266 3300046665 Bacteria 2145
918 Ga0495588_0012438 3300046674 Bacteria 4023
919 Ga0495588_0014961 3300046674 Bacteria 3724
920 Ga0495588_0153045 3300046674 Bacteria 1219
921 Ga0495657_0001580 3300046675 Bacteria 19584
922 Ga0495657_0011547 3300046675 Bacteria 6601
923 Ga0495657_0014186 3300046675 Bacteria 5856
924 Ga0495657_0022703 3300046675 Bacteria 4490
925 Ga0495657_0273900 3300046675 Bacteria 1011
926 Ga0495599_0002450 3300046678 Bacteria 10814
927 Ga0495599_0004705 3300046678 Bacteria 8102
928 Ga0495599_0008858 3300046678 Bacteria 6126
929 Ga0495599_0097826 3300046678 Bacteria 1829
930 Ga0495599_0099226 3300046678 Bacteria 1815
931 Ga0495623_0003302 3300046679 Bacteria 10657
932 Ga0495623_0004415 3300046679 Bacteria 9243
933 Ga0495623_0007570 3300046679 Bacteria 7049
934 Ga0495623_0070830 3300046679 Bacteria 2171
935 Ga0495646_0008689 3300046680 Bacteria 6456
936 Ga0495646_0009141 3300046680 Bacteria 6286
937 Ga0495646_0155680 3300046680 Bacteria 1268
938 Ga0495647_0000425 3300046681 Bacteria 12065
939 Ga0495647_0003921 3300046681 Bacteria 4803
940 Ga0495647_0011744 3300046681 Bacteria 3004
941 Ga0495647_0055163 3300046681 Bacteria 1555
942 Ga0495647_0062514 3300046681 Bacteria 1472
943 Ga0495647_0094537 3300046681 Bacteria 1230
944 Ga0495658_0002141 3300046683 Bacteria 9990
945 Ga0495658_0080016 3300046683 Bacteria 1916
946 Ga0495658_0256916 3300046683 Bacteria 1099
947 Ga0495613_0006654 3300046689 Bacteria 8632
948 Ga0495613_0061717 3300046689 Bacteria 2744
949 Ga0495613_0074369 3300046689 Bacteria 2474
950 Ga0495613_0079595 3300046689 Bacteria 2383
951 Ga0495613_0188278 3300046689 Bacteria 1459
952 Ga0495624_0002150 3300046690 Bacteria 15030
953 Ga0495624_0016820 3300046690 Bacteria 4921
954 Ga0495624_0031899 3300046690 Bacteria 3421
955 Ga0495624_0037502 3300046690 Bacteria 3117
956 Ga0495624_0054674 3300046690 Bacteria 2516
957 Ga0495624_0083551 3300046690 Bacteria 1974
958 Ga0495671_0100654 3300046692 Bacteria 1413
959 Ga0495589_0038693 3300046794 Bacteria 2386
960 Ga0495600_0003717 3300046809 Bacteria 9019
961 Ga0495600_0012024 3300046809 Bacteria 5405
962 Ga0495600_0077207 3300046809 Bacteria 2175
963 Ga0495600_0192020 3300046809 Bacteria 1313
964 Ga0495581_0020224 3300047315 Bacteria 3864
965 Ga0495581_0183974 3300047315 Bacteria 1222
966 Ga0495604_0000619 3300047317 Bacteria 30531
967 Ga0495604_0002250 3300047317 Bacteria 15465
968 Ga0495604_0009792 3300047317 Bacteria 7580
969 Ga0495604_0013676 3300047317 Bacteria 6472
970 Ga0495604_0052907 3300047317 Bacteria 3142
971 Ga0495604_0179819 3300047317 Bacteria 1480
972 Ga0495674_0001395 3300047319 Bacteria 23609
973 Ga0495674_0015878 3300047319 Bacteria 7029
974 Ga0495674_0023981 3300047319 Bacteria 5612
975 Ga0495674_0027710 3300047319 Bacteria 5174
976 Ga0495674_0065812 3300047319 Bacteria 3147
977 Ga0495674_0074951 3300047319 Bacteria 2912
978 Ga0495674_0084875 3300047319 Bacteria 2713
979 Ga0495674_0405787 3300047319 Bacteria 1099
980 Ga0495674_0541519 3300047319 Bacteria 927
981 Ga0495672_0143094 3300047320 Bacteria 1247
982 Ga0495676_0005796 3300047321 Bacteria 11329
983 Ga0495676_0040689 3300047321 Bacteria 3833
984 Ga0495676_0076463 3300047321 Bacteria 2556
985 Ga0495676_0101380 3300047321 Bacteria 2130
986 Ga0495676_0190769 3300047321 Bacteria 1429
987 Ga0495676_0210182 3300047321 Bacteria 1346
988 Ga0495680_0002033 3300047322 Bacteria 21172
989 Ga0495680_0002310 3300047322 Bacteria 19589
990 Ga0495680_0002550 3300047322 Bacteria 18591
991 Ga0495680_0008188 3300047322 Bacteria 9532
992 Ga0495680_0031481 3300047322 Bacteria 4317
993 Ga0495680_0034782 3300047322 Bacteria 4065
994 Ga0495680_0037738 3300047322 Bacteria 3869
995 Ga0495680_0143040 3300047322 Bacteria 1749
996 Ga0495680_0338185 3300047322 Bacteria 1050
997 Ga0495675_0000716 3300047444 Bacteria 20715
998 Ga0495675_0004772 3300047444 Bacteria 8236
999 Ga0495675_0018579 3300047444 Bacteria 4413
1000 Ga0495675_0131508 3300047444 Bacteria 1555
1001 Ga0495677_0079814 3300047445 Bacteria 1226
1002 Ga0495685_026414 3300047447 Bacteria 1998
1003 Ga0495684_0000825 3300047471 Bacteria 25064
1004 Ga0495684_0004726 3300047471 Bacteria 10637
1005 Ga0495684_0007901 3300047471 Bacteria 8227
1006 Ga0495684_0016020 3300047471 Bacteria 5772
1007 Ga0495684_0026005 3300047471 Bacteria 4498
1008 Ga0495684_0032246 3300047471 Bacteria 4021
1009 Ga0495684_0056487 3300047471 Bacteria 2993
1010 Ga0495684_0086977 3300047471 Bacteria 2369
1011 Ga0495684_0231612 3300047471 Bacteria 1351
1012 Ga0495593_0003064 3300047673 Bacteria 10067
1013 Ga0495593_0007837 3300047673 Bacteria 6223
1014 Ga0495593_0037487 3300047673 Bacteria 2622
1015 Ga0495593_0050529 3300047673 Bacteria 2202
1016 Ga0495593_0052707 3300047673 Bacteria 2149
1017 Ga0495593_0142428 3300047673 Bacteria 1214
1018 Ga0495602_0001747 3300048088 Bacteria 21667
1019 Ga0495602_0043075 3300048088 Bacteria 4107
1020 Ga0495614_0156518 3300048089 Bacteria 1018
1021 Ga0495614_0209180 3300048089 Bacteria 884
1022 Ga0496100_0001536 3300048903 Bacteria 11327
1023 Ga0496100_0022035 3300048903 Bacteria 3848
1024 Ga0496100_0030732 3300048903 Bacteria 3333
1025 Ga0496100_0052100 3300048903 Bacteria 2659
1026 Ga0496100_0096185 3300048903 Bacteria 2031
1027 Ga0496100_0258618 3300048903 Bacteria 1290
1028 Ga0496101_0005474 3300048904 Bacteria 8097
1029 Ga0496101_0025559 3300048904 Bacteria 4098
1030 Ga0496101_0040327 3300048904 Bacteria 3325
1031 Ga0496101_0090526 3300048904 Bacteria 2275
1032 Ga0496102_0006414 3300048905 Bacteria 10028
1033 Ga0496102_0040169 3300048905 Bacteria 4230
1034 Ga0496102_0152457 3300048905 Bacteria 2172
1035 Ga0496102_0234587 3300048905 Bacteria 1729
1036 Ga0496102_0609982 3300048905 Bacteria 1014
1037 Ga0496103_0010767 3300048906 Bacteria 5411
1038 Ga0496103_0020771 3300048906 Bacteria 3947
1039 Ga0496103_0024227 3300048906 Bacteria 3661
1040 Ga0496104_0000406 3300048907 Bacteria 37705
1041 Ga0496104_0001510 3300048907 Bacteria 20080
1042 Ga0496104_0007033 3300048907 Bacteria 9922
1043 Ga0496104_0037709 3300048907 Bacteria 4519
1044 Ga0496104_0063344 3300048907 Bacteria 3506
1045 Ga0496104_0081673 3300048907 Bacteria 3082
1046 Ga0496104_0204045 3300048907 Bacteria 1888
1047 Ga0496104_0459027 3300048907 Bacteria 1185
1048 Ga0496105_0001047 3300048908 Bacteria 19154
1049 Ga0496105_0001986 3300048908 Bacteria 14735
1050 Ga0496105_0002573 3300048908 Bacteria 13183
1051 Ga0496105_0012460 3300048908 Bacteria 6732
1052 Ga0496105_0033425 3300048908 Bacteria 4223
1053 Ga0496105_0037663 3300048908 Bacteria 3982
1054 Ga0496105_0047296 3300048908 Bacteria 3550
1055 Ga0496105_0095056 3300048908 Bacteria 2461
1056 Ga0496105_0130752 3300048908 Bacteria 2069
1057 Ga0496106_0003156 3300048909 Bacteria 12301
1058 Ga0496106_0019108 3300048909 Bacteria 5079
1059 Ga0496106_0073799 3300048909 Bacteria 2610
1060 Ga0496106_0143187 3300048909 Bacteria 1881
1061 Ga0496106_0197987 3300048909 Bacteria 1598
1062 Ga0496106_0288080 3300048909 Bacteria 1316
1063 Ga0496107_0013464 3300048910 Bacteria 5717
1064 Ga0496107_0018862 3300048910 Bacteria 4862
1065 Ga0496107_0036358 3300048910 Bacteria 3532
1066 Ga0496107_0049621 3300048910 Bacteria 3024
1067 Ga0496107_0225393 3300048910 Bacteria 1394
1068 Ga0496108_0002003 3300048911 Bacteria 16322
1069 Ga0496108_0013605 3300048911 Bacteria 6642
1070 Ga0496108_0048580 3300048911 Bacteria 3547
1071 Ga0496108_0057445 3300048911 Bacteria 3269
1072 Ga0496108_0108311 3300048911 Bacteria 2373
1073 Ga0496108_0152277 3300048911 Bacteria 1996
1074 Ga0496108_0198026 3300048911 Bacteria 1743
1075 Ga0496109_0001830 3300048912 Bacteria 17639
1076 Ga0496109_0013278 3300048912 Bacteria 7134
1077 Ga0496109_0028719 3300048912 Bacteria 4979
1078 Ga0496109_0091169 3300048912 Bacteria 2818
1079 Ga0496109_0102900 3300048912 Bacteria 2650
1080 Ga0496109_0145321 3300048912 Bacteria 2218
1081 Ga0496109_0219390 3300048912 Bacteria 1788
1082 Ga0496109_0394053 3300048912 Bacteria 1308
1083 Ga0496110_0016733 3300048913 Bacteria 6125
1084 Ga0496110_0023741 3300048913 Bacteria 5218
1085 Ga0496110_0057471 3300048913 Bacteria 3424
1086 Ga0496110_0145822 3300048913 Bacteria 2141
1087 Ga0496110_0163870 3300048913 Bacteria 2015
1088 Ga0496110_0189587 3300048913 Bacteria 1867
1089 Ga0496111_0012150 3300048914 Bacteria 5824
1090 Ga0496111_0038112 3300048914 Bacteria 3442
1091 Ga0496111_0056798 3300048914 Bacteria 2832
1092 Ga0496111_0089090 3300048914 Bacteria 2260
1093 Ga0496111_0094932 3300048914 Bacteria 2187
1094 Ga0496111_0258695 3300048914 Bacteria 1291
1095 Ga0496111_0460249 3300048914 Bacteria 938
1096 Ga0496112_0002042 3300048915 Bacteria 15992
1097 Ga0496112_0043069 3300048915 Bacteria 4418
1098 Ga0496112_0590802 3300048915 Bacteria 1042
1099 Ga0496113_0003321 3300048916 Bacteria 9609
1100 Ga0496113_0020069 3300048916 Bacteria 4691
1101 Ga0496113_0053545 3300048916 Bacteria 3017
1102 Ga0496113_0087728 3300048916 Bacteria 2392
1103 Ga0496113_0097495 3300048916 Bacteria 2274
1104 Ga0496113_0280749 3300048916 Bacteria 1332
1105 Ga0496114_0006915 3300048917 Bacteria 8937
1106 Ga0496114_0033768 3300048917 Bacteria 4217
1107 Ga0496114_0039534 3300048917 Bacteria 3903
1108 Ga0496114_0242430 3300048917 Bacteria 1585
1109 Ga0496114_0334692 3300048917 Bacteria 1338
1110 Ga0496114_0634760 3300048917 Bacteria 940
1111 Ga0496114_0645353 3300048917 Bacteria 931
1112 Ga0496115_0003503 3300048918 Bacteria 11282
1113 Ga0496115_0013117 3300048918 Bacteria 6258
1114 Ga0496115_0014503 3300048918 Bacteria 5966
1115 Ga0496115_0032072 3300048918 Bacteria 4143
1116 Ga0496115_0040074 3300048918 Bacteria 3722
1117 Ga0496115_0041134 3300048918 Bacteria 3676
1118 Ga0496115_0100073 3300048918 Bacteria 2376
1119 Ga0496115_0140904 3300048918 Bacteria 1989
1120 Ga0496115_0219889 3300048918 Bacteria 1567
1121 Ga0496115_0346305 3300048918 Bacteria 1212
1122 Ga0501031_0008274 3300049568 Bacteria 6766
1123 Ga0501032_0093601 3300049569 Bacteria 1993
1124 Ga0501032_0097746 3300049569 Bacteria 1945
1125 Ga0501033_0057588 3300049570 Bacteria 2871
1126 Ga0501033_0115385 3300049570 Bacteria 1951
1127 Ga0501033_0164632 3300049570 Bacteria 1595
1128 Ga0501034_0000593 3300049571 Bacteria 57233
1129 Ga0501034_0016957 3300049571 Bacteria 7466
1130 Ga0501034_0226612 3300049571 Bacteria 1820
1131 Ga0501034_0430976 3300049571 Bacteria 1238
1132 Ga0501036_0026682 3300049572 Bacteria 4879
1133 Ga0501036_0057013 3300049572 Bacteria 3309
1134 Ga0501036_0141350 3300049572 Bacteria 2031
1135 Ga0501036_0169157 3300049572 Bacteria 1842
1136 Ga0501036_0456938 3300049572 Bacteria 1064
1137 Ga0501037_0012848 3300049573 Bacteria 6172
1138 Ga0501037_0064905 3300049573 Bacteria 2660
1139 Ga0501037_0160685 3300049573 Bacteria 1601
1140 Ga0501038_0026716 3300049574 Bacteria 5139
1141 Ga0501038_0059924 3300049574 Bacteria 3259
1142 Ga0501039_0076719 3300049575 Bacteria 2598
1143 Ga0501040_0098416 3300049576 Bacteria 2038
1144 Ga0501041_0134985 3300049577 Bacteria 1538
1145 Ga0501042_0114111 3300049578 Bacteria 1945
1146 Ga0501043_0019458 3300049579 Bacteria 5328
1147 Ga0501046_0012009 3300049580 Bacteria 7389
1148 Ga0501046_0164436 3300049580 Bacteria 1667
1149 Ga0501046_0456213 3300049580 Bacteria 919
1150 Ga0501047_0012917 3300049581 Bacteria 7911
1151 Ga0501047_0062788 3300049581 Bacteria 3583
1152 Ga0501047_0132919 3300049581 Bacteria 2368
1153 Ga0501047_0195045 3300049581 Bacteria 1887
1154 Ga0501048_0019492 3300049582 Bacteria 4976
1155 Ga0501067_0025678 3300049583 Bacteria 3265
1156 Ga0501067_0082310 3300049583 Bacteria 1785
1157 Ga0501068_0076589 3300049584 Bacteria 2047
1158 Ga0501068_0344379 3300049584 Bacteria 957
1159 Ga0501069_0003092 3300049585 Bacteria 8526
1160 Ga0501070_0053826 3300049586 Bacteria 3337
1161 Ga0501070_0142396 3300049586 Bacteria 1979
1162 Ga0501070_0148487 3300049586 Bacteria 1935
1163 Ga0501070_0153673 3300049586 Bacteria 1898
1164 Ga0501070_0307918 3300049586 Bacteria 1290
1165 Ga0501070_0534528 3300049586 Bacteria 940
1166 Ga0501071_0015807 3300049587 Bacteria 5184
1167 Ga0501071_0565425 3300049587 Bacteria 874
1168 Ga0501072_0004057 3300049588 Bacteria 11086
1169 Ga0501072_0036400 3300049588 Bacteria 3858
1170 Ga0501072_0059733 3300049588 Bacteria 3006
1171 Ga0501073_0006160 3300049589 Bacteria 8952
1172 Ga0501073_0034498 3300049589 Bacteria 3601
1173 Ga0501073_0061364 3300049589 Bacteria 2623
1174 Ga0501073_0145579 3300049589 Bacteria 1642
1175 Ga0501074_0015124 3300049590 Bacteria 5610
1176 Ga0501074_0022331 3300049590 Bacteria 4596
1177 Ga0501074_0140500 3300049590 Bacteria 1727
1178 Ga0501074_0198040 3300049590 Bacteria 1432
1179 Ga0501074_0351118 3300049590 Bacteria 1047
1180 Ga0501075_0212613 3300049591 Bacteria 1475
1181 Ga0501075_0308237 3300049591 Bacteria 1206
1182 Ga0501075_0442412 3300049591 Unclassified 991
1183 Ga0501076_0107116 3300049592 Bacteria 2257
1184 Ga0501076_0124635 3300049592 Bacteria 2087
1185 Ga0501076_0221790 3300049592 Bacteria 1545
1186 Ga0501076_0281744 3300049592 Bacteria 1362
1187 Ga0501077_0005408 3300049593 Bacteria 7765
1188 Ga0501077_0031147 3300049593 Bacteria 3393
1189 Ga0501077_0071960 3300049593 Bacteria 2191
1190 Ga0501077_0211360 3300049593 Bacteria 1233
1191 Ga0501077_0303591 3300049593 Bacteria 1017
1192 Ga0501079_0009679 3300049741 Bacteria 7308
1193 Ga0501079_0018353 3300049741 Bacteria 5347
1194 Ga0501079_0172569 3300049741 Bacteria 1686
1195 Ga0501080_0017501 3300049742 Bacteria 6628
1196 Ga0501080_0090883 3300049742 Bacteria 2835
1197 Ga0501080_0116435 3300049742 Bacteria 2477
1198 Ga0501080_0165945 3300049742 Bacteria 2038
1199 Ga0501081_0032259 3300049743 Bacteria 3553
1200 Ga0501081_0057536 3300049743 Bacteria 2688
1201 Ga0501081_0143881 3300049743 Bacteria 1710
1202 Ga0501081_0314749 3300049743 Bacteria 1150
1203 Ga0501083_0017077 3300049744 Bacteria 5064
1204 Ga0501083_0047603 3300049744 Bacteria 2897
1205 Ga0501083_0085177 3300049744 Bacteria 2091
1206 Ga0501083_0109942 3300049744 Bacteria 1812
1207 Ga0501083_0355186 3300049744 Bacteria 953
1208 Ga0501035_0095026 3300049822 Bacteria 2620
1209 Ga0501035_0294977 3300049822 Bacteria 1367
1210 Ga0501044_0043598 3300049823 Bacteria 4659
1211 Ga0501044_0122691 3300049823 Bacteria 2597
1212 Ga0501044_0125584 3300049823 Bacteria 2563
1213 Ga0501044_0371075 3300049823 Bacteria 1347
1214 Ga0501045_0177283 3300049824 Bacteria 1588
1215 nmdc:mga03683_175051_c1 3300050489 Bacteria 977
1216 nmdc:mga0yw44_3557_c1 3300050492 Bacteria 6945
1217 nmdc:mga0yw44_506_c1 3300050492 Bacteria 13926
1218 nmdc:mga0yw44_98043_c1 3300050492 Bacteria 1863
1219 nmdc:mga0k408_3642_c1 3300050493 Bacteria 8157
1220 nmdc:mga04h51_35371_c1 3300050495 Bacteria 1601
1221 nmdc:mga05p37_115589_c1 3300050507 Bacteria 3298
1222 nmdc:mga05p37_12664_c1 3300050507 Bacteria 10076
1223 nmdc:mga05p37_1375_c1 3300050507 Bacteria 28284
1224 nmdc:mga05p37_1568_c1 3300050507 Bacteria 26557
1225 nmdc:mga05p37_189659_c1 3300050507 Bacteria 2497
1226 nmdc:mga09592_1386_c1 3300050508 Bacteria 19389
1227 nmdc:mga09592_9070_c2 3300050508 Bacteria 1479
1228 nmdc:mga0qj67_3364_c1 3300050509 Bacteria 11534
1229 nmdc:mga0qj67_959_c1 3300050509 Bacteria 19847
1230 nmdc:mga06r32_134_c1 3300050510 Bacteria 54737
1231 nmdc:mga06r32_306204_c1 3300050510 Bacteria 1574
1232 nmdc:mga06r32_4090_c1 3300050510 Bacteria 13078
1233 nmdc:mga06r32_526715_c1 3300050510 Bacteria 1157
1234 nmdc:mga06r32_555472_c1 3300050510 Bacteria 1122
1235 nmdc:mga06r32_592_c1 3300050510 Bacteria 31540
1236 nmdc:mga06r32_82747_c1 3300050510 Bacteria 3127
1237 nmdc:mga08y16_108_c1 3300050511 Bacteria 69804
1238 nmdc:mga08y16_177801_c1 3300050511 Bacteria 2210
1239 nmdc:mga08y16_341934_c1 3300050511 Bacteria 1538
1240 nmdc:mga08y16_59205_c1 3300050511 Bacteria 4002
1241 nmdc:mga08y16_67147_c1 3300050511 Bacteria 3741
1242 nmdc:mga08y16_725793_c1 3300050511 Bacteria 991
1243 nmdc:mga08y16_961_c1 3300050511 Bacteria 28000
1244 nmdc:mga0n895_277356_c1 3300050512 Bacteria 1700
1245 nmdc:mga0n895_295587_c1 3300050512 Bacteria 1642
1246 nmdc:mga0n895_337_c1 3300050512 Bacteria 31380
1247 nmdc:mga0n895_354558_c1 3300050512 Bacteria 1486
1248 nmdc:mga0n895_406_c1 3300050512 Bacteria 28847
1249 nmdc:mga0n895_53313_c1 3300050512 Bacteria 3974
1250 nmdc:mga0n895_70196_c1 3300050512 Bacteria 3472
1251 nmdc:mga0rr50_1110_c1 3300050513 Bacteria 14607
1252 nmdc:mga0rr50_194356_c1 3300050513 Bacteria 1664
1253 nmdc:mga0rr50_39218_c1 3300050513 Bacteria 3434
1254 nmdc:mga0rr50_605847_c1 3300050513 Bacteria 934
1255 nmdc:mga0rr50_95538_c1 3300050513 Bacteria 2323
1256 nmdc:mga08x19_127456_c1 3300050514 Bacteria 1710
1257 nmdc:mga08x19_141387_c1 3300050514 Bacteria 1626
1258 nmdc:mga08x19_262858_c1 3300050514 Bacteria 1193
1259 nmdc:mga08x19_281080_c1 3300050514 Bacteria 1153
1260 nmdc:mga0a205_2128_c1 3300050515 Bacteria 17383
1261 nmdc:mga0a205_2355_c1 3300050515 Bacteria 9637
1262 Ga0495601_0000620 3300053077 Bacteria 18909
1263 Ga0495601_0000644 3300053077 Bacteria 18615
1264 Ga0495601_0002141 3300053077 Bacteria 11109
1265 Ga0495601_0005888 3300053077 Bacteria 7148
1266 Ga0495601_0011286 3300053077 Bacteria 5340
1267 Ga0495601_0012098 3300053077 Bacteria 5172
1268 Ga0495601_0025835 3300053077 Bacteria 3623
1269 Ga0495601_0032738 3300053077 Bacteria 3237
1270 Ga0495601_0069363 3300053077 Bacteria 2249
1271 Ga0495601_0158795 3300053077 Bacteria 1477
1272 Ga0495601_0297035 3300053077 Bacteria 1052
1273 Ga0495612_0007575 3300053078 Bacteria 4435
1274 Ga0495612_0012717 3300053078 Bacteria 3392
1275 Ga0495612_0023074 3300053078 Bacteria 2494
1276 Ga0495612_0028557 3300053078 Bacteria 2246
1277 Ga0495655_0046578 3300053083 Bacteria 1131
1278 Ga0495595_0000357 3300053084 Bacteria 17350
1279 Ga0495595_0000433 3300053084 Bacteria 15833
1280 Ga0495595_0001562 3300053084 Bacteria 8936
1281 Ga0495595_0002261 3300053084 Bacteria 7496
1282 Ga0495595_0047641 3300053084 Bacteria 1978
1283 Ga0495619_0000048 3300053085 Bacteria 102117
1284 Ga0495619_0000314 3300053085 Bacteria 33926
1285 Ga0495619_0001178 3300053085 Bacteria 17227
1286 Ga0495619_0002963 3300053085 Bacteria 11018
1287 Ga0495619_0003221 3300053085 Bacteria 10568
1288 Ga0495619_0004731 3300053085 Bacteria 8659
1289 Ga0495619_0009018 3300053085 Bacteria 6293
1290 Ga0495619_0017743 3300053085 Bacteria 4509
1291 Ga0495619_0021240 3300053085 Bacteria 4142
1292 Ga0495619_0058437 3300053085 Bacteria 2560
1293 Ga0495619_0062986 3300053085 Bacteria 2470
1294 Ga0495619_0418470 3300053085 Bacteria 924
1295 Ga0500644_0000713 3300053088 Bacteria 11764
1296 Ga0500651_0018327 3300053093 Bacteria 4332
1297 Ga0500566_0007013 3300053094 Bacteria 6667
1298 Ga0500595_000003 3300053119 Bacteria 419332
1299 Ga0500652_006382 3300053131 Bacteria 3795
1300 Ga0500616_0000002 3300053153 Bacteria 1611257
1301 Ga0500616_0039792 3300053153 Bacteria 2532
1302 Ga0500645_000217 3300053730 Bacteria 43911
1303 Ga0501084_0028014 3300054114 Bacteria 4708
1304 Ga0501084_0063132 3300054114 Bacteria 3101
1305 Ga0501084_0257523 3300054114 Bacteria 1473
1306 Ga0501084_0419872 3300054114 Bacteria 1131
1307 Ga0501084_0646597 3300054114 Bacteria 893
1308 Ga0501082_0001104 3300060353 Bacteria 23858
1309 Ga0501082_0072550 3300060353 Bacteria 2965
1310 Ga0501082_0074289 3300060353 Bacteria 2928
1311 Ga0501082_0116499 3300060353 Bacteria 2314
1312 Ga0501082_0118981 3300060353 Bacteria 2289
1313 Ga0501082_0127023 3300060353 Bacteria 2211
1314 Ga0501082_0129875 3300060353 Bacteria 2186
1315 Ga0501082_0250686 3300060353 Bacteria 1541
1316 Ga0530510_0295341 3300061734 Bacteria 1212
1317 Ga0530510_0426645 3300061734 Bacteria 1001

MSA Aligner

Family Sequences

Sample Scaffold Protein Protein Length
1 3300047320 Ga0495672_0143094 Ga0495672_0143094_231_1025 211
2 3300046472 Ga0495580_0621425 Ga0495580_0621425_23_685 217
3 3300006038 Ga0075365_10151434 Ga0075365_101514342 218
4 3300006844 Ga0075428_100214741 Ga0075428_1002147412 218
5 3300006847 Ga0075431_100291859 Ga0075431_1002918592 218
6 3300050492 nmdc:mga0yw44_98043_c1 nmdc:mga0yw44_98043_c1_474_1208 218
7 3300050510 nmdc:mga06r32_555472_c1 nmdc:mga06r32_555472_c1_190_924 218
8 3300049583 Ga0501067_0082310 Ga0501067_0082310_367_1104 223
9 3300049589 Ga0501073_0006160 Ga0501073_0006160_6457_7194 223
10 3300060353 Ga0501082_0074289 Ga0501082_0074289_1980_2717 223
11 3300006847 Ga0075431_100404160 Ga0075431_1004041602 224
12 3300005937 Ga0081455_10123144 Ga0081455_101231443 226
13 3300036647 Ga0316582_0005151 Ga0316582_0005151_4098_4814 228
14 3300037588 Ga0316581_0083955 Ga0316581_0083955_20_736 228
15 3300005937 Ga0081455_10006153 Ga0081455_1000615315 232
16 3300037466 Ga0395898_0204484 Ga0395898_0204484_532_1269 232
17 3300048905 Ga0496102_0609982 Ga0496102_0609982_46_774 232
18 3300048907 Ga0496104_0000406 Ga0496104_0000406_24601_25332 232
19 3300048907 Ga0496104_0007033 Ga0496104_0007033_7963_8691 232
20 3300048908 Ga0496105_0001047 Ga0496105_0001047_14288_15019 232
21 3300048908 Ga0496105_0002573 Ga0496105_0002573_11924_12652 232
22 3300048911 Ga0496108_0198026 Ga0496108_0198026_511_1242 232
23 3300048912 Ga0496109_0028719 Ga0496109_0028719_2502_3230 232
24 3300048912 Ga0496109_0394053 Ga0496109_0394053_84_815 232
25 3300048916 Ga0496113_0280749 Ga0496113_0280749_562_1290 232
26 3300048917 Ga0496114_0634760 Ga0496114_0634760_142_873 232
27 3300048917 Ga0496114_0645353 Ga0496114_0645353_77_805 232
28 3300048918 Ga0496115_0100073 Ga0496115_0100073_582_1310 232
29 3300050507 nmdc:mga05p37_189659_c1 nmdc:mga05p37_189659_c1_633_1370 232
30 3300049743 Ga0501081_0314749 Ga0501081_0314749_181_909 233
31 iso_pu_bacteria 2838675328 2838679183 235
32 iso_pu_bacteria 2838714209 2838719028 235
33 iso_pu_bacteria 2838719591 2838724027 235
34 iso_pu_bacteria 2838724970 2838728861 235
35 iso_pu_bacteria 2841846520 2841850152 235
36 iso_pu_bacteria 2842124991 2842128624 235
37 iso_pu_bacteria 2842130223 2842134085 235
38 iso_pu_bacteria 2842152218 2842156081 235
39 iso_pu_bacteria 2842170452 2842175274 235
40 iso_pu_bacteria 2842175837 2842179826 235
41 iso_pu_bacteria 2842187318 2842191839 235
42 iso_pu_bacteria 2842211629 2842216156 235
43 iso_pu_bacteria 2842224351 2842228792 235
44 iso_pu_bacteria 2919114240 2919117821 235
45 iso_pu_bacteria 2926754445 2926757626 235
46 iso_pu_bacteria 2933006813 2933010226 235
47 3300054114 Ga0501084_0646597 Ga0501084_0646597_144_869 238
48 3300001977 JGI24746J21847_1024205 JGI24746J21847_10242051 239
49 3300001991 JGI24743J22301_10003444 JGI24743J22301_100034442 239
50 3300002077 JGI24744J21845_10004555 JGI24744J21845_100045553 239
51 3300002244 JGI24742J22300_10017014 JGI24742J22300_100170142 239
52 3300003911 JGI25405J52794_10028521 JGI25405J52794_100285212 239
53 3300005327 Ga0070658_10301684 Ga0070658_103016841 239
54 3300005331 Ga0070670_100007686 Ga0070670_1000076863 239
55 3300005331 Ga0070670_100162184 Ga0070670_1001621842 239
56 3300005335 Ga0070666_10219793 Ga0070666_102197931 239
57 3300005338 Ga0068868_100011568 Ga0068868_1000115683 239
58 3300005340 Ga0070689_100002706 Ga0070689_1000027069 239
59 3300005343 Ga0070687_100166370 Ga0070687_1001663702 239
60 3300005345 Ga0070692_10287006 Ga0070692_102870062 239
61 3300005347 Ga0070668_100151059 Ga0070668_1001510592 239
62 3300005347 Ga0070668_100197024 Ga0070668_1001970242 239
63 3300005353 Ga0070669_100268686 Ga0070669_1002686862 239
64 3300005354 Ga0070675_100058680 Ga0070675_1000586802 239
65 3300005355 Ga0070671_100034879 Ga0070671_1000348792 239
66 3300005356 Ga0070674_100609455 Ga0070674_1006094552 239
67 3300005364 Ga0070673_100156083 Ga0070673_1001560832 239
68 3300005365 Ga0070688_100018218 Ga0070688_1000182182 239
69 3300005366 Ga0070659_100074146 Ga0070659_1000741462 239
70 3300005367 Ga0070667_100231853 Ga0070667_1002318532 239
71 3300005438 Ga0070701_10005183 Ga0070701_100051834 239
72 3300005439 Ga0070711_100159121 Ga0070711_1001591212 239
73 3300005441 Ga0070700_100085331 Ga0070700_1000853312 239
74 3300005441 Ga0070700_100596852 Ga0070700_1005968521 239
75 3300005456 Ga0070678_100153890 Ga0070678_1001538902 239
76 3300005543 Ga0070672_100036343 Ga0070672_1000363434 239
77 3300005544 Ga0070686_100257933 Ga0070686_1002579332 239
78 3300005548 Ga0070665_100060023 Ga0070665_1000600233 239
79 3300005548 Ga0070665_100274222 Ga0070665_1002742222 239
80 3300005549 Ga0070704_100240320 Ga0070704_1002403202 239
81 3300005564 Ga0070664_100364938 Ga0070664_1003649382 239
82 3300005564 Ga0070664_100569054 Ga0070664_1005690542 239
83 3300005578 Ga0068854_100112363 Ga0068854_1001123633 239
84 3300005615 Ga0070702_100042202 Ga0070702_1000422022 239
85 3300005617 Ga0068859_100028616 Ga0068859_1000286165 239
86 3300005618 Ga0068864_100148927 Ga0068864_1001489272 239
87 3300005719 Ga0068861_100184414 Ga0068861_1001844142 239
88 3300005719 Ga0068861_100294189 Ga0068861_1002941892 239
89 3300005834 Ga0068851_10058442 Ga0068851_100584423 239
90 3300005840 Ga0068870_10007043 Ga0068870_100070432 239
91 3300005841 Ga0068863_100009723 Ga0068863_1000097232 239
92 3300005842 Ga0068858_100257420 Ga0068858_1002574202 239
93 3300005843 Ga0068860_100054689 Ga0068860_1000546894 239
94 3300005844 Ga0068862_100484115 Ga0068862_1004841152 239
95 3300005937 Ga0081455_10019331 Ga0081455_100193313 239
96 3300005981 Ga0081538_10101443 Ga0081538_101014432 239
97 3300006038 Ga0075365_10041567 Ga0075365_100415672 239
98 3300006038 Ga0075365_10042236 Ga0075365_100422363 239
99 3300006038 Ga0075365_10210986 Ga0075365_102109862 239
100 3300006038 Ga0075365_10228270 Ga0075365_102282702 239
101 3300006042 Ga0075368_10027359 Ga0075368_100273592 239
102 3300006048 Ga0075363_100194167 Ga0075363_1001941672 239
103 3300006051 Ga0075364_10293488 Ga0075364_102934881 239
104 3300006175 Ga0070712_100150566 Ga0070712_1001505662 239
105 3300006177 Ga0075362_10075904 Ga0075362_100759042 239
106 3300006178 Ga0075367_10075823 Ga0075367_100758232 239
107 3300006237 Ga0097621_100140217 Ga0097621_1001402172 239
108 3300006358 Ga0068871_100476848 Ga0068871_1004768482 239
109 3300006844 Ga0075428_100011046 Ga0075428_1000110465 239
110 3300006847 Ga0075431_100157437 Ga0075431_1001574373 239
111 3300006871 Ga0075434_100111741 Ga0075434_1001117412 239
112 3300006931 Ga0097620_100028617 Ga0097620_1000286175 239
113 3300007076 Ga0075435_100338575 Ga0075435_1003385752 239
114 3300009094 Ga0111539_10214376 Ga0111539_102143762 239
115 3300009094 Ga0111539_10614778 Ga0111539_106147782 239
116 3300009098 Ga0105245_10062920 Ga0105245_100629204 239
117 3300009101 Ga0105247_10027047 Ga0105247_100270474 239
118 3300009147 Ga0114129_10079730 Ga0114129_100797304 239
119 3300009148 Ga0105243_10216409 Ga0105243_102164092 239
120 3300009545 Ga0105237_10037364 Ga0105237_100373642 239
121 3300009551 Ga0105238_10888632 Ga0105238_108886321 239
122 3300010375 Ga0105239_10132832 Ga0105239_101328322 239
123 3300013308 Ga0157375_10039882 Ga0157375_100398824 239
124 3300014325 Ga0163163_10040807 Ga0163163_100408074 239
125 3300014968 Ga0157379_10200901 Ga0157379_102009012 239
126 3300014968 Ga0157379_10317670 Ga0157379_103176702 239
127 3300014969 Ga0157376_10072080 Ga0157376_100720802 239
128 3300025899 Ga0207642_10011215 Ga0207642_100112153 239
129 3300025900 Ga0207710_10091839 Ga0207710_100918392 239
130 3300025901 Ga0207688_10000186 Ga0207688_1000018620 239
131 3300025903 Ga0207680_10018727 Ga0207680_100187274 239
132 3300025904 Ga0207647_10051248 Ga0207647_100512482 239
133 3300025905 Ga0207685_10131792 Ga0207685_101317922 239
134 3300025907 Ga0207645_10014552 Ga0207645_100145523 239
135 3300025908 Ga0207643_10002007 Ga0207643_100020073 239
136 3300025911 Ga0207654_10488595 Ga0207654_104885952 239
137 3300025914 Ga0207671_10141865 Ga0207671_101418652 239
138 3300025915 Ga0207693_10028141 Ga0207693_100281411 239
139 3300025915 Ga0207693_10049890 Ga0207693_100498903 239
140 3300025915 Ga0207693_10488167 Ga0207693_104881672 239
141 3300025916 Ga0207663_10234972 Ga0207663_102349722 239
142 3300025918 Ga0207662_10010856 Ga0207662_100108562 239
143 3300025919 Ga0207657_10055032 Ga0207657_100550324 239
144 3300025923 Ga0207681_10517965 Ga0207681_105179651 239
145 3300025925 Ga0207650_10005265 Ga0207650_100052653 239
146 3300025925 Ga0207650_10038889 Ga0207650_100388892 239
147 3300025926 Ga0207659_10249286 Ga0207659_102492862 239
148 3300025927 Ga0207687_10093143 Ga0207687_100931432 239
149 3300025931 Ga0207644_10083701 Ga0207644_100837012 239
150 3300025932 Ga0207690_10098288 Ga0207690_100982882 239
151 3300025933 Ga0207706_10007571 Ga0207706_100075719 239
152 3300025934 Ga0207686_10057242 Ga0207686_100572423 239
153 3300025936 Ga0207670_10016339 Ga0207670_100163394 239
154 3300025937 Ga0207669_10075088 Ga0207669_100750882 239
155 3300025938 Ga0207704_10140792 Ga0207704_101407922 239
156 3300025940 Ga0207691_10010685 Ga0207691_100106855 239
157 3300025942 Ga0207689_10013137 Ga0207689_100131373 239
158 3300025960 Ga0207651_10584841 Ga0207651_105848412 239
159 3300025981 Ga0207640_10289236 Ga0207640_102892362 239
160 3300025986 Ga0207658_10093741 Ga0207658_100937412 239
161 3300026023 Ga0207677_10021647 Ga0207677_100216472 239
162 3300026041 Ga0207639_10222772 Ga0207639_102227722 239
163 3300026067 Ga0207678_10391743 Ga0207678_103917432 239
164 3300026075 Ga0207708_10003429 Ga0207708_100034299 239
165 3300026088 Ga0207641_10052682 Ga0207641_100526822 239
166 3300026089 Ga0207648_10004301 Ga0207648_100043019 239
167 3300026095 Ga0207676_10175058 Ga0207676_101750582 239
168 3300026116 Ga0207674_10033472 Ga0207674_100334724 239
169 3300026121 Ga0207683_10017988 Ga0207683_100179882 239
170 3300027866 Ga0209813_10064051 Ga0209813_100640512 239
171 3300027907 Ga0207428_10069927 Ga0207428_100699272 239
172 3300028379 Ga0268266_10372010 Ga0268266_103720102 239
173 3300028379 Ga0268266_10462497 Ga0268266_104624972 239
174 3300031456 Ga0307513_10003997 Ga0307513_100039973 239
175 3300031730 Ga0307516_10108311 Ga0307516_101083113 239
176 3300034957 Ga0373938_0069830 Ga0373938_0069830_95_826 239
177 3300035089 Ga0373944_0001954 Ga0373944_0001954_4197_4925 239
178 3300035116 Ga0373945_0020194 Ga0373945_0020194_846_1574 239
179 3300035170 Ga0373943_0029181 Ga0373943_0029181_346_1074 239
180 3300035171 Ga0373946_0030378 Ga0373946_0030378_1276_2004 239
181 3300035691 Ga0373931_0086997 Ga0373931_0086997_176_907 239
182 3300035692 Ga0373935_0121101 Ga0373935_0121101_291_1019 239
183 3300035695 Ga0373927_0031311 Ga0373927_0031311_1765_2493 239
184 3300035725 Ga0373947_0028814 Ga0373947_0028814_763_1491 239
185 3300036401 Ga0373937_1044532 Ga0373937_1044532_10_738 239
186 3300045051 Ga0451576_0209012 Ga0451576_0209012_555_1283 239
187 3300046453 Ga0495627_064297 Ga0495627_064297_281_1009 239
188 3300046461 Ga0495641_0029893 Ga0495641_0029893_985_1713 239
189 3300046461 Ga0495641_0073660 Ga0495641_0073660_501_1232 239
190 3300046473 Ga0495582_0002745 Ga0495582_0002745_5227_5955 239
191 3300046474 Ga0495605_0131484 Ga0495605_0131484_64_792 239
192 3300046492 Ga0495585_0016258 Ga0495585_0016258_3262_3990 239
193 3300046499 Ga0495594_0031041 Ga0495594_0031041_797_1525 239
194 3300046517 Ga0495630_0234734 Ga0495630_0234734_595_1329 239
195 3300046518 Ga0495631_0093058 Ga0495631_0093058_161_889 239
196 3300046520 Ga0495637_0046486 Ga0495637_0046486_964_1692 239
197 3300046525 Ga0495663_0007691 Ga0495663_0007691_1857_2585 239
198 3300046526 Ga0495666_0209080 Ga0495666_0209080_36_764 239
199 3300046531 Ga0495665_0096655 Ga0495665_0096655_255_983 239
200 3300046558 Ga0495633_0084221 Ga0495633_0084221_30_758 239
201 3300046615 Ga0495656_0026584 Ga0495656_0026584_1181_1909 239
202 3300046664 Ga0495659_0221563 Ga0495659_0221563_33_761 239
203 3300046665 Ga0495661_0065266 Ga0495661_0065266_308_1036 239
204 3300046674 Ga0495588_0014961 Ga0495588_0014961_2817_3545 239
205 3300046681 Ga0495647_0011744 Ga0495647_0011744_1755_2483 239
206 3300046681 Ga0495647_0094537 Ga0495647_0094537_351_1082 239
207 3300046689 Ga0495613_0079595 Ga0495613_0079595_192_923 239
208 3300046690 Ga0495624_0083551 Ga0495624_0083551_793_1521 239
209 3300046794 Ga0495589_0038693 Ga0495589_0038693_512_1240 239
210 3300047319 Ga0495674_0084875 Ga0495674_0084875_38_769 239
211 3300047321 Ga0495676_0076463 Ga0495676_0076463_828_1556 239
212 3300047445 Ga0495677_0079814 Ga0495677_0079814_41_769 239
213 3300047471 Ga0495684_0086977 Ga0495684_0086977_584_1315 239
214 3300048903 Ga0496100_0030732 Ga0496100_0030732_1728_2447 239
215 3300048903 Ga0496100_0052100 Ga0496100_0052100_1550_2278 239
216 3300048904 Ga0496101_0040327 Ga0496101_0040327_1735_2454 239
217 3300048904 Ga0496101_0090526 Ga0496101_0090526_1302_2033 239
218 3300048905 Ga0496102_0040169 Ga0496102_0040169_899_1618 239
219 3300048906 Ga0496103_0010767 Ga0496103_0010767_2527_3255 239
220 3300048906 Ga0496103_0024227 Ga0496103_0024227_2068_2787 239
221 3300048907 Ga0496104_0081673 Ga0496104_0081673_607_1338 239
222 3300048907 Ga0496104_0204045 Ga0496104_0204045_899_1618 239
223 3300048908 Ga0496105_0001986 Ga0496105_0001986_4697_5428 239
224 3300048908 Ga0496105_0037663 Ga0496105_0037663_3133_3861 239
225 3300048908 Ga0496105_0095056 Ga0496105_0095056_919_1638 239
226 3300048909 Ga0496106_0019108 Ga0496106_0019108_721_1440 239
227 3300048909 Ga0496106_0143187 Ga0496106_0143187_685_1413 239
228 3300048909 Ga0496106_0197987 Ga0496106_0197987_730_1461 239
229 3300048910 Ga0496107_0013464 Ga0496107_0013464_1693_2421 239
230 3300048910 Ga0496107_0018862 Ga0496107_0018862_2430_3149 239
231 3300048910 Ga0496107_0225393 Ga0496107_0225393_421_1152 239
232 3300048911 Ga0496108_0002003 Ga0496108_0002003_455_1186 239
233 3300048911 Ga0496108_0057445 Ga0496108_0057445_2470_3198 239
234 3300048911 Ga0496108_0108311 Ga0496108_0108311_1499_2218 239
235 3300048912 Ga0496109_0013278 Ga0496109_0013278_5262_5993 239
236 3300048912 Ga0496109_0102900 Ga0496109_0102900_350_1078 239
237 3300048912 Ga0496109_0145321 Ga0496109_0145321_601_1320 239
238 3300048913 Ga0496110_0016733 Ga0496110_0016733_4832_5563 239
239 3300048913 Ga0496110_0023741 Ga0496110_0023741_2071_2790 239
240 3300048913 Ga0496110_0163870 Ga0496110_0163870_350_1078 239
241 3300048914 Ga0496111_0056798 Ga0496111_0056798_1718_2449 239
242 3300048914 Ga0496111_0094932 Ga0496111_0094932_605_1324 239
243 3300048914 Ga0496111_0258695 Ga0496111_0258695_493_1221 239
244 3300048914 Ga0496111_0460249 Ga0496111_0460249_159_890 239
245 3300048915 Ga0496112_0002042 Ga0496112_0002042_13544_14275 239
246 3300048915 Ga0496112_0043069 Ga0496112_0043069_1172_1900 239
247 3300048915 Ga0496112_0590802 Ga0496112_0590802_168_887 239
248 3300048916 Ga0496113_0003321 Ga0496113_0003321_8316_9047 239
249 3300048916 Ga0496113_0053545 Ga0496113_0053545_899_1618 239
250 3300048916 Ga0496113_0087728 Ga0496113_0087728_344_1072 239
251 3300048917 Ga0496114_0039534 Ga0496114_0039534_2044_2775 239
252 3300048917 Ga0496114_0242430 Ga0496114_0242430_171_899 239
253 3300048918 Ga0496115_0014503 Ga0496115_0014503_715_1443 239
254 3300048918 Ga0496115_0040074 Ga0496115_0040074_700_1431 239
255 3300048918 Ga0496115_0041134 Ga0496115_0041134_890_1609 239
256 3300049572 Ga0501036_0169157 Ga0501036_0169157_819_1556 239
257 3300049577 Ga0501041_0134985 Ga0501041_0134985_62_790 239
258 3300049586 Ga0501070_0307918 Ga0501070_0307918_499_1236 239
259 3300049591 Ga0501075_0212613 Ga0501075_0212613_391_1128 239
260 3300049592 Ga0501076_0107116 Ga0501076_0107116_1500_2228 239
261 3300049592 Ga0501076_0281744 Ga0501076_0281744_544_1281 239
262 3300049593 Ga0501077_0071960 Ga0501077_0071960_300_1037 239
263 3300049593 Ga0501077_0303591 Ga0501077_0303591_243_971 239
264 3300050492 nmdc:mga0yw44_3557_c1 nmdc:mga0yw44_3557_c1_4875_5633 239
265 3300050492 nmdc:mga0yw44_506_c1 nmdc:mga0yw44_506_c1_9009_9737 239
266 3300050495 nmdc:mga04h51_35371_c1 nmdc:mga04h51_35371_c1_700_1434 239
267 3300050507 nmdc:mga05p37_12664_c1 nmdc:mga05p37_12664_c1_8977_9708 239
268 3300050510 nmdc:mga06r32_526715_c1 nmdc:mga06r32_526715_c1_354_1091 239
269 3300050510 nmdc:mga06r32_82747_c1 nmdc:mga06r32_82747_c1_1290_2021 239
270 3300050511 nmdc:mga08y16_177801_c1 nmdc:mga08y16_177801_c1_1278_2009 239
271 3300050511 nmdc:mga08y16_341934_c1 nmdc:mga08y16_341934_c1_124_852 239
272 3300050512 nmdc:mga0n895_70196_c1 nmdc:mga0n895_70196_c1_589_1320 239
273 3300050513 nmdc:mga0rr50_194356_c1 nmdc:mga0rr50_194356_c1_850_1581 239
274 3300053077 Ga0495601_0069363 Ga0495601_0069363_310_1038 239
275 3300053077 Ga0495601_0158795 Ga0495601_0158795_519_1247 239
276 3300053085 Ga0495619_0058437 Ga0495619_0058437_15_743 239
277 3300060353 Ga0501082_0116499 Ga0501082_0116499_863_1591 239
278 3300060353 Ga0501082_0129875 Ga0501082_0129875_1368_2105 239
279 3300060353 Ga0501082_0250686 Ga0501082_0250686_624_1361 239
280 3300061734 Ga0530510_0295341 Ga0530510_0295341_235_963 239
281 3300021441 Ga0213871_10010264 Ga0213871_100102643 240
282 3300024227 Ga0228598_1001587 Ga0228598_10015873 240
283 3300037853 Ga0436364_0871221 Ga0436364_0871221_87_818 240
284 3300039438 Ga0436360_0259210 Ga0436360_0259210_846_1586 240
285 3300039438 Ga0436360_0682985 Ga0436360_0682985_208_939 240
286 3300039438 Ga0436360_0906691 Ga0436360_0906691_399_1139 240
287 3300039438 Ga0436360_1311043 Ga0436360_1311043_2651_3427 240
288 3300039447 Ga0436361_1005552 Ga0436361_1005552_4464_5195 240
289 3300039450 Ga0436363_0461379 Ga0436363_0461379_1639_2370 240
290 3300039453 Ga0436362_0392492 Ga0436362_0392492_1012_1752 240
291 3300044684 Ga0466966_0027189 Ga0466966_0027189_2875_3606 240
292 3300044719 Ga0466971_0037480 Ga0466971_0037480_654_1385 240
293 3300045049 Ga0466959_0005881 Ga0466959_0005881_6730_7461 240
294 3300046454 Ga0495592_0158559 Ga0495592_0158559_112_843 240
295 3300046514 Ga0495618_0055437 Ga0495618_0055437_1286_2017 240
296 3300046529 Ga0495652_0339911 Ga0495652_0339911_16_747 240
297 3300053077 Ga0495601_0032738 Ga0495601_0032738_2211_2942 240
298 3300035086 Ga0373934_0014951 Ga0373934_0014951_751_1554 241
299 3300035111 Ga0373923_0054373 Ga0373923_0054373_14_817 241
300 3300035117 Ga0373953_0036517 Ga0373953_0036517_203_1006 241
301 3300035118 Ga0373954_0004874 Ga0373954_0004874_3418_4221 241
302 3300035119 Ga0373956_0027317 Ga0373956_0027317_671_1474 241
303 3300035170 Ga0373943_0126532 Ga0373943_0126532_538_1341 241
304 3300035172 Ga0373955_0019472 Ga0373955_0019472_568_1371 241
305 3300035692 Ga0373935_0007892 Ga0373935_0007892_4246_5049 241
306 3300035695 Ga0373927_0031918 Ga0373927_0031918_1671_2474 241
307 3300035724 Ga0373933_0009529 Ga0373933_0009529_4244_5047 241
308 3300035725 Ga0373947_0066242 Ga0373947_0066242_114_917 241
309 3300037068 Ga0373925_0160146 Ga0373925_0160146_861_1664 241
310 3300046454 Ga0495592_0006852 Ga0495592_0006852_4603_5406 241
311 3300046455 Ga0495603_0094984 Ga0495603_0094984_885_1688 241
312 3300046459 Ga0495629_0006249 Ga0495629_0006249_5663_6466 241
313 3300046462 Ga0495651_0001457 Ga0495651_0001457_7920_8723 241
314 3300046463 Ga0495653_0001646 Ga0495653_0001646_9555_10358 241
315 3300046472 Ga0495580_0235526 Ga0495580_0235526_72_875 241
316 3300046511 Ga0495608_0002194 Ga0495608_0002194_3824_4627 241
317 3300046514 Ga0495618_0002260 Ga0495618_0002260_9987_10790 241
318 3300046516 Ga0495628_0007617 Ga0495628_0007617_6508_7311 241
319 3300046529 Ga0495652_0001117 Ga0495652_0001117_17187_17990 241
320 3300046531 Ga0495665_0155233 Ga0495665_0155233_357_1160 241
321 3300046533 Ga0495640_0008299 Ga0495640_0008299_6370_7173 241
322 3300046536 Ga0495587_0002652 Ga0495587_0002652_8083_8886 241
323 3300046543 Ga0495645_0022506 Ga0495645_0022506_3319_4122 241
324 3300046559 Ga0495667_0001890 Ga0495667_0001890_4178_4981 241
325 3300046642 Ga0495634_0018062 Ga0495634_0018062_1858_2661 241
326 3300046663 Ga0495635_0006483 Ga0495635_0006483_2128_2931 241
327 3300046675 Ga0495657_0014186 Ga0495657_0014186_4011_4814 241
328 3300046678 Ga0495599_0004705 Ga0495599_0004705_1017_1820 241
329 3300046679 Ga0495623_0003302 Ga0495623_0003302_6861_7664 241
330 3300046680 Ga0495646_0008689 Ga0495646_0008689_4142_4945 241
331 3300046681 Ga0495647_0055163 Ga0495647_0055163_463_1266 241
332 3300046689 Ga0495613_0061717 Ga0495613_0061717_776_1579 241
333 3300047317 Ga0495604_0000619 Ga0495604_0000619_26510_27313 241
334 3300047319 Ga0495674_0074951 Ga0495674_0074951_1779_2582 241
335 3300047321 Ga0495676_0101380 Ga0495676_0101380_810_1613 241
336 3300047322 Ga0495680_0002310 Ga0495680_0002310_6395_7198 241
337 3300047444 Ga0495675_0004772 Ga0495675_0004772_1902_2705 241
338 3300047471 Ga0495684_0016020 Ga0495684_0016020_4107_4910 241
339 3300047673 Ga0495593_0037487 Ga0495593_0037487_31_834 241
340 3300048088 Ga0495602_0001747 Ga0495602_0001747_17719_18522 241
341 3300053077 Ga0495601_0025835 Ga0495601_0025835_1042_1845 241
342 3300053078 Ga0495612_0012717 Ga0495612_0012717_1110_1913 241
343 3300053084 Ga0495595_0001562 Ga0495595_0001562_3564_4367 241
344 3300053085 Ga0495619_0017743 Ga0495619_0017743_1780_2583 241
345 3300005548 Ga0070665_100605349 Ga0070665_1006053492 242
346 3300024225 Ga0224572_1002117 Ga0224572_10021174 242
347 3300024225 Ga0224572_1031639 Ga0224572_10316391 242
348 3300025898 Ga0207692_10270000 Ga0207692_102700002 242
349 3300028023 Ga0265357_1000317 Ga0265357_10003172 242
350 3300028379 Ga0268266_10544815 Ga0268266_105448152 242
351 3300028800 Ga0265338_10024025 Ga0265338_100240255 242
352 3300030763 Ga0265763_1006724 Ga0265763_10067241 242
353 3300031090 Ga0265760_10051922 Ga0265760_100519222 242
354 3300031249 Ga0265339_10000047 Ga0265339_1000004738 242
355 3300031595 Ga0265313_10000069 Ga0265313_1000006923 242
356 3300031712 Ga0265342_10011844 Ga0265342_100118445 242
357 3300035083 Ga0373926_0063446 Ga0373926_0063446_204_983 242
358 3300035695 Ga0373927_0002902 Ga0373927_0002902_4257_5036 242
359 3300046454 Ga0495592_0141761 Ga0495592_0141761_688_1467 242
360 3300046459 Ga0495629_0047995 Ga0495629_0047995_2177_2956 242
361 3300046463 Ga0495653_0011975 Ga0495653_0011975_2956_3735 242
362 3300046476 Ga0495662_0001545 Ga0495662_0001545_9936_10715 242
363 3300046477 Ga0495664_0009700 Ga0495664_0009700_622_1401 242
364 3300046514 Ga0495618_0002528 Ga0495618_0002528_6286_7065 242
365 3300046517 Ga0495630_0171813 Ga0495630_0171813_616_1395 242
366 3300046529 Ga0495652_0006045 Ga0495652_0006045_7221_8000 242
367 3300046531 Ga0495665_0079827 Ga0495665_0079827_332_1111 242
368 3300046533 Ga0495640_0000643 Ga0495640_0000643_15151_15930 242
369 3300046535 Ga0495586_0026940 Ga0495586_0026940_627_1406 242
370 3300046543 Ga0495645_0042462 Ga0495645_0042462_1602_2381 242
371 3300046663 Ga0495635_0001865 Ga0495635_0001865_6168_6947 242
372 3300046690 Ga0495624_0016820 Ga0495624_0016820_1753_2532 242
373 3300047319 Ga0495674_0023981 Ga0495674_0023981_1590_2369 242
374 3300047471 Ga0495684_0032246 Ga0495684_0032246_854_1633 242
375 3300049591 Ga0501075_0442412 Ga0501075_0442412_235_969 242
376 3300049593 Ga0501077_0005408 Ga0501077_0005408_99_833 242
377 3300049741 Ga0501079_0009679 Ga0501079_0009679_5905_6639 242
378 3300049743 Ga0501081_0057536 Ga0501081_0057536_185_919 242
379 3300053084 Ga0495595_0047641 Ga0495595_0047641_123_902 242
380 3300053085 Ga0495619_0009018 Ga0495619_0009018_2937_3716 242
381 3300053119 Ga0500595_000003 Ga0500595_000003_174305_175051 242
382 3300054114 Ga0501084_0063132 Ga0501084_0063132_1219_1953 242
383 3300060353 Ga0501082_0072550 Ga0501082_0072550_955_1689 242
384 3300003203 JGI25406J46586_10007775 JGI25406J46586_100077753 243
385 3300003323 rootH1_10081664 rootH1_100816642 243
386 3300005290 Ga0065712_10025030 Ga0065712_100250302 243
387 3300005293 Ga0065715_10044697 Ga0065715_100446972 243
388 3300005329 Ga0070683_100074779 Ga0070683_1000747792 243
389 3300005329 Ga0070683_100284676 Ga0070683_1002846762 243
390 3300005330 Ga0070690_100111302 Ga0070690_1001113022 243
391 3300005331 Ga0070670_100088865 Ga0070670_1000888653 243
392 3300005331 Ga0070670_100091746 Ga0070670_1000917462 243
393 3300005335 Ga0070666_10036756 Ga0070666_100367562 243
394 3300005335 Ga0070666_10185972 Ga0070666_101859721 243
395 3300005336 Ga0070680_100127729 Ga0070680_1001277293 243
396 3300005336 Ga0070680_100272143 Ga0070680_1002721432 243
397 3300005337 Ga0070682_100108008 Ga0070682_1001080081 243
398 3300005338 Ga0068868_100340113 Ga0068868_1003401132 243
399 3300005340 Ga0070689_100028076 Ga0070689_1000280762 243
400 3300005340 Ga0070689_100074758 Ga0070689_1000747582 243
401 3300005343 Ga0070687_100157131 Ga0070687_1001571311 243
402 3300005344 Ga0070661_100254527 Ga0070661_1002545272 243
403 3300005344 Ga0070661_100323061 Ga0070661_1003230612 243
404 3300005353 Ga0070669_100341474 Ga0070669_1003414741 243
405 3300005354 Ga0070675_100220808 Ga0070675_1002208082 243
406 3300005354 Ga0070675_100553471 Ga0070675_1005534711 243
407 3300005355 Ga0070671_100071257 Ga0070671_1000712572 243
408 3300005355 Ga0070671_100079633 Ga0070671_1000796332 243
409 3300005355 Ga0070671_100220122 Ga0070671_1002201222 243
410 3300005356 Ga0070674_100196552 Ga0070674_1001965522 243
411 3300005356 Ga0070674_100324377 Ga0070674_1003243772 243
412 3300005356 Ga0070674_100331382 Ga0070674_1003313822 243
413 3300005365 Ga0070688_100458218 Ga0070688_1004582182 243
414 3300005366 Ga0070659_100258399 Ga0070659_1002583992 243
415 3300005367 Ga0070667_100014232 Ga0070667_1000142323 243
416 3300005367 Ga0070667_100081667 Ga0070667_1000816672 243
417 3300005434 Ga0070709_10013778 Ga0070709_100137784 243
418 3300005434 Ga0070709_10079636 Ga0070709_100796363 243
419 3300005434 Ga0070709_10080089 Ga0070709_100800893 243
420 3300005434 Ga0070709_10325790 Ga0070709_103257902 243
421 3300005435 Ga0070714_100065673 Ga0070714_1000656733 243
422 3300005435 Ga0070714_100091577 Ga0070714_1000915773 243
423 3300005435 Ga0070714_100125857 Ga0070714_1001258573 243
424 3300005436 Ga0070713_100007912 Ga0070713_1000079124 243
425 3300005436 Ga0070713_100075416 Ga0070713_1000754162 243
426 3300005436 Ga0070713_100207680 Ga0070713_1002076802 243
427 3300005437 Ga0070710_10009968 Ga0070710_100099682 243
428 3300005437 Ga0070710_10032321 Ga0070710_100323213 243
429 3300005439 Ga0070711_100031105 Ga0070711_1000311054 243
430 3300005439 Ga0070711_100062336 Ga0070711_1000623363 243
431 3300005439 Ga0070711_100172665 Ga0070711_1001726652 243
432 3300005440 Ga0070705_100114065 Ga0070705_1001140652 243
433 3300005455 Ga0070663_100040726 Ga0070663_1000407262 243
434 3300005455 Ga0070663_100120940 Ga0070663_1001209402 243
435 3300005456 Ga0070678_100013322 Ga0070678_1000133225 243
436 3300005456 Ga0070678_100307875 Ga0070678_1003078752 243
437 3300005457 Ga0070662_100011859 Ga0070662_1000118594 243
438 3300005457 Ga0070662_100089049 Ga0070662_1000890492 243
439 3300005458 Ga0070681_10068522 Ga0070681_100685222 243
440 3300005458 Ga0070681_10074842 Ga0070681_100748424 243
441 3300005459 Ga0068867_100084281 Ga0068867_1000842813 243
442 3300005459 Ga0068867_100299538 Ga0068867_1002995382 243
443 3300005466 Ga0070685_10232332 Ga0070685_102323322 243
444 3300005466 Ga0070685_10398413 Ga0070685_103984131 243
445 3300005530 Ga0070679_100167832 Ga0070679_1001678322 243
446 3300005535 Ga0070684_100207066 Ga0070684_1002070663 243
447 3300005536 Ga0070697_100477183 Ga0070697_1004771832 243
448 3300005543 Ga0070672_100272487 Ga0070672_1002724872 243
449 3300005543 Ga0070672_100374021 Ga0070672_1003740212 243
450 3300005544 Ga0070686_100347046 Ga0070686_1003470461 243
451 3300005546 Ga0070696_100133955 Ga0070696_1001339552 243
452 3300005547 Ga0070693_100072109 Ga0070693_1000721093 243
453 3300005548 Ga0070665_100104073 Ga0070665_1001040733 243
454 3300005548 Ga0070665_100119266 Ga0070665_1001192662 243
455 3300005548 Ga0070665_100330198 Ga0070665_1003301982 243
456 3300005564 Ga0070664_100083451 Ga0070664_1000834512 243
457 3300005564 Ga0070664_100280331 Ga0070664_1002803312 243
458 3300005615 Ga0070702_100018538 Ga0070702_1000185382 243
459 3300005617 Ga0068859_100064865 Ga0068859_1000648652 243
460 3300005617 Ga0068859_100459111 Ga0068859_1004591112 243
461 3300005618 Ga0068864_100020286 Ga0068864_1000202865 243
462 3300005618 Ga0068864_100032658 Ga0068864_1000326582 243
463 3300005618 Ga0068864_100086947 Ga0068864_1000869473 243
464 3300005718 Ga0068866_10025366 Ga0068866_100253663 243
465 3300005718 Ga0068866_10161551 Ga0068866_101615512 243
466 3300005841 Ga0068863_100079796 Ga0068863_1000797963 243
467 3300005842 Ga0068858_100111126 Ga0068858_1001111262 243
468 3300005843 Ga0068860_100459535 Ga0068860_1004595352 243
469 3300005937 Ga0081455_10031401 Ga0081455_100314012 243
470 3300005983 Ga0081540_1005337 Ga0081540_10053373 243
471 3300005985 Ga0081539_10001225 Ga0081539_100012259 243
472 3300006028 Ga0070717_10014612 Ga0070717_100146123 243
473 3300006048 Ga0075363_100022308 Ga0075363_1000223082 243
474 3300006051 Ga0075364_10423000 Ga0075364_104230002 243
475 3300006163 Ga0070715_10219505 Ga0070715_102195052 243
476 3300006175 Ga0070712_100022333 Ga0070712_1000223334 243
477 3300006175 Ga0070712_100223810 Ga0070712_1002238102 243
478 3300006177 Ga0075362_10010411 Ga0075362_100104112 243
479 3300006195 Ga0075366_10004424 Ga0075366_100044243 243
480 3300006237 Ga0097621_100045500 Ga0097621_1000455004 243
481 3300006358 Ga0068871_100139402 Ga0068871_1001394022 243
482 3300006358 Ga0068871_100296337 Ga0068871_1002963372 243
483 3300006358 Ga0068871_100547467 Ga0068871_1005474672 243
484 3300006844 Ga0075428_100113955 Ga0075428_1001139552 243
485 3300006847 Ga0075431_100005224 Ga0075431_1000052246 243
486 3300006871 Ga0075434_100173756 Ga0075434_1001737563 243
487 3300006871 Ga0075434_100337034 Ga0075434_1003370341 243
488 3300006871 Ga0075434_100760601 Ga0075434_1007606012 243
489 3300006881 Ga0068865_100039551 Ga0068865_1000395513 243
490 3300006881 Ga0068865_100078150 Ga0068865_1000781503 243
491 3300006881 Ga0068865_100374512 Ga0068865_1003745122 243
492 3300006914 Ga0075436_100150280 Ga0075436_1001502802 243
493 3300006914 Ga0075436_100268874 Ga0075436_1002688742 243
494 3300006931 Ga0097620_100064874 Ga0097620_1000648744 243
495 3300006931 Ga0097620_100459100 Ga0097620_1004591002 243
496 3300007076 Ga0075435_100064584 Ga0075435_1000645842 243
497 3300007076 Ga0075435_100156388 Ga0075435_1001563882 243
498 3300007076 Ga0075435_100363937 Ga0075435_1003639372 243
499 3300007076 Ga0075435_100465792 Ga0075435_1004657922 243
500 3300009093 Ga0105240_10827192 Ga0105240_108271922 243
501 3300009098 Ga0105245_10058895 Ga0105245_100588953 243
502 3300009101 Ga0105247_10022098 Ga0105247_100220983 243
503 3300009101 Ga0105247_10027549 Ga0105247_100275493 243
504 3300009101 Ga0105247_10064224 Ga0105247_100642242 243
505 3300009174 Ga0105241_10176943 Ga0105241_101769432 243
506 3300009174 Ga0105241_10588827 Ga0105241_105888271 243
507 3300009176 Ga0105242_10047117 Ga0105242_100471173 243
508 3300009177 Ga0105248_10081604 Ga0105248_100816042 243
509 3300009177 Ga0105248_10081747 Ga0105248_100817472 243
510 3300009177 Ga0105248_10973582 Ga0105248_109735822 243
511 3300009551 Ga0105238_10014485 Ga0105238_100144854 243
512 3300009551 Ga0105238_10685324 Ga0105238_106853242 243
513 3300009553 Ga0105249_10500055 Ga0105249_105000552 243
514 3300010375 Ga0105239_10194102 Ga0105239_101941022 243
515 3300010375 Ga0105239_10400794 Ga0105239_104007942 243
516 3300010375 Ga0105239_10539416 Ga0105239_105394162 243
517 3300011119 Ga0105246_10026146 Ga0105246_100261463 243
518 3300011119 Ga0105246_10150284 Ga0105246_101502842 243
519 3300011119 Ga0105246_10280601 Ga0105246_102806012 243
520 3300013100 Ga0157373_10555723 Ga0157373_105557231 243
521 3300013104 Ga0157370_10140653 Ga0157370_101406532 243
522 3300013296 Ga0157374_10060577 Ga0157374_100605774 243
523 3300013297 Ga0157378_10030576 Ga0157378_100305762 243
524 3300013297 Ga0157378_10568043 Ga0157378_105680432 243
525 3300013306 Ga0163162_10141913 Ga0163162_101419132 243
526 3300013307 Ga0157372_10336143 Ga0157372_103361432 243
527 3300014325 Ga0163163_10122290 Ga0163163_101222902 243
528 3300014325 Ga0163163_10533361 Ga0163163_105333612 243
529 3300014968 Ga0157379_10060634 Ga0157379_100606343 243
530 3300014968 Ga0157379_10259238 Ga0157379_102592382 243
531 3300014968 Ga0157379_10304189 Ga0157379_103041892 243
532 3300014969 Ga0157376_10035816 Ga0157376_100358162 243
533 3300014969 Ga0157376_10111487 Ga0157376_101114873 243
534 3300017792 Ga0163161_10512083 Ga0163161_105120832 243
535 3300021384 Ga0213876_10049768 Ga0213876_100497683 243
536 3300025893 Ga0207682_10004092 Ga0207682_100040924 243
537 3300025898 Ga0207692_10004511 Ga0207692_100045112 243
538 3300025898 Ga0207692_10006797 Ga0207692_100067973 243
539 3300025898 Ga0207692_10103085 Ga0207692_101030852 243
540 3300025898 Ga0207692_10364174 Ga0207692_103641742 243
541 3300025900 Ga0207710_10004015 Ga0207710_100040154 243
542 3300025900 Ga0207710_10035278 Ga0207710_100352783 243
543 3300025901 Ga0207688_10041998 Ga0207688_100419983 243
544 3300025903 Ga0207680_10008720 Ga0207680_100087203 243
545 3300025905 Ga0207685_10033222 Ga0207685_100332223 243
546 3300025906 Ga0207699_10043766 Ga0207699_100437662 243
547 3300025906 Ga0207699_10115162 Ga0207699_101151622 243
548 3300025906 Ga0207699_10251218 Ga0207699_102512182 243
549 3300025907 Ga0207645_10125706 Ga0207645_101257061 243
550 3300025908 Ga0207643_10048340 Ga0207643_100483402 243
551 3300025913 Ga0207695_10574261 Ga0207695_105742612 243
552 3300025915 Ga0207693_10017687 Ga0207693_100176872 243
553 3300025915 Ga0207693_10037919 Ga0207693_100379192 243
554 3300025915 Ga0207693_10073159 Ga0207693_100731592 243
555 3300025915 Ga0207693_10180624 Ga0207693_101806242 243
556 3300025915 Ga0207693_10331250 Ga0207693_103312502 243
557 3300025916 Ga0207663_10047758 Ga0207663_100477583 243
558 3300025916 Ga0207663_10289541 Ga0207663_102895412 243
559 3300025916 Ga0207663_10476693 Ga0207663_104766932 243
560 3300025916 Ga0207663_10599980 Ga0207663_105999802 243
561 3300025917 Ga0207660_10021494 Ga0207660_100214942 243
562 3300025918 Ga0207662_10002485 Ga0207662_100024854 243
563 3300025919 Ga0207657_10028043 Ga0207657_100280434 243
564 3300025920 Ga0207649_10194317 Ga0207649_101943172 243
565 3300025921 Ga0207652_10210773 Ga0207652_102107733 243
566 3300025924 Ga0207694_10058150 Ga0207694_100581502 243
567 3300025924 Ga0207694_10532240 Ga0207694_105322402 243
568 3300025925 Ga0207650_10314125 Ga0207650_103141252 243
569 3300025925 Ga0207650_10394724 Ga0207650_103947242 243
570 3300025927 Ga0207687_10011022 Ga0207687_100110224 243
571 3300025927 Ga0207687_10513179 Ga0207687_105131792 243
572 3300025928 Ga0207700_10009461 Ga0207700_100094613 243
573 3300025928 Ga0207700_10100526 Ga0207700_101005263 243
574 3300025929 Ga0207664_10056771 Ga0207664_100567713 243
575 3300025929 Ga0207664_10094460 Ga0207664_100944602 243
576 3300025929 Ga0207664_10100435 Ga0207664_101004353 243
577 3300025931 Ga0207644_10017604 Ga0207644_100176045 243
578 3300025931 Ga0207644_10043634 Ga0207644_100436343 243
579 3300025931 Ga0207644_10153807 Ga0207644_101538072 243
580 3300025931 Ga0207644_10379239 Ga0207644_103792392 243
581 3300025932 Ga0207690_10146626 Ga0207690_101466261 243
582 3300025932 Ga0207690_10173578 Ga0207690_101735782 243
583 3300025933 Ga0207706_10020218 Ga0207706_100202183 243
584 3300025933 Ga0207706_10075807 Ga0207706_100758073 243
585 3300025934 Ga0207686_10006259 Ga0207686_100062594 243
586 3300025934 Ga0207686_10226400 Ga0207686_102264002 243
587 3300025935 Ga0207709_10082053 Ga0207709_100820533 243
588 3300025936 Ga0207670_10294838 Ga0207670_102948382 243
589 3300025937 Ga0207669_10033098 Ga0207669_100330982 243
590 3300025938 Ga0207704_10006237 Ga0207704_100062375 243
591 3300025938 Ga0207704_10169858 Ga0207704_101698582 243
592 3300025938 Ga0207704_10344674 Ga0207704_103446742 243
593 3300025940 Ga0207691_10008010 Ga0207691_100080104 243
594 3300025940 Ga0207691_10164297 Ga0207691_101642971 243
595 3300025941 Ga0207711_10021915 Ga0207711_100219155 243
596 3300025941 Ga0207711_10043967 Ga0207711_100439673 243
597 3300025941 Ga0207711_10275722 Ga0207711_102757222 243
598 3300025944 Ga0207661_10035580 Ga0207661_100355803 243
599 3300025945 Ga0207679_10078420 Ga0207679_100784202 243
600 3300025986 Ga0207658_10027814 Ga0207658_100278142 243
601 3300026023 Ga0207677_10124468 Ga0207677_101244682 243
602 3300026023 Ga0207677_10158017 Ga0207677_101580172 243
603 3300026035 Ga0207703_10028219 Ga0207703_100282193 243
604 3300026035 Ga0207703_10382891 Ga0207703_103828912 243
605 3300026067 Ga0207678_10154943 Ga0207678_101549432 243
606 3300026088 Ga0207641_10025266 Ga0207641_100252665 243
607 3300026089 Ga0207648_10036835 Ga0207648_100368353 243
608 3300026089 Ga0207648_10116285 Ga0207648_101162853 243
609 3300026095 Ga0207676_10014556 Ga0207676_100145565 243
610 3300026095 Ga0207676_10028765 Ga0207676_100287654 243
611 3300026095 Ga0207676_10170304 Ga0207676_101703042 243
612 3300026116 Ga0207674_10165477 Ga0207674_101654772 243
613 3300026118 Ga0207675_100163025 Ga0207675_1001630251 243
614 3300026118 Ga0207675_100932735 Ga0207675_1009327351 243
615 3300026121 Ga0207683_10004948 Ga0207683_1000494811 243
616 3300026121 Ga0207683_10005418 Ga0207683_100054187 243
617 3300026121 Ga0207683_10026333 Ga0207683_100263332 243
618 3300028379 Ga0268266_10003098 Ga0268266_1000309812 243
619 3300028379 Ga0268266_10127050 Ga0268266_101270502 243
620 3300028381 Ga0268264_10411106 Ga0268264_104111062 243
621 3300028573 Ga0265334_10095520 Ga0265334_100955202 243
622 3300028800 Ga0265338_10060542 Ga0265338_100605422 243
623 3300028800 Ga0265338_10157163 Ga0265338_101571632 243
624 3300031235 Ga0265330_10011398 Ga0265330_100113985 243
625 3300031241 Ga0265325_10000442 Ga0265325_1000044220 243
626 3300031241 Ga0265325_10000474 Ga0265325_1000047421 243
627 3300031241 Ga0265325_10052918 Ga0265325_100529183 243
628 3300031241 Ga0265325_10158698 Ga0265325_101586982 243
629 3300031247 Ga0265340_10025842 Ga0265340_100258424 243
630 3300031247 Ga0265340_10045473 Ga0265340_100454733 243
631 3300031249 Ga0265339_10077972 Ga0265339_100779722 243
632 3300031595 Ga0265313_10000305 Ga0265313_1000030520 243
633 3300031595 Ga0265313_10007720 Ga0265313_100077208 243
634 3300031595 Ga0265313_10011147 Ga0265313_100111475 243
635 3300031711 Ga0265314_10001589 Ga0265314_100015897 243
636 3300031711 Ga0265314_10034545 Ga0265314_100345453 243
637 3300031712 Ga0265342_10077212 Ga0265342_100772121 243
638 3300035083 Ga0373926_0008281 Ga0373926_0008281_515_1249 243
639 3300035083 Ga0373926_0077638 Ga0373926_0077638_352_1083 243
640 3300035086 Ga0373934_0016360 Ga0373934_0016360_1339_2070 243
641 3300035086 Ga0373934_0053230 Ga0373934_0053230_295_1026 243
642 3300035086 Ga0373934_0077057 Ga0373934_0077057_343_1089 243
643 3300035089 Ga0373944_0019742 Ga0373944_0019742_887_1618 243
644 3300035089 Ga0373944_0030103 Ga0373944_0030103_638_1384 243
645 3300035089 Ga0373944_0047260 Ga0373944_0047260_373_1107 243
646 3300035111 Ga0373923_0055992 Ga0373923_0055992_894_1628 243
647 3300035113 Ga0373936_0112127 Ga0373936_0112127_245_991 243
648 3300035116 Ga0373945_0027803 Ga0373945_0027803_486_1220 243
649 3300035116 Ga0373945_0035082 Ga0373945_0035082_65_796 243
650 3300035117 Ga0373953_0013298 Ga0373953_0013298_836_1567 243
651 3300035117 Ga0373953_0026974 Ga0373953_0026974_949_1707 243
652 3300035117 Ga0373953_0041742 Ga0373953_0041742_250_981 243
653 3300035117 Ga0373953_0076451 Ga0373953_0076451_472_1218 243
654 3300035118 Ga0373954_0008018 Ga0373954_0008018_1743_2474 243
655 3300035118 Ga0373954_0009199 Ga0373954_0009199_3072_3803 243
656 3300035118 Ga0373954_0025645 Ga0373954_0025645_812_1558 243
657 3300035119 Ga0373956_0015678 Ga0373956_0015678_418_1149 243
658 3300035119 Ga0373956_0045362 Ga0373956_0045362_752_1498 243
659 3300035119 Ga0373956_0053846 Ga0373956_0053846_816_1547 243
660 3300035120 Ga0373957_0000227 Ga0373957_0000227_11127_11858 243
661 3300035120 Ga0373957_0017699 Ga0373957_0017699_454_1212 243
662 3300035170 Ga0373943_0122435 Ga0373943_0122435_121_852 243
663 3300035172 Ga0373955_0001227 Ga0373955_0001227_8832_9578 243
664 3300035172 Ga0373955_0002716 Ga0373955_0002716_176_934 243
665 3300035172 Ga0373955_0022212 Ga0373955_0022212_958_1689 243
666 3300035172 Ga0373955_0169822 Ga0373955_0169822_139_870 243
667 3300035410 Ga0373924_0008569 Ga0373924_0008569_330_1061 243
668 3300035410 Ga0373924_0024554 Ga0373924_0024554_1583_2329 243
669 3300035410 Ga0373924_0183910 Ga0373924_0183910_145_879 243
670 3300035691 Ga0373931_0032571 Ga0373931_0032571_1513_2247 243
671 3300035691 Ga0373931_0034336 Ga0373931_0034336_1507_2238 243
672 3300035691 Ga0373931_0039031 Ga0373931_0039031_742_1473 243
673 3300035691 Ga0373931_0058991 Ga0373931_0058991_408_1139 243
674 3300035692 Ga0373935_0015088 Ga0373935_0015088_1523_2254 243
675 3300035692 Ga0373935_0032021 Ga0373935_0032021_2414_3145 243
676 3300035695 Ga0373927_0004582 Ga0373927_0004582_3917_4648 243
677 3300035695 Ga0373927_0014291 Ga0373927_0014291_3517_4248 243
678 3300035695 Ga0373927_0062975 Ga0373927_0062975_702_1436 243
679 3300035695 Ga0373927_0075971 Ga0373927_0075971_557_1288 243
680 3300035695 Ga0373927_0250132 Ga0373927_0250132_230_976 243
681 3300035724 Ga0373933_0000770 Ga0373933_0000770_8555_9286 243
682 3300035724 Ga0373933_0005841 Ga0373933_0005841_969_1727 243
683 3300035724 Ga0373933_0050777 Ga0373933_0050777_920_1666 243
684 3300035725 Ga0373947_0010593 Ga0373947_0010593_3206_3937 243
685 3300035725 Ga0373947_0034893 Ga0373947_0034893_122_853 243
686 3300035725 Ga0373947_0061881 Ga0373947_0061881_748_1479 243
687 3300036401 Ga0373937_0001549 Ga0373937_0001549_16540_17271 243
688 3300036401 Ga0373937_0002009 Ga0373937_0002009_4715_5473 243
689 3300036401 Ga0373937_0040363 Ga0373937_0040363_974_1720 243
690 3300036401 Ga0373937_0053069 Ga0373937_0053069_2266_3012 243
691 3300036401 Ga0373937_0065756 Ga0373937_0065756_100_831 243
692 3300036401 Ga0373937_0462176 Ga0373937_0462176_26_766 243
693 3300037068 Ga0373925_0009269 Ga0373925_0009269_4833_5564 243
694 3300037068 Ga0373925_0076284 Ga0373925_0076284_813_1544 243
695 3300037068 Ga0373925_0077677 Ga0373925_0077677_789_1535 243
696 3300037853 Ga0436364_0508282 Ga0436364_0508282_729_1472 243
697 3300039437 Ga0436365_0161216 Ga0436365_0161216_446_1177 243
698 3300039437 Ga0436365_1534371 Ga0436365_1534371_2794_3525 243
699 3300039437 Ga0436365_1566633 Ga0436365_1566633_75_809 243
700 3300039437 Ga0436365_1745913 Ga0436365_1745913_122_877 243
701 3300039438 Ga0436360_0787757 Ga0436360_0787757_42_773 243
702 3300044684 Ga0466966_0374481 Ga0466966_0374481_35_766 243
703 3300044694 Ga0466963_0058061 Ga0466963_0058061_593_1324 243
704 3300044842 Ga0466957_0059806 Ga0466957_0059806_344_1075 243
705 3300045836 Ga0466958_0007033 Ga0466958_0007033_2297_3028 243
706 3300046452 Ga0495617_049798 Ga0495617_049798_635_1366 243
707 3300046454 Ga0495592_0005984 Ga0495592_0005984_3636_4367 243
708 3300046454 Ga0495592_0007886 Ga0495592_0007886_385_1116 243
709 3300046454 Ga0495592_0020684 Ga0495592_0020684_798_1544 243
710 3300046454 Ga0495592_0106171 Ga0495592_0106171_207_965 243
711 3300046455 Ga0495603_0003970 Ga0495603_0003970_6684_7415 243
712 3300046455 Ga0495603_0154811 Ga0495603_0154811_573_1304 243
713 3300046458 Ga0495591_048921 Ga0495591_048921_376_1107 243
714 3300046459 Ga0495629_0009599 Ga0495629_0009599_6201_6932 243
715 3300046459 Ga0495629_0020177 Ga0495629_0020177_1516_2247 243
716 3300046459 Ga0495629_0385437 Ga0495629_0385437_101_832 243
717 3300046460 Ga0495638_0194863 Ga0495638_0194863_132_878 243
718 3300046461 Ga0495641_0015534 Ga0495641_0015534_112_843 243
719 3300046461 Ga0495641_0023614 Ga0495641_0023614_1624_2355 243
720 3300046462 Ga0495651_0002845 Ga0495651_0002845_1235_1966 243
721 3300046462 Ga0495651_0020550 Ga0495651_0020550_3439_4170 243
722 3300046462 Ga0495651_0055920 Ga0495651_0055920_475_1221 243
723 3300046462 Ga0495651_0165052 Ga0495651_0165052_673_1419 243
724 3300046462 Ga0495651_0279448 Ga0495651_0279448_328_1065 243
725 3300046463 Ga0495653_0001457 Ga0495653_0001457_12983_13714 243
726 3300046463 Ga0495653_0006997 Ga0495653_0006997_770_1501 243
727 3300046463 Ga0495653_0212928 Ga0495653_0212928_517_1251 243
728 3300046463 Ga0495653_0246603 Ga0495653_0246603_206_964 243
729 3300046472 Ga0495580_0108843 Ga0495580_0108843_934_1665 243
730 3300046473 Ga0495582_0017002 Ga0495582_0017002_2557_3288 243
731 3300046473 Ga0495582_0263160 Ga0495582_0263160_143_883 243
732 3300046475 Ga0495639_0092624 Ga0495639_0092624_442_1173 243
733 3300046475 Ga0495639_0149698 Ga0495639_0149698_172_906 243
734 3300046475 Ga0495639_0180159 Ga0495639_0180159_96_827 243
735 3300046476 Ga0495662_0038969 Ga0495662_0038969_73_804 243
736 3300046476 Ga0495662_0101721 Ga0495662_0101721_559_1293 243
737 3300046476 Ga0495662_0219702 Ga0495662_0219702_157_888 243
738 3300046477 Ga0495664_0035691 Ga0495664_0035691_281_1012 243
739 3300046477 Ga0495664_0043326 Ga0495664_0043326_1662_2396 243
740 3300046477 Ga0495664_0051466 Ga0495664_0051466_1203_1934 243
741 3300046477 Ga0495664_0188731 Ga0495664_0188731_39_785 243
742 3300046491 Ga0495584_0063859 Ga0495584_0063859_613_1344 243
743 3300046491 Ga0495584_0138016 Ga0495584_0138016_211_945 243
744 3300046492 Ga0495585_0147346 Ga0495585_0147346_327_1058 243
745 3300046499 Ga0495594_0010912 Ga0495594_0010912_1034_1765 243
746 3300046499 Ga0495594_0023234 Ga0495594_0023234_1558_2292 243
747 3300046501 Ga0495607_0068028 Ga0495607_0068028_926_1657 243
748 3300046511 Ga0495608_0002362 Ga0495608_0002362_6545_7276 243
749 3300046511 Ga0495608_0013615 Ga0495608_0013615_4090_4836 243
750 3300046511 Ga0495608_0185091 Ga0495608_0185091_145_891 243
751 3300046514 Ga0495618_0031740 Ga0495618_0031740_322_1053 243
752 3300046514 Ga0495618_0039445 Ga0495618_0039445_1355_2086 243
753 3300046514 Ga0495618_0106327 Ga0495618_0106327_659_1405 243
754 3300046514 Ga0495618_0151254 Ga0495618_0151254_91_822 243
755 3300046516 Ga0495628_0001326 Ga0495628_0001326_21105_21851 243
756 3300046516 Ga0495628_0001767 Ga0495628_0001767_4999_5730 243
757 3300046516 Ga0495628_0385609 Ga0495628_0385609_29_775 243
758 3300046517 Ga0495630_0031233 Ga0495630_0031233_1065_1796 243
759 3300046517 Ga0495630_0232488 Ga0495630_0232488_651_1382 243
760 3300046517 Ga0495630_0581551 Ga0495630_0581551_101_832 243
761 3300046526 Ga0495666_0017207 Ga0495666_0017207_97_828 243
762 3300046529 Ga0495652_0008381 Ga0495652_0008381_818_1564 243
763 3300046529 Ga0495652_0017281 Ga0495652_0017281_2039_2770 243
764 3300046531 Ga0495665_0002705 Ga0495665_0002705_2512_3243 243
765 3300046531 Ga0495665_0134051 Ga0495665_0134051_527_1261 243
766 3300046533 Ga0495640_0004495 Ga0495640_0004495_8231_8962 243
767 3300046533 Ga0495640_0023100 Ga0495640_0023100_3519_4253 243
768 3300046533 Ga0495640_0207845 Ga0495640_0207845_461_1207 243
769 3300046533 Ga0495640_0237932 Ga0495640_0237932_312_1043 243
770 3300046533 Ga0495640_0280070 Ga0495640_0280070_101_832 243
771 3300046535 Ga0495586_0009695 Ga0495586_0009695_1256_1987 243
772 3300046536 Ga0495587_0005531 Ga0495587_0005531_4284_5015 243
773 3300046536 Ga0495587_0057592 Ga0495587_0057592_287_1033 243
774 3300046536 Ga0495587_0155572 Ga0495587_0155572_253_999 243
775 3300046537 Ga0495598_0018175 Ga0495598_0018175_145_876 243
776 3300046539 Ga0495621_0192707 Ga0495621_0192707_11_748 243
777 3300046543 Ga0495645_0001639 Ga0495645_0001639_2170_2901 243
778 3300046543 Ga0495645_0003190 Ga0495645_0003190_9492_10238 243
779 3300046557 Ga0495622_0040898 Ga0495622_0040898_270_1001 243
780 3300046558 Ga0495633_0067210 Ga0495633_0067210_646_1377 243
781 3300046559 Ga0495667_0005963 Ga0495667_0005963_2749_3480 243
782 3300046559 Ga0495667_0037515 Ga0495667_0037515_13_744 243
783 3300046559 Ga0495667_0042664 Ga0495667_0042664_816_1562 243
784 3300046559 Ga0495667_0060106 Ga0495667_0060106_1585_2343 243
785 3300046559 Ga0495667_0088242 Ga0495667_0088242_73_804 243
786 3300046615 Ga0495656_0003447 Ga0495656_0003447_1210_1941 243
787 3300046642 Ga0495634_0018938 Ga0495634_0018938_1174_1905 243
788 3300046642 Ga0495634_0033844 Ga0495634_0033844_2518_3249 243
789 3300046642 Ga0495634_0038180 Ga0495634_0038180_2021_2752 243
790 3300046642 Ga0495634_0101360 Ga0495634_0101360_62_808 243
791 3300046642 Ga0495634_0116846 Ga0495634_0116846_448_1188 243
792 3300046663 Ga0495635_0000337 Ga0495635_0000337_15534_16265 243
793 3300046663 Ga0495635_0016846 Ga0495635_0016846_1455_2186 243
794 3300046663 Ga0495635_0080514 Ga0495635_0080514_859_1590 243
795 3300046663 Ga0495635_0163615 Ga0495635_0163615_409_1167 243
796 3300046664 Ga0495659_0005965 Ga0495659_0005965_2559_3290 243
797 3300046674 Ga0495588_0012438 Ga0495588_0012438_2398_3129 243
798 3300046674 Ga0495588_0153045 Ga0495588_0153045_199_933 243
799 3300046675 Ga0495657_0001580 Ga0495657_0001580_2693_3424 243
800 3300046675 Ga0495657_0011547 Ga0495657_0011547_2519_3277 243
801 3300046675 Ga0495657_0022703 Ga0495657_0022703_3026_3772 243
802 3300046675 Ga0495657_0273900 Ga0495657_0273900_102_848 243
803 3300046678 Ga0495599_0002450 Ga0495599_0002450_9410_10156 243
804 3300046678 Ga0495599_0008858 Ga0495599_0008858_1349_2080 243
805 3300046678 Ga0495599_0097826 Ga0495599_0097826_1026_1757 243
806 3300046678 Ga0495599_0099226 Ga0495599_0099226_425_1159 243
807 3300046679 Ga0495623_0004415 Ga0495623_0004415_6999_7730 243
808 3300046679 Ga0495623_0007570 Ga0495623_0007570_5730_6476 243
809 3300046679 Ga0495623_0070830 Ga0495623_0070830_844_1602 243
810 3300046680 Ga0495646_0009141 Ga0495646_0009141_2167_2898 243
811 3300046680 Ga0495646_0155680 Ga0495646_0155680_295_1029 243
812 3300046681 Ga0495647_0000425 Ga0495647_0000425_4314_5045 243
813 3300046681 Ga0495647_0003921 Ga0495647_0003921_3744_4478 243
814 3300046681 Ga0495647_0062514 Ga0495647_0062514_486_1217 243
815 3300046683 Ga0495658_0002141 Ga0495658_0002141_7127_7858 243
816 3300046683 Ga0495658_0080016 Ga0495658_0080016_321_1067 243
817 3300046683 Ga0495658_0256916 Ga0495658_0256916_122_853 243
818 3300046689 Ga0495613_0006654 Ga0495613_0006654_5165_5896 243
819 3300046689 Ga0495613_0188278 Ga0495613_0188278_620_1351 243
820 3300046690 Ga0495624_0031899 Ga0495624_0031899_1316_2047 243
821 3300046690 Ga0495624_0037502 Ga0495624_0037502_625_1359 243
822 3300046690 Ga0495624_0054674 Ga0495624_0054674_578_1309 243
823 3300046692 Ga0495671_0100654 Ga0495671_0100654_205_936 243
824 3300046809 Ga0495600_0003717 Ga0495600_0003717_6544_7275 243
825 3300046809 Ga0495600_0012024 Ga0495600_0012024_2031_2762 243
826 3300046809 Ga0495600_0077207 Ga0495600_0077207_179_910 243
827 3300047315 Ga0495581_0183974 Ga0495581_0183974_332_1063 243
828 3300047317 Ga0495604_0002250 Ga0495604_0002250_13197_13928 243
829 3300047317 Ga0495604_0009792 Ga0495604_0009792_111_857 243
830 3300047317 Ga0495604_0013676 Ga0495604_0013676_814_1560 243
831 3300047317 Ga0495604_0052907 Ga0495604_0052907_407_1147 243
832 3300047317 Ga0495604_0179819 Ga0495604_0179819_116_847 243
833 3300047319 Ga0495674_0001395 Ga0495674_0001395_13489_14220 243
834 3300047319 Ga0495674_0015878 Ga0495674_0015878_2266_3000 243
835 3300047319 Ga0495674_0027710 Ga0495674_0027710_403_1149 243
836 3300047319 Ga0495674_0065812 Ga0495674_0065812_237_977 243
837 3300047319 Ga0495674_0405787 Ga0495674_0405787_122_853 243
838 3300047319 Ga0495674_0541519 Ga0495674_0541519_75_806 243
839 3300047321 Ga0495676_0005796 Ga0495676_0005796_1051_1782 243
840 3300047321 Ga0495676_0190769 Ga0495676_0190769_179_913 243
841 3300047321 Ga0495676_0210182 Ga0495676_0210182_123_854 243
842 3300047322 Ga0495680_0002033 Ga0495680_0002033_6110_6841 243
843 3300047322 Ga0495680_0002550 Ga0495680_0002550_952_1683 243
844 3300047322 Ga0495680_0008188 Ga0495680_0008188_8216_8962 243
845 3300047322 Ga0495680_0031481 Ga0495680_0031481_2804_3550 243
846 3300047322 Ga0495680_0034782 Ga0495680_0034782_2209_2967 243
847 3300047322 Ga0495680_0037738 Ga0495680_0037738_1532_2263 243
848 3300047322 Ga0495680_0143040 Ga0495680_0143040_911_1645 243
849 3300047322 Ga0495680_0338185 Ga0495680_0338185_235_966 243
850 3300047444 Ga0495675_0000716 Ga0495675_0000716_15757_16488 243
851 3300047444 Ga0495675_0018579 Ga0495675_0018579_1704_2462 243
852 3300047444 Ga0495675_0131508 Ga0495675_0131508_85_831 243
853 3300047447 Ga0495685_026414 Ga0495685_026414_644_1378 243
854 3300047471 Ga0495684_0000825 Ga0495684_0000825_2815_3546 243
855 3300047471 Ga0495684_0004726 Ga0495684_0004726_3877_4608 243
856 3300047471 Ga0495684_0056487 Ga0495684_0056487_1598_2344 243
857 3300047471 Ga0495684_0231612 Ga0495684_0231612_429_1163 243
858 3300047673 Ga0495593_0003064 Ga0495593_0003064_1021_1752 243
859 3300047673 Ga0495593_0007837 Ga0495593_0007837_2025_2756 243
860 3300047673 Ga0495593_0052707 Ga0495593_0052707_1045_1776 243
861 3300047673 Ga0495593_0142428 Ga0495593_0142428_395_1129 243
862 3300048088 Ga0495602_0043075 Ga0495602_0043075_818_1564 243
863 3300048089 Ga0495614_0209180 Ga0495614_0209180_73_804 243
864 3300048903 Ga0496100_0022035 Ga0496100_0022035_2065_2796 243
865 3300048903 Ga0496100_0096185 Ga0496100_0096185_416_1147 243
866 3300048903 Ga0496100_0258618 Ga0496100_0258618_188_919 243
867 3300048904 Ga0496101_0005474 Ga0496101_0005474_2879_3610 243
868 3300048904 Ga0496101_0025559 Ga0496101_0025559_2418_3149 243
869 3300048905 Ga0496102_0152457 Ga0496102_0152457_708_1439 243
870 3300048905 Ga0496102_0234587 Ga0496102_0234587_67_798 243
871 3300048906 Ga0496103_0020771 Ga0496103_0020771_1731_2462 243
872 3300048907 Ga0496104_0001510 Ga0496104_0001510_12291_13037 243
873 3300048907 Ga0496104_0037709 Ga0496104_0037709_76_807 243
874 3300048907 Ga0496104_0063344 Ga0496104_0063344_752_1483 243
875 3300048907 Ga0496104_0459027 Ga0496104_0459027_198_929 243
876 3300048908 Ga0496105_0012460 Ga0496105_0012460_3855_4586 243
877 3300048908 Ga0496105_0033425 Ga0496105_0033425_958_1704 243
878 3300048908 Ga0496105_0047296 Ga0496105_0047296_752_1483 243
879 3300048908 Ga0496105_0130752 Ga0496105_0130752_971_1702 243
880 3300048909 Ga0496106_0073799 Ga0496106_0073799_306_1037 243
881 3300048909 Ga0496106_0288080 Ga0496106_0288080_444_1175 243
882 3300048910 Ga0496107_0036358 Ga0496107_0036358_830_1561 243
883 3300048911 Ga0496108_0048580 Ga0496108_0048580_2065_2796 243
884 3300048911 Ga0496108_0152277 Ga0496108_0152277_267_998 243
885 3300048912 Ga0496109_0091169 Ga0496109_0091169_23_754 243
886 3300048912 Ga0496109_0219390 Ga0496109_0219390_710_1441 243
887 3300048913 Ga0496110_0057471 Ga0496110_0057471_887_1618 243
888 3300048913 Ga0496110_0145822 Ga0496110_0145822_179_910 243
889 3300048914 Ga0496111_0038112 Ga0496111_0038112_1824_2555 243
890 3300048914 Ga0496111_0089090 Ga0496111_0089090_775_1506 243
891 3300048916 Ga0496113_0097495 Ga0496113_0097495_23_754 243
892 3300048917 Ga0496114_0033768 Ga0496114_0033768_2506_3237 243
893 3300048917 Ga0496114_0334692 Ga0496114_0334692_397_1128 243
894 3300048918 Ga0496115_0003503 Ga0496115_0003503_4681_5412 243
895 3300048918 Ga0496115_0032072 Ga0496115_0032072_1306_2037 243
896 3300048918 Ga0496115_0140904 Ga0496115_0140904_342_1073 243
897 3300048918 Ga0496115_0219889 Ga0496115_0219889_778_1509 243
898 3300048918 Ga0496115_0346305 Ga0496115_0346305_438_1169 243
899 3300049569 Ga0501032_0093601 Ga0501032_0093601_986_1720 243
900 3300049570 Ga0501033_0164632 Ga0501033_0164632_584_1318 243
901 3300049571 Ga0501034_0430976 Ga0501034_0430976_193_927 243
902 3300049573 Ga0501037_0064905 Ga0501037_0064905_1256_1990 243
903 3300049574 Ga0501038_0059924 Ga0501038_0059924_1654_2388 243
904 3300049580 Ga0501046_0456213 Ga0501046_0456213_22_756 243
905 3300049581 Ga0501047_0012917 Ga0501047_0012917_769_1503 243
906 3300049586 Ga0501070_0534528 Ga0501070_0534528_177_908 243
907 3300049589 Ga0501073_0034498 Ga0501073_0034498_1078_1812 243
908 3300049589 Ga0501073_0145579 Ga0501073_0145579_653_1387 243
909 3300049744 Ga0501083_0085177 Ga0501083_0085177_519_1253 243
910 3300049744 Ga0501083_0109942 Ga0501083_0109942_693_1427 243
911 3300050489 nmdc:mga03683_175051_c1 nmdc:mga03683_175051_c1_156_890 243
912 3300050493 nmdc:mga0k408_3642_c1 nmdc:mga0k408_3642_c1_6982_7716 243
913 3300050508 nmdc:mga09592_9070_c2 nmdc:mga09592_9070_c2_308_1039 243
914 3300050510 nmdc:mga06r32_4090_c1 nmdc:mga06r32_4090_c1_10290_11021 243
915 3300050511 nmdc:mga08y16_725793_c1 nmdc:mga08y16_725793_c1_236_967 243
916 3300050512 nmdc:mga0n895_277356_c1 nmdc:mga0n895_277356_c1_496_1227 243
917 3300050512 nmdc:mga0n895_354558_c1 nmdc:mga0n895_354558_c1_507_1241 243
918 3300050512 nmdc:mga0n895_53313_c1 nmdc:mga0n895_53313_c1_520_1260 243
919 3300050513 nmdc:mga0rr50_39218_c1 nmdc:mga0rr50_39218_c1_1695_2426 243
920 3300050513 nmdc:mga0rr50_605847_c1 nmdc:mga0rr50_605847_c1_166_897 243
921 3300050513 nmdc:mga0rr50_95538_c1 nmdc:mga0rr50_95538_c1_851_1582 243
922 3300050514 nmdc:mga08x19_127456_c1 nmdc:mga08x19_127456_c1_903_1688 243
923 3300050514 nmdc:mga08x19_262858_c1 nmdc:mga08x19_262858_c1_430_1161 243
924 3300050514 nmdc:mga08x19_281080_c1 nmdc:mga08x19_281080_c1_383_1114 243
925 3300053077 Ga0495601_0000620 Ga0495601_0000620_17299_18045 243
926 3300053077 Ga0495601_0000644 Ga0495601_0000644_8186_8932 243
927 3300053077 Ga0495601_0002141 Ga0495601_0002141_4956_5687 243
928 3300053077 Ga0495601_0005888 Ga0495601_0005888_101_832 243
929 3300053077 Ga0495601_0011286 Ga0495601_0011286_4516_5274 243
930 3300053077 Ga0495601_0012098 Ga0495601_0012098_2343_3077 243
931 3300053077 Ga0495601_0297035 Ga0495601_0297035_101_832 243
932 3300053078 Ga0495612_0007575 Ga0495612_0007575_3453_4184 243
933 3300053078 Ga0495612_0023074 Ga0495612_0023074_1025_1771 243
934 3300053078 Ga0495612_0028557 Ga0495612_0028557_480_1211 243
935 3300053083 Ga0495655_0046578 Ga0495655_0046578_374_1108 243
936 3300053084 Ga0495595_0000357 Ga0495595_0000357_13209_13940 243
937 3300053084 Ga0495595_0000433 Ga0495595_0000433_9169_9927 243
938 3300053084 Ga0495595_0002261 Ga0495595_0002261_794_1540 243
939 3300053085 Ga0495619_0000048 Ga0495619_0000048_18197_18943 243
940 3300053085 Ga0495619_0000314 Ga0495619_0000314_29337_30068 243
941 3300053085 Ga0495619_0001178 Ga0495619_0001178_10436_11194 243
942 3300053085 Ga0495619_0002963 Ga0495619_0002963_9080_9811 243
943 3300053085 Ga0495619_0003221 Ga0495619_0003221_1114_1860 243
944 3300053085 Ga0495619_0004731 Ga0495619_0004731_7240_7974 243
945 3300053085 Ga0495619_0021240 Ga0495619_0021240_1373_2104 243
946 3300053085 Ga0495619_0418470 Ga0495619_0418470_101_832 243
947 3300053088 Ga0500644_0000713 Ga0500644_0000713_9662_10420 243
948 3300053093 Ga0500651_0018327 Ga0500651_0018327_3150_3896 243
949 3300053094 Ga0500566_0007013 Ga0500566_0007013_5310_6068 243
950 3300053131 Ga0500652_006382 Ga0500652_006382_708_1466 243
951 3300053153 Ga0500616_0000002 Ga0500616_0000002_1361007_1361765 243
952 3300053730 Ga0500645_000217 Ga0500645_000217_15399_16133 243
953 3300060353 Ga0501082_0001104 Ga0501082_0001104_18452_19186 243
954 3300001430 JGI24032J14994_100963 JGI24032J14994_1009632 244
955 3300001915 JGI24741J21665_1012966 JGI24741J21665_10129662 244
956 3300001990 JGI24737J22298_10000343 JGI24737J22298_1000034316 244
957 3300002070 JGI24750J21931_1002404 JGI24750J21931_10024041 244
958 3300002074 JGI24748J21848_1001218 JGI24748J21848_10012183 244
959 3300002075 JGI24738J21930_10000219 JGI24738J21930_100002195 244
960 3300002076 JGI24749J21850_1000319 JGI24749J21850_10003197 244
961 3300002077 JGI24744J21845_10004689 JGI24744J21845_100046892 244
962 3300002126 JGI24035J26624_1000193 JGI24035J26624_10001933 244
963 3300002155 JGI24033J26618_1000254 JGI24033J26618_10002543 244
964 3300002244 JGI24742J22300_10000563 JGI24742J22300_100005633 244
965 3300003373 JGI25407J50210_10029444 JGI25407J50210_100294442 244
966 3300003659 JGI25404J52841_10003386 JGI25404J52841_100033863 244
967 3300003911 JGI25405J52794_10003907 JGI25405J52794_100039072 244
968 3300005293 Ga0065715_10049495 Ga0065715_100494952 244
969 3300005293 Ga0065715_10093306 Ga0065715_100933065 244
970 3300005329 Ga0070683_100001967 Ga0070683_10000196715 244
971 3300005329 Ga0070683_100163838 Ga0070683_1001638382 244
972 3300005330 Ga0070690_100000854 Ga0070690_1000008544 244
973 3300005331 Ga0070670_100002178 Ga0070670_10000217815 244
974 3300005333 Ga0070677_10000486 Ga0070677_100004866 244
975 3300005336 Ga0070680_100006836 Ga0070680_1000068363 244
976 3300005336 Ga0070680_100083682 Ga0070680_1000836822 244
977 3300005336 Ga0070680_100260841 Ga0070680_1002608412 244
978 3300005337 Ga0070682_100001998 Ga0070682_1000019985 244
979 3300005338 Ga0068868_100091469 Ga0068868_1000914693 244
980 3300005339 Ga0070660_100001923 Ga0070660_1000019234 244
981 3300005340 Ga0070689_100001902 Ga0070689_1000019022 244
982 3300005343 Ga0070687_100000334 Ga0070687_1000003341 244
983 3300005344 Ga0070661_100033673 Ga0070661_1000336731 244
984 3300005345 Ga0070692_10000022 Ga0070692_1000002214 244
985 3300005347 Ga0070668_100000947 Ga0070668_10000094715 244
986 3300005353 Ga0070669_100009110 Ga0070669_1000091104 244
987 3300005354 Ga0070675_100001735 Ga0070675_1000017354 244
988 3300005355 Ga0070671_100001490 Ga0070671_10000149015 244
989 3300005365 Ga0070688_100000196 Ga0070688_10000019618 244
990 3300005366 Ga0070659_100001661 Ga0070659_10000166114 244
991 3300005367 Ga0070667_100001157 Ga0070667_10000115713 244
992 3300005434 Ga0070709_10016416 Ga0070709_100164165 244
993 3300005434 Ga0070709_10453505 Ga0070709_104535052 244
994 3300005435 Ga0070714_100162151 Ga0070714_1001621512 244
995 3300005435 Ga0070714_100311339 Ga0070714_1003113392 244
996 3300005437 Ga0070710_10083894 Ga0070710_100838943 244
997 3300005438 Ga0070701_10002605 Ga0070701_100026053 244
998 3300005439 Ga0070711_100044159 Ga0070711_1000441592 244
999 3300005439 Ga0070711_100064164 Ga0070711_1000641643 244
1000 3300005440 Ga0070705_100003300 Ga0070705_1000033005 244
1001 3300005440 Ga0070705_100245500 Ga0070705_1002455002 244
1002 3300005444 Ga0070694_100005857 Ga0070694_1000058571 244
1003 3300005445 Ga0070708_100363709 Ga0070708_1003637092 244
1004 3300005455 Ga0070663_100007452 Ga0070663_1000074525 244
1005 3300005456 Ga0070678_100067495 Ga0070678_1000674951 244
1006 3300005457 Ga0070662_100040314 Ga0070662_1000403144 244
1007 3300005458 Ga0070681_10000884 Ga0070681_1000088423 244
1008 3300005458 Ga0070681_10025427 Ga0070681_100254273 244
1009 3300005458 Ga0070681_10312438 Ga0070681_103124382 244
1010 3300005459 Ga0068867_100000744 Ga0068867_10000074419 244
1011 3300005466 Ga0070685_10001903 Ga0070685_1000190310 244
1012 3300005530 Ga0070679_100016345 Ga0070679_1000163455 244
1013 3300005530 Ga0070679_100044032 Ga0070679_1000440325 244
1014 3300005530 Ga0070679_100174098 Ga0070679_1001740982 244
1015 3300005530 Ga0070679_100455717 Ga0070679_1004557172 244
1016 3300005530 Ga0070679_100512351 Ga0070679_1005123511 244
1017 3300005535 Ga0070684_100028411 Ga0070684_1000284114 244
1018 3300005536 Ga0070697_100033622 Ga0070697_1000336225 244
1019 3300005539 Ga0068853_100004568 Ga0068853_1000045689 244
1020 3300005539 Ga0068853_100621256 Ga0068853_1006212562 244
1021 3300005543 Ga0070672_100001256 Ga0070672_1000012564 244
1022 3300005544 Ga0070686_100000931 Ga0070686_1000009316 244
1023 3300005544 Ga0070686_100312680 Ga0070686_1003126802 244
1024 3300005545 Ga0070695_100001091 Ga0070695_10000109113 244
1025 3300005546 Ga0070696_100107647 Ga0070696_1001076473 244
1026 3300005547 Ga0070693_100054819 Ga0070693_1000548193 244
1027 3300005549 Ga0070704_100000586 Ga0070704_10000058616 244
1028 3300005563 Ga0068855_100007540 Ga0068855_10000754011 244
1029 3300005563 Ga0068855_100178113 Ga0068855_1001781132 244
1030 3300005564 Ga0070664_100009220 Ga0070664_1000092206 244
1031 3300005577 Ga0068857_100004156 Ga0068857_10000415611 244
1032 3300005578 Ga0068854_100007843 Ga0068854_1000078434 244
1033 3300005615 Ga0070702_100017341 Ga0070702_1000173411 244
1034 3300005616 Ga0068852_100001321 Ga0068852_10000132115 244
1035 3300005617 Ga0068859_100003378 Ga0068859_10000337814 244
1036 3300005718 Ga0068866_10000805 Ga0068866_1000080513 244
1037 3300005719 Ga0068861_100010705 Ga0068861_1000107054 244
1038 3300005719 Ga0068861_100106078 Ga0068861_1001060782 244
1039 3300005834 Ga0068851_10035522 Ga0068851_100355222 244
1040 3300005840 Ga0068870_10000414 Ga0068870_100004141 244
1041 3300005842 Ga0068858_100002675 Ga0068858_1000026756 244
1042 3300005843 Ga0068860_100127879 Ga0068860_1001278792 244
1043 3300005844 Ga0068862_100001659 Ga0068862_10000165916 244
1044 3300005981 Ga0081538_10003643 Ga0081538_100036437 244
1045 3300005981 Ga0081538_10019476 Ga0081538_100194763 244
1046 3300005983 Ga0081540_1000229 Ga0081540_100022948 244
1047 3300005983 Ga0081540_1004582 Ga0081540_10045823 244
1048 3300006042 Ga0075368_10059404 Ga0075368_100594042 244
1049 3300006048 Ga0075363_100056553 Ga0075363_1000565532 244
1050 3300006051 Ga0075364_10096142 Ga0075364_100961423 244
1051 3300006058 Ga0075432_10003064 Ga0075432_100030643 244
1052 3300006058 Ga0075432_10054910 Ga0075432_100549102 244
1053 3300006175 Ga0070712_100004179 Ga0070712_1000041797 244
1054 3300006175 Ga0070712_100041408 Ga0070712_1000414082 244
1055 3300006177 Ga0075362_10165381 Ga0075362_101653811 244
1056 3300006178 Ga0075367_10014656 Ga0075367_100146565 244
1057 3300006178 Ga0075367_10115737 Ga0075367_101157372 244
1058 3300006178 Ga0075367_10152143 Ga0075367_101521432 244
1059 3300006186 Ga0075369_10110302 Ga0075369_101103023 244
1060 3300006194 Ga0075427_10005535 Ga0075427_100055352 244
1061 3300006237 Ga0097621_100000432 Ga0097621_10000043216 244
1062 3300006353 Ga0075370_10002383 Ga0075370_1000238310 244
1063 3300006358 Ga0068871_100059160 Ga0068871_1000591603 244
1064 3300006844 Ga0075428_100014981 Ga0075428_1000149812 244
1065 3300006844 Ga0075428_100047216 Ga0075428_1000472163 244
1066 3300006844 Ga0075428_100386666 Ga0075428_1003866662 244
1067 3300006846 Ga0075430_100000312 Ga0075430_10000031215 244
1068 3300006846 Ga0075430_100244476 Ga0075430_1002444762 244
1069 3300006847 Ga0075431_100001045 Ga0075431_10000104524 244
1070 3300006847 Ga0075431_100024225 Ga0075431_1000242255 244
1071 3300006852 Ga0075433_10000217 Ga0075433_1000021712 244
1072 3300006871 Ga0075434_100000482 Ga0075434_10000048215 244
1073 3300006871 Ga0075434_100002518 Ga0075434_10000251816 244
1074 3300006880 Ga0075429_100005381 Ga0075429_10000538111 244
1075 3300006880 Ga0075429_100009838 Ga0075429_1000098389 244
1076 3300006881 Ga0068865_100000989 Ga0068865_10000098915 244
1077 3300006914 Ga0075436_100036229 Ga0075436_1000362292 244
1078 3300006931 Ga0097620_100003378 Ga0097620_10000337814 244
1079 3300007076 Ga0075435_100004247 Ga0075435_1000042479 244
1080 3300009093 Ga0105240_10020505 Ga0105240_100205055 244
1081 3300009094 Ga0111539_10000725 Ga0111539_1000072515 244
1082 3300009094 Ga0111539_10001938 Ga0111539_1000193814 244
1083 3300009094 Ga0111539_10006634 Ga0111539_1000663416 244
1084 3300009094 Ga0111539_10126030 Ga0111539_101260303 244
1085 3300009098 Ga0105245_10000534 Ga0105245_1000053416 244
1086 3300009098 Ga0105245_10003999 Ga0105245_100039997 244
1087 3300009101 Ga0105247_10002155 Ga0105247_1000215511 244
1088 3300009147 Ga0114129_10000227 Ga0114129_1000022756 244
1089 3300009147 Ga0114129_10120350 Ga0114129_101203502 244
1090 3300009147 Ga0114129_10136923 Ga0114129_101369234 244
1091 3300009551 Ga0105238_10670928 Ga0105238_106709282 244
1092 3300013100 Ga0157373_10064644 Ga0157373_100646441 244
1093 3300013100 Ga0157373_10136668 Ga0157373_101366682 244
1094 3300013102 Ga0157371_10008779 Ga0157371_100087799 244
1095 3300013105 Ga0157369_10789287 Ga0157369_107892871 244
1096 3300013296 Ga0157374_10056887 Ga0157374_100568874 244
1097 3300013297 Ga0157378_10398433 Ga0157378_103984331 244
1098 3300013306 Ga0163162_10003671 Ga0163162_1000367115 244
1099 3300013307 Ga0157372_10003634 Ga0157372_100036347 244
1100 3300013307 Ga0157372_10071371 Ga0157372_100713712 244
1101 3300014325 Ga0163163_10007527 Ga0163163_100075276 244
1102 3300014326 Ga0157380_10000558 Ga0157380_100005587 244
1103 3300014326 Ga0157380_10241836 Ga0157380_102418362 244
1104 3300014968 Ga0157379_10003079 Ga0157379_100030791 244
1105 3300025271 Ga0207666_1000030 Ga0207666_100003017 244
1106 3300025290 Ga0207673_1000218 Ga0207673_10002183 244
1107 3300025315 Ga0207697_10000225 Ga0207697_1000022519 244
1108 3300025885 Ga0207653_10008797 Ga0207653_100087972 244
1109 3300025893 Ga0207682_10000009 Ga0207682_1000000930 244
1110 3300025899 Ga0207642_10002006 Ga0207642_100020066 244
1111 3300025901 Ga0207688_10000060 Ga0207688_1000006015 244
1112 3300025903 Ga0207680_10140594 Ga0207680_101405942 244
1113 3300025904 Ga0207647_10000172 Ga0207647_1000017217 244
1114 3300025906 Ga0207699_10410186 Ga0207699_104101862 244
1115 3300025908 Ga0207643_10000244 Ga0207643_1000024415 244
1116 3300025912 Ga0207707_10003182 Ga0207707_100031822 244
1117 3300025912 Ga0207707_10278683 Ga0207707_102786832 244
1118 3300025913 Ga0207695_10036880 Ga0207695_100368805 244
1119 3300025913 Ga0207695_10127645 Ga0207695_101276452 244
1120 3300025913 Ga0207695_10556979 Ga0207695_105569792 244
1121 3300025914 Ga0207671_10003102 Ga0207671_100031025 244
1122 3300025915 Ga0207693_10003429 Ga0207693_100034298 244
1123 3300025915 Ga0207693_10063636 Ga0207693_100636363 244
1124 3300025916 Ga0207663_10093253 Ga0207663_100932532 244
1125 3300025917 Ga0207660_10000179 Ga0207660_1000017925 244
1126 3300025917 Ga0207660_10039415 Ga0207660_100394154 244
1127 3300025917 Ga0207660_10067189 Ga0207660_100671892 244
1128 3300025917 Ga0207660_10215521 Ga0207660_102155212 244
1129 3300025918 Ga0207662_10000025 Ga0207662_1000002529 244
1130 3300025919 Ga0207657_10001867 Ga0207657_100018679 244
1131 3300025920 Ga0207649_10000693 Ga0207649_1000069310 244
1132 3300025921 Ga0207652_10002825 Ga0207652_100028253 244
1133 3300025921 Ga0207652_10056325 Ga0207652_100563252 244
1134 3300025923 Ga0207681_10031992 Ga0207681_100319922 244
1135 3300025924 Ga0207694_10336648 Ga0207694_103366483 244
1136 3300025925 Ga0207650_10113403 Ga0207650_101134032 244
1137 3300025926 Ga0207659_10000283 Ga0207659_1000028316 244
1138 3300025926 Ga0207659_10134966 Ga0207659_101349663 244
1139 3300025927 Ga0207687_10022241 Ga0207687_100222415 244
1140 3300025929 Ga0207664_10109506 Ga0207664_101095062 244
1141 3300025931 Ga0207644_10027313 Ga0207644_100273135 244
1142 3300025932 Ga0207690_10000808 Ga0207690_100008085 244
1143 3300025933 Ga0207706_10000734 Ga0207706_1000073415 244
1144 3300025935 Ga0207709_10009900 Ga0207709_100099002 244
1145 3300025936 Ga0207670_10106021 Ga0207670_101060212 244
1146 3300025937 Ga0207669_10000204 Ga0207669_1000020416 244
1147 3300025938 Ga0207704_10000130 Ga0207704_1000013032 244
1148 3300025940 Ga0207691_10000309 Ga0207691_1000030919 244
1149 3300025941 Ga0207711_10024232 Ga0207711_100242326 244
1150 3300025942 Ga0207689_10000893 Ga0207689_1000089315 244
1151 3300025944 Ga0207661_10009141 Ga0207661_100091413 244
1152 3300025944 Ga0207661_10492969 Ga0207661_104929692 244
1153 3300025945 Ga0207679_10000128 Ga0207679_1000012816 244
1154 3300025949 Ga0207667_10025198 Ga0207667_100251986 244
1155 3300025960 Ga0207651_10007318 Ga0207651_100073183 244
1156 3300025960 Ga0207651_10415088 Ga0207651_104150882 244
1157 3300025986 Ga0207658_10265832 Ga0207658_102658322 244
1158 3300025986 Ga0207658_10539492 Ga0207658_105394922 244
1159 3300026023 Ga0207677_10007755 Ga0207677_100077553 244
1160 3300026035 Ga0207703_10024451 Ga0207703_100244513 244
1161 3300026041 Ga0207639_10002888 Ga0207639_1000288811 244
1162 3300026067 Ga0207678_10000759 Ga0207678_1000075915 244
1163 3300026075 Ga0207708_10000391 Ga0207708_1000039115 244
1164 3300026078 Ga0207702_10012125 Ga0207702_100121257 244
1165 3300026088 Ga0207641_10051093 Ga0207641_100510932 244
1166 3300026089 Ga0207648_10000862 Ga0207648_1000086215 244
1167 3300026095 Ga0207676_10032956 Ga0207676_100329564 244
1168 3300026116 Ga0207674_10000806 Ga0207674_1000080625 244
1169 3300026118 Ga0207675_100000637 Ga0207675_10000063719 244
1170 3300026118 Ga0207675_100129487 Ga0207675_1001294874 244
1171 3300026121 Ga0207683_10000330 Ga0207683_1000033015 244
1172 3300027617 Ga0210002_1000486 Ga0210002_10004862 244
1173 3300027695 Ga0209966_1007500 Ga0209966_10075002 244
1174 3300027717 Ga0209998_10000253 Ga0209998_1000025311 244
1175 3300027717 Ga0209998_10002914 Ga0209998_100029143 244
1176 3300027876 Ga0209974_10000230 Ga0209974_100002307 244
1177 3300027907 Ga0207428_10000164 Ga0207428_1000016481 244
1178 3300027907 Ga0207428_10000815 Ga0207428_1000081527 244
1179 3300027907 Ga0207428_10004757 Ga0207428_1000475713 244
1180 3300028380 Ga0268265_10004750 Ga0268265_100047503 244
1181 3300028381 Ga0268264_10013527 Ga0268264_100135276 244
1182 3300034816 Ga0373930_0018187 Ga0373930_0018187_528_1262 244
1183 3300034820 Ga0373959_0007119 Ga0373959_0007119_716_1450 244
1184 3300035085 Ga0373929_0002082 Ga0373929_0002082_759_1493 244
1185 3300035088 Ga0373940_0001141 Ga0373940_0001141_2459_3193 244
1186 3300035090 Ga0373949_0002607 Ga0373949_0002607_3399_4133 244
1187 3300035092 Ga0373952_0000397 Ga0373952_0000397_5964_6698 244
1188 3300035113 Ga0373936_0022805 Ga0373936_0022805_647_1411 244
1189 3300035114 Ga0373939_0002797 Ga0373939_0002797_997_1731 244
1190 3300035116 Ga0373945_0012790 Ga0373945_0012790_989_1753 244
1191 3300035170 Ga0373943_0002664 Ga0373943_0002664_1039_1803 244
1192 3300035171 Ga0373946_0015674 Ga0373946_0015674_1621_2385 244
1193 3300035242 Ga0373962_0000571 Ga0373962_0000571_6931_7665 244
1194 3300035691 Ga0373931_0197279 Ga0373931_0197279_433_1167 244
1195 3300035692 Ga0373935_0009246 Ga0373935_0009246_2763_3527 244
1196 3300035695 Ga0373927_0000709 Ga0373927_0000709_16276_17040 244
1197 3300037068 Ga0373925_0001095 Ga0373925_0001095_6104_6868 244
1198 3300039437 Ga0436365_0239293 Ga0436365_0239293_4720_5454 244
1199 3300041408 Ga0439453_0000384 Ga0439453_0000384_316_1053 244
1200 3300042001 Ga0439441_006240 Ga0439441_006240_523_1260 244
1201 3300042001 Ga0439441_009085 Ga0439441_009085_193_927 244
1202 3300042003 Ga0439443_002564 Ga0439443_002564_746_1483 244
1203 3300042016 Ga0439463_015138 Ga0439463_015138_603_1337 244
1204 3300042156 Ga0439446_0103735 Ga0439446_0103735_152_889 244
1205 3300042157 Ga0439458_0018270 Ga0439458_0018270_618_1352 244
1206 3300042436 Ga0439435_0066074 Ga0439435_0066074_158_895 244
1207 3300042461 Ga0439460_0015122 Ga0439460_0015122_422_1159 244
1208 3300042532 Ga0450893_0008740 Ga0450893_0008740_176_910 244
1209 3300042993 Ga0439440_0019896 Ga0439440_0019896_17_754 244
1210 3300046457 Ga0495590_0144363 Ga0495590_0144363_87_821 244
1211 3300046459 Ga0495629_0185097 Ga0495629_0185097_428_1192 244
1212 3300046472 Ga0495580_0058441 Ga0495580_0058441_1198_1962 244
1213 3300046475 Ga0495639_0015188 Ga0495639_0015188_2388_3152 244
1214 3300046499 Ga0495594_0294637 Ga0495594_0294637_56_820 244
1215 3300046517 Ga0495630_0009151 Ga0495630_0009151_163_927 244
1216 3300046531 Ga0495665_0094785 Ga0495665_0094785_157_921 244
1217 3300046533 Ga0495640_0065176 Ga0495640_0065176_954_1718 244
1218 3300046642 Ga0495634_0012116 Ga0495634_0012116_3243_4031 244
1219 3300046663 Ga0495635_0076773 Ga0495635_0076773_590_1354 244
1220 3300046689 Ga0495613_0074369 Ga0495613_0074369_784_1548 244
1221 3300046690 Ga0495624_0002150 Ga0495624_0002150_1767_2531 244
1222 3300046809 Ga0495600_0192020 Ga0495600_0192020_167_955 244
1223 3300047315 Ga0495581_0020224 Ga0495581_0020224_2378_3142 244
1224 3300047321 Ga0495676_0040689 Ga0495676_0040689_1043_1807 244
1225 3300047471 Ga0495684_0007901 Ga0495684_0007901_5179_5943 244
1226 3300047471 Ga0495684_0026005 Ga0495684_0026005_1904_2692 244
1227 3300047673 Ga0495593_0050529 Ga0495593_0050529_354_1118 244
1228 3300048089 Ga0495614_0156518 Ga0495614_0156518_156_920 244
1229 3300048903 Ga0496100_0001536 Ga0496100_0001536_10583_11317 244
1230 3300048905 Ga0496102_0006414 Ga0496102_0006414_4550_5284 244
1231 3300048909 Ga0496106_0003156 Ga0496106_0003156_9399_10133 244
1232 3300048910 Ga0496107_0049621 Ga0496107_0049621_1894_2628 244
1233 3300048911 Ga0496108_0013605 Ga0496108_0013605_3992_4726 244
1234 3300048912 Ga0496109_0001830 Ga0496109_0001830_2075_2809 244
1235 3300048913 Ga0496110_0189587 Ga0496110_0189587_314_1048 244
1236 3300048914 Ga0496111_0012150 Ga0496111_0012150_4315_5049 244
1237 3300048916 Ga0496113_0020069 Ga0496113_0020069_3914_4648 244
1238 3300048917 Ga0496114_0006915 Ga0496114_0006915_7751_8485 244
1239 3300048918 Ga0496115_0013117 Ga0496115_0013117_4393_5127 244
1240 3300049568 Ga0501031_0008274 Ga0501031_0008274_4748_5482 244
1241 3300049569 Ga0501032_0097746 Ga0501032_0097746_302_1036 244
1242 3300049570 Ga0501033_0057588 Ga0501033_0057588_633_1367 244
1243 3300049570 Ga0501033_0115385 Ga0501033_0115385_925_1659 244
1244 3300049571 Ga0501034_0000593 Ga0501034_0000593_26258_27025 244
1245 3300049571 Ga0501034_0016957 Ga0501034_0016957_5958_6692 244
1246 3300049571 Ga0501034_0226612 Ga0501034_0226612_772_1506 244
1247 3300049572 Ga0501036_0026682 Ga0501036_0026682_1136_1870 244
1248 3300049572 Ga0501036_0057013 Ga0501036_0057013_572_1330 244
1249 3300049572 Ga0501036_0141350 Ga0501036_0141350_1218_1952 244
1250 3300049572 Ga0501036_0456938 Ga0501036_0456938_19_753 244
1251 3300049573 Ga0501037_0012848 Ga0501037_0012848_2303_3061 244
1252 3300049573 Ga0501037_0160685 Ga0501037_0160685_55_789 244
1253 3300049574 Ga0501038_0026716 Ga0501038_0026716_698_1432 244
1254 3300049575 Ga0501039_0076719 Ga0501039_0076719_1387_2121 244
1255 3300049576 Ga0501040_0098416 Ga0501040_0098416_361_1095 244
1256 3300049578 Ga0501042_0114111 Ga0501042_0114111_857_1591 244
1257 3300049579 Ga0501043_0019458 Ga0501043_0019458_3350_4084 244
1258 3300049580 Ga0501046_0012009 Ga0501046_0012009_5156_5890 244
1259 3300049580 Ga0501046_0164436 Ga0501046_0164436_173_931 244
1260 3300049581 Ga0501047_0062788 Ga0501047_0062788_860_1618 244
1261 3300049581 Ga0501047_0132919 Ga0501047_0132919_990_1724 244
1262 3300049581 Ga0501047_0195045 Ga0501047_0195045_78_815 244
1263 3300049582 Ga0501048_0019492 Ga0501048_0019492_1135_1869 244
1264 3300049583 Ga0501067_0025678 Ga0501067_0025678_1503_2237 244
1265 3300049584 Ga0501068_0076589 Ga0501068_0076589_812_1546 244
1266 3300049584 Ga0501068_0344379 Ga0501068_0344379_98_832 244
1267 3300049585 Ga0501069_0003092 Ga0501069_0003092_207_941 244
1268 3300049586 Ga0501070_0053826 Ga0501070_0053826_1731_2465 244
1269 3300049586 Ga0501070_0142396 Ga0501070_0142396_925_1659 244
1270 3300049586 Ga0501070_0148487 Ga0501070_0148487_69_803 244
1271 3300049586 Ga0501070_0153673 Ga0501070_0153673_538_1272 244
1272 3300049587 Ga0501071_0015807 Ga0501071_0015807_3484_4218 244
1273 3300049587 Ga0501071_0565425 Ga0501071_0565425_82_816 244
1274 3300049588 Ga0501072_0004057 Ga0501072_0004057_7853_8590 244
1275 3300049588 Ga0501072_0036400 Ga0501072_0036400_2605_3339 244
1276 3300049588 Ga0501072_0059733 Ga0501072_0059733_557_1291 244
1277 3300049589 Ga0501073_0061364 Ga0501073_0061364_1029_1763 244
1278 3300049590 Ga0501074_0015124 Ga0501074_0015124_3429_4163 244
1279 3300049590 Ga0501074_0022331 Ga0501074_0022331_1493_2227 244
1280 3300049590 Ga0501074_0140500 Ga0501074_0140500_463_1197 244
1281 3300049590 Ga0501074_0198040 Ga0501074_0198040_380_1117 244
1282 3300049590 Ga0501074_0351118 Ga0501074_0351118_240_977 244
1283 3300049591 Ga0501075_0308237 Ga0501075_0308237_431_1165 244
1284 3300049592 Ga0501076_0124635 Ga0501076_0124635_817_1551 244
1285 3300049592 Ga0501076_0221790 Ga0501076_0221790_93_827 244
1286 3300049593 Ga0501077_0031147 Ga0501077_0031147_1484_2218 244
1287 3300049593 Ga0501077_0211360 Ga0501077_0211360_287_1024 244
1288 3300049741 Ga0501079_0018353 Ga0501079_0018353_2575_3309 244
1289 3300049741 Ga0501079_0172569 Ga0501079_0172569_42_776 244
1290 3300049742 Ga0501080_0017501 Ga0501080_0017501_3337_4071 244
1291 3300049742 Ga0501080_0090883 Ga0501080_0090883_421_1155 244
1292 3300049742 Ga0501080_0116435 Ga0501080_0116435_1030_1764 244
1293 3300049742 Ga0501080_0165945 Ga0501080_0165945_766_1500 244
1294 3300049743 Ga0501081_0032259 Ga0501081_0032259_658_1392 244
1295 3300049743 Ga0501081_0143881 Ga0501081_0143881_275_1012 244
1296 3300049744 Ga0501083_0017077 Ga0501083_0017077_3849_4583 244
1297 3300049744 Ga0501083_0047603 Ga0501083_0047603_1655_2389 244
1298 3300049744 Ga0501083_0355186 Ga0501083_0355186_128_865 244
1299 3300049822 Ga0501035_0095026 Ga0501035_0095026_1233_1991 244
1300 3300049822 Ga0501035_0294977 Ga0501035_0294977_264_998 244
1301 3300049823 Ga0501044_0043598 Ga0501044_0043598_3662_4396 244
1302 3300049823 Ga0501044_0122691 Ga0501044_0122691_1022_1780 244
1303 3300049823 Ga0501044_0125584 Ga0501044_0125584_448_1182 244
1304 3300049823 Ga0501044_0371075 Ga0501044_0371075_144_878 244
1305 3300049824 Ga0501045_0177283 Ga0501045_0177283_480_1214 244
1306 3300050507 nmdc:mga05p37_115589_c1 nmdc:mga05p37_115589_c1_2247_2984 244
1307 3300050507 nmdc:mga05p37_1375_c1 nmdc:mga05p37_1375_c1_19861_20595 244
1308 3300050507 nmdc:mga05p37_1568_c1 nmdc:mga05p37_1568_c1_20505_21239 244
1309 3300050508 nmdc:mga09592_1386_c1 nmdc:mga09592_1386_c1_15434_16168 244
1310 3300050509 nmdc:mga0qj67_3364_c1 nmdc:mga0qj67_3364_c1_107_841 244
1311 3300050509 nmdc:mga0qj67_959_c1 nmdc:mga0qj67_959_c1_7233_7967 244
1312 3300050510 nmdc:mga06r32_134_c1 nmdc:mga06r32_134_c1_34365_35099 244
1313 3300050510 nmdc:mga06r32_306204_c1 nmdc:mga06r32_306204_c1_754_1491 244
1314 3300050510 nmdc:mga06r32_592_c1 nmdc:mga06r32_592_c1_12366_13100 244
1315 3300050511 nmdc:mga08y16_108_c1 nmdc:mga08y16_108_c1_15266_16000 244
1316 3300050511 nmdc:mga08y16_59205_c1 nmdc:mga08y16_59205_c1_1568_2302 244
1317 3300050511 nmdc:mga08y16_67147_c1 nmdc:mga08y16_67147_c1_2486_3220 244
1318 3300050511 nmdc:mga08y16_961_c1 nmdc:mga08y16_961_c1_14949_15683 244
1319 3300050512 nmdc:mga0n895_295587_c1 nmdc:mga0n895_295587_c1_636_1373 244
1320 3300050512 nmdc:mga0n895_337_c1 nmdc:mga0n895_337_c1_12023_12757 244
1321 3300050512 nmdc:mga0n895_406_c1 nmdc:mga0n895_406_c1_21782_22516 244
1322 3300050513 nmdc:mga0rr50_1110_c1 nmdc:mga0rr50_1110_c1_1779_2513 244
1323 3300050514 nmdc:mga08x19_141387_c1 nmdc:mga08x19_141387_c1_80_814 244
1324 3300050515 nmdc:mga0a205_2128_c1 nmdc:mga0a205_2128_c1_4641_5375 244
1325 3300050515 nmdc:mga0a205_2355_c1 nmdc:mga0a205_2355_c1_669_1403 244
1326 3300053085 Ga0495619_0062986 Ga0495619_0062986_163_927 244
1327 3300053153 Ga0500616_0039792 Ga0500616_0039792_1577_2314 244
1328 3300054114 Ga0501084_0028014 Ga0501084_0028014_2407_3141 244
1329 3300054114 Ga0501084_0257523 Ga0501084_0257523_713_1447 244
1330 3300054114 Ga0501084_0419872 Ga0501084_0419872_62_796 244
1331 3300060353 Ga0501082_0118981 Ga0501082_0118981_183_917 244
1332 3300060353 Ga0501082_0127023 Ga0501082_0127023_980_1714 244
1333 3300061734 Ga0530510_0426645 Ga0530510_0426645_68_802 244

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF00005

ABC_tran

ABC transporter

20

172

0.92

Structural Annotation

Top 5 Hits

ID Description Score Start End
6mit-assembly2.cif.gz_E lptbfgc from enterobacter cloacae 0.9394 5 244
5x5y-assembly1.cif.gz_A a membrane protein complex 0.9386 5 243
6b89-assembly1.cif.gz_A e. coli lptb in complex with adp and novobiocin 0.9378 5 241
4wbs-assembly1.cif.gz_A crystal structure of an abc transporter related protein from burkholderia phymatum 0.9358 5 244
6mjp-assembly1.cif.gz_B lptb(e163q)fgc from vibrio cholerae 0.935 3 244
ID Description Score Start End Superfamily
af_A0A1D6P1I8_181_285_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.936 5 68 3.40.50.300
4wbsA00 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9359 5 244 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9329 1 227 3.40.50.300
af_P0A9S7_4_254_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9306 4 244 3.40.50.300
af_P77795_1_218_3.40.50.300 Alpha Beta;3-Layer(aba) Sandwich;Rossmann fold;P-loop containing nucleotide triphosphate hydrolases 0.9288 1 227 3.40.50.300

Feature Viewer

pLDDT pTM Quality
92.37 0.9 High
Powered by Feature Viewer

Predicted Structure (AlphaFold2)

Powered by PDBe Molstar

Map