F493034

General Info

Members Datasets Scaffolds Average Seq Length
1326 397 2652 111

Family's Representative Sequence

Representative Sequence 3300028800|Ga0265338_10040736|Ga0265338_100407366
Length 126
Sequence LLESRRPLHYHSSMDDCLFCKIIAGKIPSRKVYEDDKVYVFEDITPKAPTHLLIVPKRHIAGLKEAQPEDAEIIGYSHLVAANIARDRGIEDSYRTVYNVGPGSGQSVFHLHLHLLGGRDLTWPPG

Samples

Sample ID Description Type Environment
1 3300028800 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG Metagenome Rhizosphere
2 2162886012 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 Metagenome Rhizosphere
3 3300001991 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 Metagenome Rhizosphere
4 3300002239 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 Metagenome Rhizosphere
5 3300002459 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 Metagenome Rhizosphere
6 3300003320 Sugarcane root Sample H2 Metagenome Unclassified
7 3300003322 Sugarcane root Sample L2 Metagenome Unclassified
8 3300005289 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) Metagenome Rhizosphere
9 3300005290 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) Metagenome Rhizosphere
10 3300005293 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) Metagenome Rhizosphere
11 3300005295 Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) Metagenome Rhizosphere
12 3300005327 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG Metagenome Rhizosphere
13 3300005328 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG Metagenome Rhizosphere
14 3300005329 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG Metagenome Rhizosphere
15 3300005330 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG Metagenome Rhizosphere
16 3300005331 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG Metagenome Rhizosphere
17 3300005334 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 Metagenome Rhizosphere
18 3300005335 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG Metagenome Rhizosphere
19 3300005336 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG Metagenome Rhizosphere
20 3300005337 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG Metagenome Rhizosphere
21 3300005338 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 Metagenome Rhizosphere
22 3300005339 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG Metagenome Rhizosphere
23 3300005340 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG Metagenome Rhizosphere
24 3300005341 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG Metagenome Rhizosphere
25 3300005343 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG Metagenome Rhizosphere
26 3300005344 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG Metagenome Rhizosphere
27 3300005345 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG Metagenome Rhizosphere
28 3300005347 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG Metagenome Rhizosphere
29 3300005353 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG Metagenome Rhizosphere
30 3300005354 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG Metagenome Rhizosphere
31 3300005355 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG Metagenome Rhizosphere
32 3300005356 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG Metagenome Rhizosphere
33 3300005364 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG Metagenome Rhizosphere
34 3300005365 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG Metagenome Rhizosphere
35 3300005366 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG Metagenome Rhizosphere
36 3300005367 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG Metagenome Rhizosphere
37 3300005434 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG Metagenome Rhizosphere
38 3300005435 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG Metagenome Rhizosphere
39 3300005436 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG Metagenome Rhizosphere
40 3300005437 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG Metagenome Rhizosphere
41 3300005438 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG Metagenome Rhizosphere
42 3300005439 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG Metagenome Rhizosphere
43 3300005440 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG Metagenome Rhizosphere
44 3300005441 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG Metagenome Rhizosphere
45 3300005444 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG Metagenome Rhizosphere
46 3300005445 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG Metagenome Rhizosphere
47 3300005455 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG Metagenome Rhizosphere
48 3300005456 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG Metagenome Rhizosphere
49 3300005457 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG Metagenome Rhizosphere
50 3300005458 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG Metagenome Rhizosphere
51 3300005459 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 Metagenome Rhizosphere
52 3300005466 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG Metagenome Rhizosphere
53 3300005467 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG Metagenome Rhizosphere
54 3300005468 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG Metagenome Rhizosphere
55 3300005471 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG Metagenome Rhizosphere
56 3300005518 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG Metagenome Rhizosphere
57 3300005530 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG Metagenome Rhizosphere
58 3300005535 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG Metagenome Rhizosphere
59 3300005536 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG Metagenome Rhizosphere
60 3300005539 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 Metagenome Rhizosphere
61 3300005543 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG Metagenome Rhizosphere
62 3300005544 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG Metagenome Rhizosphere
63 3300005545 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG Metagenome Rhizosphere
64 3300005546 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG Metagenome Rhizosphere
65 3300005547 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG Metagenome Rhizosphere
66 3300005548 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG Metagenome Rhizosphere
67 3300005549 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG Metagenome Rhizosphere
68 3300005563 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 Metagenome Rhizosphere
69 3300005564 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG Metagenome Rhizosphere
70 3300005577 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 Metagenome Rhizosphere
71 3300005578 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 Metagenome Rhizosphere
72 3300005614 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 Metagenome Rhizosphere
73 3300005615 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG Metagenome Rhizosphere
74 3300005616 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 Metagenome Rhizosphere
75 3300005617 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 Metagenome Rhizosphere
76 3300005618 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 Metagenome Rhizosphere
77 3300005718 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 Metagenome Rhizosphere
78 3300005719 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 Metagenome Rhizosphere
79 3300005834 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 Metagenome Rhizosphere
80 3300005840 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 Metagenome Rhizosphere
81 3300005841 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 Metagenome Rhizosphere
82 3300005842 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 Metagenome Rhizosphere
83 3300005843 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 Metagenome Rhizosphere
84 3300005844 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 Metagenome Rhizosphere
85 3300005937 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 Metagenome Rhizosphere
86 3300005981 Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 Metagenome Rhizosphere
87 3300006028 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG Metagenome Rhizosphere
88 3300006038 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 Metagenome Endosphere
89 3300006051 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 Metagenome Endosphere
90 3300006163 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG Metagenome Rhizosphere
91 3300006173 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG Metagenome Rhizosphere
92 3300006175 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG Metagenome Rhizosphere
93 3300006237 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) Metagenome Rhizosphere
94 3300006353 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 Metagenome Endosphere
95 3300006358 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 Metagenome Rhizosphere
96 3300006844 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 Metagenome Rhizosphere
97 3300006846 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 Metagenome Rhizosphere
98 3300006847 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 Metagenome Rhizosphere
99 3300006852 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 Metagenome Rhizosphere
100 3300006871 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 Metagenome Rhizosphere
101 3300006880 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 Metagenome Rhizosphere
102 3300006881 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 Metagenome Rhizosphere
103 3300006914 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 Metagenome Rhizosphere
104 3300006931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) Metagenome Rhizosphere
105 3300007076 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 Metagenome Rhizosphere
106 3300009093 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG Metagenome Rhizosphere
107 3300009094 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) Metagenome Rhizosphere
108 3300009098 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG Metagenome Rhizosphere
109 3300009101 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG Metagenome Rhizosphere
110 3300009147 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) Metagenome Rhizosphere
111 3300009148 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG Metagenome Rhizosphere
112 3300009174 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG Metagenome Rhizosphere
113 3300009176 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG Metagenome Rhizosphere
114 3300009177 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG Metagenome Rhizosphere
115 3300009545 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG Metagenome Rhizosphere
116 3300009551 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG Metagenome Rhizosphere
117 3300009553 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG Metagenome Rhizosphere
118 3300010375 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG Metagenome Rhizosphere
119 3300011119 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG Metagenome Rhizosphere
120 3300012483 Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 Metagenome Rhizosphere
121 3300013100 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG Metagenome Rhizosphere
122 3300013102 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG Metagenome Rhizosphere
123 3300013104 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG Metagenome Rhizosphere
124 3300013105 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG Metagenome Rhizosphere
125 3300013296 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG Metagenome Rhizosphere
126 3300013297 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG Metagenome Rhizosphere
127 3300013306 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG Metagenome Rhizosphere
128 3300013307 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG Metagenome Rhizosphere
129 3300013308 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG Metagenome Rhizosphere
130 3300014325 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG Metagenome Rhizosphere
131 3300014326 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG Metagenome Rhizosphere
132 3300014497 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG Metagenome Rhizosphere
133 3300014745 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG Metagenome Rhizosphere
134 3300014968 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG Metagenome Rhizosphere
135 3300014969 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG Metagenome Rhizosphere
136 3300015261 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG Metagenome Rhizosphere
137 3300015262 Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG Metagenome Rhizosphere
138 3300017792 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG Metagenome Rhizosphere
139 3300020070 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
140 3300020077 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
141 3300020081 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
142 3300020082 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) Metatranscriptome Rhizosphere
143 3300025315 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) Metagenome Rhizosphere
144 3300025321 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) Metagenome Rhizosphere
145 3300025893 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
146 3300025898 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
147 3300025899 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) Metagenome Rhizosphere
148 3300025900 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
149 3300025901 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) Metagenome Rhizosphere
150 3300025903 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
151 3300025904 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) Metagenome Rhizosphere
152 3300025906 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
153 3300025907 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
154 3300025908 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) Metagenome Rhizosphere
155 3300025909 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
156 3300025910 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
157 3300025911 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
158 3300025912 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
159 3300025913 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
160 3300025914 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
161 3300025915 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
162 3300025916 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
163 3300025917 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
164 3300025918 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
165 3300025919 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
166 3300025920 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
167 3300025921 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) Metagenome Rhizosphere
168 3300025922 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
169 3300025923 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
170 3300025924 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
171 3300025925 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
172 3300025926 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
173 3300025927 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
174 3300025928 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
175 3300025929 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
176 3300025931 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
177 3300025932 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
178 3300025933 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
179 3300025934 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
180 3300025935 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
181 3300025936 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) Metagenome Rhizosphere
182 3300025937 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
183 3300025938 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) Metagenome Rhizosphere
184 3300025939 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) Metagenome Rhizosphere
185 3300025940 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
186 3300025941 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
187 3300025942 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) Metagenome Rhizosphere
188 3300025944 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) Metagenome Rhizosphere
189 3300025945 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
190 3300025949 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) Metagenome Rhizosphere
191 3300025960 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
192 3300025961 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) Metagenome Rhizosphere
193 3300025972 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
194 3300025981 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) Metagenome Rhizosphere
195 3300025986 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
196 3300026023 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) Metagenome Rhizosphere
197 3300026035 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) Metagenome Rhizosphere
198 3300026041 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) Metagenome Rhizosphere
199 3300026067 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
200 3300026075 Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) Metagenome Rhizosphere
201 3300026078 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) Metagenome Rhizosphere
202 3300026088 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) Metagenome Rhizosphere
203 3300026089 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) Metagenome Rhizosphere
204 3300026095 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) Metagenome Rhizosphere
205 3300026116 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) Metagenome Rhizosphere
206 3300026118 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) Metagenome Rhizosphere
207 3300026121 Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
208 3300026142 Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) Metagenome Rhizosphere
209 3300027671 Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) Metagenome Rhizosphere
210 3300027717 Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) Metagenome Rhizosphere
211 3300027907 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) Metagenome Rhizosphere
212 3300028379 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) Metagenome Rhizosphere
213 3300028380 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) Metagenome Rhizosphere
214 3300028381 Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) Metagenome Rhizosphere
215 3300028556 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG Metagenome Rhizosphere
216 3300028558 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG Metagenome Rhizosphere
217 3300028563 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG Metagenome Rhizosphere
218 3300028653 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG Metagenome Rhizosphere
219 3300028654 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG Metagenome Rhizosphere
220 3300028666 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG Metagenome Rhizosphere
221 3300031241 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG Metagenome Rhizosphere
222 3300031247 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG Metagenome Rhizosphere
223 3300031344 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG Metagenome Rhizosphere
224 3300031595 Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG Metagenome Rhizosphere
225 3300031727 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 Metagenome Rhizosphere
226 3300031728 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC Metagenome Rhizosphere
227 3300031731 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 Metagenome Rhizosphere
228 3300031733 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 Metagenome Rhizosphere
229 3300031852 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 Metagenome Rhizosphere
230 3300031903 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 Metagenome Rhizosphere
231 3300032002 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 Metagenome Rhizosphere
232 3300032004 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 Metagenome Rhizosphere
233 3300032126 Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 Metagenome Rhizosphere
234 3300032137 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC Metagenome Rhizosphere
235 3300034817 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 Metagenome Rhizosphere
236 3300034818 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 Metagenome Rhizosphere
237 3300035083 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 Metagenome Rhizosphere
238 3300035089 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 Metagenome Rhizosphere
239 3300035090 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 Metagenome Rhizosphere
240 3300035113 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 Metagenome Rhizosphere
241 3300035114 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 Metagenome Rhizosphere
242 3300035115 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 Metagenome Rhizosphere
243 3300035116 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 Metagenome Rhizosphere
244 3300035117 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 Metagenome Rhizosphere
245 3300035120 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 Metagenome Rhizosphere
246 3300035121 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 Metagenome Rhizosphere
247 3300035170 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 Metagenome Rhizosphere
248 3300035171 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 Metagenome Rhizosphere
249 3300035172 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 Metagenome Rhizosphere
250 3300035241 Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 Metagenome Rhizosphere
251 3300035398 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 Metagenome Rhizosphere
252 3300035410 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 Metagenome Rhizosphere
253 3300035691 Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 Metagenome Rhizosphere
254 3300035695 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 Metagenome Rhizosphere
255 3300035724 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 Metagenome Rhizosphere
256 3300035725 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 Metagenome Rhizosphere
257 3300036401 Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 Metagenome Rhizosphere
258 3300036647 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA Metagenome Rhizosphere
259 3300036712 Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA Metagenome Rhizosphere
260 3300037068 Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 Metagenome Rhizosphere
261 3300037418 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 Metagenome Rhizosphere
262 3300037466 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 Metagenome Rhizosphere
263 3300037471 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 Metagenome Rhizosphere
264 3300037853 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 Metagenome Unclassified
265 3300038443 Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 Metagenome Rhizosphere
266 3300039437 Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 Metagenome Unclassified
267 3300039453 Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 Metagenome Rhizosphere
268 3300041408 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 Metagenome Rhizosphere
269 3300041463 Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG Metagenome Rhizoplane
270 3300041511 White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG Metagenome Unclassified
271 3300042009 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 Metagenome Rhizosphere
272 3300042011 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 Metagenome Rhizosphere
273 3300042118 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 Metagenome Rhizosphere
274 3300042122 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 Metagenome Rhizosphere
275 3300042142 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 Metagenome Rhizosphere
276 3300042145 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 Metagenome Rhizosphere
277 3300042184 Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 Metagenome Rhizosphere
278 3300042439 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 Metagenome Rhizosphere
279 3300042530 Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 Metagenome Rhizosphere
280 3300042876 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED Metagenome Rhizosphere
281 3300044656 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R Metagenome Rhizosphere
282 3300044684 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R Metagenome Rhizosphere
283 3300044693 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R Metagenome Rhizosphere
284 3300044694 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R Metagenome Rhizosphere
285 3300044719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R Metagenome Rhizosphere
286 3300044842 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R Metagenome Rhizosphere
287 3300044901 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R Metagenome Rhizosphere
288 3300045049 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R Metagenome Rhizosphere
289 3300045051 Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED Metagenome Rhizosphere
290 3300045836 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R Metagenome Rhizosphere
291 3300045976 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R Metagenome Rhizosphere
292 3300046459 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere Metagenome Rhizosphere
293 3300046463 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere Metagenome Rhizosphere
294 3300046472 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere Metagenome Rhizosphere
295 3300046473 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere Metagenome Rhizosphere
296 3300046475 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere Metagenome Rhizosphere
297 3300046492 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere Metagenome Rhizosphere
298 3300046499 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere Metagenome Rhizosphere
299 3300046511 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere Metagenome Rhizosphere
300 3300046517 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere Metagenome Rhizosphere
301 3300046518 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere Metagenome Rhizosphere
302 3300046523 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere Metagenome Rhizosphere
303 3300046529 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere Metagenome Rhizosphere
304 3300046531 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere Metagenome Rhizosphere
305 3300046535 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere Metagenome Rhizosphere
306 3300046536 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere Metagenome Rhizosphere
307 3300046543 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere Metagenome Rhizosphere
308 3300046615 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere Metagenome Rhizosphere
309 3300046616 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere Metagenome Rhizosphere
310 3300046674 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere Metagenome Rhizosphere
311 3300046678 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere Metagenome Rhizosphere
312 3300046679 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere Metagenome Rhizosphere
313 3300046683 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere Metagenome Rhizosphere
314 3300046684 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere Metagenome Rhizosphere
315 3300046689 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere Metagenome Rhizosphere
316 3300046690 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere Metagenome Rhizosphere
317 3300046691 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere Metagenome Rhizosphere
318 3300047315 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere Metagenome Rhizosphere
319 3300047317 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere Metagenome Rhizosphere
320 3300047321 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere Metagenome Rhizosphere
321 3300047322 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere Metagenome Rhizosphere
322 3300047323 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere Metagenome Rhizosphere
323 3300047471 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere Metagenome Rhizosphere
324 3300047673 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere Metagenome Rhizosphere
325 3300048088 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere Metagenome Rhizosphere
326 3300048903 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled Metagenome Rhizoplane
327 3300048904 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled Metagenome Rhizoplane
328 3300048905 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 Metagenome Rhizoplane
329 3300048906 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 Metagenome Rhizoplane
330 3300048907 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 Metagenome Rhizoplane
331 3300048908 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 Metagenome Rhizoplane
332 3300048909 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 Metagenome Rhizoplane
333 3300048910 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 Metagenome Rhizoplane
334 3300048911 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled Metagenome Rhizoplane
335 3300048912 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled Metagenome Rhizoplane
336 3300048913 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 Metagenome Rhizoplane
337 3300048914 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 Metagenome Rhizoplane
338 3300048915 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 Metagenome Rhizoplane
339 3300048916 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 Metagenome Rhizoplane
340 3300048917 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 Metagenome Rhizoplane
341 3300048918 Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 Metagenome Rhizoplane
342 3300049460 Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere Metagenome Rhizosphere
343 3300049568 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 Metagenome Rhizosphere
344 3300049569 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 Metagenome Rhizosphere
345 3300049570 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 Metagenome Rhizosphere
346 3300049572 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 Metagenome Rhizosphere
347 3300049573 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 Metagenome Rhizosphere
348 3300049574 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 Metagenome Rhizosphere
349 3300049575 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 Metagenome Rhizosphere
350 3300049576 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 Metagenome Rhizosphere
351 3300049577 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 Metagenome Rhizosphere
352 3300049578 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 Metagenome Rhizosphere
353 3300049579 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 Metagenome Rhizosphere
354 3300049580 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 Metagenome Rhizosphere
355 3300049581 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 Metagenome Rhizosphere
356 3300049582 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 Metagenome Rhizosphere
357 3300049584 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 Metagenome Rhizosphere
358 3300049585 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 Metagenome Rhizosphere
359 3300049586 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 Metagenome Rhizosphere
360 3300049587 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 Metagenome Rhizosphere
361 3300049588 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 Metagenome Rhizosphere
362 3300049589 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 Metagenome Rhizosphere
363 3300049590 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 Metagenome Rhizosphere
364 3300049591 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 Metagenome Rhizosphere
365 3300049592 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 Metagenome Rhizosphere
366 3300049593 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 Metagenome Rhizosphere
367 3300049661 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control Metagenome Rhizosphere
368 3300049668 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought Metagenome Rhizosphere
369 3300049687 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought Metagenome Rhizosphere
370 3300049690 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought Metagenome Rhizosphere
371 3300049707 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought Metagenome Rhizosphere
372 3300049741 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 Metagenome Rhizosphere
373 3300049742 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 Metagenome Rhizosphere
374 3300049743 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 Metagenome Rhizosphere
375 3300049744 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 Metagenome Rhizosphere
376 3300049767 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought Metagenome Rhizosphere
377 3300049771 Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control Metagenome Rhizosphere
378 3300049822 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 Metagenome Rhizosphere
379 3300049824 Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 Metagenome Rhizosphere
380 3300050491 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation Metagenome Endosphere
381 3300050492 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation Metagenome Endosphere
382 3300050496 Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation Metagenome Endosphere
383 3300050507 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation Metagenome Rhizosphere
384 3300050508 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation Metagenome Rhizosphere
385 3300050509 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation Metagenome Rhizosphere
386 3300050510 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation Metagenome Rhizosphere
387 3300050511 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation Metagenome Rhizosphere
388 3300050512 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation Metagenome Rhizosphere
389 3300050513 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation Metagenome Rhizosphere
390 3300050514 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation Metagenome Rhizosphere
391 3300050515 Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation Metagenome Rhizosphere
392 3300053077 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere Metagenome Rhizosphere
393 3300053084 Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere Metagenome Rhizosphere
394 3300054114 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 Metagenome Rhizosphere
395 3300060353 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 Metagenome Rhizosphere
396 3300061719 Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 Metagenome Rhizosphere
397 3300061734 Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) Metagenome Rhizosphere

Type Distribution

Type Percentage (%)
Metagenomes 99.4
Metatranscriptomes 0.6
Isolates 0

Biome Distribution

Category Percentage (%)
Aerial Root 0
Bulb 0
Endosphere 0.53
Nodule 0
Rhizoplane 6.79
Rhizosphere 92.31
Stem 0
Stem Tuber 0
Unclassified 13.42

Taxonomy

Scaffolds

Scaffold Dataset Taxonomy Length
1 Ga0265338_10040736 3300028800 Bacteria 4357
2 MBSR1b_contig_12373578 2162886012 Bacteria 1021
3 MBSR1b_contig_9591076 2162886012 Bacteria 1021
4 JGI24743J22301_10087115 3300001991 Unclassified 663
5 JGI24034J26672_10118024 3300002239 Bacteria 511
6 JGI24751J29686_10004867 3300002459 Bacteria 2733
7 rootH2_10104511 3300003320 Bacteria 1730
8 rootL2_10068500 3300003322 Unclassified 3501
9 Ga0065704_10124661 3300005289 Bacteria 1708
10 Ga0065712_10000113 3300005290 Bacteria 191931
11 Ga0065712_10112355 3300005290 Bacteria 1793
12 Ga0065712_10176847 3300005290 Bacteria 1213
13 Ga0065715_10094050 3300005293 Bacteria 4459
14 Ga0065715_10103679 3300005293 Bacteria 3014
15 Ga0065715_10112900 3300005293 Bacteria 2511
16 Ga0065707_10000935 3300005295 Bacteria 9396
17 Ga0065707_11019243 3300005295 Unclassified 534
18 Ga0070658_10007310 3300005327 Bacteria 8921
19 Ga0070658_10013304 3300005327 Bacteria 6603
20 Ga0070658_10183542 3300005327 Bacteria 1761
21 Ga0070658_10186550 3300005327 Unclassified 1747
22 Ga0070658_10210289 3300005327 Bacteria 1643
23 Ga0070676_10024646 3300005328 Bacteria 3391
24 Ga0070676_10037433 3300005328 Bacteria 2798
25 Ga0070676_10098943 3300005328 Bacteria 1799
26 Ga0070676_10336987 3300005328 Unclassified 1033
27 Ga0070683_100000756 3300005329 Bacteria 23693
28 Ga0070683_100007927 3300005329 Bacteria 9006
29 Ga0070683_100014671 3300005329 Bacteria 6862
30 Ga0070683_100019192 3300005329 Bacteria 6071
31 Ga0070683_100022422 3300005329 Bacteria 5644
32 Ga0070683_100685353 3300005329 Bacteria 981
33 Ga0070690_100025672 3300005330 Bacteria 3628
34 Ga0070690_100128105 3300005330 Bacteria 1711
35 Ga0070690_100143479 3300005330 Bacteria 1622
36 Ga0070690_100148356 3300005330 Bacteria 1598
37 Ga0070690_100598326 3300005330 Bacteria 837
38 Ga0070690_100620365 3300005330 Bacteria 823
39 Ga0070690_100776022 3300005330 Unclassified 742
40 Ga0070690_101333133 3300005330 Bacteria 576
41 Ga0070670_100014183 3300005331 Bacteria 6837
42 Ga0070670_101090624 3300005331 Bacteria 728
43 Ga0070670_101993141 3300005331 Bacteria 535
44 Ga0068869_100026692 3300005334 Bacteria 4021
45 Ga0068869_100032009 3300005334 Bacteria 3703
46 Ga0068869_100032975 3300005334 Bacteria 3654
47 Ga0068869_100038892 3300005334 Bacteria 3393
48 Ga0068869_100052368 3300005334 Bacteria 2964
49 Ga0068869_100081849 3300005334 Bacteria 2412
50 Ga0070666_10000136 3300005335 Bacteria 50851
51 Ga0070666_10034971 3300005335 Bacteria 3330
52 Ga0070666_10091297 3300005335 Bacteria 2092
53 Ga0070666_10107992 3300005335 Bacteria 1923
54 Ga0070666_10911708 3300005335 Bacteria 650
55 Ga0070680_100022389 3300005336 Bacteria 5034
56 Ga0070680_100082597 3300005336 Bacteria 2652
57 Ga0070680_100108847 3300005336 Bacteria 2306
58 Ga0070680_100251405 3300005336 Unclassified 1494
59 Ga0070680_100282881 3300005336 Bacteria 1405
60 Ga0070680_100471255 3300005336 Bacteria 1073
61 Ga0070680_101156844 3300005336 Bacteria 669
62 Ga0070682_100002163 3300005337 Bacteria 10905
63 Ga0070682_100006650 3300005337 Bacteria 6483
64 Ga0070682_100012996 3300005337 Bacteria 4780
65 Ga0070682_100084198 3300005337 Bacteria 2066
66 Ga0070682_100997086 3300005337 Unclassified 695
67 Ga0070682_101152765 3300005337 Unclassified 652
68 Ga0070682_101340098 3300005337 Bacteria 609
69 Ga0068868_100001217 3300005338 Bacteria 17690
70 Ga0068868_100002119 3300005338 Bacteria 13676
71 Ga0068868_100002890 3300005338 Bacteria 11920
72 Ga0068868_100039811 3300005338 Bacteria 3655
73 Ga0068868_100047731 3300005338 Bacteria 3357
74 Ga0068868_100084109 3300005338 Bacteria 2555
75 Ga0068868_100087614 3300005338 Bacteria 2504
76 Ga0068868_100415232 3300005338 Bacteria 1164
77 Ga0068868_101017659 3300005338 Bacteria 759
78 Ga0070660_100001227 3300005339 Bacteria 17435
79 Ga0070660_100031624 3300005339 Bacteria 3976
80 Ga0070660_100039327 3300005339 Bacteria 3594
81 Ga0070660_100083304 3300005339 Bacteria 2512
82 Ga0070660_100722484 3300005339 Bacteria 836
83 Ga0070689_100003801 3300005340 Bacteria 10118
84 Ga0070689_100027513 3300005340 Bacteria 4288
85 Ga0070689_100236840 3300005340 Bacteria 1502
86 Ga0070689_100418114 3300005340 Bacteria 1136
87 Ga0070689_101412425 3300005340 Unclassified 629
88 Ga0070691_10018946 3300005341 Bacteria 3172
89 Ga0070691_10061718 3300005341 Bacteria 1804
90 Ga0070691_10491081 3300005341 Bacteria 708
91 Ga0070691_10647404 3300005341 Bacteria 629
92 Ga0070687_100129414 3300005343 Bacteria 1455
93 Ga0070661_100012914 3300005344 Bacteria 5851
94 Ga0070661_100019124 3300005344 Bacteria 4877
95 Ga0070661_100057993 3300005344 Bacteria 2837
96 Ga0070661_100245337 3300005344 Bacteria 1380
97 Ga0070661_100288254 3300005344 Bacteria 1275
98 Ga0070661_100462839 3300005344 Bacteria 1010
99 Ga0070692_10021033 3300005345 Bacteria 3171
100 Ga0070692_10089511 3300005345 Bacteria 1670
101 Ga0070692_10091149 3300005345 Bacteria 1657
102 Ga0070692_10573902 3300005345 Bacteria 742
103 Ga0070668_100016124 3300005347 Bacteria 5592
104 Ga0070668_100044409 3300005347 Bacteria 3409
105 Ga0070668_102014085 3300005347 Bacteria 533
106 Ga0070669_100002341 3300005353 Bacteria 13694
107 Ga0070669_100183464 3300005353 Bacteria 1638
108 Ga0070675_100187609 3300005354 Bacteria 1790
109 Ga0070671_100033932 3300005355 Bacteria 4223
110 Ga0070671_100143202 3300005355 Bacteria 2017
111 Ga0070671_100288764 3300005355 Bacteria 1396
112 Ga0070671_100726032 3300005355 Bacteria 863
113 Ga0070671_101030889 3300005355 Bacteria 721
114 Ga0070671_101261756 3300005355 Bacteria 651
115 Ga0070674_100008505 3300005356 Bacteria 6114
116 Ga0070673_100004418 3300005364 Bacteria 8897
117 Ga0070673_100138657 3300005364 Bacteria 2050
118 Ga0070673_100161477 3300005364 Bacteria 1906
119 Ga0070673_101117298 3300005364 Unclassified 737
120 Ga0070673_101382869 3300005364 Bacteria 662
121 Ga0070688_100006966 3300005365 Bacteria 6074
122 Ga0070688_100015715 3300005365 Bacteria 4314
123 Ga0070688_100751627 3300005365 Bacteria 759
124 Ga0070688_100888709 3300005365 Unclassified 702
125 Ga0070659_100046133 3300005366 Bacteria 3416
126 Ga0070659_100137645 3300005366 Bacteria 1986
127 Ga0070659_100245284 3300005366 Unclassified 1483
128 Ga0070659_100794275 3300005366 Unclassified 823
129 Ga0070659_101035753 3300005366 Bacteria 721
130 Ga0070659_101237699 3300005366 Bacteria 661
131 Ga0070659_101264190 3300005366 Bacteria 654
132 Ga0070667_100089334 3300005367 Bacteria 2646
133 Ga0070667_100130792 3300005367 Bacteria 2190
134 Ga0070667_100985799 3300005367 Bacteria 786
135 Ga0070709_10414586 3300005434 Bacteria 1008
136 Ga0070714_100174463 3300005435 Bacteria 1953
137 Ga0070713_100367382 3300005436 Unclassified 1338
138 Ga0070713_100468323 3300005436 Bacteria 1185
139 Ga0070713_101678420 3300005436 Bacteria 617
140 Ga0070710_10129794 3300005437 Bacteria 1535
141 Ga0070701_10081377 3300005438 Bacteria 1754
142 Ga0070701_10113017 3300005438 Bacteria 1520
143 Ga0070711_100106905 3300005439 Bacteria 2047
144 Ga0070711_100289918 3300005439 Bacteria 1298
145 Ga0070711_100474563 3300005439 Bacteria 1027
146 Ga0070711_100541280 3300005439 Bacteria 965
147 Ga0070705_101389495 3300005440 Bacteria 585
148 Ga0070705_101591641 3300005440 Bacteria 550
149 Ga0070705_101647847 3300005440 Unclassified 541
150 Ga0070700_100006579 3300005441 Bacteria 6222
151 Ga0070700_100101318 3300005441 Bacteria 1898
152 Ga0070700_100289339 3300005441 Bacteria 1191
153 Ga0070700_100303712 3300005441 Bacteria 1166
154 Ga0070694_100020121 3300005444 Bacteria 4252
155 Ga0070694_100087631 3300005444 Bacteria 2178
156 Ga0070694_100546548 3300005444 Unclassified 927
157 Ga0070694_101525176 3300005444 Bacteria 566
158 Ga0070708_100353401 3300005445 Unclassified 1385
159 Ga0070708_100679513 3300005445 Bacteria 969
160 Ga0070663_100005796 3300005455 Bacteria 7378
161 Ga0070663_100052380 3300005455 Bacteria 2911
162 Ga0070663_100320070 3300005455 Bacteria 1247
163 Ga0070663_100534320 3300005455 Unclassified 978
164 Ga0070663_101051467 3300005455 Unclassified 710
165 Ga0070663_101468997 3300005455 Bacteria 605
166 Ga0070678_100305629 3300005456 Bacteria 1353
167 Ga0070678_100316190 3300005456 Bacteria 1332
168 Ga0070678_100470981 3300005456 Bacteria 1103
169 Ga0070678_101370888 3300005456 Bacteria 659
170 Ga0070662_100002146 3300005457 Bacteria 12089
171 Ga0070662_100054367 3300005457 Bacteria 2901
172 Ga0070662_100115297 3300005457 Bacteria 2052
173 Ga0070662_100656578 3300005457 Bacteria 885
174 Ga0070662_100840129 3300005457 Bacteria 782
175 Ga0070681_10002072 3300005458 Bacteria 18196
176 Ga0070681_10003001 3300005458 Bacteria 15664
177 Ga0070681_10060771 3300005458 Bacteria 3755
178 Ga0070681_10099766 3300005458 Bacteria 2849
179 Ga0070681_10200404 3300005458 Unclassified 1914
180 Ga0070681_10236932 3300005458 Bacteria 1738
181 Ga0070681_10314424 3300005458 Bacteria 1475
182 Ga0070681_10878373 3300005458 Bacteria 815
183 Ga0070681_11458330 3300005458 Unclassified 608
184 Ga0068867_100009629 3300005459 Bacteria 6813
185 Ga0068867_100031705 3300005459 Bacteria 3818
186 Ga0068867_100597063 3300005459 Unclassified 962
187 Ga0070685_10003709 3300005466 Bacteria 7730
188 Ga0070685_10062521 3300005466 Unclassified 2183
189 Ga0070685_10402902 3300005466 Bacteria 948
190 Ga0070685_10742698 3300005466 Bacteria 719
191 Ga0070706_101124700 3300005467 Bacteria 723
192 Ga0070707_100492906 3300005468 Bacteria 1187
193 Ga0070698_100043277 3300005471 Bacteria 4618
194 Ga0070698_100611415 3300005471 Bacteria 1030
195 Ga0070699_100368630 3300005518 Unclassified 1295
196 Ga0070699_100433402 3300005518 Bacteria 1191
197 Ga0070699_100515543 3300005518 Unclassified 1087
198 Ga0070679_100011572 3300005530 Bacteria 8407
199 Ga0070679_100023415 3300005530 Bacteria 6044
200 Ga0070679_100114548 3300005530 Bacteria 2681
201 Ga0070679_100131088 3300005530 Bacteria 2488
202 Ga0070679_100164781 3300005530 Bacteria 2190
203 Ga0070679_100240735 3300005530 Bacteria 1767
204 Ga0070679_101843282 3300005530 Bacteria 553
205 Ga0070684_100001840 3300005535 Bacteria 15538
206 Ga0070684_100014693 3300005535 Bacteria 6351
207 Ga0070684_100033044 3300005535 Bacteria 4414
208 Ga0070684_100039896 3300005535 Bacteria 4040
209 Ga0070684_100163098 3300005535 Bacteria 2023
210 Ga0070684_100195335 3300005535 Bacteria 1842
211 Ga0070684_100249375 3300005535 Bacteria 1623
212 Ga0070697_100017534 3300005536 Bacteria 5635
213 Ga0068853_100009840 3300005539 Bacteria 7715
214 Ga0068853_100071772 3300005539 Bacteria 3016
215 Ga0068853_100120312 3300005539 Bacteria 2341
216 Ga0068853_102422881 3300005539 Bacteria 508
217 Ga0070672_100045874 3300005543 Bacteria 3384
218 Ga0070672_100188701 3300005543 Bacteria 1720
219 Ga0070672_101255254 3300005543 Bacteria 661
220 Ga0070672_101356262 3300005543 Bacteria 636
221 Ga0070686_100022318 3300005544 Bacteria 3769
222 Ga0070686_100069929 3300005544 Bacteria 2294
223 Ga0070686_100129919 3300005544 Bacteria 1740
224 Ga0070695_100070577 3300005545 Bacteria 2285
225 Ga0070695_100126431 3300005545 Bacteria 1756
226 Ga0070695_100309767 3300005545 Bacteria 1170
227 Ga0070695_100626200 3300005545 Bacteria 847
228 Ga0070695_100728138 3300005545 Bacteria 789
229 Ga0070695_101044428 3300005545 Bacteria 666
230 Ga0070696_100046824 3300005546 Bacteria 3000
231 Ga0070696_100076775 3300005546 Bacteria 2359
232 Ga0070696_100095761 3300005546 Unclassified 2120
233 Ga0070696_100180676 3300005546 Bacteria 1565
234 Ga0070696_100265491 3300005546 Bacteria 1303
235 Ga0070696_100380141 3300005546 Bacteria 1100
236 Ga0070696_101840826 3300005546 Bacteria 524
237 Ga0070693_100023085 3300005547 Bacteria 3319
238 Ga0070693_100038394 3300005547 Bacteria 2676
239 Ga0070693_100040134 3300005547 Bacteria 2626
240 Ga0070693_100131897 3300005547 Bacteria 1563
241 Ga0070693_100165776 3300005547 Bacteria 1411
242 Ga0070693_100291626 3300005547 Bacteria 1096
243 Ga0070693_100302811 3300005547 Unclassified 1078
244 Ga0070665_100135217 3300005548 Bacteria 2467
245 Ga0070665_100439846 3300005548 Bacteria 1313
246 Ga0070704_100019732 3300005549 Bacteria 4337
247 Ga0070704_100256675 3300005549 Bacteria 1438
248 Ga0070704_100616069 3300005549 Unclassified 955
249 Ga0070704_100979334 3300005549 Unclassified 764
250 Ga0068855_100009158 3300005563 Bacteria 11957
251 Ga0068855_100025509 3300005563 Bacteria 7071
252 Ga0068855_100103491 3300005563 Unclassified 3275
253 Ga0068855_100363829 3300005563 Bacteria 1591
254 Ga0068855_100387560 3300005563 Unclassified 1533
255 Ga0070664_100059253 3300005564 Bacteria 3257
256 Ga0070664_100130291 3300005564 Bacteria 2209
257 Ga0070664_100180628 3300005564 Bacteria 1875
258 Ga0070664_100254907 3300005564 Bacteria 1578
259 Ga0070664_100255920 3300005564 Bacteria 1575
260 Ga0070664_100448165 3300005564 Bacteria 1185
261 Ga0070664_100703838 3300005564 Bacteria 941
262 Ga0070664_100891139 3300005564 Bacteria 834
263 Ga0070664_101020232 3300005564 Unclassified 778
264 Ga0070664_101351071 3300005564 Bacteria 673
265 Ga0068857_100018128 3300005577 Bacteria 6174
266 Ga0068857_100027115 3300005577 Bacteria 5053
267 Ga0068857_100056006 3300005577 Bacteria 3498
268 Ga0068857_100225290 3300005577 Bacteria 1713
269 Ga0068857_100579573 3300005577 Bacteria 1059
270 Ga0068857_101132770 3300005577 Bacteria 756
271 Ga0068854_100023491 3300005578 Bacteria 4212
272 Ga0068854_100030966 3300005578 Bacteria 3715
273 Ga0068854_100212288 3300005578 Bacteria 1527
274 Ga0068854_100406016 3300005578 Bacteria 1128
275 Ga0068854_100529969 3300005578 Bacteria 996
276 Ga0068856_100020346 3300005614 Bacteria 6446
277 Ga0068856_100102950 3300005614 Bacteria 2849
278 Ga0068856_100126510 3300005614 Bacteria 2559
279 Ga0068856_100183984 3300005614 Bacteria 2103
280 Ga0068856_100264315 3300005614 Bacteria 1736
281 Ga0068856_100378943 3300005614 Bacteria 1434
282 Ga0068856_100475115 3300005614 Bacteria 1271
283 Ga0068856_101744106 3300005614 Unclassified 635
284 Ga0068856_101913277 3300005614 Unclassified 604
285 Ga0068856_102200338 3300005614 Unclassified 560
286 Ga0070702_100007942 3300005615 Bacteria 5111
287 Ga0070702_100045524 3300005615 Bacteria 2483
288 Ga0070702_100164409 3300005615 Bacteria 1437
289 Ga0068852_100019433 3300005616 Bacteria 5377
290 Ga0068852_100079034 3300005616 Bacteria 2912
291 Ga0068852_100086783 3300005616 Bacteria 2790
292 Ga0068852_100328693 3300005616 Bacteria 1487
293 Ga0068852_101172593 3300005616 Unclassified 789
294 Ga0068859_100006803 3300005617 Bacteria 11616
295 Ga0068859_100020458 3300005617 Bacteria 6642
296 Ga0068859_100037054 3300005617 Bacteria 4895
297 Ga0068859_100109639 3300005617 Bacteria 2822
298 Ga0068859_100138625 3300005617 Bacteria 2506
299 Ga0068859_100368043 3300005617 Bacteria 1533
300 Ga0068859_100600168 3300005617 Bacteria 1194
301 Ga0068859_101588569 3300005617 Bacteria 722
302 Ga0068859_103043436 3300005617 Bacteria 512
303 Ga0068864_100012542 3300005618 Bacteria 7008
304 Ga0068864_100069652 3300005618 Bacteria 3059
305 Ga0068864_100093480 3300005618 Bacteria 2656
306 Ga0068864_101249266 3300005618 Bacteria 742
307 Ga0068864_101587905 3300005618 Bacteria 658
308 Ga0068864_101744278 3300005618 Bacteria 628
309 Ga0068864_101779571 3300005618 Bacteria 621
310 Ga0068866_10009453 3300005718 Bacteria 4140
311 Ga0068866_10089942 3300005718 Bacteria 1669
312 Ga0068866_10265761 3300005718 Bacteria 1056
313 Ga0068866_10411420 3300005718 Bacteria 875
314 Ga0068861_100002524 3300005719 Bacteria 11961
315 Ga0068861_100016124 3300005719 Bacteria 5279
316 Ga0068861_100033820 3300005719 Bacteria 3775
317 Ga0068861_100154429 3300005719 Bacteria 1886
318 Ga0068851_10020578 3300005834 Bacteria 3195
319 Ga0068851_10069325 3300005834 Bacteria 1821
320 Ga0068851_10083378 3300005834 Bacteria 1673
321 Ga0068851_10726306 3300005834 Bacteria 613
322 Ga0068851_10820172 3300005834 Unclassified 579
323 Ga0068870_10005385 3300005840 Bacteria 5584
324 Ga0068870_10031247 3300005840 Bacteria 2697
325 Ga0068870_10040121 3300005840 Bacteria 2426
326 Ga0068870_10064706 3300005840 Bacteria 1976
327 Ga0068870_10373218 3300005840 Unclassified 921
328 Ga0068863_100014794 3300005841 Bacteria 7503
329 Ga0068863_100064693 3300005841 Bacteria 3459
330 Ga0068863_100103600 3300005841 Unclassified 2707
331 Ga0068863_100160560 3300005841 Bacteria 2153
332 Ga0068863_100258779 3300005841 Bacteria 1682
333 Ga0068863_100281364 3300005841 Bacteria 1612
334 Ga0068863_100413645 3300005841 Unclassified 1320
335 Ga0068863_100614847 3300005841 Bacteria 1076
336 Ga0068863_100865708 3300005841 Bacteria 903
337 Ga0068858_100008344 3300005842 Bacteria 9966
338 Ga0068858_100032781 3300005842 Bacteria 4825
339 Ga0068858_100044309 3300005842 Bacteria 4124
340 Ga0068858_100467125 3300005842 Bacteria 1217
341 Ga0068860_100094217 3300005843 Bacteria 2854
342 Ga0068860_100096034 3300005843 Bacteria 2825
343 Ga0068860_100099475 3300005843 Bacteria 2774
344 Ga0068860_100110208 3300005843 Bacteria 2631
345 Ga0068860_100187295 3300005843 Bacteria 2002
346 Ga0068860_100553346 3300005843 Bacteria 1153
347 Ga0068860_101159819 3300005843 Unclassified 793
348 Ga0068860_101524553 3300005843 Bacteria 690
349 Ga0068862_100039699 3300005844 Bacteria 3999
350 Ga0068862_100079235 3300005844 Bacteria 2847
351 Ga0068862_100112131 3300005844 Bacteria 2395
352 Ga0068862_100187036 3300005844 Bacteria 1862
353 Ga0081455_10087984 3300005937 Bacteria 2526
354 Ga0081455_10132010 3300005937 Bacteria 1952
355 Ga0081455_10498030 3300005937 Unclassified 819
356 Ga0081538_10000375 3300005981 Bacteria 51029
357 Ga0081538_10011208 3300005981 Bacteria 7281
358 Ga0081538_10095535 3300005981 Bacteria 1518
359 Ga0070717_10001342 3300006028 Bacteria 16912
360 Ga0070717_10057233 3300006028 Bacteria 3222
361 Ga0070717_10130126 3300006028 Bacteria 2164
362 Ga0070717_11224671 3300006028 Unclassified 683
363 Ga0075365_10047793 3300006038 Bacteria 2813
364 Ga0075364_10154452 3300006051 Bacteria 1547
365 Ga0070715_10930395 3300006163 Unclassified 537
366 Ga0070716_100024271 3300006173 Bacteria 3226
367 Ga0070716_100190086 3300006173 Bacteria 1356
368 Ga0070716_100383428 3300006173 Unclassified 1005
369 Ga0070716_100384279 3300006173 Bacteria 1004
370 Ga0070716_101067475 3300006173 Bacteria 642
371 Ga0070712_100049839 3300006175 Unclassified 2910
372 Ga0070712_100192541 3300006175 Bacteria 1597
373 Ga0070712_100213561 3300006175 Unclassified 1523
374 Ga0070712_100740401 3300006175 Bacteria 841
375 Ga0097621_100009585 3300006237 Bacteria 7038
376 Ga0097621_100060850 3300006237 Bacteria 3096
377 Ga0097621_100247790 3300006237 Bacteria 1559
378 Ga0097621_100297993 3300006237 Bacteria 1423
379 Ga0097621_100679507 3300006237 Bacteria 946
380 Ga0097621_100993107 3300006237 Bacteria 785
381 Ga0097621_101017171 3300006237 Bacteria 776
382 Ga0097621_101389752 3300006237 Unclassified 664
383 Ga0075370_10198211 3300006353 Bacteria 1184
384 Ga0068871_100011336 3300006358 Bacteria 6535
385 Ga0068871_100013539 3300006358 Bacteria 6054
386 Ga0068871_100017424 3300006358 Bacteria 5437
387 Ga0068871_100061356 3300006358 Bacteria 3071
388 Ga0068871_100154192 3300006358 Bacteria 1960
389 Ga0068871_100290967 3300006358 Bacteria 1431
390 Ga0068871_100326313 3300006358 Bacteria 1353
391 Ga0068871_100387668 3300006358 Unclassified 1242
392 Ga0068871_100398187 3300006358 Unclassified 1226
393 Ga0068871_100447209 3300006358 Bacteria 1158
394 Ga0068871_101016379 3300006358 Bacteria 772
395 Ga0068871_101167333 3300006358 Bacteria 721
396 Ga0075428_100043771 3300006844 Bacteria 4922
397 Ga0075428_101820077 3300006844 Unclassified 634
398 Ga0075430_100077424 3300006846 Unclassified 2787
399 Ga0075430_100673608 3300006846 Bacteria 853
400 Ga0075431_100354985 3300006847 Bacteria 1473
401 Ga0075433_10250049 3300006852 Bacteria 1573
402 Ga0075433_10552596 3300006852 Unclassified 1012
403 Ga0075433_10651977 3300006852 Bacteria 923
404 Ga0075434_100002797 3300006871 Bacteria 15461
405 Ga0075434_100384352 3300006871 Bacteria 1425
406 Ga0075434_100658256 3300006871 Bacteria 1065
407 Ga0075434_100675064 3300006871 Bacteria 1051
408 Ga0075434_101677908 3300006871 Bacteria 643
409 Ga0075429_100003982 3300006880 Bacteria 12638
410 Ga0068865_100021438 3300006881 Bacteria 4201
411 Ga0068865_100029734 3300006881 Bacteria 3628
412 Ga0068865_100038186 3300006881 Bacteria 3249
413 Ga0068865_100369792 3300006881 Bacteria 1166
414 Ga0075436_100002372 3300006914 Bacteria 13006
415 Ga0075436_100004880 3300006914 Bacteria 9217
416 Ga0075436_100007385 3300006914 Bacteria 7515
417 Ga0075436_100011228 3300006914 Bacteria 6141
418 Ga0075436_100163612 3300006914 Unclassified 1569
419 Ga0075436_100306811 3300006914 Bacteria 1138
420 Ga0075436_100636656 3300006914 Bacteria 787
421 Ga0097620_100006804 3300006931 Bacteria 11616
422 Ga0097620_100020457 3300006931 Bacteria 6642
423 Ga0097620_100037052 3300006931 Bacteria 4895
424 Ga0097620_100109642 3300006931 Bacteria 2822
425 Ga0097620_100138623 3300006931 Bacteria 2506
426 Ga0097620_100368058 3300006931 Bacteria 1533
427 Ga0097620_100600045 3300006931 Bacteria 1194
428 Ga0097620_101589031 3300006931 Bacteria 722
429 Ga0097620_103042862 3300006931 Bacteria 512
430 Ga0075435_100016937 3300007076 Bacteria 5503
431 Ga0075435_100223745 3300007076 Bacteria 1598
432 Ga0075435_100467805 3300007076 Unclassified 1088
433 Ga0075435_100970409 3300007076 Bacteria 742
434 Ga0075435_101210354 3300007076 Bacteria 661
435 Ga0105240_10011749 3300009093 Bacteria 12166
436 Ga0105240_10040284 3300009093 Bacteria 5976
437 Ga0105240_10070460 3300009093 Bacteria 4325
438 Ga0105240_10148480 3300009093 Bacteria 2794
439 Ga0105240_10221035 3300009093 Bacteria 2207
440 Ga0105240_11526110 3300009093 Bacteria 700
441 Ga0111539_10001409 3300009094 Bacteria 32013
442 Ga0111539_10206534 3300009094 Bacteria 2289
443 Ga0111539_10245625 3300009094 Bacteria 2084
444 Ga0105245_10001513 3300009098 Bacteria 21071
445 Ga0105245_10002924 3300009098 Bacteria 15331
446 Ga0105245_10036084 3300009098 Bacteria 4390
447 Ga0105245_10276290 3300009098 Unclassified 1640
448 Ga0105245_10391005 3300009098 Bacteria 1387
449 Ga0105245_10476179 3300009098 Bacteria 1261
450 Ga0105245_10480242 3300009098 Bacteria 1256
451 Ga0105245_11255203 3300009098 Bacteria 789
452 Ga0105247_10013833 3300009101 Bacteria 4838
453 Ga0105247_10054695 3300009101 Bacteria 2463
454 Ga0105247_10476505 3300009101 Unclassified 905
455 Ga0105247_10514485 3300009101 Unclassified 874
456 Ga0105247_10568540 3300009101 Bacteria 836
457 Ga0105247_10591185 3300009101 Bacteria 822
458 Ga0105247_11404744 3300009101 Bacteria 565
459 Ga0114129_10003933 3300009147 Bacteria 20982
460 Ga0114129_10129300 3300009147 Bacteria 3471
461 Ga0114129_10576338 3300009147 Unclassified 1461
462 Ga0105243_10035969 3300009148 Bacteria 3841
463 Ga0105243_10573871 3300009148 Bacteria 1082
464 Ga0105243_11463467 3300009148 Bacteria 706
465 Ga0105241_10006639 3300009174 Bacteria 8526
466 Ga0105241_10012006 3300009174 Bacteria 6361
467 Ga0105241_10168613 3300009174 Bacteria 1806
468 Ga0105241_10181883 3300009174 Bacteria 1744
469 Ga0105241_10341915 3300009174 Bacteria 1297
470 Ga0105241_10471002 3300009174 Unclassified 1115
471 Ga0105241_11183544 3300009174 Bacteria 723
472 Ga0105241_12287859 3300009174 Unclassified 538
473 Ga0105242_10003716 3300009176 Bacteria 11867
474 Ga0105242_10012411 3300009176 Bacteria 6560
475 Ga0105242_10093547 3300009176 Bacteria 2534
476 Ga0105242_10103660 3300009176 Bacteria 2414
477 Ga0105242_10405217 3300009176 Bacteria 1274
478 Ga0105242_11583309 3300009176 Bacteria 688
479 Ga0105248_10011119 3300009177 Bacteria 9933
480 Ga0105248_10020606 3300009177 Bacteria 7308
481 Ga0105248_10136810 3300009177 Bacteria 2764
482 Ga0105248_10234317 3300009177 Bacteria 2067
483 Ga0105248_10276428 3300009177 Bacteria 1891
484 Ga0105248_10306201 3300009177 Bacteria 1789
485 Ga0105248_10685070 3300009177 Unclassified 1156
486 Ga0105248_11057000 3300009177 Bacteria 917
487 Ga0105237_10006860 3300009545 Unclassified 12551
488 Ga0105237_10179521 3300009545 Bacteria 2117
489 Ga0105237_10469140 3300009545 Bacteria 1265
490 Ga0105237_10830370 3300009545 Viruses 931
491 Ga0105237_10927222 3300009545 Bacteria 878
492 Ga0105237_12038217 3300009545 Unclassified 583
493 Ga0105238_10011190 3300009551 Bacteria 9025
494 Ga0105238_10138546 3300009551 Bacteria 2410
495 Ga0105238_10249073 3300009551 Bacteria 1754
496 Ga0105238_10291559 3300009551 Bacteria 1614
497 Ga0105238_11291305 3300009551 Unclassified 756
498 Ga0105238_11961666 3300009551 Unclassified 619
499 Ga0105238_13021246 3300009551 Bacteria 505
500 Ga0105249_10066414 3300009553 Bacteria 3321
501 Ga0105249_10117880 3300009553 Bacteria 2519
502 Ga0105249_10121750 3300009553 Bacteria 2480
503 Ga0105249_10158706 3300009553 Bacteria 2184
504 Ga0105249_11057291 3300009553 Bacteria 881
505 Ga0105249_12991532 3300009553 Unclassified 543
506 Ga0105239_10016536 3300010375 Bacteria 8156
507 Ga0105239_10209622 3300010375 Bacteria 2184
508 Ga0105239_10544240 3300010375 Unclassified 1322
509 Ga0105239_10726215 3300010375 Bacteria 1136
510 Ga0105239_10936831 3300010375 Bacteria 994
511 Ga0105239_11707894 3300010375 Unclassified 729
512 Ga0105239_12183591 3300010375 Bacteria 644
513 Ga0105239_12363716 3300010375 Unclassified 619
514 Ga0105246_10003229 3300011119 Bacteria 9894
515 Ga0105246_10013497 3300011119 Bacteria 5122
516 Ga0105246_10106621 3300011119 Bacteria 2050
517 Ga0105246_10119425 3300011119 Bacteria 1951
518 Ga0105246_10201895 3300011119 Unclassified 1546
519 Ga0157337_1003496 3300012483 Bacteria 954
520 Ga0157373_10006408 3300013100 Bacteria 8793
521 Ga0157373_10010571 3300013100 Bacteria 6790
522 Ga0157373_10673671 3300013100 Bacteria 757
523 Ga0157371_10002909 3300013102 Bacteria 16009
524 Ga0157371_10015099 3300013102 Bacteria 5805
525 Ga0157371_10217440 3300013102 Bacteria 1372
526 Ga0157371_10624601 3300013102 Bacteria 803
527 Ga0157371_10985387 3300013102 Unclassified 642
528 Ga0157370_10067220 3300013104 Bacteria 3388
529 Ga0157370_10596929 3300013104 Bacteria 1011
530 Ga0157370_10785521 3300013104 Bacteria 867
531 Ga0157370_10820473 3300013104 Bacteria 846
532 Ga0157370_11323731 3300013104 Archaea 649
533 Ga0157370_11633896 3300013104 Unclassified 579
534 Ga0157369_10051967 3300013105 Bacteria 4434
535 Ga0157369_10056671 3300013105 Bacteria 4228
536 Ga0157369_10063704 3300013105 Bacteria 3972
537 Ga0157369_10206937 3300013105 Unclassified 2058
538 Ga0157369_10250577 3300013105 Bacteria 1848
539 Ga0157374_10014124 3300013296 Bacteria 6980
540 Ga0157374_10074767 3300013296 Bacteria 3200
541 Ga0157374_10079953 3300013296 Bacteria 3099
542 Ga0157374_10088131 3300013296 Bacteria 2955
543 Ga0157374_10222367 3300013296 Bacteria 1853
544 Ga0157374_10246146 3300013296 Unclassified 1759
545 Ga0157374_10300959 3300013296 Bacteria 1587
546 Ga0157374_10303400 3300013296 Bacteria 1580
547 Ga0157374_12342562 3300013296 Bacteria 561
548 Ga0157374_12819007 3300013296 Bacteria 514
549 Ga0157378_10000695 3300013297 Bacteria 31659
550 Ga0157378_10003297 3300013297 Bacteria 14371
551 Ga0157378_10015002 3300013297 Bacteria 6784
552 Ga0157378_10173174 3300013297 Unclassified 2026
553 Ga0157378_10278142 3300013297 Bacteria 1612
554 Ga0157378_10372478 3300013297 Bacteria 1400
555 Ga0157378_11361682 3300013297 Unclassified 752
556 Ga0157378_12122184 3300013297 Bacteria 613
557 Ga0163162_10002605 3300013306 Bacteria 17096
558 Ga0163162_10032931 3300013306 Bacteria 5147
559 Ga0163162_10038936 3300013306 Bacteria 4747
560 Ga0163162_10081380 3300013306 Bacteria 3309
561 Ga0163162_10082742 3300013306 Bacteria 3282
562 Ga0163162_10115603 3300013306 Bacteria 2783
563 Ga0163162_10213930 3300013306 Bacteria 2058
564 Ga0163162_10371461 3300013306 Bacteria 1563
565 Ga0163162_10913531 3300013306 Bacteria 990
566 Ga0163162_11643941 3300013306 Bacteria 733
567 Ga0163162_12944152 3300013306 Bacteria 548
568 Ga0163162_13398806 3300013306 Unclassified 508
569 Ga0157372_10028501 3300013307 Bacteria 6094
570 Ga0157372_10168540 3300013307 Bacteria 2533
571 Ga0157372_10487444 3300013307 Bacteria 1437
572 Ga0157372_10500589 3300013307 Bacteria 1417
573 Ga0157372_10730593 3300013307 Bacteria 1151
574 Ga0157372_11376139 3300013307 Bacteria 814
575 Ga0157372_11825520 3300013307 Unclassified 699
576 Ga0157372_12418254 3300013307 Unclassified 603
577 Ga0157375_10035022 3300013308 Bacteria 4788
578 Ga0157375_10112524 3300013308 Bacteria 2822
579 Ga0157375_10119818 3300013308 Bacteria 2740
580 Ga0157375_10180998 3300013308 Bacteria 2259
581 Ga0157375_10224039 3300013308 Bacteria 2040
582 Ga0157375_10251474 3300013308 Bacteria 1928
583 Ga0157375_10261771 3300013308 Bacteria 1891
584 Ga0157375_10467400 3300013308 Bacteria 1427
585 Ga0157375_10594108 3300013308 Bacteria 1266
586 Ga0157375_10717993 3300013308 Bacteria 1152
587 Ga0163163_10004114 3300014325 Bacteria 12403
588 Ga0163163_10015926 3300014325 Bacteria 6966
589 Ga0163163_10024238 3300014325 Bacteria 5773
590 Ga0163163_10031497 3300014325 Bacteria 5119
591 Ga0163163_10127654 3300014325 Bacteria 2581
592 Ga0163163_10234738 3300014325 Bacteria 1883
593 Ga0163163_10531144 3300014325 Unclassified 1239
594 Ga0163163_10553239 3300014325 Bacteria 1213
595 Ga0157380_10002195 3300014326 Bacteria 13119
596 Ga0157380_10005146 3300014326 Bacteria 9138
597 Ga0182008_10001761 3300014497 Bacteria 14190
598 Ga0182008_10117712 3300014497 Bacteria 1319
599 Ga0157377_10000703 3300014745 Bacteria 13790
600 Ga0157377_10003516 3300014745 Bacteria 7088
601 Ga0157377_10034483 3300014745 Bacteria 2769
602 Ga0157377_10234401 3300014745 Bacteria 1182
603 Ga0157377_10656138 3300014745 Unclassified 756
604 Ga0157377_10750776 3300014745 Bacteria 714
605 Ga0157379_10007733 3300014968 Bacteria 9308
606 Ga0157379_10107212 3300014968 Bacteria 2508
607 Ga0157379_10275774 3300014968 Bacteria 1530
608 Ga0157379_10853173 3300014968 Bacteria 862
609 Ga0157379_11208038 3300014968 Bacteria 727
610 Ga0157376_10091623 3300014969 Bacteria 2634
611 Ga0157376_10146029 3300014969 Bacteria 2128
612 Ga0157376_10173658 3300014969 Unclassified 1964
613 Ga0157376_10229379 3300014969 Bacteria 1724
614 Ga0157376_10518957 3300014969 Bacteria 1174
615 Ga0157376_10537068 3300014969 Bacteria 1155
616 Ga0157376_11602388 3300014969 Bacteria 685
617 Ga0157376_11607296 3300014969 Bacteria 684
618 Ga0157376_11711350 3300014969 Bacteria 664
619 Ga0182006_1169850 3300015261 Unclassified 731
620 Ga0182007_10067860 3300015262 Bacteria 1168
621 Ga0163161_10001109 3300017792 Bacteria 20362
622 Ga0163161_10326170 3300017792 Bacteria 1215
623 Ga0163161_11380973 3300017792 Bacteria 615
624 Ga0206356_11077341 3300020070 Bacteria 626
625 Ga0206351_10706853 3300020077 Bacteria 668
626 Ga0206354_10157849 3300020081 Bacteria 871
627 Ga0206354_11090343 3300020081 Bacteria 549
628 Ga0206354_11457533 3300020081 Bacteria 575
629 Ga0206353_10520053 3300020082 Unclassified 1770
630 Ga0206353_10525352 3300020082 Bacteria 5207
631 Ga0206353_11801339 3300020082 Bacteria 774
632 Ga0207697_10005260 3300025315 Bacteria 6032
633 Ga0207656_10008994 3300025321 Bacteria 3701
634 Ga0207656_10020340 3300025321 Bacteria 2637
635 Ga0207656_10024011 3300025321 Bacteria 2461
636 Ga0207682_10133448 3300025893 Bacteria 1110
637 Ga0207692_10554920 3300025898 Bacteria 734
638 Ga0207692_10814260 3300025898 Bacteria 611
639 Ga0207642_10003430 3300025899 Bacteria 5005
640 Ga0207642_10038221 3300025899 Bacteria 2075
641 Ga0207642_10745672 3300025899 Unclassified 620
642 Ga0207710_10014060 3300025900 Bacteria 3371
643 Ga0207710_10665647 3300025900 Unclassified 545
644 Ga0207688_10000393 3300025901 Bacteria 20500
645 Ga0207688_10004736 3300025901 Bacteria 7412
646 Ga0207688_10023107 3300025901 Bacteria 3402
647 Ga0207688_10998545 3300025901 Unclassified 529
648 Ga0207680_10005965 3300025903 Bacteria 5853
649 Ga0207680_10062010 3300025903 Bacteria 2282
650 Ga0207680_10111136 3300025903 Bacteria 1777
651 Ga0207647_10002678 3300025904 Bacteria 13433
652 Ga0207699_10020840 3300025906 Bacteria 3522
653 Ga0207699_10024951 3300025906 Unclassified 3276
654 Ga0207699_10490367 3300025906 Bacteria 886
655 Ga0207645_10000019 3300025907 Bacteria 110182
656 Ga0207645_10050408 3300025907 Bacteria 2658
657 Ga0207645_10332038 3300025907 Unclassified 1015
658 Ga0207643_10000432 3300025908 Bacteria 27650
659 Ga0207643_10017042 3300025908 Bacteria 3967
660 Ga0207643_10056440 3300025908 Bacteria 2234
661 Ga0207643_10089529 3300025908 Bacteria 1792
662 Ga0207643_10097530 3300025908 Bacteria 1720
663 Ga0207643_10259783 3300025908 Bacteria 1072
664 Ga0207643_10909607 3300025908 Unclassified 570
665 Ga0207705_10046456 3300025909 Bacteria 3120
666 Ga0207705_10063567 3300025909 Bacteria 2667
667 Ga0207705_10145141 3300025909 Bacteria 1775
668 Ga0207705_10542997 3300025909 Unclassified 903
669 Ga0207684_11389414 3300025910 Unclassified 575
670 Ga0207654_10009502 3300025911 Bacteria 4940
671 Ga0207654_10013219 3300025911 Bacteria 4243
672 Ga0207654_10134217 3300025911 Bacteria 1570
673 Ga0207654_10254141 3300025911 Bacteria 1179
674 Ga0207654_10269338 3300025911 Bacteria 1148
675 Ga0207707_10002237 3300025912 Bacteria 17490
676 Ga0207707_10014753 3300025912 Bacteria 6808
677 Ga0207707_10053394 3300025912 Bacteria 3518
678 Ga0207707_10106509 3300025912 Bacteria 2451
679 Ga0207707_10343048 3300025912 Bacteria 1288
680 Ga0207707_11014909 3300025912 Bacteria 680
681 Ga0207695_10079393 3300025913 Bacteria 3326
682 Ga0207695_10377001 3300025913 Bacteria 1304
683 Ga0207695_10835226 3300025913 Bacteria 801
684 Ga0207671_10208720 3300025914 Bacteria 1527
685 Ga0207671_10325025 3300025914 Unclassified 1218
686 Ga0207671_10473588 3300025914 Unclassified 998
687 Ga0207693_10021046 3300025915 Bacteria 5183
688 Ga0207693_10176204 3300025915 Unclassified 1683
689 Ga0207693_10263793 3300025915 Bacteria 1350
690 Ga0207693_10276855 3300025915 Bacteria 1315
691 Ga0207663_10169935 3300025916 Bacteria 1547
692 Ga0207663_10879560 3300025916 Bacteria 716
693 Ga0207660_10045160 3300025917 Bacteria 3102
694 Ga0207660_10055513 3300025917 Bacteria 2831
695 Ga0207660_10056915 3300025917 Bacteria 2800
696 Ga0207660_10507836 3300025917 Bacteria 978
697 Ga0207660_10953458 3300025917 Unclassified 700
698 Ga0207662_10000715 3300025918 Bacteria 15165
699 Ga0207662_10368848 3300025918 Bacteria 968
700 Ga0207657_10000731 3300025919 Bacteria 34878
701 Ga0207657_10005013 3300025919 Bacteria 13905
702 Ga0207657_10009782 3300025919 Bacteria 9612
703 Ga0207657_10028465 3300025919 Bacteria 5097
704 Ga0207657_10228610 3300025919 Bacteria 1488
705 Ga0207657_10441906 3300025919 Bacteria 1021
706 Ga0207657_10834452 3300025919 Bacteria 712
707 Ga0207657_10930788 3300025919 Bacteria 669
708 Ga0207649_10000188 3300025920 Bacteria 50655
709 Ga0207649_10004372 3300025920 Bacteria 7668
710 Ga0207649_10232878 3300025920 Bacteria 1318
711 Ga0207649_10330866 3300025920 Unclassified 1122
712 Ga0207649_10730396 3300025920 Bacteria 769
713 Ga0207652_10018886 3300025921 Bacteria 5659
714 Ga0207652_10024777 3300025921 Bacteria 4980
715 Ga0207652_10032420 3300025921 Bacteria 4392
716 Ga0207652_10153892 3300025921 Bacteria 2060
717 Ga0207652_10650400 3300025921 Bacteria 943
718 Ga0207646_10120585 3300025922 Bacteria 2356
719 Ga0207681_10013593 3300025923 Bacteria 5040
720 Ga0207681_10022406 3300025923 Bacteria 4029
721 Ga0207681_10050972 3300025923 Bacteria 2802
722 Ga0207694_10132648 3300025924 Bacteria 1998
723 Ga0207694_10938251 3300025924 Bacteria 732
724 Ga0207650_10000024 3300025925 Bacteria 299184
725 Ga0207650_10201193 3300025925 Bacteria 1596
726 Ga0207650_10579411 3300025925 Bacteria 942
727 Ga0207650_11392797 3300025925 Bacteria 597
728 Ga0207659_10010347 3300025926 Bacteria 5859
729 Ga0207659_10228722 3300025926 Unclassified 1499
730 Ga0207687_10001849 3300025927 Bacteria 14556
731 Ga0207687_10007823 3300025927 Bacteria 7010
732 Ga0207687_10039043 3300025927 Bacteria 3249
733 Ga0207687_10155136 3300025927 Bacteria 1751
734 Ga0207687_10334030 3300025927 Bacteria 1230
735 Ga0207687_10341831 3300025927 Unclassified 1217
736 Ga0207687_10478405 3300025927 Bacteria 1037
737 Ga0207700_10700615 3300025928 Bacteria 904
738 Ga0207664_10293259 3300025929 Bacteria 1430
739 Ga0207664_11533377 3300025929 Unclassified 588
740 Ga0207664_11912645 3300025929 Unclassified 516
741 Ga0207644_10068646 3300025931 Bacteria 2587
742 Ga0207644_10239694 3300025931 Bacteria 1443
743 Ga0207644_10601611 3300025931 Bacteria 913
744 Ga0207690_10019446 3300025932 Bacteria 4183
745 Ga0207690_10026441 3300025932 Bacteria 3654
746 Ga0207690_10220141 3300025932 Unclassified 1452
747 Ga0207690_10308487 3300025932 Bacteria 1240
748 Ga0207690_11129932 3300025932 Bacteria 653
749 Ga0207690_11178074 3300025932 Bacteria 639
750 Ga0207706_10000912 3300025933 Bacteria 30372
751 Ga0207706_10003049 3300025933 Bacteria 16140
752 Ga0207706_10055523 3300025933 Bacteria 3492
753 Ga0207706_10210884 3300025933 Bacteria 1703
754 Ga0207706_10628332 3300025933 Bacteria 921
755 Ga0207686_10025124 3300025934 Bacteria 3461
756 Ga0207686_10026204 3300025934 Bacteria 3400
757 Ga0207686_10056448 3300025934 Bacteria 2468
758 Ga0207686_10610278 3300025934 Unclassified 859
759 Ga0207686_10620163 3300025934 Unclassified 853
760 Ga0207709_10128148 3300025935 Bacteria 1725
761 Ga0207709_10137494 3300025935 Bacteria 1675
762 Ga0207709_10477537 3300025935 Bacteria 969
763 Ga0207709_11808566 3300025935 Bacteria 508
764 Ga0207670_10080240 3300025936 Bacteria 2280
765 Ga0207670_10112448 3300025936 Bacteria 1965
766 Ga0207670_10112449 3300025936 Bacteria 1965
767 Ga0207670_10857842 3300025936 Bacteria 759
768 Ga0207670_11203169 3300025936 Unclassified 641
769 Ga0207669_10003738 3300025937 Bacteria 6614
770 Ga0207669_10844599 3300025937 Unclassified 762
771 Ga0207704_10010186 3300025938 Bacteria 4572
772 Ga0207704_10063743 3300025938 Bacteria 2299
773 Ga0207704_10235851 3300025938 Bacteria 1364
774 Ga0207704_10681596 3300025938 Bacteria 849
775 Ga0207665_10016629 3300025939 Bacteria 4833
776 Ga0207665_10142527 3300025939 Bacteria 1710
777 Ga0207665_10375427 3300025939 Bacteria 1078
778 Ga0207691_10003833 3300025940 Bacteria 14588
779 Ga0207691_10028474 3300025940 Bacteria 5232
780 Ga0207691_10295317 3300025940 Bacteria 1393
781 Ga0207691_10387425 3300025940 Unclassified 1193
782 Ga0207711_10001719 3300025941 Bacteria 20130
783 Ga0207711_10053771 3300025941 Bacteria 3454
784 Ga0207711_10183183 3300025941 Bacteria 1905
785 Ga0207711_10318879 3300025941 Bacteria 1436
786 Ga0207711_10434944 3300025941 Unclassified 1221
787 Ga0207711_10437427 3300025941 Bacteria 1217
788 Ga0207711_10712904 3300025941 Bacteria 936
789 Ga0207711_11295918 3300025941 Unclassified 671
790 Ga0207689_10001992 3300025942 Bacteria 19297
791 Ga0207689_10002848 3300025942 Bacteria 15961
792 Ga0207689_10025057 3300025942 Bacteria 5001
793 Ga0207689_10053430 3300025942 Bacteria 3328
794 Ga0207689_10064764 3300025942 Bacteria 3006
795 Ga0207689_11686934 3300025942 Bacteria 525
796 Ga0207661_10000067 3300025944 Bacteria 72201
797 Ga0207661_10001401 3300025944 Bacteria 16231
798 Ga0207661_10001542 3300025944 Bacteria 15663
799 Ga0207661_10040019 3300025944 Bacteria 3683
800 Ga0207661_10076039 3300025944 Bacteria 2757
801 Ga0207661_10370686 3300025944 Unclassified 1294
802 Ga0207661_10680870 3300025944 Bacteria 945
803 Ga0207679_10000055 3300025945 Bacteria 108728
804 Ga0207679_10090635 3300025945 Bacteria 2364
805 Ga0207679_10173263 3300025945 Unclassified 1778
806 Ga0207679_10192682 3300025945 Bacteria 1696
807 Ga0207679_10269513 3300025945 Bacteria 1455
808 Ga0207679_10498576 3300025945 Bacteria 1086
809 Ga0207667_10079834 3300025949 Bacteria 3390
810 Ga0207667_10618316 3300025949 Bacteria 1091
811 Ga0207667_11420820 3300025949 Bacteria 667
812 Ga0207651_10012890 3300025960 Bacteria 4754
813 Ga0207651_10083509 3300025960 Bacteria 2310
814 Ga0207651_10294871 3300025960 Bacteria 1346
815 Ga0207651_10337602 3300025960 Bacteria 1265
816 Ga0207712_10229540 3300025961 Bacteria 1489
817 Ga0207712_10367773 3300025961 Bacteria 1200
818 Ga0207712_10684581 3300025961 Bacteria 894
819 Ga0207668_10036023 3300025972 Bacteria 3300
820 Ga0207668_10038261 3300025972 Bacteria 3218
821 Ga0207668_10046904 3300025972 Bacteria 2955
822 Ga0207640_10011325 3300025981 Bacteria 5047
823 Ga0207640_10204128 3300025981 Bacteria 1500
824 Ga0207640_10237235 3300025981 Bacteria 1407
825 Ga0207640_10237779 3300025981 Bacteria 1405
826 Ga0207640_10725099 3300025981 Bacteria 855
827 Ga0207640_10826263 3300025981 Bacteria 804
828 Ga0207658_10039535 3300025986 Bacteria 3403
829 Ga0207658_10213881 3300025986 Bacteria 1617
830 Ga0207658_10560212 3300025986 Bacteria 1023
831 Ga0207658_11075044 3300025986 Bacteria 735
832 Ga0207677_10010017 3300026023 Bacteria 5350
833 Ga0207677_10013512 3300026023 Bacteria 4736
834 Ga0207677_10014490 3300026023 Bacteria 4606
835 Ga0207677_10063300 3300026023 Bacteria 2570
836 Ga0207677_11072475 3300026023 Bacteria 733
837 Ga0207677_11142317 3300026023 Bacteria 711
838 Ga0207703_10002963 3300026035 Bacteria 14394
839 Ga0207703_10055609 3300026035 Bacteria 3220
840 Ga0207703_11170958 3300026035 Bacteria 739
841 Ga0207639_10296093 3300026041 Bacteria 1428
842 Ga0207639_11410369 3300026041 Bacteria 654
843 Ga0207678_10001331 3300026067 Bacteria 22808
844 Ga0207678_10001590 3300026067 Bacteria 20893
845 Ga0207678_10437116 3300026067 Bacteria 1136
846 Ga0207678_11000136 3300026067 Bacteria 740
847 Ga0207708_10003250 3300026075 Bacteria 11978
848 Ga0207708_10048689 3300026075 Bacteria 3227
849 Ga0207708_10291754 3300026075 Bacteria 1324
850 Ga0207702_10021041 3300026078 Bacteria 5397
851 Ga0207702_10042043 3300026078 Bacteria 3833
852 Ga0207702_10160873 3300026078 Bacteria 2050
853 Ga0207702_10169653 3300026078 Bacteria 2000
854 Ga0207702_10194248 3300026078 Unclassified 1877
855 Ga0207702_10202889 3300026078 Bacteria 1839
856 Ga0207702_10431996 3300026078 Bacteria 1275
857 Ga0207702_12508089 3300026078 Unclassified 502
858 Ga0207641_10000030 3300026088 Bacteria 224468
859 Ga0207641_10078190 3300026088 Bacteria 2865
860 Ga0207641_10263389 3300026088 Unclassified 1615
861 Ga0207641_10361956 3300026088 Bacteria 1385
862 Ga0207641_10381618 3300026088 Unclassified 1350
863 Ga0207641_10433545 3300026088 Bacteria 1268
864 Ga0207641_10648087 3300026088 Bacteria 1037
865 Ga0207641_11607921 3300026088 Bacteria 652
866 Ga0207648_10000031 3300026089 Bacteria 129124
867 Ga0207648_10040838 3300026089 Bacteria 4075
868 Ga0207676_10001006 3300026095 Bacteria 21691
869 Ga0207676_10014080 3300026095 Bacteria 5745
870 Ga0207676_10652351 3300026095 Bacteria 1016
871 Ga0207676_10679121 3300026095 Bacteria 996
872 Ga0207676_10852250 3300026095 Bacteria 891
873 Ga0207676_11209463 3300026095 Unclassified 749
874 Ga0207674_10000618 3300026116 Bacteria 46623
875 Ga0207674_10002728 3300026116 Bacteria 22028
876 Ga0207674_10040199 3300026116 Bacteria 4847
877 Ga0207674_10076386 3300026116 Bacteria 3357
878 Ga0207674_10169715 3300026116 Unclassified 2136
879 Ga0207674_10433101 3300026116 Bacteria 1271
880 Ga0207674_11356129 3300026116 Bacteria 681
881 Ga0207675_100008535 3300026118 Bacteria 9635
882 Ga0207675_100011099 3300026118 Bacteria 8441
883 Ga0207675_100038821 3300026118 Bacteria 4443
884 Ga0207683_10014563 3300026121 Bacteria 6699
885 Ga0207683_10084602 3300026121 Bacteria 2820
886 Ga0207683_10351753 3300026121 Bacteria 1352
887 Ga0207683_10665043 3300026121 Bacteria 965
888 Ga0207698_10135238 3300026142 Unclassified 2114
889 Ga0207698_10194152 3300026142 Bacteria 1812
890 Ga0207698_10293887 3300026142 Bacteria 1509
891 Ga0207698_10307446 3300026142 Unclassified 1479
892 Ga0207698_10639542 3300026142 Bacteria 1053
893 Ga0207698_10910774 3300026142 Unclassified 887
894 Ga0209588_1044297 3300027671 Bacteria 1439
895 Ga0209998_10164321 3300027717 Unclassified 574
896 Ga0207428_10030102 3300027907 Bacteria 4490
897 Ga0207428_10135611 3300027907 Bacteria 1882
898 Ga0268266_10005546 3300028379 Bacteria 11745
899 Ga0268266_10128776 3300028379 Bacteria 2262
900 Ga0268266_10307359 3300028379 Bacteria 1481
901 Ga0268266_11617406 3300028379 Bacteria 623
902 Ga0268265_10092033 3300028380 Unclassified 2426
903 Ga0268265_10094108 3300028380 Bacteria 2402
904 Ga0268265_10140531 3300028380 Bacteria 2021
905 Ga0268265_10150376 3300028380 Bacteria 1963
906 Ga0268265_12643113 3300028380 Bacteria 507
907 Ga0268264_10046537 3300028381 Bacteria 3603
908 Ga0268264_10123056 3300028381 Bacteria 2289
909 Ga0268264_10186689 3300028381 Bacteria 1887
910 Ga0268264_10255245 3300028381 Bacteria 1631
911 Ga0268264_10256384 3300028381 Bacteria 1627
912 Ga0268264_10699368 3300028381 Bacteria 1007
913 Ga0268264_11583787 3300028381 Bacteria 666
914 Ga0268264_11814294 3300028381 Unclassified 620
915 Ga0265337_1077731 3300028556 Bacteria 909
916 Ga0265326_10060152 3300028558 Bacteria 1075
917 Ga0265319_1044163 3300028563 Bacteria 1494
918 Ga0265319_1052405 3300028563 Bacteria 1343
919 Ga0265323_10125494 3300028653 Bacteria 834
920 Ga0265322_10024897 3300028654 Bacteria 1713
921 Ga0265336_10003729 3300028666 Bacteria 5902
922 Ga0265338_10007600 3300028800 Bacteria 13391
923 Ga0265325_10005401 3300031241 Bacteria 7895
924 Ga0265340_10001376 3300031247 Bacteria 13943
925 Ga0265316_10172810 3300031344 Bacteria 1611
926 Ga0265313_10024931 3300031595 Bacteria 3182
927 Ga0316576_10024976 3300031727 Bacteria 4179
928 Ga0316576_10042070 3300031727 Bacteria 3292
929 Ga0316576_10195478 3300031727 Bacteria 1524
930 Ga0316578_10072799 3300031728 Bacteria 2036
931 Ga0316578_10189013 3300031728 Bacteria 1241
932 Ga0307405_10216675 3300031731 Unclassified 1402
933 Ga0316577_10036591 3300031733 Bacteria 2745
934 Ga0307410_10700937 3300031852 Bacteria 853
935 Ga0307407_10189453 3300031903 Bacteria 1370
936 Ga0307416_101347574 3300032002 Bacteria 819
937 Ga0307414_10631030 3300032004 Bacteria 964
938 Ga0307415_100262168 3300032126 Bacteria 1411
939 Ga0316585_10137882 3300032137 Bacteria 805
940 Ga0373948_0015880 3300034817 Bacteria 1387
941 Ga0373950_0038783 3300034818 Bacteria 906
942 Ga0373926_0031683 3300035083 Bacteria 1865
943 Ga0373926_0150284 3300035083 Bacteria 887
944 Ga0373944_0023577 3300035089 Bacteria 1797
945 Ga0373949_0141694 3300035090 Bacteria 689
946 Ga0373936_0002175 3300035113 Bacteria 7307
947 Ga0373936_0167725 3300035113 Unclassified 959
948 Ga0373939_0017420 3300035114 Bacteria 1908
949 Ga0373941_0075559 3300035115 Unclassified 1128
950 Ga0373941_0362854 3300035115 Bacteria 592
951 Ga0373941_0375371 3300035115 Unclassified 583
952 Ga0373945_0140031 3300035116 Unclassified 975
953 Ga0373953_0241141 3300035117 Bacteria 785
954 Ga0373957_0183595 3300035120 Bacteria 868
955 Ga0373960_0138285 3300035121 Bacteria 823
956 Ga0373960_0411822 3300035121 Bacteria 523
957 Ga0373943_0107216 3300035170 Bacteria 1469
958 Ga0373943_0137020 3300035170 Bacteria 1315
959 Ga0373943_0360936 3300035170 Bacteria 834
960 Ga0373943_0668507 3300035170 Bacteria 614
961 Ga0373946_0073471 3300035171 Bacteria 1482
962 Ga0373955_0189434 3300035172 Bacteria 1223
963 Ga0373961_0201548 3300035241 Bacteria 702
964 Ga0373961_0316119 3300035241 Bacteria 581
965 Ga0373961_0391214 3300035241 Bacteria 532
966 Ga0316574_0151133 3300035398 Bacteria 1496
967 Ga0316574_0155696 3300035398 Bacteria 1472
968 Ga0316574_0499900 3300035398 Bacteria 758
969 Ga0373924_0039844 3300035410 Bacteria 1921
970 Ga0373931_0037515 3300035691 Bacteria 2531
971 Ga0373931_0117624 3300035691 Bacteria 1515
972 Ga0373927_0444905 3300035695 Unclassified 856
973 Ga0373933_0103943 3300035724 Bacteria 1765
974 Ga0373933_0641958 3300035724 Archaea 698
975 Ga0373947_0018665 3300035725 Bacteria 3993
976 Ga0373947_0193680 3300035725 Bacteria 1327
977 Ga0373937_0002393 3300036401 Bacteria 15607
978 Ga0373937_0083150 3300036401 Bacteria 2962
979 Ga0373937_0171915 3300036401 Bacteria 2033
980 Ga0373937_0420769 3300036401 Bacteria 1268
981 Ga0316582_0374009 3300036647 Bacteria 981
982 Ga0316584_0086994 3300036712 Bacteria 2339
983 Ga0316584_0228639 3300036712 Bacteria 1364
984 Ga0373925_0001169 3300037068 Bacteria 23275
985 Ga0373925_0283285 3300037068 Unclassified 1335
986 Ga0373925_0488677 3300037068 Bacteria 1010
987 Ga0373925_1067842 3300037068 Unclassified 664
988 Ga0395900_0093144 3300037418 Bacteria 3095
989 Ga0395900_0860393 3300037418 Bacteria 832
990 Ga0395898_0408364 3300037466 Bacteria 1295
991 Ga0395905_0277710 3300037471 Bacteria 1561
992 Ga0395905_1417871 3300037471 Unclassified 599
993 Ga0436364_0868731 3300037853 Bacteria 2416
994 Ga0395901_0032207 3300038443 Bacteria 5410
995 Ga0395901_0640637 3300038443 Bacteria 1067
996 Ga0395901_1209235 3300038443 Bacteria 721
997 Ga0436365_1865349 3300039437 Bacteria 1292
998 Ga0436362_0068786 3300039453 Unclassified 677
999 Ga0436362_0197399 3300039453 Bacteria 3687
1000 Ga0439453_0009799 3300041408 Unclassified 1567
1001 Ga0451804_0554939 3300041463 Bacteria 761
1002 Ga0451855_1312722 3300041511 Bacteria 568
1003 Ga0439451_010984 3300042009 Bacteria 1826
1004 Ga0439454_003816 3300042011 Unclassified 1701
1005 Ga0450914_002057 3300042118 Unclassified 1381
1006 Ga0450920_012436 3300042122 Unclassified 1597
1007 Ga0450905_061641 3300042142 Unclassified 627
1008 Ga0450906_003773 3300042145 Unclassified 3224
1009 Ga0450908_007909 3300042184 Bacteria 1995
1010 Ga0439464_0055024 3300042439 Bacteria 1157
1011 Ga0450916_015776 3300042530 Bacteria 996
1012 Ga0451577_1765109 3300042876 Bacteria 543
1013 Ga0466969_0051021 3300044656 Bacteria 2037
1014 Ga0466966_0772016 3300044684 Bacteria 579
1015 Ga0466961_0074888 3300044693 Bacteria 2146
1016 Ga0466963_0182756 3300044694 Bacteria 1464
1017 Ga0466963_0748781 3300044694 Bacteria 689
1018 Ga0466963_0880227 3300044694 Bacteria 631
1019 Ga0466971_0001350 3300044719 Bacteria 10290
1020 Ga0466957_0152252 3300044842 Bacteria 1496
1021 Ga0466957_0451704 3300044842 Unclassified 886
1022 Ga0466957_0635498 3300044842 Bacteria 749
1023 Ga0466960_0758981 3300044901 Bacteria 585
1024 Ga0466959_0010178 3300045049 Bacteria 6714
1025 Ga0466959_0055746 3300045049 Bacteria 2884
1026 Ga0466959_0992303 3300045049 Unclassified 559
1027 Ga0451576_2115528 3300045051 Bacteria 579
1028 Ga0466958_0022669 3300045836 Bacteria 3681
1029 Ga0466958_0028012 3300045836 Bacteria 3337
1030 Ga0466958_0150993 3300045836 Bacteria 1465
1031 Ga0466958_1012797 3300045836 Bacteria 542
1032 Ga0466967_0021185 3300045976 Bacteria 5272
1033 Ga0466967_0026563 3300045976 Bacteria 4797
1034 Ga0466967_0147809 3300045976 Unclassified 2193
1035 Ga0466967_0402266 3300045976 Bacteria 1332
1036 Ga0466967_0723471 3300045976 Bacteria 986
1037 Ga0495629_0584444 3300046459 Bacteria 748
1038 Ga0495653_0187253 3300046463 Bacteria 1415
1039 Ga0495580_0000116 3300046472 Bacteria 54763
1040 Ga0495580_0010633 3300046472 Bacteria 7151
1041 Ga0495580_0180365 3300046472 Bacteria 1458
1042 Ga0495580_0192593 3300046472 Unclassified 1406
1043 Ga0495580_0518531 3300046472 Bacteria 794
1044 Ga0495580_0652213 3300046472 Bacteria 692
1045 Ga0495580_0905282 3300046472 Bacteria 567
1046 Ga0495582_0054763 3300046473 Bacteria 2199
1047 Ga0495582_0628413 3300046473 Bacteria 621
1048 Ga0495639_0386809 3300046475 Bacteria 705
1049 Ga0495585_0611406 3300046492 Unclassified 512
1050 Ga0495594_0219039 3300046499 Bacteria 1085
1051 Ga0495608_0292066 3300046511 Bacteria 1010
1052 Ga0495630_0109339 3300046517 Bacteria 2094
1053 Ga0495630_0502230 3300046517 Bacteria 930
1054 Ga0495630_0637890 3300046517 Bacteria 816
1055 Ga0495630_1287939 3300046517 Bacteria 551
1056 Ga0495631_0426462 3300046518 Bacteria 565
1057 Ga0495644_0093220 3300046523 Bacteria 1137
1058 Ga0495652_0284847 3300046529 Bacteria 1208
1059 Ga0495665_0130938 3300046531 Bacteria 1313
1060 Ga0495665_0349661 3300046531 Bacteria 753
1061 Ga0495586_0003843 3300046535 Bacteria 8052
1062 Ga0495586_0381312 3300046535 Unclassified 811
1063 Ga0495587_0267520 3300046536 Bacteria 959
1064 Ga0495645_0698883 3300046543 Bacteria 616
1065 Ga0495656_0069159 3300046615 Bacteria 1563
1066 Ga0495656_0125264 3300046615 Bacteria 1217
1067 Ga0495668_0394838 3300046616 Archaea 760
1068 Ga0495588_0016297 3300046674 Bacteria 3591
1069 Ga0495599_0373343 3300046678 Bacteria 852
1070 Ga0495623_0205519 3300046679 Bacteria 1130
1071 Ga0495623_0659650 3300046679 Bacteria 539
1072 Ga0495658_0022699 3300046683 Bacteria 3322
1073 Ga0495658_0155773 3300046683 Bacteria 1406
1074 Ga0495658_0182073 3300046683 Bacteria 1304
1075 Ga0495669_0001864 3300046684 Bacteria 8642
1076 Ga0495669_0040733 3300046684 Unclassified 2061
1077 Ga0495613_0024887 3300046689 Bacteria 4461
1078 Ga0495613_0218700 3300046689 Bacteria 1338
1079 Ga0495613_0298883 3300046689 Bacteria 1115
1080 Ga0495624_0415794 3300046690 Unclassified 807
1081 Ga0495670_0497662 3300046691 Unclassified 662
1082 Ga0495581_0694405 3300047315 Unclassified 587
1083 Ga0495604_0422940 3300047317 Bacteria 874
1084 Ga0495604_0469062 3300047317 Bacteria 820
1085 Ga0495604_1024605 3300047317 Unclassified 510
1086 Ga0495676_0050963 3300047321 Bacteria 3316
1087 Ga0495676_0573942 3300047321 Unclassified 736
1088 Ga0495680_0394721 3300047322 Bacteria 956
1089 Ga0495680_1103004 3300047322 Bacteria 501
1090 Ga0495683_0088327 3300047323 Bacteria 1505
1091 Ga0495684_0389692 3300047471 Bacteria 981
1092 Ga0495684_0428849 3300047471 Bacteria 923
1093 Ga0495593_0185945 3300047673 Bacteria 1046
1094 Ga0495593_0593320 3300047673 Bacteria 556
1095 Ga0495602_0384123 3300048088 Bacteria 1005
1096 Ga0495602_0759495 3300048088 Bacteria 654
1097 Ga0496100_0010347 3300048903 Bacteria 5278
1098 Ga0496100_0226874 3300048903 Unclassified 1373
1099 Ga0496100_0685755 3300048903 Bacteria 799
1100 Ga0496100_0705349 3300048903 Bacteria 788
1101 Ga0496101_0025335 3300048904 Bacteria 4115
1102 Ga0496101_0102413 3300048904 Bacteria 2144
1103 Ga0496101_0190221 3300048904 Bacteria 1584
1104 Ga0496101_0437880 3300048904 Bacteria 1031
1105 Ga0496101_0467431 3300048904 Bacteria 995
1106 Ga0496101_0707588 3300048904 Bacteria 795
1107 Ga0496102_0084282 3300048905 Bacteria 2933
1108 Ga0496102_0159591 3300048905 Bacteria 2121
1109 Ga0496102_0390861 3300048905 Unclassified 1308
1110 Ga0496102_0425386 3300048905 Bacteria 1247
1111 Ga0496102_0524267 3300048905 Bacteria 1107
1112 Ga0496102_0771183 3300048905 Bacteria 884
1113 Ga0496102_1756005 3300048905 Unclassified 538
1114 Ga0496103_0187447 3300048906 Bacteria 1330
1115 Ga0496103_0553735 3300048906 Bacteria 734
1116 Ga0496104_0032468 3300048907 Bacteria 4859
1117 Ga0496104_0275845 3300048907 Bacteria 1594
1118 Ga0496104_0282967 3300048907 Bacteria 1571
1119 Ga0496104_0295423 3300048907 Bacteria 1533
1120 Ga0496104_0345512 3300048907 Bacteria 1400
1121 Ga0496104_0476060 3300048907 Bacteria 1160
1122 Ga0496104_0497486 3300048907 Bacteria 1130
1123 Ga0496104_0669393 3300048907 Bacteria 946
1124 Ga0496104_1366253 3300048907 Unclassified 611
1125 Ga0496105_0056007 3300048908 Bacteria 3255
1126 Ga0496105_0179918 3300048908 Bacteria 1732
1127 Ga0496105_0958143 3300048908 Bacteria 642
1128 Ga0496106_0409171 3300048909 Bacteria 1090
1129 Ga0496106_0473493 3300048909 Bacteria 1006
1130 Ga0496106_0739210 3300048909 Bacteria 783
1131 Ga0496106_0856878 3300048909 Unclassified 719
1132 Ga0496106_0986674 3300048909 Bacteria 663
1133 Ga0496107_0050240 3300048910 Unclassified 3006
1134 Ga0496107_0108919 3300048910 Bacteria 2035
1135 Ga0496107_0305058 3300048910 Bacteria 1185
1136 Ga0496107_0666717 3300048910 Bacteria 766
1137 Ga0496107_0771609 3300048910 Unclassified 705
1138 Ga0496107_1078853 3300048910 Unclassified 581
1139 Ga0496108_0000602 3300048911 Bacteria 28172
1140 Ga0496108_0004142 3300048911 Bacteria 11659
1141 Ga0496108_0091571 3300048911 Bacteria 2584
1142 Ga0496108_0420673 3300048911 Bacteria 1167
1143 Ga0496108_1377197 3300048911 Bacteria 591
1144 Ga0496109_0000941 3300048912 Bacteria 24099
1145 Ga0496109_0006116 3300048912 Bacteria 10112
1146 Ga0496109_0033373 3300048912 Bacteria 4630
1147 Ga0496109_0195340 3300048912 Bacteria 1902
1148 Ga0496109_0208834 3300048912 Bacteria 1836
1149 Ga0496109_0243055 3300048912 Bacteria 1694
1150 Ga0496109_0325795 3300048912 Bacteria 1450
1151 Ga0496109_0527243 3300048912 Bacteria 1115
1152 Ga0496109_1245121 3300048912 Bacteria 680
1153 Ga0496109_1283022 3300048912 Bacteria 668
1154 Ga0496110_0001419 3300048913 Bacteria 17303
1155 Ga0496110_0006002 3300048913 Bacteria 9563
1156 Ga0496110_0017934 3300048913 Bacteria 5928
1157 Ga0496110_0190466 3300048913 Bacteria 1863
1158 Ga0496110_0352206 3300048913 Bacteria 1341
1159 Ga0496111_0000612 3300048914 Bacteria 18851
1160 Ga0496111_0001316 3300048914 Bacteria 13943
1161 Ga0496111_0119718 3300048914 Bacteria 1944
1162 Ga0496111_0283496 3300048914 Bacteria 1229
1163 Ga0496111_0301194 3300048914 Bacteria 1188
1164 Ga0496111_0476695 3300048914 Unclassified 919
1165 Ga0496112_0000964 3300048915 Bacteria 20930
1166 Ga0496112_0007171 3300048915 Bacteria 9873
1167 Ga0496112_0021577 3300048915 Bacteria 6126
1168 Ga0496112_0047308 3300048915 Bacteria 4220
1169 Ga0496112_0124580 3300048915 Bacteria 2548
1170 Ga0496112_0163855 3300048915 Bacteria 2189
1171 Ga0496112_0226424 3300048915 Bacteria 1825
1172 Ga0496112_0327249 3300048915 Unclassified 1476
1173 Ga0496112_0455150 3300048915 Bacteria 1217
1174 Ga0496112_0610318 3300048915 Bacteria 1022
1175 Ga0496113_0000942 3300048916 Bacteria 15468
1176 Ga0496113_0077713 3300048916 Bacteria 2538
1177 Ga0496113_0178448 3300048916 Bacteria 1683
1178 Ga0496113_0487052 3300048916 Unclassified 990
1179 Ga0496113_1174003 3300048916 Bacteria 600
1180 Ga0496114_0150802 3300048917 Bacteria 2017
1181 Ga0496114_0236526 3300048917 Bacteria 1605
1182 Ga0496114_0347198 3300048917 Bacteria 1312
1183 Ga0496114_0400477 3300048917 Bacteria 1215
1184 Ga0496115_0030437 3300048918 Bacteria 4246
1185 Ga0496115_0955471 3300048918 Bacteria 658
1186 Ga0495682_0200746 3300049460 Bacteria 707
1187 Ga0501031_0045189 3300049568 Bacteria 2874
1188 Ga0501032_0018830 3300049569 Bacteria 4831
1189 Ga0501032_0264191 3300049569 Unclassified 1116
1190 Ga0501033_0136620 3300049570 Bacteria 1774
1191 Ga0501033_0507254 3300049570 Unclassified 834
1192 Ga0501036_0015843 3300049572 Bacteria 6296
1193 Ga0501036_0124625 3300049572 Unclassified 2176
1194 Ga0501037_0226548 3300049573 Bacteria 1313
1195 Ga0501037_0624489 3300049573 Bacteria 722
1196 Ga0501038_0047096 3300049574 Bacteria 3736
1197 Ga0501039_0333206 3300049575 Bacteria 1192
1198 Ga0501039_0841562 3300049575 Bacteria 715
1199 Ga0501040_0002790 3300049576 Bacteria 11257
1200 Ga0501040_0022602 3300049576 Bacteria 4211
1201 Ga0501040_0035632 3300049576 Bacteria 3376
1202 Ga0501040_0252850 3300049576 Bacteria 1257
1203 Ga0501041_0002443 3300049577 Bacteria 10552
1204 Ga0501041_0003646 3300049577 Bacteria 8858
1205 Ga0501042_0000396 3300049578 Bacteria 22075
1206 Ga0501042_0045429 3300049578 Bacteria 3130
1207 Ga0501042_1041692 3300049578 Bacteria 596
1208 Ga0501043_0087192 3300049579 Bacteria 2453
1209 Ga0501046_0040849 3300049580 Bacteria 3704
1210 Ga0501046_0052281 3300049580 Bacteria 3220
1211 Ga0501046_0677666 3300049580 Bacteria 728
1212 Ga0501047_0304752 3300049581 Bacteria 1435
1213 Ga0501047_0641300 3300049581 Bacteria 882
1214 Ga0501048_0002492 3300049582 Bacteria 14056
1215 Ga0501048_0128294 3300049582 Bacteria 1793
1216 Ga0501048_0554341 3300049582 Bacteria 825
1217 Ga0501068_0086110 3300049584 Bacteria 1934
1218 Ga0501069_0559855 3300049585 Bacteria 684
1219 Ga0501070_0023046 3300049586 Bacteria 5213
1220 Ga0501070_0281740 3300049586 Bacteria 1356
1221 Ga0501070_0623056 3300049586 Bacteria 859
1222 Ga0501071_0003292 3300049587 Bacteria 10088
1223 Ga0501071_0007296 3300049587 Bacteria 7239
1224 Ga0501071_0420785 3300049587 Unclassified 1021
1225 Ga0501071_0817523 3300049587 Bacteria 719
1226 Ga0501072_0011126 3300049588 Bacteria 6867
1227 Ga0501072_0597586 3300049588 Bacteria 870
1228 Ga0501072_0866542 3300049588 Bacteria 706
1229 Ga0501073_0016278 3300049589 Bacteria 5389
1230 Ga0501073_0109818 3300049589 Bacteria 1913
1231 Ga0501074_0003979 3300049590 Bacteria 10531
1232 Ga0501074_0009456 3300049590 Bacteria 7079
1233 Ga0501074_0029852 3300049590 Bacteria 3951
1234 Ga0501074_0316690 3300049590 Unclassified 1108
1235 Ga0501075_0008695 3300049591 Bacteria 7080
1236 Ga0501075_0008857 3300049591 Bacteria 7016
1237 Ga0501075_1355211 3300049591 Unclassified 539
1238 Ga0501076_0000767 3300049592 Bacteria 20726
1239 Ga0501076_0093553 3300049592 Bacteria 2419
1240 Ga0501076_0101506 3300049592 Unclassified 2319
1241 Ga0501076_0288373 3300049592 Bacteria 1345
1242 Ga0501077_0003676 3300049593 Bacteria 9230
1243 Ga0501077_0004634 3300049593 Bacteria 8349
1244 Ga0501217_064451 3300049661 Bacteria 985
1245 Ga0501233_041059 3300049668 Bacteria 1087
1246 Ga0501258_005425 3300049687 Bacteria 1237
1247 Ga0501261_024961 3300049690 Bacteria 877
1248 Ga0501234_013588 3300049707 Bacteria 1278
1249 Ga0501079_0007024 3300049741 Bacteria 8493
1250 Ga0501079_0019926 3300049741 Bacteria 5124
1251 Ga0501079_0050781 3300049741 Bacteria 3201
1252 Ga0501079_0086098 3300049741 Bacteria 2432
1253 Ga0501079_0633872 3300049741 Bacteria 841
1254 Ga0501079_1338403 3300049741 Bacteria 564
1255 Ga0501080_0012655 3300049742 Bacteria 7737
1256 Ga0501080_0224863 3300049742 Bacteria 1716
1257 Ga0501080_0295484 3300049742 Bacteria 1470
1258 Ga0501081_0005884 3300049743 Bacteria 7937
1259 Ga0501081_0009803 3300049743 Bacteria 6239
1260 Ga0501081_0888063 3300049743 Bacteria 672
1261 Ga0501083_0001397 3300049744 Bacteria 16415
1262 Ga0501083_0929837 3300049744 Bacteria 566
1263 Ga0501270_029816 3300049767 Bacteria 893
1264 Ga0501274_003161 3300049771 Bacteria 1320
1265 Ga0501035_0055632 3300049822 Bacteria 3532
1266 Ga0501035_0066442 3300049822 Bacteria 3200
1267 Ga0501045_0016348 3300049824 Bacteria 5268
1268 Ga0501045_0051317 3300049824 Bacteria 3010
1269 Ga0501045_0100957 3300049824 Bacteria 2136
1270 nmdc:mga00v17_968074_c1 3300050491 Bacteria 537
1271 nmdc:mga0yw44_22461_c1 3300050492 Bacteria 3539
1272 nmdc:mga0yw44_46394_c1 3300050492 Bacteria 2609
1273 nmdc:mga07m45_476387_c1 3300050496 Bacteria 723
1274 nmdc:mga05p37_106971_c1 3300050507 Bacteria 3441
1275 nmdc:mga05p37_218080_c1 3300050507 Bacteria 2304
1276 nmdc:mga09592_7067_c1 3300050508 Bacteria 9123
1277 nmdc:mga0qj67_246812_c1 3300050509 Bacteria 1448
1278 nmdc:mga0qj67_81299_c1 3300050509 Bacteria 2598
1279 nmdc:mga06r32_334446_c1 3300050510 Bacteria 1499
1280 nmdc:mga06r32_93487_c1 3300050510 Bacteria 2941
1281 nmdc:mga08y16_367264_c1 3300050511 Bacteria 1476
1282 nmdc:mga08y16_38382_c1 3300050511 Bacteria 5029
1283 nmdc:mga08y16_793934_c1 3300050511 Bacteria 940
1284 nmdc:mga0n895_105654_c1 3300050512 Bacteria 2828
1285 nmdc:mga0n895_1841778_c1 3300050512 Bacteria 565
1286 nmdc:mga0n895_1894549_c1 3300050512 Unclassified 555
1287 nmdc:mga0n895_219993_c1 3300050512 Bacteria 1928
1288 nmdc:mga0n895_269214_c1 3300050512 Bacteria 1728
1289 nmdc:mga0n895_85740_c1 3300050512 Bacteria 3145
1290 nmdc:mga0rr50_1049372_c1 3300050513 Unclassified 694
1291 nmdc:mga0rr50_1384132_c1 3300050513 Bacteria 596
1292 nmdc:mga0rr50_23570_c1 3300050513 Bacteria 4246
1293 nmdc:mga0rr50_298897_c1 3300050513 Bacteria 1346
1294 nmdc:mga0rr50_39543_c1 3300050513 Bacteria 3124
1295 nmdc:mga0rr50_498093_c1 3300050513 Unclassified 1036
1296 nmdc:mga0rr50_722533_c1 3300050513 Bacteria 850
1297 nmdc:mga08x19_11630_c1 3300050514 Bacteria 5298
1298 nmdc:mga08x19_177832_c1 3300050514 Bacteria 1452
1299 nmdc:mga08x19_1875_c1 3300050514 Bacteria 12876
1300 nmdc:mga08x19_219423_c1 3300050514 Unclassified 1306
1301 nmdc:mga08x19_3451_c1 3300050514 Bacteria 9426
1302 nmdc:mga08x19_40184_c1 3300050514 Bacteria 2976
1303 nmdc:mga08x19_466882_c1 3300050514 Bacteria 889
1304 nmdc:mga08x19_586722_c1 3300050514 Bacteria 789
1305 nmdc:mga0a205_130669_c1 3300050515 Bacteria 2411
1306 nmdc:mga0a205_1478711_c1 3300050515 Unclassified 527
1307 nmdc:mga0a205_348493_c1 3300050515 Bacteria 1349
1308 nmdc:mga0a205_575773_c1 3300050515 Bacteria 980
1309 Ga0495601_0719668 3300053077 Bacteria 636
1310 Ga0495595_0158866 3300053084 Bacteria 1115
1311 Ga0501084_0031034 3300054114 Bacteria 4469
1312 Ga0501084_0049274 3300054114 Bacteria 3526
1313 Ga0501084_0171996 3300054114 Bacteria 1828
1314 Ga0501084_0247243 3300054114 Bacteria 1506
1315 Ga0501084_0725813 3300054114 Bacteria 837
1316 Ga0501084_0900645 3300054114 Unclassified 744
1317 Ga0501084_0913761 3300054114 Unclassified 738
1318 Ga0501082_0081431 3300060353 Bacteria 2793
1319 Ga0501082_0356301 3300060353 Bacteria 1276
1320 Ga0501082_0888987 3300060353 Bacteria 779
1321 Ga0501082_0992548 3300060353 Bacteria 734
1322 Ga0501082_1296478 3300060353 Bacteria 636
1323 Ga0466962_0001308 3300061719 Bacteria 11490
1324 Ga0530510_0002000 3300061734 Bacteria 13983
1325 Ga0530510_0036011 3300061734 Bacteria 3567
1326 Ga0530510_0560463 3300061734 Bacteria 868
1327 Ga0265338_10040736
1328 MBSR1b_contig_12373578
1329 MBSR1b_contig_9591076
1330 JGI24743J22301_10087115
1331 JGI24034J26672_10118024
1332 JGI24751J29686_10004867
1333 rootH2_10104511
1334 rootL2_10068500
1335 Ga0065704_10124661
1336 Ga0065712_10000113
1337 Ga0065712_10112355
1338 Ga0065712_10176847
1339 Ga0065715_10094050
1340 Ga0065715_10103679
1341 Ga0065715_10112900
1342 Ga0065707_10000935
1343 Ga0065707_11019243
1344 Ga0070658_10007310
1345 Ga0070658_10013304
1346 Ga0070658_10183542
1347 Ga0070658_10186550
1348 Ga0070658_10210289
1349 Ga0070676_10024646
1350 Ga0070676_10037433
1351 Ga0070676_10098943
1352 Ga0070676_10336987
1353 Ga0070683_100000756
1354 Ga0070683_100007927
1355 Ga0070683_100014671
1356 Ga0070683_100019192
1357 Ga0070683_100022422
1358 Ga0070683_100685353
1359 Ga0070690_100025672
1360 Ga0070690_100128105
1361 Ga0070690_100143479
1362 Ga0070690_100148356
1363 Ga0070690_100598326
1364 Ga0070690_100620365
1365 Ga0070690_100776022
1366 Ga0070690_101333133
1367 Ga0070670_100014183
1368 Ga0070670_101090624
1369 Ga0070670_101993141
1370 Ga0068869_100026692
1371 Ga0068869_100032009
1372 Ga0068869_100032975
1373 Ga0068869_100038892
1374 Ga0068869_100052368
1375 Ga0068869_100081849
1376 Ga0070666_10000136
1377 Ga0070666_10034971
1378 Ga0070666_10091297
1379 Ga0070666_10107992
1380 Ga0070666_10911708
1381 Ga0070680_100022389
1382 Ga0070680_100082597
1383 Ga0070680_100108847
1384 Ga0070680_100251405
1385 Ga0070680_100282881
1386 Ga0070680_100471255
1387 Ga0070680_101156844
1388 Ga0070682_100002163
1389 Ga0070682_100006650
1390 Ga0070682_100012996
1391 Ga0070682_100084198
1392 Ga0070682_100997086
1393 Ga0070682_101152765
1394 Ga0070682_101340098
1395 Ga0068868_100001217
1396 Ga0068868_100002119
1397 Ga0068868_100002890
1398 Ga0068868_100039811
1399 Ga0068868_100047731
1400 Ga0068868_100084109
1401 Ga0068868_100087614
1402 Ga0068868_100415232
1403 Ga0068868_101017659
1404 Ga0070660_100001227
1405 Ga0070660_100031624
1406 Ga0070660_100039327
1407 Ga0070660_100083304
1408 Ga0070660_100722484
1409 Ga0070689_100003801
1410 Ga0070689_100027513
1411 Ga0070689_100236840
1412 Ga0070689_100418114
1413 Ga0070689_101412425
1414 Ga0070691_10018946
1415 Ga0070691_10061718
1416 Ga0070691_10491081
1417 Ga0070691_10647404
1418 Ga0070687_100129414
1419 Ga0070661_100012914
1420 Ga0070661_100019124
1421 Ga0070661_100057993
1422 Ga0070661_100245337
1423 Ga0070661_100288254
1424 Ga0070661_100462839
1425 Ga0070692_10021033
1426 Ga0070692_10089511
1427 Ga0070692_10091149
1428 Ga0070692_10573902
1429 Ga0070668_100016124
1430 Ga0070668_100044409
1431 Ga0070668_102014085
1432 Ga0070669_100002341
1433 Ga0070669_100183464
1434 Ga0070675_100187609
1435 Ga0070671_100033932
1436 Ga0070671_100143202
1437 Ga0070671_100288764
1438 Ga0070671_100726032
1439 Ga0070671_101030889
1440 Ga0070671_101261756
1441 Ga0070674_100008505
1442 Ga0070673_100004418
1443 Ga0070673_100138657
1444 Ga0070673_100161477
1445 Ga0070673_101117298
1446 Ga0070673_101382869
1447 Ga0070688_100006966
1448 Ga0070688_100015715
1449 Ga0070688_100751627
1450 Ga0070688_100888709
1451 Ga0070659_100046133
1452 Ga0070659_100137645
1453 Ga0070659_100245284
1454 Ga0070659_100794275
1455 Ga0070659_101035753
1456 Ga0070659_101237699
1457 Ga0070659_101264190
1458 Ga0070667_100089334
1459 Ga0070667_100130792
1460 Ga0070667_100985799
1461 Ga0070709_10414586
1462 Ga0070714_100174463
1463 Ga0070713_100367382
1464 Ga0070713_100468323
1465 Ga0070713_101678420
1466 Ga0070710_10129794
1467 Ga0070701_10081377
1468 Ga0070701_10113017
1469 Ga0070711_100106905
1470 Ga0070711_100289918
1471 Ga0070711_100474563
1472 Ga0070711_100541280
1473 Ga0070705_101389495
1474 Ga0070705_101591641
1475 Ga0070705_101647847
1476 Ga0070700_100006579
1477 Ga0070700_100101318
1478 Ga0070700_100289339
1479 Ga0070700_100303712
1480 Ga0070694_100020121
1481 Ga0070694_100087631
1482 Ga0070694_100546548
1483 Ga0070694_101525176
1484 Ga0070708_100353401
1485 Ga0070708_100679513
1486 Ga0070663_100005796
1487 Ga0070663_100052380
1488 Ga0070663_100320070
1489 Ga0070663_100534320
1490 Ga0070663_101051467
1491 Ga0070663_101468997
1492 Ga0070678_100305629
1493 Ga0070678_100316190
1494 Ga0070678_100470981
1495 Ga0070678_101370888
1496 Ga0070662_100002146
1497 Ga0070662_100054367
1498 Ga0070662_100115297
1499 Ga0070662_100656578
1500 Ga0070662_100840129
1501 Ga0070681_10002072
1502 Ga0070681_10003001
1503 Ga0070681_10060771
1504 Ga0070681_10099766
1505 Ga0070681_10200404
1506 Ga0070681_10236932
1507 Ga0070681_10314424
1508 Ga0070681_10878373
1509 Ga0070681_11458330
1510 Ga0068867_100009629
1511 Ga0068867_100031705
1512 Ga0068867_100597063
1513 Ga0070685_10003709
1514 Ga0070685_10062521
1515 Ga0070685_10402902
1516 Ga0070685_10742698
1517 Ga0070706_101124700
1518 Ga0070707_100492906
1519 Ga0070698_100043277
1520 Ga0070698_100611415
1521 Ga0070699_100368630
1522 Ga0070699_100433402
1523 Ga0070699_100515543
1524 Ga0070679_100011572
1525 Ga0070679_100023415
1526 Ga0070679_100114548
1527 Ga0070679_100131088
1528 Ga0070679_100164781
1529 Ga0070679_100240735
1530 Ga0070679_101843282
1531 Ga0070684_100001840
1532 Ga0070684_100014693
1533 Ga0070684_100033044
1534 Ga0070684_100039896
1535 Ga0070684_100163098
1536 Ga0070684_100195335
1537 Ga0070684_100249375
1538 Ga0070697_100017534
1539 Ga0068853_100009840
1540 Ga0068853_100071772
1541 Ga0068853_100120312
1542 Ga0068853_102422881
1543 Ga0070672_100045874
1544 Ga0070672_100188701
1545 Ga0070672_101255254
1546 Ga0070672_101356262
1547 Ga0070686_100022318
1548 Ga0070686_100069929
1549 Ga0070686_100129919
1550 Ga0070695_100070577
1551 Ga0070695_100126431
1552 Ga0070695_100309767
1553 Ga0070695_100626200
1554 Ga0070695_100728138
1555 Ga0070695_101044428
1556 Ga0070696_100046824
1557 Ga0070696_100076775
1558 Ga0070696_100095761
1559 Ga0070696_100180676
1560 Ga0070696_100265491
1561 Ga0070696_100380141
1562 Ga0070696_101840826
1563 Ga0070693_100023085
1564 Ga0070693_100038394
1565 Ga0070693_100040134
1566 Ga0070693_100131897
1567 Ga0070693_100165776
1568 Ga0070693_100291626
1569 Ga0070693_100302811
1570 Ga0070665_100135217
1571 Ga0070665_100439846
1572 Ga0070704_100019732
1573 Ga0070704_100256675
1574 Ga0070704_100616069
1575 Ga0070704_100979334
1576 Ga0068855_100009158
1577 Ga0068855_100025509
1578 Ga0068855_100103491
1579 Ga0068855_100363829
1580 Ga0068855_100387560
1581 Ga0070664_100059253
1582 Ga0070664_100130291
1583 Ga0070664_100180628
1584 Ga0070664_100254907
1585 Ga0070664_100255920
1586 Ga0070664_100448165
1587 Ga0070664_100703838
1588 Ga0070664_100891139
1589 Ga0070664_101020232
1590 Ga0070664_101351071
1591 Ga0068857_100018128
1592 Ga0068857_100027115
1593 Ga0068857_100056006
1594 Ga0068857_100225290
1595 Ga0068857_100579573
1596 Ga0068857_101132770
1597 Ga0068854_100023491
1598 Ga0068854_100030966
1599 Ga0068854_100212288
1600 Ga0068854_100406016
1601 Ga0068854_100529969
1602 Ga0068856_100020346
1603 Ga0068856_100102950
1604 Ga0068856_100126510
1605 Ga0068856_100183984
1606 Ga0068856_100264315
1607 Ga0068856_100378943
1608 Ga0068856_100475115
1609 Ga0068856_101744106
1610 Ga0068856_101913277
1611 Ga0068856_102200338
1612 Ga0070702_100007942
1613 Ga0070702_100045524
1614 Ga0070702_100164409
1615 Ga0068852_100019433
1616 Ga0068852_100079034
1617 Ga0068852_100086783
1618 Ga0068852_100328693
1619 Ga0068852_101172593
1620 Ga0068859_100006803
1621 Ga0068859_100020458
1622 Ga0068859_100037054
1623 Ga0068859_100109639
1624 Ga0068859_100138625
1625 Ga0068859_100368043
1626 Ga0068859_100600168
1627 Ga0068859_101588569
1628 Ga0068859_103043436
1629 Ga0068864_100012542
1630 Ga0068864_100069652
1631 Ga0068864_100093480
1632 Ga0068864_101249266
1633 Ga0068864_101587905
1634 Ga0068864_101744278
1635 Ga0068864_101779571
1636 Ga0068866_10009453
1637 Ga0068866_10089942
1638 Ga0068866_10265761
1639 Ga0068866_10411420
1640 Ga0068861_100002524
1641 Ga0068861_100016124
1642 Ga0068861_100033820
1643 Ga0068861_100154429
1644 Ga0068851_10020578
1645 Ga0068851_10069325
1646 Ga0068851_10083378
1647 Ga0068851_10726306
1648 Ga0068851_10820172
1649 Ga0068870_10005385
1650 Ga0068870_10031247
1651 Ga0068870_10040121
1652 Ga0068870_10064706
1653 Ga0068870_10373218
1654 Ga0068863_100014794
1655 Ga0068863_100064693
1656 Ga0068863_100103600
1657 Ga0068863_100160560
1658 Ga0068863_100258779
1659 Ga0068863_100281364
1660 Ga0068863_100413645
1661 Ga0068863_100614847
1662 Ga0068863_100865708
1663 Ga0068858_100008344
1664 Ga0068858_100032781
1665 Ga0068858_100044309
1666 Ga0068858_100467125
1667 Ga0068860_100094217
1668 Ga0068860_100096034
1669 Ga0068860_100099475
1670 Ga0068860_100110208
1671 Ga0068860_100187295
1672 Ga0068860_100553346
1673 Ga0068860_101159819
1674 Ga0068860_101524553
1675 Ga0068862_100039699
1676 Ga0068862_100079235
1677 Ga0068862_100112131
1678 Ga0068862_100187036
1679 Ga0081455_10087984
1680 Ga0081455_10132010
1681 Ga0081455_10498030
1682 Ga0081538_10000375
1683 Ga0081538_10011208
1684 Ga0081538_10095535
1685 Ga0070717_10001342
1686 Ga0070717_10057233
1687 Ga0070717_10130126
1688 Ga0070717_11224671
1689 Ga0075365_10047793
1690 Ga0075364_10154452
1691 Ga0070715_10930395
1692 Ga0070716_100024271
1693 Ga0070716_100190086
1694 Ga0070716_100383428
1695 Ga0070716_100384279
1696 Ga0070716_101067475
1697 Ga0070712_100049839
1698 Ga0070712_100192541
1699 Ga0070712_100213561
1700 Ga0070712_100740401
1701 Ga0097621_100009585
1702 Ga0097621_100060850
1703 Ga0097621_100247790
1704 Ga0097621_100297993
1705 Ga0097621_100679507
1706 Ga0097621_100993107
1707 Ga0097621_101017171
1708 Ga0097621_101389752
1709 Ga0075370_10198211
1710 Ga0068871_100011336
1711 Ga0068871_100013539
1712 Ga0068871_100017424
1713 Ga0068871_100061356
1714 Ga0068871_100154192
1715 Ga0068871_100290967
1716 Ga0068871_100326313
1717 Ga0068871_100387668
1718 Ga0068871_100398187
1719 Ga0068871_100447209
1720 Ga0068871_101016379
1721 Ga0068871_101167333
1722 Ga0075428_100043771
1723 Ga0075428_101820077
1724 Ga0075430_100077424
1725 Ga0075430_100673608
1726 Ga0075431_100354985
1727 Ga0075433_10250049
1728 Ga0075433_10552596
1729 Ga0075433_10651977
1730 Ga0075434_100002797
1731 Ga0075434_100384352
1732 Ga0075434_100658256
1733 Ga0075434_100675064
1734 Ga0075434_101677908
1735 Ga0075429_100003982
1736 Ga0068865_100021438
1737 Ga0068865_100029734
1738 Ga0068865_100038186
1739 Ga0068865_100369792
1740 Ga0075436_100002372
1741 Ga0075436_100004880
1742 Ga0075436_100007385
1743 Ga0075436_100011228
1744 Ga0075436_100163612
1745 Ga0075436_100306811
1746 Ga0075436_100636656
1747 Ga0097620_100006804
1748 Ga0097620_100020457
1749 Ga0097620_100037052
1750 Ga0097620_100109642
1751 Ga0097620_100138623
1752 Ga0097620_100368058
1753 Ga0097620_100600045
1754 Ga0097620_101589031
1755 Ga0097620_103042862
1756 Ga0075435_100016937
1757 Ga0075435_100223745
1758 Ga0075435_100467805
1759 Ga0075435_100970409
1760 Ga0075435_101210354
1761 Ga0105240_10011749
1762 Ga0105240_10040284
1763 Ga0105240_10070460
1764 Ga0105240_10148480
1765 Ga0105240_10221035
1766 Ga0105240_11526110
1767 Ga0111539_10001409
1768 Ga0111539_10206534
1769 Ga0111539_10245625
1770 Ga0105245_10001513
1771 Ga0105245_10002924
1772 Ga0105245_10036084
1773 Ga0105245_10276290
1774 Ga0105245_10391005
1775 Ga0105245_10476179
1776 Ga0105245_10480242
1777 Ga0105245_11255203
1778 Ga0105247_10013833
1779 Ga0105247_10054695
1780 Ga0105247_10476505
1781 Ga0105247_10514485
1782 Ga0105247_10568540
1783 Ga0105247_10591185
1784 Ga0105247_11404744
1785 Ga0114129_10003933
1786 Ga0114129_10129300
1787 Ga0114129_10576338
1788 Ga0105243_10035969
1789 Ga0105243_10573871
1790 Ga0105243_11463467
1791 Ga0105241_10006639
1792 Ga0105241_10012006
1793 Ga0105241_10168613
1794 Ga0105241_10181883
1795 Ga0105241_10341915
1796 Ga0105241_10471002
1797 Ga0105241_11183544
1798 Ga0105241_12287859
1799 Ga0105242_10003716
1800 Ga0105242_10012411
1801 Ga0105242_10093547
1802 Ga0105242_10103660
1803 Ga0105242_10405217
1804 Ga0105242_11583309
1805 Ga0105248_10011119
1806 Ga0105248_10020606
1807 Ga0105248_10136810
1808 Ga0105248_10234317
1809 Ga0105248_10276428
1810 Ga0105248_10306201
1811 Ga0105248_10685070
1812 Ga0105248_11057000
1813 Ga0105237_10006860
1814 Ga0105237_10179521
1815 Ga0105237_10469140
1816 Ga0105237_10830370
1817 Ga0105237_10927222
1818 Ga0105237_12038217
1819 Ga0105238_10011190
1820 Ga0105238_10138546
1821 Ga0105238_10249073
1822 Ga0105238_10291559
1823 Ga0105238_11291305
1824 Ga0105238_11961666
1825 Ga0105238_13021246
1826 Ga0105249_10066414
1827 Ga0105249_10117880
1828 Ga0105249_10121750
1829 Ga0105249_10158706
1830 Ga0105249_11057291
1831 Ga0105249_12991532
1832 Ga0105239_10016536
1833 Ga0105239_10209622
1834 Ga0105239_10544240
1835 Ga0105239_10726215
1836 Ga0105239_10936831
1837 Ga0105239_11707894
1838 Ga0105239_12183591
1839 Ga0105239_12363716
1840 Ga0105246_10003229
1841 Ga0105246_10013497
1842 Ga0105246_10106621
1843 Ga0105246_10119425
1844 Ga0105246_10201895
1845 Ga0157337_1003496
1846 Ga0157373_10006408
1847 Ga0157373_10010571
1848 Ga0157373_10673671
1849 Ga0157371_10002909
1850 Ga0157371_10015099
1851 Ga0157371_10217440
1852 Ga0157371_10624601
1853 Ga0157371_10985387
1854 Ga0157370_10067220
1855 Ga0157370_10596929
1856 Ga0157370_10785521
1857 Ga0157370_10820473
1858 Ga0157370_11323731
1859 Ga0157370_11633896
1860 Ga0157369_10051967
1861 Ga0157369_10056671
1862 Ga0157369_10063704
1863 Ga0157369_10206937
1864 Ga0157369_10250577
1865 Ga0157374_10014124
1866 Ga0157374_10074767
1867 Ga0157374_10079953
1868 Ga0157374_10088131
1869 Ga0157374_10222367
1870 Ga0157374_10246146
1871 Ga0157374_10300959
1872 Ga0157374_10303400
1873 Ga0157374_12342562
1874 Ga0157374_12819007
1875 Ga0157378_10000695
1876 Ga0157378_10003297
1877 Ga0157378_10015002
1878 Ga0157378_10173174
1879 Ga0157378_10278142
1880 Ga0157378_10372478
1881 Ga0157378_11361682
1882 Ga0157378_12122184
1883 Ga0163162_10002605
1884 Ga0163162_10032931
1885 Ga0163162_10038936
1886 Ga0163162_10081380
1887 Ga0163162_10082742
1888 Ga0163162_10115603
1889 Ga0163162_10213930
1890 Ga0163162_10371461
1891 Ga0163162_10913531
1892 Ga0163162_11643941
1893 Ga0163162_12944152
1894 Ga0163162_13398806
1895 Ga0157372_10028501
1896 Ga0157372_10168540
1897 Ga0157372_10487444
1898 Ga0157372_10500589
1899 Ga0157372_10730593
1900 Ga0157372_11376139
1901 Ga0157372_11825520
1902 Ga0157372_12418254
1903 Ga0157375_10035022
1904 Ga0157375_10112524
1905 Ga0157375_10119818
1906 Ga0157375_10180998
1907 Ga0157375_10224039
1908 Ga0157375_10251474
1909 Ga0157375_10261771
1910 Ga0157375_10467400
1911 Ga0157375_10594108
1912 Ga0157375_10717993
1913 Ga0163163_10004114
1914 Ga0163163_10015926
1915 Ga0163163_10024238
1916 Ga0163163_10031497
1917 Ga0163163_10127654
1918 Ga0163163_10234738
1919 Ga0163163_10531144
1920 Ga0163163_10553239
1921 Ga0157380_10002195
1922 Ga0157380_10005146
1923 Ga0182008_10001761
1924 Ga0182008_10117712
1925 Ga0157377_10000703
1926 Ga0157377_10003516
1927 Ga0157377_10034483
1928 Ga0157377_10234401
1929 Ga0157377_10656138
1930 Ga0157377_10750776
1931 Ga0157379_10007733
1932 Ga0157379_10107212
1933 Ga0157379_10275774
1934 Ga0157379_10853173
1935 Ga0157379_11208038
1936 Ga0157376_10091623
1937 Ga0157376_10146029
1938 Ga0157376_10173658
1939 Ga0157376_10229379
1940 Ga0157376_10518957
1941 Ga0157376_10537068
1942 Ga0157376_11602388
1943 Ga0157376_11607296
1944 Ga0157376_11711350
1945 Ga0182006_1169850
1946 Ga0182007_10067860
1947 Ga0163161_10001109
1948 Ga0163161_10326170
1949 Ga0163161_11380973
1950 Ga0206356_11077341
1951 Ga0206351_10706853
1952 Ga0206354_10157849
1953 Ga0206354_11090343
1954 Ga0206354_11457533
1955 Ga0206353_10520053
1956 Ga0206353_10525352
1957 Ga0206353_11801339
1958 Ga0207697_10005260
1959 Ga0207656_10008994
1960 Ga0207656_10020340
1961 Ga0207656_10024011
1962 Ga0207682_10133448
1963 Ga0207692_10554920
1964 Ga0207692_10814260
1965 Ga0207642_10003430
1966 Ga0207642_10038221
1967 Ga0207642_10745672
1968 Ga0207710_10014060
1969 Ga0207710_10665647
1970 Ga0207688_10000393
1971 Ga0207688_10004736
1972 Ga0207688_10023107
1973 Ga0207688_10998545
1974 Ga0207680_10005965
1975 Ga0207680_10062010
1976 Ga0207680_10111136
1977 Ga0207647_10002678
1978 Ga0207699_10020840
1979 Ga0207699_10024951
1980 Ga0207699_10490367
1981 Ga0207645_10000019
1982 Ga0207645_10050408
1983 Ga0207645_10332038
1984 Ga0207643_10000432
1985 Ga0207643_10017042
1986 Ga0207643_10056440
1987 Ga0207643_10089529
1988 Ga0207643_10097530
1989 Ga0207643_10259783
1990 Ga0207643_10909607
1991 Ga0207705_10046456
1992 Ga0207705_10063567
1993 Ga0207705_10145141
1994 Ga0207705_10542997
1995 Ga0207684_11389414
1996 Ga0207654_10009502
1997 Ga0207654_10013219
1998 Ga0207654_10134217
1999 Ga0207654_10254141
2000 Ga0207654_10269338
2001 Ga0207707_10002237
2002 Ga0207707_10014753
2003 Ga0207707_10053394
2004 Ga0207707_10106509
2005 Ga0207707_10343048
2006 Ga0207707_11014909
2007 Ga0207695_10079393
2008 Ga0207695_10377001
2009 Ga0207695_10835226
2010 Ga0207671_10208720
2011 Ga0207671_10325025
2012 Ga0207671_10473588
2013 Ga0207693_10021046
2014 Ga0207693_10176204
2015 Ga0207693_10263793
2016 Ga0207693_10276855
2017 Ga0207663_10169935
2018 Ga0207663_10879560
2019 Ga0207660_10045160
2020 Ga0207660_10055513
2021 Ga0207660_10056915
2022 Ga0207660_10507836
2023 Ga0207660_10953458
2024 Ga0207662_10000715
2025 Ga0207662_10368848
2026 Ga0207657_10000731
2027 Ga0207657_10005013
2028 Ga0207657_10009782
2029 Ga0207657_10028465
2030 Ga0207657_10228610
2031 Ga0207657_10441906
2032 Ga0207657_10834452
2033 Ga0207657_10930788
2034 Ga0207649_10000188
2035 Ga0207649_10004372
2036 Ga0207649_10232878
2037 Ga0207649_10330866
2038 Ga0207649_10730396
2039 Ga0207652_10018886
2040 Ga0207652_10024777
2041 Ga0207652_10032420
2042 Ga0207652_10153892
2043 Ga0207652_10650400
2044 Ga0207646_10120585
2045 Ga0207681_10013593
2046 Ga0207681_10022406
2047 Ga0207681_10050972
2048 Ga0207694_10132648
2049 Ga0207694_10938251
2050 Ga0207650_10000024
2051 Ga0207650_10201193
2052 Ga0207650_10579411
2053 Ga0207650_11392797
2054 Ga0207659_10010347
2055 Ga0207659_10228722
2056 Ga0207687_10001849
2057 Ga0207687_10007823
2058 Ga0207687_10039043
2059 Ga0207687_10155136
2060 Ga0207687_10334030
2061 Ga0207687_10341831
2062 Ga0207687_10478405
2063 Ga0207700_10700615
2064 Ga0207664_10293259
2065 Ga0207664_11533377
2066 Ga0207664_11912645
2067 Ga0207644_10068646
2068 Ga0207644_10239694
2069 Ga0207644_10601611
2070 Ga0207690_10019446
2071 Ga0207690_10026441
2072 Ga0207690_10220141
2073 Ga0207690_10308487
2074 Ga0207690_11129932
2075 Ga0207690_11178074
2076 Ga0207706_10000912
2077 Ga0207706_10003049
2078 Ga0207706_10055523
2079 Ga0207706_10210884
2080 Ga0207706_10628332
2081 Ga0207686_10025124
2082 Ga0207686_10026204
2083 Ga0207686_10056448
2084 Ga0207686_10610278
2085 Ga0207686_10620163
2086 Ga0207709_10128148
2087 Ga0207709_10137494
2088 Ga0207709_10477537
2089 Ga0207709_11808566
2090 Ga0207670_10080240
2091 Ga0207670_10112448
2092 Ga0207670_10112449
2093 Ga0207670_10857842
2094 Ga0207670_11203169
2095 Ga0207669_10003738
2096 Ga0207669_10844599
2097 Ga0207704_10010186
2098 Ga0207704_10063743
2099 Ga0207704_10235851
2100 Ga0207704_10681596
2101 Ga0207665_10016629
2102 Ga0207665_10142527
2103 Ga0207665_10375427
2104 Ga0207691_10003833
2105 Ga0207691_10028474
2106 Ga0207691_10295317
2107 Ga0207691_10387425
2108 Ga0207711_10001719
2109 Ga0207711_10053771
2110 Ga0207711_10183183
2111 Ga0207711_10318879
2112 Ga0207711_10434944
2113 Ga0207711_10437427
2114 Ga0207711_10712904
2115 Ga0207711_11295918
2116 Ga0207689_10001992
2117 Ga0207689_10002848
2118 Ga0207689_10025057
2119 Ga0207689_10053430
2120 Ga0207689_10064764
2121 Ga0207689_11686934
2122 Ga0207661_10000067
2123 Ga0207661_10001401
2124 Ga0207661_10001542
2125 Ga0207661_10040019
2126 Ga0207661_10076039
2127 Ga0207661_10370686
2128 Ga0207661_10680870
2129 Ga0207679_10000055
2130 Ga0207679_10090635
2131 Ga0207679_10173263
2132 Ga0207679_10192682
2133 Ga0207679_10269513
2134 Ga0207679_10498576
2135 Ga0207667_10079834
2136 Ga0207667_10618316
2137 Ga0207667_11420820
2138 Ga0207651_10012890
2139 Ga0207651_10083509
2140 Ga0207651_10294871
2141 Ga0207651_10337602
2142 Ga0207712_10229540
2143 Ga0207712_10367773
2144 Ga0207712_10684581
2145 Ga0207668_10036023
2146 Ga0207668_10038261
2147 Ga0207668_10046904
2148 Ga0207640_10011325
2149 Ga0207640_10204128
2150 Ga0207640_10237235
2151 Ga0207640_10237779
2152 Ga0207640_10725099
2153 Ga0207640_10826263
2154 Ga0207658_10039535
2155 Ga0207658_10213881
2156 Ga0207658_10560212
2157 Ga0207658_11075044
2158 Ga0207677_10010017
2159 Ga0207677_10013512
2160 Ga0207677_10014490
2161 Ga0207677_10063300
2162 Ga0207677_11072475
2163 Ga0207677_11142317
2164 Ga0207703_10002963
2165 Ga0207703_10055609
2166 Ga0207703_11170958
2167 Ga0207639_10296093
2168 Ga0207639_11410369
2169 Ga0207678_10001331
2170 Ga0207678_10001590
2171 Ga0207678_10437116
2172 Ga0207678_11000136
2173 Ga0207708_10003250
2174 Ga0207708_10048689
2175 Ga0207708_10291754
2176 Ga0207702_10021041
2177 Ga0207702_10042043
2178 Ga0207702_10160873
2179 Ga0207702_10169653
2180 Ga0207702_10194248
2181 Ga0207702_10202889
2182 Ga0207702_10431996
2183 Ga0207702_12508089
2184 Ga0207641_10000030
2185 Ga0207641_10078190
2186 Ga0207641_10263389
2187 Ga0207641_10361956
2188 Ga0207641_10381618
2189 Ga0207641_10433545
2190 Ga0207641_10648087
2191 Ga0207641_11607921
2192 Ga0207648_10000031
2193 Ga0207648_10040838
2194 Ga0207676_10001006
2195 Ga0207676_10014080
2196 Ga0207676_10652351
2197 Ga0207676_10679121
2198 Ga0207676_10852250
2199 Ga0207676_11209463
2200 Ga0207674_10000618
2201 Ga0207674_10002728
2202 Ga0207674_10040199
2203 Ga0207674_10076386
2204 Ga0207674_10169715
2205 Ga0207674_10433101
2206 Ga0207674_11356129
2207 Ga0207675_100008535
2208 Ga0207675_100011099
2209 Ga0207675_100038821
2210 Ga0207683_10014563
2211 Ga0207683_10084602
2212 Ga0207683_10351753
2213 Ga0207683_10665043
2214 Ga0207698_10135238
2215 Ga0207698_10194152
2216 Ga0207698_10293887
2217 Ga0207698_10307446
2218 Ga0207698_10639542
2219 Ga0207698_10910774
2220 Ga0209588_1044297
2221 Ga0209998_10164321
2222 Ga0207428_10030102
2223 Ga0207428_10135611
2224 Ga0268266_10005546
2225 Ga0268266_10128776
2226 Ga0268266_10307359
2227 Ga0268266_11617406
2228 Ga0268265_10092033
2229 Ga0268265_10094108
2230 Ga0268265_10140531
2231 Ga0268265_10150376
2232 Ga0268265_12643113
2233 Ga0268264_10046537
2234 Ga0268264_10123056
2235 Ga0268264_10186689
2236 Ga0268264_10255245
2237 Ga0268264_10256384
2238 Ga0268264_10699368
2239 Ga0268264_11583787
2240 Ga0268264_11814294
2241 Ga0265337_1077731
2242 Ga0265326_10060152
2243 Ga0265319_1044163
2244 Ga0265319_1052405
2245 Ga0265323_10125494
2246 Ga0265322_10024897
2247 Ga0265336_10003729
2248 Ga0265338_10007600
2249 Ga0265325_10005401
2250 Ga0265340_10001376
2251 Ga0265316_10172810
2252 Ga0265313_10024931
2253 Ga0316576_10024976
2254 Ga0316576_10042070
2255 Ga0316576_10195478
2256 Ga0316578_10072799
2257 Ga0316578_10189013
2258 Ga0307405_10216675
2259 Ga0316577_10036591
2260 Ga0307410_10700937
2261 Ga0307407_10189453
2262 Ga0307416_101347574
2263 Ga0307414_10631030
2264 Ga0307415_100262168
2265 Ga0316585_10137882
2266 Ga0373948_0015880
2267 Ga0373950_0038783
2268 Ga0373926_0031683
2269 Ga0373926_0150284
2270 Ga0373944_0023577
2271 Ga0373949_0141694
2272 Ga0373936_0002175
2273 Ga0373936_0167725
2274 Ga0373939_0017420
2275 Ga0373941_0075559
2276 Ga0373941_0362854
2277 Ga0373941_0375371
2278 Ga0373945_0140031
2279 Ga0373953_0241141
2280 Ga0373957_0183595
2281 Ga0373960_0138285
2282 Ga0373960_0411822
2283 Ga0373943_0107216
2284 Ga0373943_0137020
2285 Ga0373943_0360936
2286 Ga0373943_0668507
2287 Ga0373946_0073471
2288 Ga0373955_0189434
2289 Ga0373961_0201548
2290 Ga0373961_0316119
2291 Ga0373961_0391214
2292 Ga0316574_0151133
2293 Ga0316574_0155696
2294 Ga0316574_0499900
2295 Ga0373924_0039844
2296 Ga0373931_0037515
2297 Ga0373931_0117624
2298 Ga0373927_0444905
2299 Ga0373933_0103943
2300 Ga0373933_0641958
2301 Ga0373947_0018665
2302 Ga0373947_0193680
2303 Ga0373937_0002393
2304 Ga0373937_0083150
2305 Ga0373937_0171915
2306 Ga0373937_0420769
2307 Ga0316582_0374009
2308 Ga0316584_0086994
2309 Ga0316584_0228639
2310 Ga0373925_0001169
2311 Ga0373925_0283285
2312 Ga0373925_0488677
2313 Ga0373925_1067842
2314 Ga0395900_0093144
2315 Ga0395900_0860393
2316 Ga0395898_0408364
2317 Ga0395905_0277710
2318 Ga0395905_1417871
2319 Ga0436364_0868731
2320 Ga0395901_0032207
2321 Ga0395901_0640637
2322 Ga0395901_1209235
2323 Ga0436365_1865349
2324 Ga0436362_0068786
2325 Ga0436362_0197399
2326 Ga0439453_0009799
2327 Ga0451804_0554939
2328 Ga0451855_1312722
2329 Ga0439451_010984
2330 Ga0439454_003816
2331 Ga0450914_002057
2332 Ga0450920_012436
2333 Ga0450905_061641
2334 Ga0450906_003773
2335 Ga0450908_007909
2336 Ga0439464_0055024
2337 Ga0450916_015776
2338 Ga0451577_1765109
2339 Ga0466969_0051021
2340 Ga0466966_0772016
2341 Ga0466961_0074888
2342 Ga0466963_0182756
2343 Ga0466963_0748781
2344 Ga0466963_0880227
2345 Ga0466971_0001350
2346 Ga0466957_0152252
2347 Ga0466957_0451704
2348 Ga0466957_0635498
2349 Ga0466960_0758981
2350 Ga0466959_0010178
2351 Ga0466959_0055746
2352 Ga0466959_0992303
2353 Ga0451576_2115528
2354 Ga0466958_0022669
2355 Ga0466958_0028012
2356 Ga0466958_0150993
2357 Ga0466958_1012797
2358 Ga0466967_0021185
2359 Ga0466967_0026563
2360 Ga0466967_0147809
2361 Ga0466967_0402266
2362 Ga0466967_0723471
2363 Ga0495629_0584444
2364 Ga0495653_0187253
2365 Ga0495580_0000116
2366 Ga0495580_0010633
2367 Ga0495580_0180365
2368 Ga0495580_0192593
2369 Ga0495580_0518531
2370 Ga0495580_0652213
2371 Ga0495580_0905282
2372 Ga0495582_0054763
2373 Ga0495582_0628413
2374 Ga0495639_0386809
2375 Ga0495585_0611406
2376 Ga0495594_0219039
2377 Ga0495608_0292066
2378 Ga0495630_0109339
2379 Ga0495630_0502230
2380 Ga0495630_0637890
2381 Ga0495630_1287939
2382 Ga0495631_0426462
2383 Ga0495644_0093220
2384 Ga0495652_0284847
2385 Ga0495665_0130938
2386 Ga0495665_0349661
2387 Ga0495586_0003843
2388 Ga0495586_0381312
2389 Ga0495587_0267520
2390 Ga0495645_0698883
2391 Ga0495656_0069159
2392 Ga0495656_0125264
2393 Ga0495668_0394838
2394 Ga0495588_0016297
2395 Ga0495599_0373343
2396 Ga0495623_0205519
2397 Ga0495623_0659650
2398 Ga0495658_0022699
2399 Ga0495658_0155773
2400 Ga0495658_0182073
2401 Ga0495669_0001864
2402 Ga0495669_0040733
2403 Ga0495613_0024887
2404 Ga0495613_0218700
2405 Ga0495613_0298883
2406 Ga0495624_0415794
2407 Ga0495670_0497662
2408 Ga0495581_0694405
2409 Ga0495604_0422940
2410 Ga0495604_0469062
2411 Ga0495604_1024605
2412 Ga0495676_0050963
2413 Ga0495676_0573942
2414 Ga0495680_0394721
2415 Ga0495680_1103004
2416 Ga0495683_0088327
2417 Ga0495684_0389692
2418 Ga0495684_0428849
2419 Ga0495593_0185945
2420 Ga0495593_0593320
2421 Ga0495602_0384123
2422 Ga0495602_0759495
2423 Ga0496100_0010347
2424 Ga0496100_0226874
2425 Ga0496100_0685755
2426 Ga0496100_0705349
2427 Ga0496101_0025335
2428 Ga0496101_0102413
2429 Ga0496101_0190221
2430 Ga0496101_0437880
2431 Ga0496101_0467431
2432 Ga0496101_0707588
2433 Ga0496102_0084282
2434 Ga0496102_0159591
2435 Ga0496102_0390861
2436 Ga0496102_0425386
2437 Ga0496102_0524267
2438 Ga0496102_0771183
2439 Ga0496102_1756005
2440 Ga0496103_0187447
2441 Ga0496103_0553735
2442 Ga0496104_0032468
2443 Ga0496104_0275845
2444 Ga0496104_0282967
2445 Ga0496104_0295423
2446 Ga0496104_0345512
2447 Ga0496104_0476060
2448 Ga0496104_0497486
2449 Ga0496104_0669393
2450 Ga0496104_1366253
2451 Ga0496105_0056007
2452 Ga0496105_0179918
2453 Ga0496105_0958143
2454 Ga0496106_0409171
2455 Ga0496106_0473493
2456 Ga0496106_0739210
2457 Ga0496106_0856878
2458 Ga0496106_0986674
2459 Ga0496107_0050240
2460 Ga0496107_0108919
2461 Ga0496107_0305058
2462 Ga0496107_0666717
2463 Ga0496107_0771609
2464 Ga0496107_1078853
2465 Ga0496108_0000602
2466 Ga0496108_0004142
2467 Ga0496108_0091571
2468 Ga0496108_0420673
2469 Ga0496108_1377197
2470 Ga0496109_0000941
2471 Ga0496109_0006116
2472 Ga0496109_0033373
2473 Ga0496109_0195340
2474 Ga0496109_0208834
2475 Ga0496109_0243055
2476 Ga0496109_0325795
2477 Ga0496109_0527243
2478 Ga0496109_1245121
2479 Ga0496109_1283022
2480 Ga0496110_0001419
2481 Ga0496110_0006002
2482 Ga0496110_0017934
2483 Ga0496110_0190466
2484 Ga0496110_0352206
2485 Ga0496111_0000612
2486 Ga0496111_0001316
2487 Ga0496111_0119718
2488 Ga0496111_0283496
2489 Ga0496111_0301194
2490 Ga0496111_0476695
2491 Ga0496112_0000964
2492 Ga0496112_0007171
2493 Ga0496112_0021577
2494 Ga0496112_0047308
2495 Ga0496112_0124580
2496 Ga0496112_0163855
2497 Ga0496112_0226424
2498 Ga0496112_0327249
2499 Ga0496112_0455150
2500 Ga0496112_0610318
2501 Ga0496113_0000942
2502 Ga0496113_0077713
2503 Ga0496113_0178448
2504 Ga0496113_0487052
2505 Ga0496113_1174003
2506 Ga0496114_0150802
2507 Ga0496114_0236526
2508 Ga0496114_0347198
2509 Ga0496114_0400477
2510 Ga0496115_0030437
2511 Ga0496115_0955471
2512 Ga0495682_0200746
2513 Ga0501031_0045189
2514 Ga0501032_0018830
2515 Ga0501032_0264191
2516 Ga0501033_0136620
2517 Ga0501033_0507254
2518 Ga0501036_0015843
2519 Ga0501036_0124625
2520 Ga0501037_0226548
2521 Ga0501037_0624489
2522 Ga0501038_0047096
2523 Ga0501039_0333206
2524 Ga0501039_0841562
2525 Ga0501040_0002790
2526 Ga0501040_0022602
2527 Ga0501040_0035632
2528 Ga0501040_0252850
2529 Ga0501041_0002443
2530 Ga0501041_0003646
2531 Ga0501042_0000396
2532 Ga0501042_0045429
2533 Ga0501042_1041692
2534 Ga0501043_0087192
2535 Ga0501046_0040849
2536 Ga0501046_0052281
2537 Ga0501046_0677666
2538 Ga0501047_0304752
2539 Ga0501047_0641300
2540 Ga0501048_0002492
2541 Ga0501048_0128294
2542 Ga0501048_0554341
2543 Ga0501068_0086110
2544 Ga0501069_0559855
2545 Ga0501070_0023046
2546 Ga0501070_0281740
2547 Ga0501070_0623056
2548 Ga0501071_0003292
2549 Ga0501071_0007296
2550 Ga0501071_0420785
2551 Ga0501071_0817523
2552 Ga0501072_0011126
2553 Ga0501072_0597586
2554 Ga0501072_0866542
2555 Ga0501073_0016278
2556 Ga0501073_0109818
2557 Ga0501074_0003979
2558 Ga0501074_0009456
2559 Ga0501074_0029852
2560 Ga0501074_0316690
2561 Ga0501075_0008695
2562 Ga0501075_0008857
2563 Ga0501075_1355211
2564 Ga0501076_0000767
2565 Ga0501076_0093553
2566 Ga0501076_0101506
2567 Ga0501076_0288373
2568 Ga0501077_0003676
2569 Ga0501077_0004634
2570 Ga0501217_064451
2571 Ga0501233_041059
2572 Ga0501258_005425
2573 Ga0501261_024961
2574 Ga0501234_013588
2575 Ga0501079_0007024
2576 Ga0501079_0019926
2577 Ga0501079_0050781
2578 Ga0501079_0086098
2579 Ga0501079_0633872
2580 Ga0501079_1338403
2581 Ga0501080_0012655
2582 Ga0501080_0224863
2583 Ga0501080_0295484
2584 Ga0501081_0005884
2585 Ga0501081_0009803
2586 Ga0501081_0888063
2587 Ga0501083_0001397
2588 Ga0501083_0929837
2589 Ga0501270_029816
2590 Ga0501274_003161
2591 Ga0501035_0055632
2592 Ga0501035_0066442
2593 Ga0501045_0016348
2594 Ga0501045_0051317
2595 Ga0501045_0100957
2596 nmdc:mga00v17_968074_c1
2597 nmdc:mga0yw44_22461_c1
2598 nmdc:mga0yw44_46394_c1
2599 nmdc:mga07m45_476387_c1
2600 nmdc:mga05p37_106971_c1
2601 nmdc:mga05p37_218080_c1
2602 nmdc:mga09592_7067_c1
2603 nmdc:mga0qj67_246812_c1
2604 nmdc:mga0qj67_81299_c1
2605 nmdc:mga06r32_334446_c1
2606 nmdc:mga06r32_93487_c1
2607 nmdc:mga08y16_367264_c1
2608 nmdc:mga08y16_38382_c1
2609 nmdc:mga08y16_793934_c1
2610 nmdc:mga0n895_105654_c1
2611 nmdc:mga0n895_1841778_c1
2612 nmdc:mga0n895_1894549_c1
2613 nmdc:mga0n895_219993_c1
2614 nmdc:mga0n895_269214_c1
2615 nmdc:mga0n895_85740_c1
2616 nmdc:mga0rr50_1049372_c1
2617 nmdc:mga0rr50_1384132_c1
2618 nmdc:mga0rr50_23570_c1
2619 nmdc:mga0rr50_298897_c1
2620 nmdc:mga0rr50_39543_c1
2621 nmdc:mga0rr50_498093_c1
2622 nmdc:mga0rr50_722533_c1
2623 nmdc:mga08x19_11630_c1
2624 nmdc:mga08x19_177832_c1
2625 nmdc:mga08x19_1875_c1
2626 nmdc:mga08x19_219423_c1
2627 nmdc:mga08x19_3451_c1
2628 nmdc:mga08x19_40184_c1
2629 nmdc:mga08x19_466882_c1
2630 nmdc:mga08x19_586722_c1
2631 nmdc:mga0a205_130669_c1
2632 nmdc:mga0a205_1478711_c1
2633 nmdc:mga0a205_348493_c1
2634 nmdc:mga0a205_575773_c1
2635 Ga0495601_0719668
2636 Ga0495595_0158866
2637 Ga0501084_0031034
2638 Ga0501084_0049274
2639 Ga0501084_0171996
2640 Ga0501084_0247243
2641 Ga0501084_0725813
2642 Ga0501084_0900645
2643 Ga0501084_0913761
2644 Ga0501082_0081431
2645 Ga0501082_0356301
2646 Ga0501082_0888987
2647 Ga0501082_0992548
2648 Ga0501082_1296478
2649 Ga0466962_0001308
2650 Ga0530510_0002000
2651 Ga0530510_0036011
2652 Ga0530510_0560463

MSA Aligner

Family Sequences

Functional Annotation

PFAM ID Name Description Start Position End Position Accuracy

PF11969

DcpS_C

Scavenger mRNA decapping enzyme C-term binding

16

121

0.97

PF01230

HIT

HIT domain

24

121

0.95

Structural Annotation

Top 5 Hits

ID Description Score Start End
5uvm-assembly1.cif.gz_A hit family hydrolase from clostridium thermocellum cth-393 0.9708 1 109
3n1s-assembly2.cif.gz_F crystal structure of wild type echint gmp complex 0.9646 5 109
6d6j-assembly1.cif.gz_A crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 0.964 3 113
3qgz-assembly1.cif.gz_A re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine 0.9559 5 113
6j65-assembly1.cif.gz_B crystal structure of human hint1 mutant complexing with ap4a ii 0.9551 3 113
ID Description Score Start End Superfamily
5uvmA00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9743 1 107 3.30.428.10
af_I1MGX8_45_178_3.30.428.10 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9599 5 113 3.30.428.10
3n1sB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9592 5 108 3.30.428.10
1kpcB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.9492 5 113 3.30.428.10
4eguB00 Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like 0.945 1 113 3.30.428.10
ID Description Score Start End GO Terms
AF-A0A1G2H9X7-F1-model_v4 Histidine triad nucleotide-binding protein 0.9954 4 107 GO:0003824
AF-A0A0G1XS28-F1-model_v4 HIT domain-containing protein 0.9886 3 107 GO:0003824
AF-A0A832B901-F1-model_v4 Histidine triad nucleotide-binding protein 0.985 1 109 GO:0003824
AF-D6YUY2-F1-model_v4 HIT domain-containing protein 0.9839 5 109 GO:0003824
AF-A0A2E4UY12-F1-model_v4 Histidine triad nucleotide-binding protein 0.9823 1 109 GO:0003824

Map