F493034
General Info
| Members | Datasets | Scaffolds | Average Seq Length |
|---|---|---|---|
| 1326 | 397 | 2652 | 111 |
Family's Representative Sequence
| Representative Sequence | 3300028800|Ga0265338_10040736|Ga0265338_100407366 |
| Length | 126 |
| Sequence | LLESRRPLHYHSSMDDCLFCKIIAGKIPSRKVYEDDKVYVFEDITPKAPTHLLIVPKRHIAGLKEAQPEDAEIIGYSHLVAANIARDRGIEDSYRTVYNVGPGSGQSVFHLHLHLLGGRDLTWPPG |
Samples
| Sample ID | Description | Type | Environment | |
|---|---|---|---|---|
| 1 | 3300028800 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-26 metaG | Metagenome | Rhizosphere |
| 2 | 2162886012 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v1 | Metagenome | Rhizosphere |
| 3 | 3300001991 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2 | Metagenome | Rhizosphere |
| 4 | 3300002239 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S2 | Metagenome | Rhizosphere |
| 5 | 3300002459 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6 | Metagenome | Rhizosphere |
| 6 | 3300003320 | Sugarcane root Sample H2 | Metagenome | Unclassified |
| 7 | 3300003322 | Sugarcane root Sample L2 | Metagenome | Unclassified |
| 8 | 3300005289 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL2 v2 (version 2) | Metagenome | Rhizosphere |
| 9 | 3300005290 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Rhizosphere Soil Replicate 1: eDNA_1 v3 (version 3) | Metagenome | Rhizosphere |
| 10 | 3300005293 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, MSU, sample Bulk Soil Replicate 1 : eDNA_1 v2 (version 2) | Metagenome | Rhizosphere |
| 11 | 3300005295 | Switchgrass rhizosphere bacterial communities from Rose Lake, Michigan, USA - RL3 v2 (version 2) | Metagenome | Rhizosphere |
| 12 | 3300005327 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG | Metagenome | Rhizosphere |
| 13 | 3300005328 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG | Metagenome | Rhizosphere |
| 14 | 3300005329 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG | Metagenome | Rhizosphere |
| 15 | 3300005330 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3H metaG | Metagenome | Rhizosphere |
| 16 | 3300005331 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG | Metagenome | Rhizosphere |
| 17 | 3300005334 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 | Metagenome | Rhizosphere |
| 18 | 3300005335 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG | Metagenome | Rhizosphere |
| 19 | 3300005336 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG | Metagenome | Rhizosphere |
| 20 | 3300005337 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3L metaG | Metagenome | Rhizosphere |
| 21 | 3300005338 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 | Metagenome | Rhizosphere |
| 22 | 3300005339 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG | Metagenome | Rhizosphere |
| 23 | 3300005340 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG | Metagenome | Rhizosphere |
| 24 | 3300005341 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-1 metaG | Metagenome | Rhizosphere |
| 25 | 3300005343 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG | Metagenome | Rhizosphere |
| 26 | 3300005344 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG | Metagenome | Rhizosphere |
| 27 | 3300005345 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-2 metaG | Metagenome | Rhizosphere |
| 28 | 3300005347 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG | Metagenome | Rhizosphere |
| 29 | 3300005353 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG | Metagenome | Rhizosphere |
| 30 | 3300005354 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG | Metagenome | Rhizosphere |
| 31 | 3300005355 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG | Metagenome | Rhizosphere |
| 32 | 3300005356 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG | Metagenome | Rhizosphere |
| 33 | 3300005364 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG | Metagenome | Rhizosphere |
| 34 | 3300005365 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3H metaG | Metagenome | Rhizosphere |
| 35 | 3300005366 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG | Metagenome | Rhizosphere |
| 36 | 3300005367 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG | Metagenome | Rhizosphere |
| 37 | 3300005434 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG | Metagenome | Rhizosphere |
| 38 | 3300005435 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG | Metagenome | Rhizosphere |
| 39 | 3300005436 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG | Metagenome | Rhizosphere |
| 40 | 3300005437 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG | Metagenome | Rhizosphere |
| 41 | 3300005438 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-2 metaG | Metagenome | Rhizosphere |
| 42 | 3300005439 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG | Metagenome | Rhizosphere |
| 43 | 3300005440 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-3 metaG | Metagenome | Rhizosphere |
| 44 | 3300005441 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG | Metagenome | Rhizosphere |
| 45 | 3300005444 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-1 metaG | Metagenome | Rhizosphere |
| 46 | 3300005445 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-3 metaG | Metagenome | Rhizosphere |
| 47 | 3300005455 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG | Metagenome | Rhizosphere |
| 48 | 3300005456 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG | Metagenome | Rhizosphere |
| 49 | 3300005457 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG | Metagenome | Rhizosphere |
| 50 | 3300005458 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG | Metagenome | Rhizosphere |
| 51 | 3300005459 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 | Metagenome | Rhizosphere |
| 52 | 3300005466 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3L metaG | Metagenome | Rhizosphere |
| 53 | 3300005467 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG | Metagenome | Rhizosphere |
| 54 | 3300005468 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG | Metagenome | Rhizosphere |
| 55 | 3300005471 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-2 metaG | Metagenome | Rhizosphere |
| 56 | 3300005518 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-3 metaG | Metagenome | Rhizosphere |
| 57 | 3300005530 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG | Metagenome | Rhizosphere |
| 58 | 3300005535 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.2-3L metaG | Metagenome | Rhizosphere |
| 59 | 3300005536 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-50-1 metaG | Metagenome | Rhizosphere |
| 60 | 3300005539 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 | Metagenome | Rhizosphere |
| 61 | 3300005543 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG | Metagenome | Rhizosphere |
| 62 | 3300005544 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3L metaG | Metagenome | Rhizosphere |
| 63 | 3300005545 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-2 metaG | Metagenome | Rhizosphere |
| 64 | 3300005546 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-25-3 metaG | Metagenome | Rhizosphere |
| 65 | 3300005547 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K1-10-3 metaG | Metagenome | Rhizosphere |
| 66 | 3300005548 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG | Metagenome | Rhizosphere |
| 67 | 3300005549 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-25-2 metaG | Metagenome | Rhizosphere |
| 68 | 3300005563 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 | Metagenome | Rhizosphere |
| 69 | 3300005564 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG | Metagenome | Rhizosphere |
| 70 | 3300005577 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 | Metagenome | Rhizosphere |
| 71 | 3300005578 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 | Metagenome | Rhizosphere |
| 72 | 3300005614 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 | Metagenome | Rhizosphere |
| 73 | 3300005615 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-3 metaG | Metagenome | Rhizosphere |
| 74 | 3300005616 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 | Metagenome | Rhizosphere |
| 75 | 3300005617 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 | Metagenome | Rhizosphere |
| 76 | 3300005618 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 | Metagenome | Rhizosphere |
| 77 | 3300005718 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 | Metagenome | Rhizosphere |
| 78 | 3300005719 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 | Metagenome | Rhizosphere |
| 79 | 3300005834 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 | Metagenome | Rhizosphere |
| 80 | 3300005840 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 | Metagenome | Rhizosphere |
| 81 | 3300005841 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 | Metagenome | Rhizosphere |
| 82 | 3300005842 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 | Metagenome | Rhizosphere |
| 83 | 3300005843 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 | Metagenome | Rhizosphere |
| 84 | 3300005844 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 | Metagenome | Rhizosphere |
| 85 | 3300005937 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S3T2R1 | Metagenome | Rhizosphere |
| 86 | 3300005981 | Tabebuia heterophylla rhizosphere microbial communities from the University of Puerto Rico - S5T2R1 | Metagenome | Rhizosphere |
| 87 | 3300006028 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-3 metaG | Metagenome | Rhizosphere |
| 88 | 3300006038 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 | Metagenome | Endosphere |
| 89 | 3300006051 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 | Metagenome | Endosphere |
| 90 | 3300006163 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-1 metaG | Metagenome | Rhizosphere |
| 91 | 3300006173 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG | Metagenome | Rhizosphere |
| 92 | 3300006175 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG | Metagenome | Rhizosphere |
| 93 | 3300006237 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 94 | 3300006353 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 | Metagenome | Endosphere |
| 95 | 3300006358 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M7-2 | Metagenome | Rhizosphere |
| 96 | 3300006844 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD2 | Metagenome | Rhizosphere |
| 97 | 3300006846 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 | Metagenome | Rhizosphere |
| 98 | 3300006847 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 | Metagenome | Rhizosphere |
| 99 | 3300006852 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 | Metagenome | Rhizosphere |
| 100 | 3300006871 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 | Metagenome | Rhizosphere |
| 101 | 3300006880 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 | Metagenome | Rhizosphere |
| 102 | 3300006881 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 | Metagenome | Rhizosphere |
| 103 | 3300006914 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 | Metagenome | Rhizosphere |
| 104 | 3300006931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S2-2 (version 2) (version 2) | Metagenome | Rhizosphere |
| 105 | 3300007076 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 | Metagenome | Rhizosphere |
| 106 | 3300009093 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG | Metagenome | Rhizosphere |
| 107 | 3300009094 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 108 | 3300009098 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG | Metagenome | Rhizosphere |
| 109 | 3300009101 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG | Metagenome | Rhizosphere |
| 110 | 3300009147 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 (version 2) (version 2) | Metagenome | Rhizosphere |
| 111 | 3300009148 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG | Metagenome | Rhizosphere |
| 112 | 3300009174 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG | Metagenome | Rhizosphere |
| 113 | 3300009176 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG | Metagenome | Rhizosphere |
| 114 | 3300009177 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG | Metagenome | Rhizosphere |
| 115 | 3300009545 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG | Metagenome | Rhizosphere |
| 116 | 3300009551 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG | Metagenome | Rhizosphere |
| 117 | 3300009553 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG | Metagenome | Rhizosphere |
| 118 | 3300010375 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-4 metaG | Metagenome | Rhizosphere |
| 119 | 3300011119 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-4 metaG | Metagenome | Rhizosphere |
| 120 | 3300012483 | Arabidopsis rhizosphere microbial communities from North Carolina - M.Col.4.yng.040610 | Metagenome | Rhizosphere |
| 121 | 3300013100 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C6-5 metaG | Metagenome | Rhizosphere |
| 122 | 3300013102 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C4-5 metaG | Metagenome | Rhizosphere |
| 123 | 3300013104 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C3-5 metaG | Metagenome | Rhizosphere |
| 124 | 3300013105 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2-5 metaG | Metagenome | Rhizosphere |
| 125 | 3300013296 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M2-5 metaG | Metagenome | Rhizosphere |
| 126 | 3300013297 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M6-5 metaG | Metagenome | Rhizosphere |
| 127 | 3300013306 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S5-5 metaG | Metagenome | Rhizosphere |
| 128 | 3300013307 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C5-5 metaG | Metagenome | Rhizosphere |
| 129 | 3300013308 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M3-5 metaG | Metagenome | Rhizosphere |
| 130 | 3300014325 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S6-5 metaG | Metagenome | Rhizosphere |
| 131 | 3300014326 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S3-5 metaG | Metagenome | Rhizosphere |
| 132 | 3300014497 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-129_1 metaG | Metagenome | Rhizosphere |
| 133 | 3300014745 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M5-5 metaG | Metagenome | Rhizosphere |
| 134 | 3300014968 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S2-5 metaG | Metagenome | Rhizosphere |
| 135 | 3300014969 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4-5 metaG | Metagenome | Rhizosphere |
| 136 | 3300015261 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-104_1 MetaG | Metagenome | Rhizosphere |
| 137 | 3300015262 | Rhizosphere microbial communities from Sorghum bicolor, Mead, Nebraska, USA - 072115-113_1 MetaG | Metagenome | Rhizosphere |
| 138 | 3300017792 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - S4-5 metaG | Metagenome | Rhizosphere |
| 139 | 3300020070 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 140 | 3300020077 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5pm-1 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 141 | 3300020081 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-3 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 142 | 3300020082 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - Diel MetaT C5am-4 (Metagenome Metatranscriptome) (v2) (version 2) | Metatranscriptome | Rhizosphere |
| 143 | 3300025315 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA, with PhiX - S5 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 144 | 3300025321 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 145 | 3300025893 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 146 | 3300025898 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 147 | 3300025899 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 148 | 3300025900 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 149 | 3300025901 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - M4 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 150 | 3300025903 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 151 | 3300025904 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - C2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 152 | 3300025906 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 153 | 3300025907 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 154 | 3300025908 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 155 | 3300025909 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 156 | 3300025910 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 157 | 3300025911 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 158 | 3300025912 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C8-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 159 | 3300025913 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 160 | 3300025914 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 161 | 3300025915 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 162 | 3300025916 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 163 | 3300025917 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 164 | 3300025918 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 165 | 3300025919 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 166 | 3300025920 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 167 | 3300025921 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3B metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 168 | 3300025922 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-50-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 169 | 3300025923 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 170 | 3300025924 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 171 | 3300025925 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 172 | 3300025926 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 173 | 3300025927 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M5-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 174 | 3300025928 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 175 | 3300025929 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L8-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 176 | 3300025931 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 177 | 3300025932 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 178 | 3300025933 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C5-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 179 | 3300025934 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 180 | 3300025935 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 181 | 3300025936 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S2-3H metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 182 | 3300025937 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 183 | 3300025938 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 184 | 3300025939 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - LAR L11-2 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 185 | 3300025940 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 186 | 3300025941 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 187 | 3300025942 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 188 | 3300025944 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7.1-3L metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 189 | 3300025945 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 190 | 3300025949 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 191 | 3300025960 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M2-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 192 | 3300025961 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-4 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 193 | 3300025972 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S4-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 194 | 3300025981 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 195 | 3300025986 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S3-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 196 | 3300026023 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 197 | 3300026035 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S1-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 198 | 3300026041 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 199 | 3300026067 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS C6-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 200 | 3300026075 | Corn, switchgrass and miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS K5-10-1 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 201 | 3300026078 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 202 | 3300026088 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S6-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 203 | 3300026089 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Miscanthus M3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 204 | 3300026095 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 205 | 3300026116 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C7-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 206 | 3300026118 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S4-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 207 | 3300026121 | Miscanthus rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS M7-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 208 | 3300026142 | Corn rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Corn C2-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 209 | 3300027671 | Vadose zone soil microbial communities from the Eel River Critical Zone Observatory, Northern California, USA - Rivendell_Oct2014_Saprolite_2_DNA_Rhizosphere_1 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 210 | 3300027717 | Arabidopsis thaliana rhizosphere microbial communities from the Joint Genome Institute, USA, that affect carbon cycling - Endophyte Co-N S PM (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 211 | 3300027907 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 (SPAdes) (version 3) | Metagenome | Rhizosphere |
| 212 | 3300028379 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS S1-3 metaG (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 213 | 3300028380 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S5-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 214 | 3300028381 | Switchgrass rhizosphere microbial communities from Kellogg Biological Station, Michigan, USA - KBS Switchgrass S3-2 (SPAdes) (version 2) | Metagenome | Rhizosphere |
| 215 | 3300028556 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-22 metaG | Metagenome | Rhizosphere |
| 216 | 3300028558 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-24 metaG | Metagenome | Rhizosphere |
| 217 | 3300028563 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-8-24 metaG | Metagenome | Rhizosphere |
| 218 | 3300028653 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-25 metaG | Metagenome | Rhizosphere |
| 219 | 3300028654 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-12-22 metaG | Metagenome | Rhizosphere |
| 220 | 3300028666 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-21-19 metaG | Metagenome | Rhizosphere |
| 221 | 3300031241 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-14-20 metaG | Metagenome | Rhizosphere |
| 222 | 3300031247 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-CB2-25 metaG | Metagenome | Rhizosphere |
| 223 | 3300031344 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-5-22 metaG | Metagenome | Rhizosphere |
| 224 | 3300031595 | Rhizosphere microbial communities from Carex aquatilis grown in University of Washington, Seatle, WA, United States - 4-1-23 metaG | Metagenome | Rhizosphere |
| 225 | 3300031727 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S0-2_050615r3r5 | Metagenome | Rhizosphere |
| 226 | 3300031728 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_160517rDrC | Metagenome | Rhizosphere |
| 227 | 3300031731 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-C-1 | Metagenome | Rhizosphere |
| 228 | 3300031733 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S5-7_050615r2r1 | Metagenome | Rhizosphere |
| 229 | 3300031852 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-3 | Metagenome | Rhizosphere |
| 230 | 3300031903 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - 322HYB-O-1 | Metagenome | Rhizosphere |
| 231 | 3300032002 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-3 | Metagenome | Rhizosphere |
| 232 | 3300032004 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-O-3 | Metagenome | Rhizosphere |
| 233 | 3300032126 | Maize rhizosphere microbial communities from greenhouse at UC Davis, California, United States - DK15-C-2 | Metagenome | Rhizosphere |
| 234 | 3300032137 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SCrBrC | Metagenome | Rhizosphere |
| 235 | 3300034817 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_1 | Metagenome | Rhizosphere |
| 236 | 3300034818 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_3 | Metagenome | Rhizosphere |
| 237 | 3300035083 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_17 | Metagenome | Rhizosphere |
| 238 | 3300035089 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_2 | Metagenome | Rhizosphere |
| 239 | 3300035090 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_N_2 | Metagenome | Rhizosphere |
| 240 | 3300035113 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 241 | 3300035114 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_3 | Metagenome | Rhizosphere |
| 242 | 3300035115 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_NoN_11 | Metagenome | Rhizosphere |
| 243 | 3300035116 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_3 | Metagenome | Rhizosphere |
| 244 | 3300035117 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_1 | Metagenome | Rhizosphere |
| 245 | 3300035120 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_5 | Metagenome | Rhizosphere |
| 246 | 3300035121 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_3 | Metagenome | Rhizosphere |
| 247 | 3300035170 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_1 | Metagenome | Rhizosphere |
| 248 | 3300035171 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_4 | Metagenome | Rhizosphere |
| 249 | 3300035172 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_N_3 | Metagenome | Rhizosphere |
| 250 | 3300035241 | Populus rhizosphere microbial communities from soil in West Virginia, United States - WV94_WV_N_4 | Metagenome | Rhizosphere |
| 251 | 3300035398 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J0-2_050615r2r1 | Metagenome | Rhizosphere |
| 252 | 3300035410 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_12 | Metagenome | Rhizosphere |
| 253 | 3300035691 | Populus rhizosphere microbial communities from soil in West Virginia, United States - GW9791_WV_NoN_4 | Metagenome | Rhizosphere |
| 254 | 3300035695 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_19 | Metagenome | Rhizosphere |
| 255 | 3300035724 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_1 | Metagenome | Rhizosphere |
| 256 | 3300035725 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_N_8 | Metagenome | Rhizosphere |
| 257 | 3300036401 | Populus rhizosphere microbial communities from soil in Oregon, United States - WV94_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 258 | 3300036647 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - J_170502JArCrA | Metagenome | Rhizosphere |
| 259 | 3300036712 | Rhizosphere microbial communities from salt marsh grasses in Alabama, United States - S_170502SBrCrA | Metagenome | Rhizosphere |
| 260 | 3300037068 | Populus rhizosphere microbial communities from soil in Oregon, United States - GW9791_Oregon_NoN_16 | Metagenome | Rhizosphere |
| 261 | 3300037418 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_C SG_3 | Metagenome | Rhizosphere |
| 262 | 3300037466 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_A SG_1 | Metagenome | Rhizosphere |
| 263 | 3300037471 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Control_C SG_11 | Metagenome | Rhizosphere |
| 264 | 3300037853 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R8 v2 | Metagenome | Unclassified |
| 265 | 3300038443 | Enriched cells from switchgrass rhizosphere in EcoFAB chamber, Walnut Creek, California, United States - Plant-Nitrogen_D SG_4 | Metagenome | Rhizosphere |
| 266 | 3300039437 | Root-associated microbial communities from Barbacenia macrantha in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R9 v2 | Metagenome | Unclassified |
| 267 | 3300039453 | Rhizosphere microbial communities from Vellozia epidendroides in rupestrian grasslands, the National Park of Serra do Cipo, Brazil - RX_R3 v2 | Metagenome | Rhizosphere |
| 268 | 3300041408 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0113LE14Z062817_5195 | Metagenome | Rhizosphere |
| 269 | 3300041463 | Perennial ryegrass root microbial community from Lincoln, Canterbury, New Zealand - RGR18_7 MetaG | Metagenome | Rhizoplane |
| 270 | 3300041511 | White clover root microbial community from Lincoln, Canterbury, New Zealand - WCR18_12 MetaG | Metagenome | Unclassified |
| 271 | 3300042009 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z071817_5348 | Metagenome | Rhizosphere |
| 272 | 3300042011 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0220FE14Z062817_5204 | Metagenome | Rhizosphere |
| 273 | 3300042118 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913F_E14_082316_2156 | Metagenome | Rhizosphere |
| 274 | 3300042122 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0926D_E14_082716_2496 | Metagenome | Rhizosphere |
| 275 | 3300042142 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0913L_E14_072516_1610 | Metagenome | Rhizosphere |
| 276 | 3300042145 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - SB0430D_E14_080116_2581 | Metagenome | Rhizosphere |
| 277 | 3300042184 | Rhizosphere microbial communities from Sorghum plant, Scottsbluff, Nebraska, USA - SB0627D_E14_080116_2630 | Metagenome | Rhizosphere |
| 278 | 3300042439 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0612FE14Z071817_5363 | Metagenome | Rhizosphere |
| 279 | 3300042530 | Rhizosphere microbial communities from Sorghum plant, Central City, Nebraska, USA - CC0530L_E14_082316_2047 | Metagenome | Rhizosphere |
| 280 | 3300042876 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9GH_GED | Metagenome | Rhizosphere |
| 281 | 3300044656 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA1R | Metagenome | Rhizosphere |
| 282 | 3300044684 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC4R | Metagenome | Rhizosphere |
| 283 | 3300044693 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC2R | Metagenome | Rhizosphere |
| 284 | 3300044694 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC3R | Metagenome | Rhizosphere |
| 285 | 3300044719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC1R | Metagenome | Rhizosphere |
| 286 | 3300044842 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA2R | Metagenome | Rhizosphere |
| 287 | 3300044901 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COA4R | Metagenome | Rhizosphere |
| 288 | 3300045049 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - COC3R | Metagenome | Rhizosphere |
| 289 | 3300045051 | Rhizosphere soil microbial communities from rice plant in Newark, Delaware, United States - Rhiz_9BH_GED | Metagenome | Rhizosphere |
| 290 | 3300045836 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC4R | Metagenome | Rhizosphere |
| 291 | 3300045976 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSA4R | Metagenome | Rhizosphere |
| 292 | 3300046459 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-448-CL3_88_32 rhizosphere | Metagenome | Rhizosphere |
| 293 | 3300046463 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL3_75_7 rhizosphere | Metagenome | Rhizosphere |
| 294 | 3300046472 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL1_35_33 rhizosphere | Metagenome | Rhizosphere |
| 295 | 3300046473 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL3_85_26 rhizosphere | Metagenome | Rhizosphere |
| 296 | 3300046475 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-845-CL1_31_22 rhizosphere | Metagenome | Rhizosphere |
| 297 | 3300046492 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-13-Co3_21_57 rhizosphere | Metagenome | Rhizosphere |
| 298 | 3300046499 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL1_24_28 rhizosphere | Metagenome | Rhizosphere |
| 299 | 3300046511 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-331-CL2_55_18 rhizosphere | Metagenome | Rhizosphere |
| 300 | 3300046517 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-470-CL2_38_23 rhizosphere | Metagenome | Rhizosphere |
| 301 | 3300046518 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-56-Co1_22_4 rhizosphere | Metagenome | Rhizosphere |
| 302 | 3300046523 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-845-Co3_28_42 rhizosphere | Metagenome | Rhizosphere |
| 303 | 3300046529 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-866-CL2_50_11 rhizosphere | Metagenome | Rhizosphere |
| 304 | 3300046531 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-11047-CL2_41_30 rhizosphere | Metagenome | Rhizosphere |
| 305 | 3300046535 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL1_28_16 rhizosphere | Metagenome | Rhizosphere |
| 306 | 3300046536 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL2_62_7 rhizosphere | Metagenome | Rhizosphere |
| 307 | 3300046543 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-847-CL1_28_5 rhizosphere | Metagenome | Rhizosphere |
| 308 | 3300046615 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - BESC-866-Co3_27_48 rhizosphere | Metagenome | Rhizosphere |
| 309 | 3300046616 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co1_14_4 rhizosphere | Metagenome | Rhizosphere |
| 310 | 3300046674 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-133-CL3_93_10 rhizosphere | Metagenome | Rhizosphere |
| 311 | 3300046678 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-258-CL1_34_5 rhizosphere | Metagenome | Rhizosphere |
| 312 | 3300046679 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL2_50_4 rhizosphere | Metagenome | Rhizosphere |
| 313 | 3300046683 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-904-CL3_91_3 rhizosphere | Metagenome | Rhizosphere |
| 314 | 3300046684 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co2_44_8 rhizosphere | Metagenome | Rhizosphere |
| 315 | 3300046689 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-351-CL2_54_28 rhizosphere | Metagenome | Rhizosphere |
| 316 | 3300046690 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-388-CL3_88_3 rhizosphere | Metagenome | Rhizosphere |
| 317 | 3300046691 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - GW-4579-Co3_14_51 rhizosphere | Metagenome | Rhizosphere |
| 318 | 3300047315 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-13-CL2_39_29 rhizosphere | Metagenome | Rhizosphere |
| 319 | 3300047317 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-307-CL2_57_8 rhizosphere | Metagenome | Rhizosphere |
| 320 | 3300047321 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - GW-9591-CL3_98_5 rhizosphere | Metagenome | Rhizosphere |
| 321 | 3300047322 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWA-24-3-CL2_69_25 rhizosphere | Metagenome | Rhizosphere |
| 322 | 3300047323 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co3_23_35 rhizosphere | Metagenome | Rhizosphere |
| 323 | 3300047471 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - SKWD-24-1-CL2_58_25 rhizosphere | Metagenome | Rhizosphere |
| 324 | 3300047673 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-198-CL3_81_33 rhizosphere | Metagenome | Rhizosphere |
| 325 | 3300048088 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL2_56_7 rhizosphere | Metagenome | Rhizosphere |
| 326 | 3300048903 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7v unlabeled | Metagenome | Rhizoplane |
| 327 | 3300048904 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_7w unlabeled | Metagenome | Rhizoplane |
| 328 | 3300048905 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1c N15 | Metagenome | Rhizoplane |
| 329 | 3300048906 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_1d N15 | Metagenome | Rhizoplane |
| 330 | 3300048907 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2c N15 | Metagenome | Rhizoplane |
| 331 | 3300048908 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_2d N15 | Metagenome | Rhizoplane |
| 332 | 3300048909 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3c N15 | Metagenome | Rhizoplane |
| 333 | 3300048910 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - CIR rhizoplane_3d N15 | Metagenome | Rhizoplane |
| 334 | 3300048911 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8v unlabeled | Metagenome | Rhizoplane |
| 335 | 3300048912 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_8w unlabeled | Metagenome | Rhizoplane |
| 336 | 3300048913 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4c N15 | Metagenome | Rhizoplane |
| 337 | 3300048914 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_4d N15 | Metagenome | Rhizoplane |
| 338 | 3300048915 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5c N15 | Metagenome | Rhizoplane |
| 339 | 3300048916 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_5d N15 | Metagenome | Rhizoplane |
| 340 | 3300048917 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6c N15 | Metagenome | Rhizoplane |
| 341 | 3300048918 | Rhizoplane soil microbial communities from switchgrass plant in W.K. Kellogg Biological Station, Michigan, USA - KLW rhizoplane_6d N15 | Metagenome | Rhizoplane |
| 342 | 3300049460 | Rhizosphere soil microbial communities from poplar common garden site in Corvallis, Oregon, USA - SKWA-24-3-Co2_41_10 rhizosphere | Metagenome | Rhizosphere |
| 343 | 3300049568 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 344 | 3300049569 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 345 | 3300049570 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - WT_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 346 | 3300049572 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 347 | 3300049573 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 348 | 3300049574 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 349 | 3300049575 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L2_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 350 | 3300049576 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 351 | 3300049577 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 352 | 3300049578 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L3_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 353 | 3300049579 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 354 | 3300049580 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_01 | Metagenome | Rhizosphere |
| 355 | 3300049581 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 356 | 3300049582 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L5_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 357 | 3300049584 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_02 | Metagenome | Rhizosphere |
| 358 | 3300049585 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - WT_T2_FRAS_03 | Metagenome | Rhizosphere |
| 359 | 3300049586 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_01 | Metagenome | Rhizosphere |
| 360 | 3300049587 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_02 | Metagenome | Rhizosphere |
| 361 | 3300049588 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L1_T2_FRAS_03 | Metagenome | Rhizosphere |
| 362 | 3300049589 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_01 | Metagenome | Rhizosphere |
| 363 | 3300049590 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_02 | Metagenome | Rhizosphere |
| 364 | 3300049591 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L2_T2_FRAS_03 | Metagenome | Rhizosphere |
| 365 | 3300049592 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_01 | Metagenome | Rhizosphere |
| 366 | 3300049593 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_02 | Metagenome | Rhizosphere |
| 367 | 3300049661 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I5_B_0_control | Metagenome | Rhizosphere |
| 368 | 3300049668 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I4_B_2_drought | Metagenome | Rhizosphere |
| 369 | 3300049687 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - F14_A_4_drought | Metagenome | Rhizosphere |
| 370 | 3300049690 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - G13_A_4_drought | Metagenome | Rhizosphere |
| 371 | 3300049707 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - B5_B_2_drought | Metagenome | Rhizosphere |
| 372 | 3300049741 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_01 | Metagenome | Rhizosphere |
| 373 | 3300049742 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_02 | Metagenome | Rhizosphere |
| 374 | 3300049743 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L4_T2_FRAS_03 | Metagenome | Rhizosphere |
| 375 | 3300049744 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_02 | Metagenome | Rhizosphere |
| 376 | 3300049767 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - A15_B_4_drought | Metagenome | Rhizosphere |
| 377 | 3300049771 | Panicgrass rhizosphere microbial communities from growth chamber in LBNL, Berkeley, California, USA - I14_B_4_control | Metagenome | Rhizosphere |
| 378 | 3300049822 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L1_TR_GHRAS_02 | Metagenome | Rhizosphere |
| 379 | 3300049824 | Sugarcane rhizosphere microbial communities from a greenhouse in University of Florida, Reddick, FL, USA - L4_TR_GHRAS_03 | Metagenome | Rhizosphere |
| 380 | 3300050491 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-4 re-annotation | Metagenome | Endosphere |
| 381 | 3300050492 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. deltoides DD176-5 re-annotation | Metagenome | Endosphere |
| 382 | 3300050496 | Populus endosphere microbial communities from Tennessee, USA - Endosphere MetaG P. TD hybrid TD303-5 re-annotation | Metagenome | Endosphere |
| 383 | 3300050507 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD1 re-annotation | Metagenome | Rhizosphere |
| 384 | 3300050508 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD3 re-annotation | Metagenome | Rhizosphere |
| 385 | 3300050509 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD4 re-annotation | Metagenome | Rhizosphere |
| 386 | 3300050510 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. deltoides SRZDD5 re-annotation | Metagenome | Rhizosphere |
| 387 | 3300050511 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD1 re-annotation | Metagenome | Rhizosphere |
| 388 | 3300050512 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD3 re-annotation | Metagenome | Rhizosphere |
| 389 | 3300050513 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD4 re-annotation | Metagenome | Rhizosphere |
| 390 | 3300050514 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD5 re-annotation | Metagenome | Rhizosphere |
| 391 | 3300050515 | Populus rhizosphere microbial communities from Tennessee, USA - Rhizosphere MetaG P. TD hybrid SRZTD2 re-annotation | Metagenome | Rhizosphere |
| 392 | 3300053077 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-285-CL1_33_12 rhizosphere | Metagenome | Rhizosphere |
| 393 | 3300053084 | Rhizosphere soil microbial communities from poplar common garden site in Clatskanie, Oregon, USA - BESC-234-CL2_65_22 rhizosphere | Metagenome | Rhizosphere |
| 394 | 3300054114 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_03 | Metagenome | Rhizosphere |
| 395 | 3300060353 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L5_T2_FRAS_01 | Metagenome | Rhizosphere |
| 396 | 3300061719 | Rhizosphere microbial communities from millet plant in semiarid region near Thies, Senegal - CSC2R1 | Metagenome | Rhizosphere |
| 397 | 3300061734 | Sugarcane rhizosphere microbial communities from experimental field in University of Florida, Reddick, FL, USA - L3_T2_FRAS_03 (v2) (version 2) | Metagenome | Rhizosphere |
Type Distribution
| Type | Percentage (%) |
|---|---|
| Metagenomes | 99.4 |
| Metatranscriptomes | 0.6 |
| Isolates | 0 |
Biome Distribution
| Category | Percentage (%) |
|---|---|
| Aerial Root | 0 |
| Bulb | 0 |
| Endosphere | 0.53 |
| Nodule | 0 |
| Rhizoplane | 6.79 |
| Rhizosphere | 92.31 |
| Stem | 0 |
| Stem Tuber | 0 |
| Unclassified | 13.42 |
Taxonomy
Scaffolds
| Scaffold | Dataset | Taxonomy | Length | |
|---|---|---|---|---|
| 1 | Ga0265338_10040736 | 3300028800 | Bacteria | 4357 |
| 2 | MBSR1b_contig_12373578 | 2162886012 | Bacteria | 1021 |
| 3 | MBSR1b_contig_9591076 | 2162886012 | Bacteria | 1021 |
| 4 | JGI24743J22301_10087115 | 3300001991 | Unclassified | 663 |
| 5 | JGI24034J26672_10118024 | 3300002239 | Bacteria | 511 |
| 6 | JGI24751J29686_10004867 | 3300002459 | Bacteria | 2733 |
| 7 | rootH2_10104511 | 3300003320 | Bacteria | 1730 |
| 8 | rootL2_10068500 | 3300003322 | Unclassified | 3501 |
| 9 | Ga0065704_10124661 | 3300005289 | Bacteria | 1708 |
| 10 | Ga0065712_10000113 | 3300005290 | Bacteria | 191931 |
| 11 | Ga0065712_10112355 | 3300005290 | Bacteria | 1793 |
| 12 | Ga0065712_10176847 | 3300005290 | Bacteria | 1213 |
| 13 | Ga0065715_10094050 | 3300005293 | Bacteria | 4459 |
| 14 | Ga0065715_10103679 | 3300005293 | Bacteria | 3014 |
| 15 | Ga0065715_10112900 | 3300005293 | Bacteria | 2511 |
| 16 | Ga0065707_10000935 | 3300005295 | Bacteria | 9396 |
| 17 | Ga0065707_11019243 | 3300005295 | Unclassified | 534 |
| 18 | Ga0070658_10007310 | 3300005327 | Bacteria | 8921 |
| 19 | Ga0070658_10013304 | 3300005327 | Bacteria | 6603 |
| 20 | Ga0070658_10183542 | 3300005327 | Bacteria | 1761 |
| 21 | Ga0070658_10186550 | 3300005327 | Unclassified | 1747 |
| 22 | Ga0070658_10210289 | 3300005327 | Bacteria | 1643 |
| 23 | Ga0070676_10024646 | 3300005328 | Bacteria | 3391 |
| 24 | Ga0070676_10037433 | 3300005328 | Bacteria | 2798 |
| 25 | Ga0070676_10098943 | 3300005328 | Bacteria | 1799 |
| 26 | Ga0070676_10336987 | 3300005328 | Unclassified | 1033 |
| 27 | Ga0070683_100000756 | 3300005329 | Bacteria | 23693 |
| 28 | Ga0070683_100007927 | 3300005329 | Bacteria | 9006 |
| 29 | Ga0070683_100014671 | 3300005329 | Bacteria | 6862 |
| 30 | Ga0070683_100019192 | 3300005329 | Bacteria | 6071 |
| 31 | Ga0070683_100022422 | 3300005329 | Bacteria | 5644 |
| 32 | Ga0070683_100685353 | 3300005329 | Bacteria | 981 |
| 33 | Ga0070690_100025672 | 3300005330 | Bacteria | 3628 |
| 34 | Ga0070690_100128105 | 3300005330 | Bacteria | 1711 |
| 35 | Ga0070690_100143479 | 3300005330 | Bacteria | 1622 |
| 36 | Ga0070690_100148356 | 3300005330 | Bacteria | 1598 |
| 37 | Ga0070690_100598326 | 3300005330 | Bacteria | 837 |
| 38 | Ga0070690_100620365 | 3300005330 | Bacteria | 823 |
| 39 | Ga0070690_100776022 | 3300005330 | Unclassified | 742 |
| 40 | Ga0070690_101333133 | 3300005330 | Bacteria | 576 |
| 41 | Ga0070670_100014183 | 3300005331 | Bacteria | 6837 |
| 42 | Ga0070670_101090624 | 3300005331 | Bacteria | 728 |
| 43 | Ga0070670_101993141 | 3300005331 | Bacteria | 535 |
| 44 | Ga0068869_100026692 | 3300005334 | Bacteria | 4021 |
| 45 | Ga0068869_100032009 | 3300005334 | Bacteria | 3703 |
| 46 | Ga0068869_100032975 | 3300005334 | Bacteria | 3654 |
| 47 | Ga0068869_100038892 | 3300005334 | Bacteria | 3393 |
| 48 | Ga0068869_100052368 | 3300005334 | Bacteria | 2964 |
| 49 | Ga0068869_100081849 | 3300005334 | Bacteria | 2412 |
| 50 | Ga0070666_10000136 | 3300005335 | Bacteria | 50851 |
| 51 | Ga0070666_10034971 | 3300005335 | Bacteria | 3330 |
| 52 | Ga0070666_10091297 | 3300005335 | Bacteria | 2092 |
| 53 | Ga0070666_10107992 | 3300005335 | Bacteria | 1923 |
| 54 | Ga0070666_10911708 | 3300005335 | Bacteria | 650 |
| 55 | Ga0070680_100022389 | 3300005336 | Bacteria | 5034 |
| 56 | Ga0070680_100082597 | 3300005336 | Bacteria | 2652 |
| 57 | Ga0070680_100108847 | 3300005336 | Bacteria | 2306 |
| 58 | Ga0070680_100251405 | 3300005336 | Unclassified | 1494 |
| 59 | Ga0070680_100282881 | 3300005336 | Bacteria | 1405 |
| 60 | Ga0070680_100471255 | 3300005336 | Bacteria | 1073 |
| 61 | Ga0070680_101156844 | 3300005336 | Bacteria | 669 |
| 62 | Ga0070682_100002163 | 3300005337 | Bacteria | 10905 |
| 63 | Ga0070682_100006650 | 3300005337 | Bacteria | 6483 |
| 64 | Ga0070682_100012996 | 3300005337 | Bacteria | 4780 |
| 65 | Ga0070682_100084198 | 3300005337 | Bacteria | 2066 |
| 66 | Ga0070682_100997086 | 3300005337 | Unclassified | 695 |
| 67 | Ga0070682_101152765 | 3300005337 | Unclassified | 652 |
| 68 | Ga0070682_101340098 | 3300005337 | Bacteria | 609 |
| 69 | Ga0068868_100001217 | 3300005338 | Bacteria | 17690 |
| 70 | Ga0068868_100002119 | 3300005338 | Bacteria | 13676 |
| 71 | Ga0068868_100002890 | 3300005338 | Bacteria | 11920 |
| 72 | Ga0068868_100039811 | 3300005338 | Bacteria | 3655 |
| 73 | Ga0068868_100047731 | 3300005338 | Bacteria | 3357 |
| 74 | Ga0068868_100084109 | 3300005338 | Bacteria | 2555 |
| 75 | Ga0068868_100087614 | 3300005338 | Bacteria | 2504 |
| 76 | Ga0068868_100415232 | 3300005338 | Bacteria | 1164 |
| 77 | Ga0068868_101017659 | 3300005338 | Bacteria | 759 |
| 78 | Ga0070660_100001227 | 3300005339 | Bacteria | 17435 |
| 79 | Ga0070660_100031624 | 3300005339 | Bacteria | 3976 |
| 80 | Ga0070660_100039327 | 3300005339 | Bacteria | 3594 |
| 81 | Ga0070660_100083304 | 3300005339 | Bacteria | 2512 |
| 82 | Ga0070660_100722484 | 3300005339 | Bacteria | 836 |
| 83 | Ga0070689_100003801 | 3300005340 | Bacteria | 10118 |
| 84 | Ga0070689_100027513 | 3300005340 | Bacteria | 4288 |
| 85 | Ga0070689_100236840 | 3300005340 | Bacteria | 1502 |
| 86 | Ga0070689_100418114 | 3300005340 | Bacteria | 1136 |
| 87 | Ga0070689_101412425 | 3300005340 | Unclassified | 629 |
| 88 | Ga0070691_10018946 | 3300005341 | Bacteria | 3172 |
| 89 | Ga0070691_10061718 | 3300005341 | Bacteria | 1804 |
| 90 | Ga0070691_10491081 | 3300005341 | Bacteria | 708 |
| 91 | Ga0070691_10647404 | 3300005341 | Bacteria | 629 |
| 92 | Ga0070687_100129414 | 3300005343 | Bacteria | 1455 |
| 93 | Ga0070661_100012914 | 3300005344 | Bacteria | 5851 |
| 94 | Ga0070661_100019124 | 3300005344 | Bacteria | 4877 |
| 95 | Ga0070661_100057993 | 3300005344 | Bacteria | 2837 |
| 96 | Ga0070661_100245337 | 3300005344 | Bacteria | 1380 |
| 97 | Ga0070661_100288254 | 3300005344 | Bacteria | 1275 |
| 98 | Ga0070661_100462839 | 3300005344 | Bacteria | 1010 |
| 99 | Ga0070692_10021033 | 3300005345 | Bacteria | 3171 |
| 100 | Ga0070692_10089511 | 3300005345 | Bacteria | 1670 |
| 101 | Ga0070692_10091149 | 3300005345 | Bacteria | 1657 |
| 102 | Ga0070692_10573902 | 3300005345 | Bacteria | 742 |
| 103 | Ga0070668_100016124 | 3300005347 | Bacteria | 5592 |
| 104 | Ga0070668_100044409 | 3300005347 | Bacteria | 3409 |
| 105 | Ga0070668_102014085 | 3300005347 | Bacteria | 533 |
| 106 | Ga0070669_100002341 | 3300005353 | Bacteria | 13694 |
| 107 | Ga0070669_100183464 | 3300005353 | Bacteria | 1638 |
| 108 | Ga0070675_100187609 | 3300005354 | Bacteria | 1790 |
| 109 | Ga0070671_100033932 | 3300005355 | Bacteria | 4223 |
| 110 | Ga0070671_100143202 | 3300005355 | Bacteria | 2017 |
| 111 | Ga0070671_100288764 | 3300005355 | Bacteria | 1396 |
| 112 | Ga0070671_100726032 | 3300005355 | Bacteria | 863 |
| 113 | Ga0070671_101030889 | 3300005355 | Bacteria | 721 |
| 114 | Ga0070671_101261756 | 3300005355 | Bacteria | 651 |
| 115 | Ga0070674_100008505 | 3300005356 | Bacteria | 6114 |
| 116 | Ga0070673_100004418 | 3300005364 | Bacteria | 8897 |
| 117 | Ga0070673_100138657 | 3300005364 | Bacteria | 2050 |
| 118 | Ga0070673_100161477 | 3300005364 | Bacteria | 1906 |
| 119 | Ga0070673_101117298 | 3300005364 | Unclassified | 737 |
| 120 | Ga0070673_101382869 | 3300005364 | Bacteria | 662 |
| 121 | Ga0070688_100006966 | 3300005365 | Bacteria | 6074 |
| 122 | Ga0070688_100015715 | 3300005365 | Bacteria | 4314 |
| 123 | Ga0070688_100751627 | 3300005365 | Bacteria | 759 |
| 124 | Ga0070688_100888709 | 3300005365 | Unclassified | 702 |
| 125 | Ga0070659_100046133 | 3300005366 | Bacteria | 3416 |
| 126 | Ga0070659_100137645 | 3300005366 | Bacteria | 1986 |
| 127 | Ga0070659_100245284 | 3300005366 | Unclassified | 1483 |
| 128 | Ga0070659_100794275 | 3300005366 | Unclassified | 823 |
| 129 | Ga0070659_101035753 | 3300005366 | Bacteria | 721 |
| 130 | Ga0070659_101237699 | 3300005366 | Bacteria | 661 |
| 131 | Ga0070659_101264190 | 3300005366 | Bacteria | 654 |
| 132 | Ga0070667_100089334 | 3300005367 | Bacteria | 2646 |
| 133 | Ga0070667_100130792 | 3300005367 | Bacteria | 2190 |
| 134 | Ga0070667_100985799 | 3300005367 | Bacteria | 786 |
| 135 | Ga0070709_10414586 | 3300005434 | Bacteria | 1008 |
| 136 | Ga0070714_100174463 | 3300005435 | Bacteria | 1953 |
| 137 | Ga0070713_100367382 | 3300005436 | Unclassified | 1338 |
| 138 | Ga0070713_100468323 | 3300005436 | Bacteria | 1185 |
| 139 | Ga0070713_101678420 | 3300005436 | Bacteria | 617 |
| 140 | Ga0070710_10129794 | 3300005437 | Bacteria | 1535 |
| 141 | Ga0070701_10081377 | 3300005438 | Bacteria | 1754 |
| 142 | Ga0070701_10113017 | 3300005438 | Bacteria | 1520 |
| 143 | Ga0070711_100106905 | 3300005439 | Bacteria | 2047 |
| 144 | Ga0070711_100289918 | 3300005439 | Bacteria | 1298 |
| 145 | Ga0070711_100474563 | 3300005439 | Bacteria | 1027 |
| 146 | Ga0070711_100541280 | 3300005439 | Bacteria | 965 |
| 147 | Ga0070705_101389495 | 3300005440 | Bacteria | 585 |
| 148 | Ga0070705_101591641 | 3300005440 | Bacteria | 550 |
| 149 | Ga0070705_101647847 | 3300005440 | Unclassified | 541 |
| 150 | Ga0070700_100006579 | 3300005441 | Bacteria | 6222 |
| 151 | Ga0070700_100101318 | 3300005441 | Bacteria | 1898 |
| 152 | Ga0070700_100289339 | 3300005441 | Bacteria | 1191 |
| 153 | Ga0070700_100303712 | 3300005441 | Bacteria | 1166 |
| 154 | Ga0070694_100020121 | 3300005444 | Bacteria | 4252 |
| 155 | Ga0070694_100087631 | 3300005444 | Bacteria | 2178 |
| 156 | Ga0070694_100546548 | 3300005444 | Unclassified | 927 |
| 157 | Ga0070694_101525176 | 3300005444 | Bacteria | 566 |
| 158 | Ga0070708_100353401 | 3300005445 | Unclassified | 1385 |
| 159 | Ga0070708_100679513 | 3300005445 | Bacteria | 969 |
| 160 | Ga0070663_100005796 | 3300005455 | Bacteria | 7378 |
| 161 | Ga0070663_100052380 | 3300005455 | Bacteria | 2911 |
| 162 | Ga0070663_100320070 | 3300005455 | Bacteria | 1247 |
| 163 | Ga0070663_100534320 | 3300005455 | Unclassified | 978 |
| 164 | Ga0070663_101051467 | 3300005455 | Unclassified | 710 |
| 165 | Ga0070663_101468997 | 3300005455 | Bacteria | 605 |
| 166 | Ga0070678_100305629 | 3300005456 | Bacteria | 1353 |
| 167 | Ga0070678_100316190 | 3300005456 | Bacteria | 1332 |
| 168 | Ga0070678_100470981 | 3300005456 | Bacteria | 1103 |
| 169 | Ga0070678_101370888 | 3300005456 | Bacteria | 659 |
| 170 | Ga0070662_100002146 | 3300005457 | Bacteria | 12089 |
| 171 | Ga0070662_100054367 | 3300005457 | Bacteria | 2901 |
| 172 | Ga0070662_100115297 | 3300005457 | Bacteria | 2052 |
| 173 | Ga0070662_100656578 | 3300005457 | Bacteria | 885 |
| 174 | Ga0070662_100840129 | 3300005457 | Bacteria | 782 |
| 175 | Ga0070681_10002072 | 3300005458 | Bacteria | 18196 |
| 176 | Ga0070681_10003001 | 3300005458 | Bacteria | 15664 |
| 177 | Ga0070681_10060771 | 3300005458 | Bacteria | 3755 |
| 178 | Ga0070681_10099766 | 3300005458 | Bacteria | 2849 |
| 179 | Ga0070681_10200404 | 3300005458 | Unclassified | 1914 |
| 180 | Ga0070681_10236932 | 3300005458 | Bacteria | 1738 |
| 181 | Ga0070681_10314424 | 3300005458 | Bacteria | 1475 |
| 182 | Ga0070681_10878373 | 3300005458 | Bacteria | 815 |
| 183 | Ga0070681_11458330 | 3300005458 | Unclassified | 608 |
| 184 | Ga0068867_100009629 | 3300005459 | Bacteria | 6813 |
| 185 | Ga0068867_100031705 | 3300005459 | Bacteria | 3818 |
| 186 | Ga0068867_100597063 | 3300005459 | Unclassified | 962 |
| 187 | Ga0070685_10003709 | 3300005466 | Bacteria | 7730 |
| 188 | Ga0070685_10062521 | 3300005466 | Unclassified | 2183 |
| 189 | Ga0070685_10402902 | 3300005466 | Bacteria | 948 |
| 190 | Ga0070685_10742698 | 3300005466 | Bacteria | 719 |
| 191 | Ga0070706_101124700 | 3300005467 | Bacteria | 723 |
| 192 | Ga0070707_100492906 | 3300005468 | Bacteria | 1187 |
| 193 | Ga0070698_100043277 | 3300005471 | Bacteria | 4618 |
| 194 | Ga0070698_100611415 | 3300005471 | Bacteria | 1030 |
| 195 | Ga0070699_100368630 | 3300005518 | Unclassified | 1295 |
| 196 | Ga0070699_100433402 | 3300005518 | Bacteria | 1191 |
| 197 | Ga0070699_100515543 | 3300005518 | Unclassified | 1087 |
| 198 | Ga0070679_100011572 | 3300005530 | Bacteria | 8407 |
| 199 | Ga0070679_100023415 | 3300005530 | Bacteria | 6044 |
| 200 | Ga0070679_100114548 | 3300005530 | Bacteria | 2681 |
| 201 | Ga0070679_100131088 | 3300005530 | Bacteria | 2488 |
| 202 | Ga0070679_100164781 | 3300005530 | Bacteria | 2190 |
| 203 | Ga0070679_100240735 | 3300005530 | Bacteria | 1767 |
| 204 | Ga0070679_101843282 | 3300005530 | Bacteria | 553 |
| 205 | Ga0070684_100001840 | 3300005535 | Bacteria | 15538 |
| 206 | Ga0070684_100014693 | 3300005535 | Bacteria | 6351 |
| 207 | Ga0070684_100033044 | 3300005535 | Bacteria | 4414 |
| 208 | Ga0070684_100039896 | 3300005535 | Bacteria | 4040 |
| 209 | Ga0070684_100163098 | 3300005535 | Bacteria | 2023 |
| 210 | Ga0070684_100195335 | 3300005535 | Bacteria | 1842 |
| 211 | Ga0070684_100249375 | 3300005535 | Bacteria | 1623 |
| 212 | Ga0070697_100017534 | 3300005536 | Bacteria | 5635 |
| 213 | Ga0068853_100009840 | 3300005539 | Bacteria | 7715 |
| 214 | Ga0068853_100071772 | 3300005539 | Bacteria | 3016 |
| 215 | Ga0068853_100120312 | 3300005539 | Bacteria | 2341 |
| 216 | Ga0068853_102422881 | 3300005539 | Bacteria | 508 |
| 217 | Ga0070672_100045874 | 3300005543 | Bacteria | 3384 |
| 218 | Ga0070672_100188701 | 3300005543 | Bacteria | 1720 |
| 219 | Ga0070672_101255254 | 3300005543 | Bacteria | 661 |
| 220 | Ga0070672_101356262 | 3300005543 | Bacteria | 636 |
| 221 | Ga0070686_100022318 | 3300005544 | Bacteria | 3769 |
| 222 | Ga0070686_100069929 | 3300005544 | Bacteria | 2294 |
| 223 | Ga0070686_100129919 | 3300005544 | Bacteria | 1740 |
| 224 | Ga0070695_100070577 | 3300005545 | Bacteria | 2285 |
| 225 | Ga0070695_100126431 | 3300005545 | Bacteria | 1756 |
| 226 | Ga0070695_100309767 | 3300005545 | Bacteria | 1170 |
| 227 | Ga0070695_100626200 | 3300005545 | Bacteria | 847 |
| 228 | Ga0070695_100728138 | 3300005545 | Bacteria | 789 |
| 229 | Ga0070695_101044428 | 3300005545 | Bacteria | 666 |
| 230 | Ga0070696_100046824 | 3300005546 | Bacteria | 3000 |
| 231 | Ga0070696_100076775 | 3300005546 | Bacteria | 2359 |
| 232 | Ga0070696_100095761 | 3300005546 | Unclassified | 2120 |
| 233 | Ga0070696_100180676 | 3300005546 | Bacteria | 1565 |
| 234 | Ga0070696_100265491 | 3300005546 | Bacteria | 1303 |
| 235 | Ga0070696_100380141 | 3300005546 | Bacteria | 1100 |
| 236 | Ga0070696_101840826 | 3300005546 | Bacteria | 524 |
| 237 | Ga0070693_100023085 | 3300005547 | Bacteria | 3319 |
| 238 | Ga0070693_100038394 | 3300005547 | Bacteria | 2676 |
| 239 | Ga0070693_100040134 | 3300005547 | Bacteria | 2626 |
| 240 | Ga0070693_100131897 | 3300005547 | Bacteria | 1563 |
| 241 | Ga0070693_100165776 | 3300005547 | Bacteria | 1411 |
| 242 | Ga0070693_100291626 | 3300005547 | Bacteria | 1096 |
| 243 | Ga0070693_100302811 | 3300005547 | Unclassified | 1078 |
| 244 | Ga0070665_100135217 | 3300005548 | Bacteria | 2467 |
| 245 | Ga0070665_100439846 | 3300005548 | Bacteria | 1313 |
| 246 | Ga0070704_100019732 | 3300005549 | Bacteria | 4337 |
| 247 | Ga0070704_100256675 | 3300005549 | Bacteria | 1438 |
| 248 | Ga0070704_100616069 | 3300005549 | Unclassified | 955 |
| 249 | Ga0070704_100979334 | 3300005549 | Unclassified | 764 |
| 250 | Ga0068855_100009158 | 3300005563 | Bacteria | 11957 |
| 251 | Ga0068855_100025509 | 3300005563 | Bacteria | 7071 |
| 252 | Ga0068855_100103491 | 3300005563 | Unclassified | 3275 |
| 253 | Ga0068855_100363829 | 3300005563 | Bacteria | 1591 |
| 254 | Ga0068855_100387560 | 3300005563 | Unclassified | 1533 |
| 255 | Ga0070664_100059253 | 3300005564 | Bacteria | 3257 |
| 256 | Ga0070664_100130291 | 3300005564 | Bacteria | 2209 |
| 257 | Ga0070664_100180628 | 3300005564 | Bacteria | 1875 |
| 258 | Ga0070664_100254907 | 3300005564 | Bacteria | 1578 |
| 259 | Ga0070664_100255920 | 3300005564 | Bacteria | 1575 |
| 260 | Ga0070664_100448165 | 3300005564 | Bacteria | 1185 |
| 261 | Ga0070664_100703838 | 3300005564 | Bacteria | 941 |
| 262 | Ga0070664_100891139 | 3300005564 | Bacteria | 834 |
| 263 | Ga0070664_101020232 | 3300005564 | Unclassified | 778 |
| 264 | Ga0070664_101351071 | 3300005564 | Bacteria | 673 |
| 265 | Ga0068857_100018128 | 3300005577 | Bacteria | 6174 |
| 266 | Ga0068857_100027115 | 3300005577 | Bacteria | 5053 |
| 267 | Ga0068857_100056006 | 3300005577 | Bacteria | 3498 |
| 268 | Ga0068857_100225290 | 3300005577 | Bacteria | 1713 |
| 269 | Ga0068857_100579573 | 3300005577 | Bacteria | 1059 |
| 270 | Ga0068857_101132770 | 3300005577 | Bacteria | 756 |
| 271 | Ga0068854_100023491 | 3300005578 | Bacteria | 4212 |
| 272 | Ga0068854_100030966 | 3300005578 | Bacteria | 3715 |
| 273 | Ga0068854_100212288 | 3300005578 | Bacteria | 1527 |
| 274 | Ga0068854_100406016 | 3300005578 | Bacteria | 1128 |
| 275 | Ga0068854_100529969 | 3300005578 | Bacteria | 996 |
| 276 | Ga0068856_100020346 | 3300005614 | Bacteria | 6446 |
| 277 | Ga0068856_100102950 | 3300005614 | Bacteria | 2849 |
| 278 | Ga0068856_100126510 | 3300005614 | Bacteria | 2559 |
| 279 | Ga0068856_100183984 | 3300005614 | Bacteria | 2103 |
| 280 | Ga0068856_100264315 | 3300005614 | Bacteria | 1736 |
| 281 | Ga0068856_100378943 | 3300005614 | Bacteria | 1434 |
| 282 | Ga0068856_100475115 | 3300005614 | Bacteria | 1271 |
| 283 | Ga0068856_101744106 | 3300005614 | Unclassified | 635 |
| 284 | Ga0068856_101913277 | 3300005614 | Unclassified | 604 |
| 285 | Ga0068856_102200338 | 3300005614 | Unclassified | 560 |
| 286 | Ga0070702_100007942 | 3300005615 | Bacteria | 5111 |
| 287 | Ga0070702_100045524 | 3300005615 | Bacteria | 2483 |
| 288 | Ga0070702_100164409 | 3300005615 | Bacteria | 1437 |
| 289 | Ga0068852_100019433 | 3300005616 | Bacteria | 5377 |
| 290 | Ga0068852_100079034 | 3300005616 | Bacteria | 2912 |
| 291 | Ga0068852_100086783 | 3300005616 | Bacteria | 2790 |
| 292 | Ga0068852_100328693 | 3300005616 | Bacteria | 1487 |
| 293 | Ga0068852_101172593 | 3300005616 | Unclassified | 789 |
| 294 | Ga0068859_100006803 | 3300005617 | Bacteria | 11616 |
| 295 | Ga0068859_100020458 | 3300005617 | Bacteria | 6642 |
| 296 | Ga0068859_100037054 | 3300005617 | Bacteria | 4895 |
| 297 | Ga0068859_100109639 | 3300005617 | Bacteria | 2822 |
| 298 | Ga0068859_100138625 | 3300005617 | Bacteria | 2506 |
| 299 | Ga0068859_100368043 | 3300005617 | Bacteria | 1533 |
| 300 | Ga0068859_100600168 | 3300005617 | Bacteria | 1194 |
| 301 | Ga0068859_101588569 | 3300005617 | Bacteria | 722 |
| 302 | Ga0068859_103043436 | 3300005617 | Bacteria | 512 |
| 303 | Ga0068864_100012542 | 3300005618 | Bacteria | 7008 |
| 304 | Ga0068864_100069652 | 3300005618 | Bacteria | 3059 |
| 305 | Ga0068864_100093480 | 3300005618 | Bacteria | 2656 |
| 306 | Ga0068864_101249266 | 3300005618 | Bacteria | 742 |
| 307 | Ga0068864_101587905 | 3300005618 | Bacteria | 658 |
| 308 | Ga0068864_101744278 | 3300005618 | Bacteria | 628 |
| 309 | Ga0068864_101779571 | 3300005618 | Bacteria | 621 |
| 310 | Ga0068866_10009453 | 3300005718 | Bacteria | 4140 |
| 311 | Ga0068866_10089942 | 3300005718 | Bacteria | 1669 |
| 312 | Ga0068866_10265761 | 3300005718 | Bacteria | 1056 |
| 313 | Ga0068866_10411420 | 3300005718 | Bacteria | 875 |
| 314 | Ga0068861_100002524 | 3300005719 | Bacteria | 11961 |
| 315 | Ga0068861_100016124 | 3300005719 | Bacteria | 5279 |
| 316 | Ga0068861_100033820 | 3300005719 | Bacteria | 3775 |
| 317 | Ga0068861_100154429 | 3300005719 | Bacteria | 1886 |
| 318 | Ga0068851_10020578 | 3300005834 | Bacteria | 3195 |
| 319 | Ga0068851_10069325 | 3300005834 | Bacteria | 1821 |
| 320 | Ga0068851_10083378 | 3300005834 | Bacteria | 1673 |
| 321 | Ga0068851_10726306 | 3300005834 | Bacteria | 613 |
| 322 | Ga0068851_10820172 | 3300005834 | Unclassified | 579 |
| 323 | Ga0068870_10005385 | 3300005840 | Bacteria | 5584 |
| 324 | Ga0068870_10031247 | 3300005840 | Bacteria | 2697 |
| 325 | Ga0068870_10040121 | 3300005840 | Bacteria | 2426 |
| 326 | Ga0068870_10064706 | 3300005840 | Bacteria | 1976 |
| 327 | Ga0068870_10373218 | 3300005840 | Unclassified | 921 |
| 328 | Ga0068863_100014794 | 3300005841 | Bacteria | 7503 |
| 329 | Ga0068863_100064693 | 3300005841 | Bacteria | 3459 |
| 330 | Ga0068863_100103600 | 3300005841 | Unclassified | 2707 |
| 331 | Ga0068863_100160560 | 3300005841 | Bacteria | 2153 |
| 332 | Ga0068863_100258779 | 3300005841 | Bacteria | 1682 |
| 333 | Ga0068863_100281364 | 3300005841 | Bacteria | 1612 |
| 334 | Ga0068863_100413645 | 3300005841 | Unclassified | 1320 |
| 335 | Ga0068863_100614847 | 3300005841 | Bacteria | 1076 |
| 336 | Ga0068863_100865708 | 3300005841 | Bacteria | 903 |
| 337 | Ga0068858_100008344 | 3300005842 | Bacteria | 9966 |
| 338 | Ga0068858_100032781 | 3300005842 | Bacteria | 4825 |
| 339 | Ga0068858_100044309 | 3300005842 | Bacteria | 4124 |
| 340 | Ga0068858_100467125 | 3300005842 | Bacteria | 1217 |
| 341 | Ga0068860_100094217 | 3300005843 | Bacteria | 2854 |
| 342 | Ga0068860_100096034 | 3300005843 | Bacteria | 2825 |
| 343 | Ga0068860_100099475 | 3300005843 | Bacteria | 2774 |
| 344 | Ga0068860_100110208 | 3300005843 | Bacteria | 2631 |
| 345 | Ga0068860_100187295 | 3300005843 | Bacteria | 2002 |
| 346 | Ga0068860_100553346 | 3300005843 | Bacteria | 1153 |
| 347 | Ga0068860_101159819 | 3300005843 | Unclassified | 793 |
| 348 | Ga0068860_101524553 | 3300005843 | Bacteria | 690 |
| 349 | Ga0068862_100039699 | 3300005844 | Bacteria | 3999 |
| 350 | Ga0068862_100079235 | 3300005844 | Bacteria | 2847 |
| 351 | Ga0068862_100112131 | 3300005844 | Bacteria | 2395 |
| 352 | Ga0068862_100187036 | 3300005844 | Bacteria | 1862 |
| 353 | Ga0081455_10087984 | 3300005937 | Bacteria | 2526 |
| 354 | Ga0081455_10132010 | 3300005937 | Bacteria | 1952 |
| 355 | Ga0081455_10498030 | 3300005937 | Unclassified | 819 |
| 356 | Ga0081538_10000375 | 3300005981 | Bacteria | 51029 |
| 357 | Ga0081538_10011208 | 3300005981 | Bacteria | 7281 |
| 358 | Ga0081538_10095535 | 3300005981 | Bacteria | 1518 |
| 359 | Ga0070717_10001342 | 3300006028 | Bacteria | 16912 |
| 360 | Ga0070717_10057233 | 3300006028 | Bacteria | 3222 |
| 361 | Ga0070717_10130126 | 3300006028 | Bacteria | 2164 |
| 362 | Ga0070717_11224671 | 3300006028 | Unclassified | 683 |
| 363 | Ga0075365_10047793 | 3300006038 | Bacteria | 2813 |
| 364 | Ga0075364_10154452 | 3300006051 | Bacteria | 1547 |
| 365 | Ga0070715_10930395 | 3300006163 | Unclassified | 537 |
| 366 | Ga0070716_100024271 | 3300006173 | Bacteria | 3226 |
| 367 | Ga0070716_100190086 | 3300006173 | Bacteria | 1356 |
| 368 | Ga0070716_100383428 | 3300006173 | Unclassified | 1005 |
| 369 | Ga0070716_100384279 | 3300006173 | Bacteria | 1004 |
| 370 | Ga0070716_101067475 | 3300006173 | Bacteria | 642 |
| 371 | Ga0070712_100049839 | 3300006175 | Unclassified | 2910 |
| 372 | Ga0070712_100192541 | 3300006175 | Bacteria | 1597 |
| 373 | Ga0070712_100213561 | 3300006175 | Unclassified | 1523 |
| 374 | Ga0070712_100740401 | 3300006175 | Bacteria | 841 |
| 375 | Ga0097621_100009585 | 3300006237 | Bacteria | 7038 |
| 376 | Ga0097621_100060850 | 3300006237 | Bacteria | 3096 |
| 377 | Ga0097621_100247790 | 3300006237 | Bacteria | 1559 |
| 378 | Ga0097621_100297993 | 3300006237 | Bacteria | 1423 |
| 379 | Ga0097621_100679507 | 3300006237 | Bacteria | 946 |
| 380 | Ga0097621_100993107 | 3300006237 | Bacteria | 785 |
| 381 | Ga0097621_101017171 | 3300006237 | Bacteria | 776 |
| 382 | Ga0097621_101389752 | 3300006237 | Unclassified | 664 |
| 383 | Ga0075370_10198211 | 3300006353 | Bacteria | 1184 |
| 384 | Ga0068871_100011336 | 3300006358 | Bacteria | 6535 |
| 385 | Ga0068871_100013539 | 3300006358 | Bacteria | 6054 |
| 386 | Ga0068871_100017424 | 3300006358 | Bacteria | 5437 |
| 387 | Ga0068871_100061356 | 3300006358 | Bacteria | 3071 |
| 388 | Ga0068871_100154192 | 3300006358 | Bacteria | 1960 |
| 389 | Ga0068871_100290967 | 3300006358 | Bacteria | 1431 |
| 390 | Ga0068871_100326313 | 3300006358 | Bacteria | 1353 |
| 391 | Ga0068871_100387668 | 3300006358 | Unclassified | 1242 |
| 392 | Ga0068871_100398187 | 3300006358 | Unclassified | 1226 |
| 393 | Ga0068871_100447209 | 3300006358 | Bacteria | 1158 |
| 394 | Ga0068871_101016379 | 3300006358 | Bacteria | 772 |
| 395 | Ga0068871_101167333 | 3300006358 | Bacteria | 721 |
| 396 | Ga0075428_100043771 | 3300006844 | Bacteria | 4922 |
| 397 | Ga0075428_101820077 | 3300006844 | Unclassified | 634 |
| 398 | Ga0075430_100077424 | 3300006846 | Unclassified | 2787 |
| 399 | Ga0075430_100673608 | 3300006846 | Bacteria | 853 |
| 400 | Ga0075431_100354985 | 3300006847 | Bacteria | 1473 |
| 401 | Ga0075433_10250049 | 3300006852 | Bacteria | 1573 |
| 402 | Ga0075433_10552596 | 3300006852 | Unclassified | 1012 |
| 403 | Ga0075433_10651977 | 3300006852 | Bacteria | 923 |
| 404 | Ga0075434_100002797 | 3300006871 | Bacteria | 15461 |
| 405 | Ga0075434_100384352 | 3300006871 | Bacteria | 1425 |
| 406 | Ga0075434_100658256 | 3300006871 | Bacteria | 1065 |
| 407 | Ga0075434_100675064 | 3300006871 | Bacteria | 1051 |
| 408 | Ga0075434_101677908 | 3300006871 | Bacteria | 643 |
| 409 | Ga0075429_100003982 | 3300006880 | Bacteria | 12638 |
| 410 | Ga0068865_100021438 | 3300006881 | Bacteria | 4201 |
| 411 | Ga0068865_100029734 | 3300006881 | Bacteria | 3628 |
| 412 | Ga0068865_100038186 | 3300006881 | Bacteria | 3249 |
| 413 | Ga0068865_100369792 | 3300006881 | Bacteria | 1166 |
| 414 | Ga0075436_100002372 | 3300006914 | Bacteria | 13006 |
| 415 | Ga0075436_100004880 | 3300006914 | Bacteria | 9217 |
| 416 | Ga0075436_100007385 | 3300006914 | Bacteria | 7515 |
| 417 | Ga0075436_100011228 | 3300006914 | Bacteria | 6141 |
| 418 | Ga0075436_100163612 | 3300006914 | Unclassified | 1569 |
| 419 | Ga0075436_100306811 | 3300006914 | Bacteria | 1138 |
| 420 | Ga0075436_100636656 | 3300006914 | Bacteria | 787 |
| 421 | Ga0097620_100006804 | 3300006931 | Bacteria | 11616 |
| 422 | Ga0097620_100020457 | 3300006931 | Bacteria | 6642 |
| 423 | Ga0097620_100037052 | 3300006931 | Bacteria | 4895 |
| 424 | Ga0097620_100109642 | 3300006931 | Bacteria | 2822 |
| 425 | Ga0097620_100138623 | 3300006931 | Bacteria | 2506 |
| 426 | Ga0097620_100368058 | 3300006931 | Bacteria | 1533 |
| 427 | Ga0097620_100600045 | 3300006931 | Bacteria | 1194 |
| 428 | Ga0097620_101589031 | 3300006931 | Bacteria | 722 |
| 429 | Ga0097620_103042862 | 3300006931 | Bacteria | 512 |
| 430 | Ga0075435_100016937 | 3300007076 | Bacteria | 5503 |
| 431 | Ga0075435_100223745 | 3300007076 | Bacteria | 1598 |
| 432 | Ga0075435_100467805 | 3300007076 | Unclassified | 1088 |
| 433 | Ga0075435_100970409 | 3300007076 | Bacteria | 742 |
| 434 | Ga0075435_101210354 | 3300007076 | Bacteria | 661 |
| 435 | Ga0105240_10011749 | 3300009093 | Bacteria | 12166 |
| 436 | Ga0105240_10040284 | 3300009093 | Bacteria | 5976 |
| 437 | Ga0105240_10070460 | 3300009093 | Bacteria | 4325 |
| 438 | Ga0105240_10148480 | 3300009093 | Bacteria | 2794 |
| 439 | Ga0105240_10221035 | 3300009093 | Bacteria | 2207 |
| 440 | Ga0105240_11526110 | 3300009093 | Bacteria | 700 |
| 441 | Ga0111539_10001409 | 3300009094 | Bacteria | 32013 |
| 442 | Ga0111539_10206534 | 3300009094 | Bacteria | 2289 |
| 443 | Ga0111539_10245625 | 3300009094 | Bacteria | 2084 |
| 444 | Ga0105245_10001513 | 3300009098 | Bacteria | 21071 |
| 445 | Ga0105245_10002924 | 3300009098 | Bacteria | 15331 |
| 446 | Ga0105245_10036084 | 3300009098 | Bacteria | 4390 |
| 447 | Ga0105245_10276290 | 3300009098 | Unclassified | 1640 |
| 448 | Ga0105245_10391005 | 3300009098 | Bacteria | 1387 |
| 449 | Ga0105245_10476179 | 3300009098 | Bacteria | 1261 |
| 450 | Ga0105245_10480242 | 3300009098 | Bacteria | 1256 |
| 451 | Ga0105245_11255203 | 3300009098 | Bacteria | 789 |
| 452 | Ga0105247_10013833 | 3300009101 | Bacteria | 4838 |
| 453 | Ga0105247_10054695 | 3300009101 | Bacteria | 2463 |
| 454 | Ga0105247_10476505 | 3300009101 | Unclassified | 905 |
| 455 | Ga0105247_10514485 | 3300009101 | Unclassified | 874 |
| 456 | Ga0105247_10568540 | 3300009101 | Bacteria | 836 |
| 457 | Ga0105247_10591185 | 3300009101 | Bacteria | 822 |
| 458 | Ga0105247_11404744 | 3300009101 | Bacteria | 565 |
| 459 | Ga0114129_10003933 | 3300009147 | Bacteria | 20982 |
| 460 | Ga0114129_10129300 | 3300009147 | Bacteria | 3471 |
| 461 | Ga0114129_10576338 | 3300009147 | Unclassified | 1461 |
| 462 | Ga0105243_10035969 | 3300009148 | Bacteria | 3841 |
| 463 | Ga0105243_10573871 | 3300009148 | Bacteria | 1082 |
| 464 | Ga0105243_11463467 | 3300009148 | Bacteria | 706 |
| 465 | Ga0105241_10006639 | 3300009174 | Bacteria | 8526 |
| 466 | Ga0105241_10012006 | 3300009174 | Bacteria | 6361 |
| 467 | Ga0105241_10168613 | 3300009174 | Bacteria | 1806 |
| 468 | Ga0105241_10181883 | 3300009174 | Bacteria | 1744 |
| 469 | Ga0105241_10341915 | 3300009174 | Bacteria | 1297 |
| 470 | Ga0105241_10471002 | 3300009174 | Unclassified | 1115 |
| 471 | Ga0105241_11183544 | 3300009174 | Bacteria | 723 |
| 472 | Ga0105241_12287859 | 3300009174 | Unclassified | 538 |
| 473 | Ga0105242_10003716 | 3300009176 | Bacteria | 11867 |
| 474 | Ga0105242_10012411 | 3300009176 | Bacteria | 6560 |
| 475 | Ga0105242_10093547 | 3300009176 | Bacteria | 2534 |
| 476 | Ga0105242_10103660 | 3300009176 | Bacteria | 2414 |
| 477 | Ga0105242_10405217 | 3300009176 | Bacteria | 1274 |
| 478 | Ga0105242_11583309 | 3300009176 | Bacteria | 688 |
| 479 | Ga0105248_10011119 | 3300009177 | Bacteria | 9933 |
| 480 | Ga0105248_10020606 | 3300009177 | Bacteria | 7308 |
| 481 | Ga0105248_10136810 | 3300009177 | Bacteria | 2764 |
| 482 | Ga0105248_10234317 | 3300009177 | Bacteria | 2067 |
| 483 | Ga0105248_10276428 | 3300009177 | Bacteria | 1891 |
| 484 | Ga0105248_10306201 | 3300009177 | Bacteria | 1789 |
| 485 | Ga0105248_10685070 | 3300009177 | Unclassified | 1156 |
| 486 | Ga0105248_11057000 | 3300009177 | Bacteria | 917 |
| 487 | Ga0105237_10006860 | 3300009545 | Unclassified | 12551 |
| 488 | Ga0105237_10179521 | 3300009545 | Bacteria | 2117 |
| 489 | Ga0105237_10469140 | 3300009545 | Bacteria | 1265 |
| 490 | Ga0105237_10830370 | 3300009545 | Viruses | 931 |
| 491 | Ga0105237_10927222 | 3300009545 | Bacteria | 878 |
| 492 | Ga0105237_12038217 | 3300009545 | Unclassified | 583 |
| 493 | Ga0105238_10011190 | 3300009551 | Bacteria | 9025 |
| 494 | Ga0105238_10138546 | 3300009551 | Bacteria | 2410 |
| 495 | Ga0105238_10249073 | 3300009551 | Bacteria | 1754 |
| 496 | Ga0105238_10291559 | 3300009551 | Bacteria | 1614 |
| 497 | Ga0105238_11291305 | 3300009551 | Unclassified | 756 |
| 498 | Ga0105238_11961666 | 3300009551 | Unclassified | 619 |
| 499 | Ga0105238_13021246 | 3300009551 | Bacteria | 505 |
| 500 | Ga0105249_10066414 | 3300009553 | Bacteria | 3321 |
| 501 | Ga0105249_10117880 | 3300009553 | Bacteria | 2519 |
| 502 | Ga0105249_10121750 | 3300009553 | Bacteria | 2480 |
| 503 | Ga0105249_10158706 | 3300009553 | Bacteria | 2184 |
| 504 | Ga0105249_11057291 | 3300009553 | Bacteria | 881 |
| 505 | Ga0105249_12991532 | 3300009553 | Unclassified | 543 |
| 506 | Ga0105239_10016536 | 3300010375 | Bacteria | 8156 |
| 507 | Ga0105239_10209622 | 3300010375 | Bacteria | 2184 |
| 508 | Ga0105239_10544240 | 3300010375 | Unclassified | 1322 |
| 509 | Ga0105239_10726215 | 3300010375 | Bacteria | 1136 |
| 510 | Ga0105239_10936831 | 3300010375 | Bacteria | 994 |
| 511 | Ga0105239_11707894 | 3300010375 | Unclassified | 729 |
| 512 | Ga0105239_12183591 | 3300010375 | Bacteria | 644 |
| 513 | Ga0105239_12363716 | 3300010375 | Unclassified | 619 |
| 514 | Ga0105246_10003229 | 3300011119 | Bacteria | 9894 |
| 515 | Ga0105246_10013497 | 3300011119 | Bacteria | 5122 |
| 516 | Ga0105246_10106621 | 3300011119 | Bacteria | 2050 |
| 517 | Ga0105246_10119425 | 3300011119 | Bacteria | 1951 |
| 518 | Ga0105246_10201895 | 3300011119 | Unclassified | 1546 |
| 519 | Ga0157337_1003496 | 3300012483 | Bacteria | 954 |
| 520 | Ga0157373_10006408 | 3300013100 | Bacteria | 8793 |
| 521 | Ga0157373_10010571 | 3300013100 | Bacteria | 6790 |
| 522 | Ga0157373_10673671 | 3300013100 | Bacteria | 757 |
| 523 | Ga0157371_10002909 | 3300013102 | Bacteria | 16009 |
| 524 | Ga0157371_10015099 | 3300013102 | Bacteria | 5805 |
| 525 | Ga0157371_10217440 | 3300013102 | Bacteria | 1372 |
| 526 | Ga0157371_10624601 | 3300013102 | Bacteria | 803 |
| 527 | Ga0157371_10985387 | 3300013102 | Unclassified | 642 |
| 528 | Ga0157370_10067220 | 3300013104 | Bacteria | 3388 |
| 529 | Ga0157370_10596929 | 3300013104 | Bacteria | 1011 |
| 530 | Ga0157370_10785521 | 3300013104 | Bacteria | 867 |
| 531 | Ga0157370_10820473 | 3300013104 | Bacteria | 846 |
| 532 | Ga0157370_11323731 | 3300013104 | Archaea | 649 |
| 533 | Ga0157370_11633896 | 3300013104 | Unclassified | 579 |
| 534 | Ga0157369_10051967 | 3300013105 | Bacteria | 4434 |
| 535 | Ga0157369_10056671 | 3300013105 | Bacteria | 4228 |
| 536 | Ga0157369_10063704 | 3300013105 | Bacteria | 3972 |
| 537 | Ga0157369_10206937 | 3300013105 | Unclassified | 2058 |
| 538 | Ga0157369_10250577 | 3300013105 | Bacteria | 1848 |
| 539 | Ga0157374_10014124 | 3300013296 | Bacteria | 6980 |
| 540 | Ga0157374_10074767 | 3300013296 | Bacteria | 3200 |
| 541 | Ga0157374_10079953 | 3300013296 | Bacteria | 3099 |
| 542 | Ga0157374_10088131 | 3300013296 | Bacteria | 2955 |
| 543 | Ga0157374_10222367 | 3300013296 | Bacteria | 1853 |
| 544 | Ga0157374_10246146 | 3300013296 | Unclassified | 1759 |
| 545 | Ga0157374_10300959 | 3300013296 | Bacteria | 1587 |
| 546 | Ga0157374_10303400 | 3300013296 | Bacteria | 1580 |
| 547 | Ga0157374_12342562 | 3300013296 | Bacteria | 561 |
| 548 | Ga0157374_12819007 | 3300013296 | Bacteria | 514 |
| 549 | Ga0157378_10000695 | 3300013297 | Bacteria | 31659 |
| 550 | Ga0157378_10003297 | 3300013297 | Bacteria | 14371 |
| 551 | Ga0157378_10015002 | 3300013297 | Bacteria | 6784 |
| 552 | Ga0157378_10173174 | 3300013297 | Unclassified | 2026 |
| 553 | Ga0157378_10278142 | 3300013297 | Bacteria | 1612 |
| 554 | Ga0157378_10372478 | 3300013297 | Bacteria | 1400 |
| 555 | Ga0157378_11361682 | 3300013297 | Unclassified | 752 |
| 556 | Ga0157378_12122184 | 3300013297 | Bacteria | 613 |
| 557 | Ga0163162_10002605 | 3300013306 | Bacteria | 17096 |
| 558 | Ga0163162_10032931 | 3300013306 | Bacteria | 5147 |
| 559 | Ga0163162_10038936 | 3300013306 | Bacteria | 4747 |
| 560 | Ga0163162_10081380 | 3300013306 | Bacteria | 3309 |
| 561 | Ga0163162_10082742 | 3300013306 | Bacteria | 3282 |
| 562 | Ga0163162_10115603 | 3300013306 | Bacteria | 2783 |
| 563 | Ga0163162_10213930 | 3300013306 | Bacteria | 2058 |
| 564 | Ga0163162_10371461 | 3300013306 | Bacteria | 1563 |
| 565 | Ga0163162_10913531 | 3300013306 | Bacteria | 990 |
| 566 | Ga0163162_11643941 | 3300013306 | Bacteria | 733 |
| 567 | Ga0163162_12944152 | 3300013306 | Bacteria | 548 |
| 568 | Ga0163162_13398806 | 3300013306 | Unclassified | 508 |
| 569 | Ga0157372_10028501 | 3300013307 | Bacteria | 6094 |
| 570 | Ga0157372_10168540 | 3300013307 | Bacteria | 2533 |
| 571 | Ga0157372_10487444 | 3300013307 | Bacteria | 1437 |
| 572 | Ga0157372_10500589 | 3300013307 | Bacteria | 1417 |
| 573 | Ga0157372_10730593 | 3300013307 | Bacteria | 1151 |
| 574 | Ga0157372_11376139 | 3300013307 | Bacteria | 814 |
| 575 | Ga0157372_11825520 | 3300013307 | Unclassified | 699 |
| 576 | Ga0157372_12418254 | 3300013307 | Unclassified | 603 |
| 577 | Ga0157375_10035022 | 3300013308 | Bacteria | 4788 |
| 578 | Ga0157375_10112524 | 3300013308 | Bacteria | 2822 |
| 579 | Ga0157375_10119818 | 3300013308 | Bacteria | 2740 |
| 580 | Ga0157375_10180998 | 3300013308 | Bacteria | 2259 |
| 581 | Ga0157375_10224039 | 3300013308 | Bacteria | 2040 |
| 582 | Ga0157375_10251474 | 3300013308 | Bacteria | 1928 |
| 583 | Ga0157375_10261771 | 3300013308 | Bacteria | 1891 |
| 584 | Ga0157375_10467400 | 3300013308 | Bacteria | 1427 |
| 585 | Ga0157375_10594108 | 3300013308 | Bacteria | 1266 |
| 586 | Ga0157375_10717993 | 3300013308 | Bacteria | 1152 |
| 587 | Ga0163163_10004114 | 3300014325 | Bacteria | 12403 |
| 588 | Ga0163163_10015926 | 3300014325 | Bacteria | 6966 |
| 589 | Ga0163163_10024238 | 3300014325 | Bacteria | 5773 |
| 590 | Ga0163163_10031497 | 3300014325 | Bacteria | 5119 |
| 591 | Ga0163163_10127654 | 3300014325 | Bacteria | 2581 |
| 592 | Ga0163163_10234738 | 3300014325 | Bacteria | 1883 |
| 593 | Ga0163163_10531144 | 3300014325 | Unclassified | 1239 |
| 594 | Ga0163163_10553239 | 3300014325 | Bacteria | 1213 |
| 595 | Ga0157380_10002195 | 3300014326 | Bacteria | 13119 |
| 596 | Ga0157380_10005146 | 3300014326 | Bacteria | 9138 |
| 597 | Ga0182008_10001761 | 3300014497 | Bacteria | 14190 |
| 598 | Ga0182008_10117712 | 3300014497 | Bacteria | 1319 |
| 599 | Ga0157377_10000703 | 3300014745 | Bacteria | 13790 |
| 600 | Ga0157377_10003516 | 3300014745 | Bacteria | 7088 |
| 601 | Ga0157377_10034483 | 3300014745 | Bacteria | 2769 |
| 602 | Ga0157377_10234401 | 3300014745 | Bacteria | 1182 |
| 603 | Ga0157377_10656138 | 3300014745 | Unclassified | 756 |
| 604 | Ga0157377_10750776 | 3300014745 | Bacteria | 714 |
| 605 | Ga0157379_10007733 | 3300014968 | Bacteria | 9308 |
| 606 | Ga0157379_10107212 | 3300014968 | Bacteria | 2508 |
| 607 | Ga0157379_10275774 | 3300014968 | Bacteria | 1530 |
| 608 | Ga0157379_10853173 | 3300014968 | Bacteria | 862 |
| 609 | Ga0157379_11208038 | 3300014968 | Bacteria | 727 |
| 610 | Ga0157376_10091623 | 3300014969 | Bacteria | 2634 |
| 611 | Ga0157376_10146029 | 3300014969 | Bacteria | 2128 |
| 612 | Ga0157376_10173658 | 3300014969 | Unclassified | 1964 |
| 613 | Ga0157376_10229379 | 3300014969 | Bacteria | 1724 |
| 614 | Ga0157376_10518957 | 3300014969 | Bacteria | 1174 |
| 615 | Ga0157376_10537068 | 3300014969 | Bacteria | 1155 |
| 616 | Ga0157376_11602388 | 3300014969 | Bacteria | 685 |
| 617 | Ga0157376_11607296 | 3300014969 | Bacteria | 684 |
| 618 | Ga0157376_11711350 | 3300014969 | Bacteria | 664 |
| 619 | Ga0182006_1169850 | 3300015261 | Unclassified | 731 |
| 620 | Ga0182007_10067860 | 3300015262 | Bacteria | 1168 |
| 621 | Ga0163161_10001109 | 3300017792 | Bacteria | 20362 |
| 622 | Ga0163161_10326170 | 3300017792 | Bacteria | 1215 |
| 623 | Ga0163161_11380973 | 3300017792 | Bacteria | 615 |
| 624 | Ga0206356_11077341 | 3300020070 | Bacteria | 626 |
| 625 | Ga0206351_10706853 | 3300020077 | Bacteria | 668 |
| 626 | Ga0206354_10157849 | 3300020081 | Bacteria | 871 |
| 627 | Ga0206354_11090343 | 3300020081 | Bacteria | 549 |
| 628 | Ga0206354_11457533 | 3300020081 | Bacteria | 575 |
| 629 | Ga0206353_10520053 | 3300020082 | Unclassified | 1770 |
| 630 | Ga0206353_10525352 | 3300020082 | Bacteria | 5207 |
| 631 | Ga0206353_11801339 | 3300020082 | Bacteria | 774 |
| 632 | Ga0207697_10005260 | 3300025315 | Bacteria | 6032 |
| 633 | Ga0207656_10008994 | 3300025321 | Bacteria | 3701 |
| 634 | Ga0207656_10020340 | 3300025321 | Bacteria | 2637 |
| 635 | Ga0207656_10024011 | 3300025321 | Bacteria | 2461 |
| 636 | Ga0207682_10133448 | 3300025893 | Bacteria | 1110 |
| 637 | Ga0207692_10554920 | 3300025898 | Bacteria | 734 |
| 638 | Ga0207692_10814260 | 3300025898 | Bacteria | 611 |
| 639 | Ga0207642_10003430 | 3300025899 | Bacteria | 5005 |
| 640 | Ga0207642_10038221 | 3300025899 | Bacteria | 2075 |
| 641 | Ga0207642_10745672 | 3300025899 | Unclassified | 620 |
| 642 | Ga0207710_10014060 | 3300025900 | Bacteria | 3371 |
| 643 | Ga0207710_10665647 | 3300025900 | Unclassified | 545 |
| 644 | Ga0207688_10000393 | 3300025901 | Bacteria | 20500 |
| 645 | Ga0207688_10004736 | 3300025901 | Bacteria | 7412 |
| 646 | Ga0207688_10023107 | 3300025901 | Bacteria | 3402 |
| 647 | Ga0207688_10998545 | 3300025901 | Unclassified | 529 |
| 648 | Ga0207680_10005965 | 3300025903 | Bacteria | 5853 |
| 649 | Ga0207680_10062010 | 3300025903 | Bacteria | 2282 |
| 650 | Ga0207680_10111136 | 3300025903 | Bacteria | 1777 |
| 651 | Ga0207647_10002678 | 3300025904 | Bacteria | 13433 |
| 652 | Ga0207699_10020840 | 3300025906 | Bacteria | 3522 |
| 653 | Ga0207699_10024951 | 3300025906 | Unclassified | 3276 |
| 654 | Ga0207699_10490367 | 3300025906 | Bacteria | 886 |
| 655 | Ga0207645_10000019 | 3300025907 | Bacteria | 110182 |
| 656 | Ga0207645_10050408 | 3300025907 | Bacteria | 2658 |
| 657 | Ga0207645_10332038 | 3300025907 | Unclassified | 1015 |
| 658 | Ga0207643_10000432 | 3300025908 | Bacteria | 27650 |
| 659 | Ga0207643_10017042 | 3300025908 | Bacteria | 3967 |
| 660 | Ga0207643_10056440 | 3300025908 | Bacteria | 2234 |
| 661 | Ga0207643_10089529 | 3300025908 | Bacteria | 1792 |
| 662 | Ga0207643_10097530 | 3300025908 | Bacteria | 1720 |
| 663 | Ga0207643_10259783 | 3300025908 | Bacteria | 1072 |
| 664 | Ga0207643_10909607 | 3300025908 | Unclassified | 570 |
| 665 | Ga0207705_10046456 | 3300025909 | Bacteria | 3120 |
| 666 | Ga0207705_10063567 | 3300025909 | Bacteria | 2667 |
| 667 | Ga0207705_10145141 | 3300025909 | Bacteria | 1775 |
| 668 | Ga0207705_10542997 | 3300025909 | Unclassified | 903 |
| 669 | Ga0207684_11389414 | 3300025910 | Unclassified | 575 |
| 670 | Ga0207654_10009502 | 3300025911 | Bacteria | 4940 |
| 671 | Ga0207654_10013219 | 3300025911 | Bacteria | 4243 |
| 672 | Ga0207654_10134217 | 3300025911 | Bacteria | 1570 |
| 673 | Ga0207654_10254141 | 3300025911 | Bacteria | 1179 |
| 674 | Ga0207654_10269338 | 3300025911 | Bacteria | 1148 |
| 675 | Ga0207707_10002237 | 3300025912 | Bacteria | 17490 |
| 676 | Ga0207707_10014753 | 3300025912 | Bacteria | 6808 |
| 677 | Ga0207707_10053394 | 3300025912 | Bacteria | 3518 |
| 678 | Ga0207707_10106509 | 3300025912 | Bacteria | 2451 |
| 679 | Ga0207707_10343048 | 3300025912 | Bacteria | 1288 |
| 680 | Ga0207707_11014909 | 3300025912 | Bacteria | 680 |
| 681 | Ga0207695_10079393 | 3300025913 | Bacteria | 3326 |
| 682 | Ga0207695_10377001 | 3300025913 | Bacteria | 1304 |
| 683 | Ga0207695_10835226 | 3300025913 | Bacteria | 801 |
| 684 | Ga0207671_10208720 | 3300025914 | Bacteria | 1527 |
| 685 | Ga0207671_10325025 | 3300025914 | Unclassified | 1218 |
| 686 | Ga0207671_10473588 | 3300025914 | Unclassified | 998 |
| 687 | Ga0207693_10021046 | 3300025915 | Bacteria | 5183 |
| 688 | Ga0207693_10176204 | 3300025915 | Unclassified | 1683 |
| 689 | Ga0207693_10263793 | 3300025915 | Bacteria | 1350 |
| 690 | Ga0207693_10276855 | 3300025915 | Bacteria | 1315 |
| 691 | Ga0207663_10169935 | 3300025916 | Bacteria | 1547 |
| 692 | Ga0207663_10879560 | 3300025916 | Bacteria | 716 |
| 693 | Ga0207660_10045160 | 3300025917 | Bacteria | 3102 |
| 694 | Ga0207660_10055513 | 3300025917 | Bacteria | 2831 |
| 695 | Ga0207660_10056915 | 3300025917 | Bacteria | 2800 |
| 696 | Ga0207660_10507836 | 3300025917 | Bacteria | 978 |
| 697 | Ga0207660_10953458 | 3300025917 | Unclassified | 700 |
| 698 | Ga0207662_10000715 | 3300025918 | Bacteria | 15165 |
| 699 | Ga0207662_10368848 | 3300025918 | Bacteria | 968 |
| 700 | Ga0207657_10000731 | 3300025919 | Bacteria | 34878 |
| 701 | Ga0207657_10005013 | 3300025919 | Bacteria | 13905 |
| 702 | Ga0207657_10009782 | 3300025919 | Bacteria | 9612 |
| 703 | Ga0207657_10028465 | 3300025919 | Bacteria | 5097 |
| 704 | Ga0207657_10228610 | 3300025919 | Bacteria | 1488 |
| 705 | Ga0207657_10441906 | 3300025919 | Bacteria | 1021 |
| 706 | Ga0207657_10834452 | 3300025919 | Bacteria | 712 |
| 707 | Ga0207657_10930788 | 3300025919 | Bacteria | 669 |
| 708 | Ga0207649_10000188 | 3300025920 | Bacteria | 50655 |
| 709 | Ga0207649_10004372 | 3300025920 | Bacteria | 7668 |
| 710 | Ga0207649_10232878 | 3300025920 | Bacteria | 1318 |
| 711 | Ga0207649_10330866 | 3300025920 | Unclassified | 1122 |
| 712 | Ga0207649_10730396 | 3300025920 | Bacteria | 769 |
| 713 | Ga0207652_10018886 | 3300025921 | Bacteria | 5659 |
| 714 | Ga0207652_10024777 | 3300025921 | Bacteria | 4980 |
| 715 | Ga0207652_10032420 | 3300025921 | Bacteria | 4392 |
| 716 | Ga0207652_10153892 | 3300025921 | Bacteria | 2060 |
| 717 | Ga0207652_10650400 | 3300025921 | Bacteria | 943 |
| 718 | Ga0207646_10120585 | 3300025922 | Bacteria | 2356 |
| 719 | Ga0207681_10013593 | 3300025923 | Bacteria | 5040 |
| 720 | Ga0207681_10022406 | 3300025923 | Bacteria | 4029 |
| 721 | Ga0207681_10050972 | 3300025923 | Bacteria | 2802 |
| 722 | Ga0207694_10132648 | 3300025924 | Bacteria | 1998 |
| 723 | Ga0207694_10938251 | 3300025924 | Bacteria | 732 |
| 724 | Ga0207650_10000024 | 3300025925 | Bacteria | 299184 |
| 725 | Ga0207650_10201193 | 3300025925 | Bacteria | 1596 |
| 726 | Ga0207650_10579411 | 3300025925 | Bacteria | 942 |
| 727 | Ga0207650_11392797 | 3300025925 | Bacteria | 597 |
| 728 | Ga0207659_10010347 | 3300025926 | Bacteria | 5859 |
| 729 | Ga0207659_10228722 | 3300025926 | Unclassified | 1499 |
| 730 | Ga0207687_10001849 | 3300025927 | Bacteria | 14556 |
| 731 | Ga0207687_10007823 | 3300025927 | Bacteria | 7010 |
| 732 | Ga0207687_10039043 | 3300025927 | Bacteria | 3249 |
| 733 | Ga0207687_10155136 | 3300025927 | Bacteria | 1751 |
| 734 | Ga0207687_10334030 | 3300025927 | Bacteria | 1230 |
| 735 | Ga0207687_10341831 | 3300025927 | Unclassified | 1217 |
| 736 | Ga0207687_10478405 | 3300025927 | Bacteria | 1037 |
| 737 | Ga0207700_10700615 | 3300025928 | Bacteria | 904 |
| 738 | Ga0207664_10293259 | 3300025929 | Bacteria | 1430 |
| 739 | Ga0207664_11533377 | 3300025929 | Unclassified | 588 |
| 740 | Ga0207664_11912645 | 3300025929 | Unclassified | 516 |
| 741 | Ga0207644_10068646 | 3300025931 | Bacteria | 2587 |
| 742 | Ga0207644_10239694 | 3300025931 | Bacteria | 1443 |
| 743 | Ga0207644_10601611 | 3300025931 | Bacteria | 913 |
| 744 | Ga0207690_10019446 | 3300025932 | Bacteria | 4183 |
| 745 | Ga0207690_10026441 | 3300025932 | Bacteria | 3654 |
| 746 | Ga0207690_10220141 | 3300025932 | Unclassified | 1452 |
| 747 | Ga0207690_10308487 | 3300025932 | Bacteria | 1240 |
| 748 | Ga0207690_11129932 | 3300025932 | Bacteria | 653 |
| 749 | Ga0207690_11178074 | 3300025932 | Bacteria | 639 |
| 750 | Ga0207706_10000912 | 3300025933 | Bacteria | 30372 |
| 751 | Ga0207706_10003049 | 3300025933 | Bacteria | 16140 |
| 752 | Ga0207706_10055523 | 3300025933 | Bacteria | 3492 |
| 753 | Ga0207706_10210884 | 3300025933 | Bacteria | 1703 |
| 754 | Ga0207706_10628332 | 3300025933 | Bacteria | 921 |
| 755 | Ga0207686_10025124 | 3300025934 | Bacteria | 3461 |
| 756 | Ga0207686_10026204 | 3300025934 | Bacteria | 3400 |
| 757 | Ga0207686_10056448 | 3300025934 | Bacteria | 2468 |
| 758 | Ga0207686_10610278 | 3300025934 | Unclassified | 859 |
| 759 | Ga0207686_10620163 | 3300025934 | Unclassified | 853 |
| 760 | Ga0207709_10128148 | 3300025935 | Bacteria | 1725 |
| 761 | Ga0207709_10137494 | 3300025935 | Bacteria | 1675 |
| 762 | Ga0207709_10477537 | 3300025935 | Bacteria | 969 |
| 763 | Ga0207709_11808566 | 3300025935 | Bacteria | 508 |
| 764 | Ga0207670_10080240 | 3300025936 | Bacteria | 2280 |
| 765 | Ga0207670_10112448 | 3300025936 | Bacteria | 1965 |
| 766 | Ga0207670_10112449 | 3300025936 | Bacteria | 1965 |
| 767 | Ga0207670_10857842 | 3300025936 | Bacteria | 759 |
| 768 | Ga0207670_11203169 | 3300025936 | Unclassified | 641 |
| 769 | Ga0207669_10003738 | 3300025937 | Bacteria | 6614 |
| 770 | Ga0207669_10844599 | 3300025937 | Unclassified | 762 |
| 771 | Ga0207704_10010186 | 3300025938 | Bacteria | 4572 |
| 772 | Ga0207704_10063743 | 3300025938 | Bacteria | 2299 |
| 773 | Ga0207704_10235851 | 3300025938 | Bacteria | 1364 |
| 774 | Ga0207704_10681596 | 3300025938 | Bacteria | 849 |
| 775 | Ga0207665_10016629 | 3300025939 | Bacteria | 4833 |
| 776 | Ga0207665_10142527 | 3300025939 | Bacteria | 1710 |
| 777 | Ga0207665_10375427 | 3300025939 | Bacteria | 1078 |
| 778 | Ga0207691_10003833 | 3300025940 | Bacteria | 14588 |
| 779 | Ga0207691_10028474 | 3300025940 | Bacteria | 5232 |
| 780 | Ga0207691_10295317 | 3300025940 | Bacteria | 1393 |
| 781 | Ga0207691_10387425 | 3300025940 | Unclassified | 1193 |
| 782 | Ga0207711_10001719 | 3300025941 | Bacteria | 20130 |
| 783 | Ga0207711_10053771 | 3300025941 | Bacteria | 3454 |
| 784 | Ga0207711_10183183 | 3300025941 | Bacteria | 1905 |
| 785 | Ga0207711_10318879 | 3300025941 | Bacteria | 1436 |
| 786 | Ga0207711_10434944 | 3300025941 | Unclassified | 1221 |
| 787 | Ga0207711_10437427 | 3300025941 | Bacteria | 1217 |
| 788 | Ga0207711_10712904 | 3300025941 | Bacteria | 936 |
| 789 | Ga0207711_11295918 | 3300025941 | Unclassified | 671 |
| 790 | Ga0207689_10001992 | 3300025942 | Bacteria | 19297 |
| 791 | Ga0207689_10002848 | 3300025942 | Bacteria | 15961 |
| 792 | Ga0207689_10025057 | 3300025942 | Bacteria | 5001 |
| 793 | Ga0207689_10053430 | 3300025942 | Bacteria | 3328 |
| 794 | Ga0207689_10064764 | 3300025942 | Bacteria | 3006 |
| 795 | Ga0207689_11686934 | 3300025942 | Bacteria | 525 |
| 796 | Ga0207661_10000067 | 3300025944 | Bacteria | 72201 |
| 797 | Ga0207661_10001401 | 3300025944 | Bacteria | 16231 |
| 798 | Ga0207661_10001542 | 3300025944 | Bacteria | 15663 |
| 799 | Ga0207661_10040019 | 3300025944 | Bacteria | 3683 |
| 800 | Ga0207661_10076039 | 3300025944 | Bacteria | 2757 |
| 801 | Ga0207661_10370686 | 3300025944 | Unclassified | 1294 |
| 802 | Ga0207661_10680870 | 3300025944 | Bacteria | 945 |
| 803 | Ga0207679_10000055 | 3300025945 | Bacteria | 108728 |
| 804 | Ga0207679_10090635 | 3300025945 | Bacteria | 2364 |
| 805 | Ga0207679_10173263 | 3300025945 | Unclassified | 1778 |
| 806 | Ga0207679_10192682 | 3300025945 | Bacteria | 1696 |
| 807 | Ga0207679_10269513 | 3300025945 | Bacteria | 1455 |
| 808 | Ga0207679_10498576 | 3300025945 | Bacteria | 1086 |
| 809 | Ga0207667_10079834 | 3300025949 | Bacteria | 3390 |
| 810 | Ga0207667_10618316 | 3300025949 | Bacteria | 1091 |
| 811 | Ga0207667_11420820 | 3300025949 | Bacteria | 667 |
| 812 | Ga0207651_10012890 | 3300025960 | Bacteria | 4754 |
| 813 | Ga0207651_10083509 | 3300025960 | Bacteria | 2310 |
| 814 | Ga0207651_10294871 | 3300025960 | Bacteria | 1346 |
| 815 | Ga0207651_10337602 | 3300025960 | Bacteria | 1265 |
| 816 | Ga0207712_10229540 | 3300025961 | Bacteria | 1489 |
| 817 | Ga0207712_10367773 | 3300025961 | Bacteria | 1200 |
| 818 | Ga0207712_10684581 | 3300025961 | Bacteria | 894 |
| 819 | Ga0207668_10036023 | 3300025972 | Bacteria | 3300 |
| 820 | Ga0207668_10038261 | 3300025972 | Bacteria | 3218 |
| 821 | Ga0207668_10046904 | 3300025972 | Bacteria | 2955 |
| 822 | Ga0207640_10011325 | 3300025981 | Bacteria | 5047 |
| 823 | Ga0207640_10204128 | 3300025981 | Bacteria | 1500 |
| 824 | Ga0207640_10237235 | 3300025981 | Bacteria | 1407 |
| 825 | Ga0207640_10237779 | 3300025981 | Bacteria | 1405 |
| 826 | Ga0207640_10725099 | 3300025981 | Bacteria | 855 |
| 827 | Ga0207640_10826263 | 3300025981 | Bacteria | 804 |
| 828 | Ga0207658_10039535 | 3300025986 | Bacteria | 3403 |
| 829 | Ga0207658_10213881 | 3300025986 | Bacteria | 1617 |
| 830 | Ga0207658_10560212 | 3300025986 | Bacteria | 1023 |
| 831 | Ga0207658_11075044 | 3300025986 | Bacteria | 735 |
| 832 | Ga0207677_10010017 | 3300026023 | Bacteria | 5350 |
| 833 | Ga0207677_10013512 | 3300026023 | Bacteria | 4736 |
| 834 | Ga0207677_10014490 | 3300026023 | Bacteria | 4606 |
| 835 | Ga0207677_10063300 | 3300026023 | Bacteria | 2570 |
| 836 | Ga0207677_11072475 | 3300026023 | Bacteria | 733 |
| 837 | Ga0207677_11142317 | 3300026023 | Bacteria | 711 |
| 838 | Ga0207703_10002963 | 3300026035 | Bacteria | 14394 |
| 839 | Ga0207703_10055609 | 3300026035 | Bacteria | 3220 |
| 840 | Ga0207703_11170958 | 3300026035 | Bacteria | 739 |
| 841 | Ga0207639_10296093 | 3300026041 | Bacteria | 1428 |
| 842 | Ga0207639_11410369 | 3300026041 | Bacteria | 654 |
| 843 | Ga0207678_10001331 | 3300026067 | Bacteria | 22808 |
| 844 | Ga0207678_10001590 | 3300026067 | Bacteria | 20893 |
| 845 | Ga0207678_10437116 | 3300026067 | Bacteria | 1136 |
| 846 | Ga0207678_11000136 | 3300026067 | Bacteria | 740 |
| 847 | Ga0207708_10003250 | 3300026075 | Bacteria | 11978 |
| 848 | Ga0207708_10048689 | 3300026075 | Bacteria | 3227 |
| 849 | Ga0207708_10291754 | 3300026075 | Bacteria | 1324 |
| 850 | Ga0207702_10021041 | 3300026078 | Bacteria | 5397 |
| 851 | Ga0207702_10042043 | 3300026078 | Bacteria | 3833 |
| 852 | Ga0207702_10160873 | 3300026078 | Bacteria | 2050 |
| 853 | Ga0207702_10169653 | 3300026078 | Bacteria | 2000 |
| 854 | Ga0207702_10194248 | 3300026078 | Unclassified | 1877 |
| 855 | Ga0207702_10202889 | 3300026078 | Bacteria | 1839 |
| 856 | Ga0207702_10431996 | 3300026078 | Bacteria | 1275 |
| 857 | Ga0207702_12508089 | 3300026078 | Unclassified | 502 |
| 858 | Ga0207641_10000030 | 3300026088 | Bacteria | 224468 |
| 859 | Ga0207641_10078190 | 3300026088 | Bacteria | 2865 |
| 860 | Ga0207641_10263389 | 3300026088 | Unclassified | 1615 |
| 861 | Ga0207641_10361956 | 3300026088 | Bacteria | 1385 |
| 862 | Ga0207641_10381618 | 3300026088 | Unclassified | 1350 |
| 863 | Ga0207641_10433545 | 3300026088 | Bacteria | 1268 |
| 864 | Ga0207641_10648087 | 3300026088 | Bacteria | 1037 |
| 865 | Ga0207641_11607921 | 3300026088 | Bacteria | 652 |
| 866 | Ga0207648_10000031 | 3300026089 | Bacteria | 129124 |
| 867 | Ga0207648_10040838 | 3300026089 | Bacteria | 4075 |
| 868 | Ga0207676_10001006 | 3300026095 | Bacteria | 21691 |
| 869 | Ga0207676_10014080 | 3300026095 | Bacteria | 5745 |
| 870 | Ga0207676_10652351 | 3300026095 | Bacteria | 1016 |
| 871 | Ga0207676_10679121 | 3300026095 | Bacteria | 996 |
| 872 | Ga0207676_10852250 | 3300026095 | Bacteria | 891 |
| 873 | Ga0207676_11209463 | 3300026095 | Unclassified | 749 |
| 874 | Ga0207674_10000618 | 3300026116 | Bacteria | 46623 |
| 875 | Ga0207674_10002728 | 3300026116 | Bacteria | 22028 |
| 876 | Ga0207674_10040199 | 3300026116 | Bacteria | 4847 |
| 877 | Ga0207674_10076386 | 3300026116 | Bacteria | 3357 |
| 878 | Ga0207674_10169715 | 3300026116 | Unclassified | 2136 |
| 879 | Ga0207674_10433101 | 3300026116 | Bacteria | 1271 |
| 880 | Ga0207674_11356129 | 3300026116 | Bacteria | 681 |
| 881 | Ga0207675_100008535 | 3300026118 | Bacteria | 9635 |
| 882 | Ga0207675_100011099 | 3300026118 | Bacteria | 8441 |
| 883 | Ga0207675_100038821 | 3300026118 | Bacteria | 4443 |
| 884 | Ga0207683_10014563 | 3300026121 | Bacteria | 6699 |
| 885 | Ga0207683_10084602 | 3300026121 | Bacteria | 2820 |
| 886 | Ga0207683_10351753 | 3300026121 | Bacteria | 1352 |
| 887 | Ga0207683_10665043 | 3300026121 | Bacteria | 965 |
| 888 | Ga0207698_10135238 | 3300026142 | Unclassified | 2114 |
| 889 | Ga0207698_10194152 | 3300026142 | Bacteria | 1812 |
| 890 | Ga0207698_10293887 | 3300026142 | Bacteria | 1509 |
| 891 | Ga0207698_10307446 | 3300026142 | Unclassified | 1479 |
| 892 | Ga0207698_10639542 | 3300026142 | Bacteria | 1053 |
| 893 | Ga0207698_10910774 | 3300026142 | Unclassified | 887 |
| 894 | Ga0209588_1044297 | 3300027671 | Bacteria | 1439 |
| 895 | Ga0209998_10164321 | 3300027717 | Unclassified | 574 |
| 896 | Ga0207428_10030102 | 3300027907 | Bacteria | 4490 |
| 897 | Ga0207428_10135611 | 3300027907 | Bacteria | 1882 |
| 898 | Ga0268266_10005546 | 3300028379 | Bacteria | 11745 |
| 899 | Ga0268266_10128776 | 3300028379 | Bacteria | 2262 |
| 900 | Ga0268266_10307359 | 3300028379 | Bacteria | 1481 |
| 901 | Ga0268266_11617406 | 3300028379 | Bacteria | 623 |
| 902 | Ga0268265_10092033 | 3300028380 | Unclassified | 2426 |
| 903 | Ga0268265_10094108 | 3300028380 | Bacteria | 2402 |
| 904 | Ga0268265_10140531 | 3300028380 | Bacteria | 2021 |
| 905 | Ga0268265_10150376 | 3300028380 | Bacteria | 1963 |
| 906 | Ga0268265_12643113 | 3300028380 | Bacteria | 507 |
| 907 | Ga0268264_10046537 | 3300028381 | Bacteria | 3603 |
| 908 | Ga0268264_10123056 | 3300028381 | Bacteria | 2289 |
| 909 | Ga0268264_10186689 | 3300028381 | Bacteria | 1887 |
| 910 | Ga0268264_10255245 | 3300028381 | Bacteria | 1631 |
| 911 | Ga0268264_10256384 | 3300028381 | Bacteria | 1627 |
| 912 | Ga0268264_10699368 | 3300028381 | Bacteria | 1007 |
| 913 | Ga0268264_11583787 | 3300028381 | Bacteria | 666 |
| 914 | Ga0268264_11814294 | 3300028381 | Unclassified | 620 |
| 915 | Ga0265337_1077731 | 3300028556 | Bacteria | 909 |
| 916 | Ga0265326_10060152 | 3300028558 | Bacteria | 1075 |
| 917 | Ga0265319_1044163 | 3300028563 | Bacteria | 1494 |
| 918 | Ga0265319_1052405 | 3300028563 | Bacteria | 1343 |
| 919 | Ga0265323_10125494 | 3300028653 | Bacteria | 834 |
| 920 | Ga0265322_10024897 | 3300028654 | Bacteria | 1713 |
| 921 | Ga0265336_10003729 | 3300028666 | Bacteria | 5902 |
| 922 | Ga0265338_10007600 | 3300028800 | Bacteria | 13391 |
| 923 | Ga0265325_10005401 | 3300031241 | Bacteria | 7895 |
| 924 | Ga0265340_10001376 | 3300031247 | Bacteria | 13943 |
| 925 | Ga0265316_10172810 | 3300031344 | Bacteria | 1611 |
| 926 | Ga0265313_10024931 | 3300031595 | Bacteria | 3182 |
| 927 | Ga0316576_10024976 | 3300031727 | Bacteria | 4179 |
| 928 | Ga0316576_10042070 | 3300031727 | Bacteria | 3292 |
| 929 | Ga0316576_10195478 | 3300031727 | Bacteria | 1524 |
| 930 | Ga0316578_10072799 | 3300031728 | Bacteria | 2036 |
| 931 | Ga0316578_10189013 | 3300031728 | Bacteria | 1241 |
| 932 | Ga0307405_10216675 | 3300031731 | Unclassified | 1402 |
| 933 | Ga0316577_10036591 | 3300031733 | Bacteria | 2745 |
| 934 | Ga0307410_10700937 | 3300031852 | Bacteria | 853 |
| 935 | Ga0307407_10189453 | 3300031903 | Bacteria | 1370 |
| 936 | Ga0307416_101347574 | 3300032002 | Bacteria | 819 |
| 937 | Ga0307414_10631030 | 3300032004 | Bacteria | 964 |
| 938 | Ga0307415_100262168 | 3300032126 | Bacteria | 1411 |
| 939 | Ga0316585_10137882 | 3300032137 | Bacteria | 805 |
| 940 | Ga0373948_0015880 | 3300034817 | Bacteria | 1387 |
| 941 | Ga0373950_0038783 | 3300034818 | Bacteria | 906 |
| 942 | Ga0373926_0031683 | 3300035083 | Bacteria | 1865 |
| 943 | Ga0373926_0150284 | 3300035083 | Bacteria | 887 |
| 944 | Ga0373944_0023577 | 3300035089 | Bacteria | 1797 |
| 945 | Ga0373949_0141694 | 3300035090 | Bacteria | 689 |
| 946 | Ga0373936_0002175 | 3300035113 | Bacteria | 7307 |
| 947 | Ga0373936_0167725 | 3300035113 | Unclassified | 959 |
| 948 | Ga0373939_0017420 | 3300035114 | Bacteria | 1908 |
| 949 | Ga0373941_0075559 | 3300035115 | Unclassified | 1128 |
| 950 | Ga0373941_0362854 | 3300035115 | Bacteria | 592 |
| 951 | Ga0373941_0375371 | 3300035115 | Unclassified | 583 |
| 952 | Ga0373945_0140031 | 3300035116 | Unclassified | 975 |
| 953 | Ga0373953_0241141 | 3300035117 | Bacteria | 785 |
| 954 | Ga0373957_0183595 | 3300035120 | Bacteria | 868 |
| 955 | Ga0373960_0138285 | 3300035121 | Bacteria | 823 |
| 956 | Ga0373960_0411822 | 3300035121 | Bacteria | 523 |
| 957 | Ga0373943_0107216 | 3300035170 | Bacteria | 1469 |
| 958 | Ga0373943_0137020 | 3300035170 | Bacteria | 1315 |
| 959 | Ga0373943_0360936 | 3300035170 | Bacteria | 834 |
| 960 | Ga0373943_0668507 | 3300035170 | Bacteria | 614 |
| 961 | Ga0373946_0073471 | 3300035171 | Bacteria | 1482 |
| 962 | Ga0373955_0189434 | 3300035172 | Bacteria | 1223 |
| 963 | Ga0373961_0201548 | 3300035241 | Bacteria | 702 |
| 964 | Ga0373961_0316119 | 3300035241 | Bacteria | 581 |
| 965 | Ga0373961_0391214 | 3300035241 | Bacteria | 532 |
| 966 | Ga0316574_0151133 | 3300035398 | Bacteria | 1496 |
| 967 | Ga0316574_0155696 | 3300035398 | Bacteria | 1472 |
| 968 | Ga0316574_0499900 | 3300035398 | Bacteria | 758 |
| 969 | Ga0373924_0039844 | 3300035410 | Bacteria | 1921 |
| 970 | Ga0373931_0037515 | 3300035691 | Bacteria | 2531 |
| 971 | Ga0373931_0117624 | 3300035691 | Bacteria | 1515 |
| 972 | Ga0373927_0444905 | 3300035695 | Unclassified | 856 |
| 973 | Ga0373933_0103943 | 3300035724 | Bacteria | 1765 |
| 974 | Ga0373933_0641958 | 3300035724 | Archaea | 698 |
| 975 | Ga0373947_0018665 | 3300035725 | Bacteria | 3993 |
| 976 | Ga0373947_0193680 | 3300035725 | Bacteria | 1327 |
| 977 | Ga0373937_0002393 | 3300036401 | Bacteria | 15607 |
| 978 | Ga0373937_0083150 | 3300036401 | Bacteria | 2962 |
| 979 | Ga0373937_0171915 | 3300036401 | Bacteria | 2033 |
| 980 | Ga0373937_0420769 | 3300036401 | Bacteria | 1268 |
| 981 | Ga0316582_0374009 | 3300036647 | Bacteria | 981 |
| 982 | Ga0316584_0086994 | 3300036712 | Bacteria | 2339 |
| 983 | Ga0316584_0228639 | 3300036712 | Bacteria | 1364 |
| 984 | Ga0373925_0001169 | 3300037068 | Bacteria | 23275 |
| 985 | Ga0373925_0283285 | 3300037068 | Unclassified | 1335 |
| 986 | Ga0373925_0488677 | 3300037068 | Bacteria | 1010 |
| 987 | Ga0373925_1067842 | 3300037068 | Unclassified | 664 |
| 988 | Ga0395900_0093144 | 3300037418 | Bacteria | 3095 |
| 989 | Ga0395900_0860393 | 3300037418 | Bacteria | 832 |
| 990 | Ga0395898_0408364 | 3300037466 | Bacteria | 1295 |
| 991 | Ga0395905_0277710 | 3300037471 | Bacteria | 1561 |
| 992 | Ga0395905_1417871 | 3300037471 | Unclassified | 599 |
| 993 | Ga0436364_0868731 | 3300037853 | Bacteria | 2416 |
| 994 | Ga0395901_0032207 | 3300038443 | Bacteria | 5410 |
| 995 | Ga0395901_0640637 | 3300038443 | Bacteria | 1067 |
| 996 | Ga0395901_1209235 | 3300038443 | Bacteria | 721 |
| 997 | Ga0436365_1865349 | 3300039437 | Bacteria | 1292 |
| 998 | Ga0436362_0068786 | 3300039453 | Unclassified | 677 |
| 999 | Ga0436362_0197399 | 3300039453 | Bacteria | 3687 |
| 1000 | Ga0439453_0009799 | 3300041408 | Unclassified | 1567 |
| 1001 | Ga0451804_0554939 | 3300041463 | Bacteria | 761 |
| 1002 | Ga0451855_1312722 | 3300041511 | Bacteria | 568 |
| 1003 | Ga0439451_010984 | 3300042009 | Bacteria | 1826 |
| 1004 | Ga0439454_003816 | 3300042011 | Unclassified | 1701 |
| 1005 | Ga0450914_002057 | 3300042118 | Unclassified | 1381 |
| 1006 | Ga0450920_012436 | 3300042122 | Unclassified | 1597 |
| 1007 | Ga0450905_061641 | 3300042142 | Unclassified | 627 |
| 1008 | Ga0450906_003773 | 3300042145 | Unclassified | 3224 |
| 1009 | Ga0450908_007909 | 3300042184 | Bacteria | 1995 |
| 1010 | Ga0439464_0055024 | 3300042439 | Bacteria | 1157 |
| 1011 | Ga0450916_015776 | 3300042530 | Bacteria | 996 |
| 1012 | Ga0451577_1765109 | 3300042876 | Bacteria | 543 |
| 1013 | Ga0466969_0051021 | 3300044656 | Bacteria | 2037 |
| 1014 | Ga0466966_0772016 | 3300044684 | Bacteria | 579 |
| 1015 | Ga0466961_0074888 | 3300044693 | Bacteria | 2146 |
| 1016 | Ga0466963_0182756 | 3300044694 | Bacteria | 1464 |
| 1017 | Ga0466963_0748781 | 3300044694 | Bacteria | 689 |
| 1018 | Ga0466963_0880227 | 3300044694 | Bacteria | 631 |
| 1019 | Ga0466971_0001350 | 3300044719 | Bacteria | 10290 |
| 1020 | Ga0466957_0152252 | 3300044842 | Bacteria | 1496 |
| 1021 | Ga0466957_0451704 | 3300044842 | Unclassified | 886 |
| 1022 | Ga0466957_0635498 | 3300044842 | Bacteria | 749 |
| 1023 | Ga0466960_0758981 | 3300044901 | Bacteria | 585 |
| 1024 | Ga0466959_0010178 | 3300045049 | Bacteria | 6714 |
| 1025 | Ga0466959_0055746 | 3300045049 | Bacteria | 2884 |
| 1026 | Ga0466959_0992303 | 3300045049 | Unclassified | 559 |
| 1027 | Ga0451576_2115528 | 3300045051 | Bacteria | 579 |
| 1028 | Ga0466958_0022669 | 3300045836 | Bacteria | 3681 |
| 1029 | Ga0466958_0028012 | 3300045836 | Bacteria | 3337 |
| 1030 | Ga0466958_0150993 | 3300045836 | Bacteria | 1465 |
| 1031 | Ga0466958_1012797 | 3300045836 | Bacteria | 542 |
| 1032 | Ga0466967_0021185 | 3300045976 | Bacteria | 5272 |
| 1033 | Ga0466967_0026563 | 3300045976 | Bacteria | 4797 |
| 1034 | Ga0466967_0147809 | 3300045976 | Unclassified | 2193 |
| 1035 | Ga0466967_0402266 | 3300045976 | Bacteria | 1332 |
| 1036 | Ga0466967_0723471 | 3300045976 | Bacteria | 986 |
| 1037 | Ga0495629_0584444 | 3300046459 | Bacteria | 748 |
| 1038 | Ga0495653_0187253 | 3300046463 | Bacteria | 1415 |
| 1039 | Ga0495580_0000116 | 3300046472 | Bacteria | 54763 |
| 1040 | Ga0495580_0010633 | 3300046472 | Bacteria | 7151 |
| 1041 | Ga0495580_0180365 | 3300046472 | Bacteria | 1458 |
| 1042 | Ga0495580_0192593 | 3300046472 | Unclassified | 1406 |
| 1043 | Ga0495580_0518531 | 3300046472 | Bacteria | 794 |
| 1044 | Ga0495580_0652213 | 3300046472 | Bacteria | 692 |
| 1045 | Ga0495580_0905282 | 3300046472 | Bacteria | 567 |
| 1046 | Ga0495582_0054763 | 3300046473 | Bacteria | 2199 |
| 1047 | Ga0495582_0628413 | 3300046473 | Bacteria | 621 |
| 1048 | Ga0495639_0386809 | 3300046475 | Bacteria | 705 |
| 1049 | Ga0495585_0611406 | 3300046492 | Unclassified | 512 |
| 1050 | Ga0495594_0219039 | 3300046499 | Bacteria | 1085 |
| 1051 | Ga0495608_0292066 | 3300046511 | Bacteria | 1010 |
| 1052 | Ga0495630_0109339 | 3300046517 | Bacteria | 2094 |
| 1053 | Ga0495630_0502230 | 3300046517 | Bacteria | 930 |
| 1054 | Ga0495630_0637890 | 3300046517 | Bacteria | 816 |
| 1055 | Ga0495630_1287939 | 3300046517 | Bacteria | 551 |
| 1056 | Ga0495631_0426462 | 3300046518 | Bacteria | 565 |
| 1057 | Ga0495644_0093220 | 3300046523 | Bacteria | 1137 |
| 1058 | Ga0495652_0284847 | 3300046529 | Bacteria | 1208 |
| 1059 | Ga0495665_0130938 | 3300046531 | Bacteria | 1313 |
| 1060 | Ga0495665_0349661 | 3300046531 | Bacteria | 753 |
| 1061 | Ga0495586_0003843 | 3300046535 | Bacteria | 8052 |
| 1062 | Ga0495586_0381312 | 3300046535 | Unclassified | 811 |
| 1063 | Ga0495587_0267520 | 3300046536 | Bacteria | 959 |
| 1064 | Ga0495645_0698883 | 3300046543 | Bacteria | 616 |
| 1065 | Ga0495656_0069159 | 3300046615 | Bacteria | 1563 |
| 1066 | Ga0495656_0125264 | 3300046615 | Bacteria | 1217 |
| 1067 | Ga0495668_0394838 | 3300046616 | Archaea | 760 |
| 1068 | Ga0495588_0016297 | 3300046674 | Bacteria | 3591 |
| 1069 | Ga0495599_0373343 | 3300046678 | Bacteria | 852 |
| 1070 | Ga0495623_0205519 | 3300046679 | Bacteria | 1130 |
| 1071 | Ga0495623_0659650 | 3300046679 | Bacteria | 539 |
| 1072 | Ga0495658_0022699 | 3300046683 | Bacteria | 3322 |
| 1073 | Ga0495658_0155773 | 3300046683 | Bacteria | 1406 |
| 1074 | Ga0495658_0182073 | 3300046683 | Bacteria | 1304 |
| 1075 | Ga0495669_0001864 | 3300046684 | Bacteria | 8642 |
| 1076 | Ga0495669_0040733 | 3300046684 | Unclassified | 2061 |
| 1077 | Ga0495613_0024887 | 3300046689 | Bacteria | 4461 |
| 1078 | Ga0495613_0218700 | 3300046689 | Bacteria | 1338 |
| 1079 | Ga0495613_0298883 | 3300046689 | Bacteria | 1115 |
| 1080 | Ga0495624_0415794 | 3300046690 | Unclassified | 807 |
| 1081 | Ga0495670_0497662 | 3300046691 | Unclassified | 662 |
| 1082 | Ga0495581_0694405 | 3300047315 | Unclassified | 587 |
| 1083 | Ga0495604_0422940 | 3300047317 | Bacteria | 874 |
| 1084 | Ga0495604_0469062 | 3300047317 | Bacteria | 820 |
| 1085 | Ga0495604_1024605 | 3300047317 | Unclassified | 510 |
| 1086 | Ga0495676_0050963 | 3300047321 | Bacteria | 3316 |
| 1087 | Ga0495676_0573942 | 3300047321 | Unclassified | 736 |
| 1088 | Ga0495680_0394721 | 3300047322 | Bacteria | 956 |
| 1089 | Ga0495680_1103004 | 3300047322 | Bacteria | 501 |
| 1090 | Ga0495683_0088327 | 3300047323 | Bacteria | 1505 |
| 1091 | Ga0495684_0389692 | 3300047471 | Bacteria | 981 |
| 1092 | Ga0495684_0428849 | 3300047471 | Bacteria | 923 |
| 1093 | Ga0495593_0185945 | 3300047673 | Bacteria | 1046 |
| 1094 | Ga0495593_0593320 | 3300047673 | Bacteria | 556 |
| 1095 | Ga0495602_0384123 | 3300048088 | Bacteria | 1005 |
| 1096 | Ga0495602_0759495 | 3300048088 | Bacteria | 654 |
| 1097 | Ga0496100_0010347 | 3300048903 | Bacteria | 5278 |
| 1098 | Ga0496100_0226874 | 3300048903 | Unclassified | 1373 |
| 1099 | Ga0496100_0685755 | 3300048903 | Bacteria | 799 |
| 1100 | Ga0496100_0705349 | 3300048903 | Bacteria | 788 |
| 1101 | Ga0496101_0025335 | 3300048904 | Bacteria | 4115 |
| 1102 | Ga0496101_0102413 | 3300048904 | Bacteria | 2144 |
| 1103 | Ga0496101_0190221 | 3300048904 | Bacteria | 1584 |
| 1104 | Ga0496101_0437880 | 3300048904 | Bacteria | 1031 |
| 1105 | Ga0496101_0467431 | 3300048904 | Bacteria | 995 |
| 1106 | Ga0496101_0707588 | 3300048904 | Bacteria | 795 |
| 1107 | Ga0496102_0084282 | 3300048905 | Bacteria | 2933 |
| 1108 | Ga0496102_0159591 | 3300048905 | Bacteria | 2121 |
| 1109 | Ga0496102_0390861 | 3300048905 | Unclassified | 1308 |
| 1110 | Ga0496102_0425386 | 3300048905 | Bacteria | 1247 |
| 1111 | Ga0496102_0524267 | 3300048905 | Bacteria | 1107 |
| 1112 | Ga0496102_0771183 | 3300048905 | Bacteria | 884 |
| 1113 | Ga0496102_1756005 | 3300048905 | Unclassified | 538 |
| 1114 | Ga0496103_0187447 | 3300048906 | Bacteria | 1330 |
| 1115 | Ga0496103_0553735 | 3300048906 | Bacteria | 734 |
| 1116 | Ga0496104_0032468 | 3300048907 | Bacteria | 4859 |
| 1117 | Ga0496104_0275845 | 3300048907 | Bacteria | 1594 |
| 1118 | Ga0496104_0282967 | 3300048907 | Bacteria | 1571 |
| 1119 | Ga0496104_0295423 | 3300048907 | Bacteria | 1533 |
| 1120 | Ga0496104_0345512 | 3300048907 | Bacteria | 1400 |
| 1121 | Ga0496104_0476060 | 3300048907 | Bacteria | 1160 |
| 1122 | Ga0496104_0497486 | 3300048907 | Bacteria | 1130 |
| 1123 | Ga0496104_0669393 | 3300048907 | Bacteria | 946 |
| 1124 | Ga0496104_1366253 | 3300048907 | Unclassified | 611 |
| 1125 | Ga0496105_0056007 | 3300048908 | Bacteria | 3255 |
| 1126 | Ga0496105_0179918 | 3300048908 | Bacteria | 1732 |
| 1127 | Ga0496105_0958143 | 3300048908 | Bacteria | 642 |
| 1128 | Ga0496106_0409171 | 3300048909 | Bacteria | 1090 |
| 1129 | Ga0496106_0473493 | 3300048909 | Bacteria | 1006 |
| 1130 | Ga0496106_0739210 | 3300048909 | Bacteria | 783 |
| 1131 | Ga0496106_0856878 | 3300048909 | Unclassified | 719 |
| 1132 | Ga0496106_0986674 | 3300048909 | Bacteria | 663 |
| 1133 | Ga0496107_0050240 | 3300048910 | Unclassified | 3006 |
| 1134 | Ga0496107_0108919 | 3300048910 | Bacteria | 2035 |
| 1135 | Ga0496107_0305058 | 3300048910 | Bacteria | 1185 |
| 1136 | Ga0496107_0666717 | 3300048910 | Bacteria | 766 |
| 1137 | Ga0496107_0771609 | 3300048910 | Unclassified | 705 |
| 1138 | Ga0496107_1078853 | 3300048910 | Unclassified | 581 |
| 1139 | Ga0496108_0000602 | 3300048911 | Bacteria | 28172 |
| 1140 | Ga0496108_0004142 | 3300048911 | Bacteria | 11659 |
| 1141 | Ga0496108_0091571 | 3300048911 | Bacteria | 2584 |
| 1142 | Ga0496108_0420673 | 3300048911 | Bacteria | 1167 |
| 1143 | Ga0496108_1377197 | 3300048911 | Bacteria | 591 |
| 1144 | Ga0496109_0000941 | 3300048912 | Bacteria | 24099 |
| 1145 | Ga0496109_0006116 | 3300048912 | Bacteria | 10112 |
| 1146 | Ga0496109_0033373 | 3300048912 | Bacteria | 4630 |
| 1147 | Ga0496109_0195340 | 3300048912 | Bacteria | 1902 |
| 1148 | Ga0496109_0208834 | 3300048912 | Bacteria | 1836 |
| 1149 | Ga0496109_0243055 | 3300048912 | Bacteria | 1694 |
| 1150 | Ga0496109_0325795 | 3300048912 | Bacteria | 1450 |
| 1151 | Ga0496109_0527243 | 3300048912 | Bacteria | 1115 |
| 1152 | Ga0496109_1245121 | 3300048912 | Bacteria | 680 |
| 1153 | Ga0496109_1283022 | 3300048912 | Bacteria | 668 |
| 1154 | Ga0496110_0001419 | 3300048913 | Bacteria | 17303 |
| 1155 | Ga0496110_0006002 | 3300048913 | Bacteria | 9563 |
| 1156 | Ga0496110_0017934 | 3300048913 | Bacteria | 5928 |
| 1157 | Ga0496110_0190466 | 3300048913 | Bacteria | 1863 |
| 1158 | Ga0496110_0352206 | 3300048913 | Bacteria | 1341 |
| 1159 | Ga0496111_0000612 | 3300048914 | Bacteria | 18851 |
| 1160 | Ga0496111_0001316 | 3300048914 | Bacteria | 13943 |
| 1161 | Ga0496111_0119718 | 3300048914 | Bacteria | 1944 |
| 1162 | Ga0496111_0283496 | 3300048914 | Bacteria | 1229 |
| 1163 | Ga0496111_0301194 | 3300048914 | Bacteria | 1188 |
| 1164 | Ga0496111_0476695 | 3300048914 | Unclassified | 919 |
| 1165 | Ga0496112_0000964 | 3300048915 | Bacteria | 20930 |
| 1166 | Ga0496112_0007171 | 3300048915 | Bacteria | 9873 |
| 1167 | Ga0496112_0021577 | 3300048915 | Bacteria | 6126 |
| 1168 | Ga0496112_0047308 | 3300048915 | Bacteria | 4220 |
| 1169 | Ga0496112_0124580 | 3300048915 | Bacteria | 2548 |
| 1170 | Ga0496112_0163855 | 3300048915 | Bacteria | 2189 |
| 1171 | Ga0496112_0226424 | 3300048915 | Bacteria | 1825 |
| 1172 | Ga0496112_0327249 | 3300048915 | Unclassified | 1476 |
| 1173 | Ga0496112_0455150 | 3300048915 | Bacteria | 1217 |
| 1174 | Ga0496112_0610318 | 3300048915 | Bacteria | 1022 |
| 1175 | Ga0496113_0000942 | 3300048916 | Bacteria | 15468 |
| 1176 | Ga0496113_0077713 | 3300048916 | Bacteria | 2538 |
| 1177 | Ga0496113_0178448 | 3300048916 | Bacteria | 1683 |
| 1178 | Ga0496113_0487052 | 3300048916 | Unclassified | 990 |
| 1179 | Ga0496113_1174003 | 3300048916 | Bacteria | 600 |
| 1180 | Ga0496114_0150802 | 3300048917 | Bacteria | 2017 |
| 1181 | Ga0496114_0236526 | 3300048917 | Bacteria | 1605 |
| 1182 | Ga0496114_0347198 | 3300048917 | Bacteria | 1312 |
| 1183 | Ga0496114_0400477 | 3300048917 | Bacteria | 1215 |
| 1184 | Ga0496115_0030437 | 3300048918 | Bacteria | 4246 |
| 1185 | Ga0496115_0955471 | 3300048918 | Bacteria | 658 |
| 1186 | Ga0495682_0200746 | 3300049460 | Bacteria | 707 |
| 1187 | Ga0501031_0045189 | 3300049568 | Bacteria | 2874 |
| 1188 | Ga0501032_0018830 | 3300049569 | Bacteria | 4831 |
| 1189 | Ga0501032_0264191 | 3300049569 | Unclassified | 1116 |
| 1190 | Ga0501033_0136620 | 3300049570 | Bacteria | 1774 |
| 1191 | Ga0501033_0507254 | 3300049570 | Unclassified | 834 |
| 1192 | Ga0501036_0015843 | 3300049572 | Bacteria | 6296 |
| 1193 | Ga0501036_0124625 | 3300049572 | Unclassified | 2176 |
| 1194 | Ga0501037_0226548 | 3300049573 | Bacteria | 1313 |
| 1195 | Ga0501037_0624489 | 3300049573 | Bacteria | 722 |
| 1196 | Ga0501038_0047096 | 3300049574 | Bacteria | 3736 |
| 1197 | Ga0501039_0333206 | 3300049575 | Bacteria | 1192 |
| 1198 | Ga0501039_0841562 | 3300049575 | Bacteria | 715 |
| 1199 | Ga0501040_0002790 | 3300049576 | Bacteria | 11257 |
| 1200 | Ga0501040_0022602 | 3300049576 | Bacteria | 4211 |
| 1201 | Ga0501040_0035632 | 3300049576 | Bacteria | 3376 |
| 1202 | Ga0501040_0252850 | 3300049576 | Bacteria | 1257 |
| 1203 | Ga0501041_0002443 | 3300049577 | Bacteria | 10552 |
| 1204 | Ga0501041_0003646 | 3300049577 | Bacteria | 8858 |
| 1205 | Ga0501042_0000396 | 3300049578 | Bacteria | 22075 |
| 1206 | Ga0501042_0045429 | 3300049578 | Bacteria | 3130 |
| 1207 | Ga0501042_1041692 | 3300049578 | Bacteria | 596 |
| 1208 | Ga0501043_0087192 | 3300049579 | Bacteria | 2453 |
| 1209 | Ga0501046_0040849 | 3300049580 | Bacteria | 3704 |
| 1210 | Ga0501046_0052281 | 3300049580 | Bacteria | 3220 |
| 1211 | Ga0501046_0677666 | 3300049580 | Bacteria | 728 |
| 1212 | Ga0501047_0304752 | 3300049581 | Bacteria | 1435 |
| 1213 | Ga0501047_0641300 | 3300049581 | Bacteria | 882 |
| 1214 | Ga0501048_0002492 | 3300049582 | Bacteria | 14056 |
| 1215 | Ga0501048_0128294 | 3300049582 | Bacteria | 1793 |
| 1216 | Ga0501048_0554341 | 3300049582 | Bacteria | 825 |
| 1217 | Ga0501068_0086110 | 3300049584 | Bacteria | 1934 |
| 1218 | Ga0501069_0559855 | 3300049585 | Bacteria | 684 |
| 1219 | Ga0501070_0023046 | 3300049586 | Bacteria | 5213 |
| 1220 | Ga0501070_0281740 | 3300049586 | Bacteria | 1356 |
| 1221 | Ga0501070_0623056 | 3300049586 | Bacteria | 859 |
| 1222 | Ga0501071_0003292 | 3300049587 | Bacteria | 10088 |
| 1223 | Ga0501071_0007296 | 3300049587 | Bacteria | 7239 |
| 1224 | Ga0501071_0420785 | 3300049587 | Unclassified | 1021 |
| 1225 | Ga0501071_0817523 | 3300049587 | Bacteria | 719 |
| 1226 | Ga0501072_0011126 | 3300049588 | Bacteria | 6867 |
| 1227 | Ga0501072_0597586 | 3300049588 | Bacteria | 870 |
| 1228 | Ga0501072_0866542 | 3300049588 | Bacteria | 706 |
| 1229 | Ga0501073_0016278 | 3300049589 | Bacteria | 5389 |
| 1230 | Ga0501073_0109818 | 3300049589 | Bacteria | 1913 |
| 1231 | Ga0501074_0003979 | 3300049590 | Bacteria | 10531 |
| 1232 | Ga0501074_0009456 | 3300049590 | Bacteria | 7079 |
| 1233 | Ga0501074_0029852 | 3300049590 | Bacteria | 3951 |
| 1234 | Ga0501074_0316690 | 3300049590 | Unclassified | 1108 |
| 1235 | Ga0501075_0008695 | 3300049591 | Bacteria | 7080 |
| 1236 | Ga0501075_0008857 | 3300049591 | Bacteria | 7016 |
| 1237 | Ga0501075_1355211 | 3300049591 | Unclassified | 539 |
| 1238 | Ga0501076_0000767 | 3300049592 | Bacteria | 20726 |
| 1239 | Ga0501076_0093553 | 3300049592 | Bacteria | 2419 |
| 1240 | Ga0501076_0101506 | 3300049592 | Unclassified | 2319 |
| 1241 | Ga0501076_0288373 | 3300049592 | Bacteria | 1345 |
| 1242 | Ga0501077_0003676 | 3300049593 | Bacteria | 9230 |
| 1243 | Ga0501077_0004634 | 3300049593 | Bacteria | 8349 |
| 1244 | Ga0501217_064451 | 3300049661 | Bacteria | 985 |
| 1245 | Ga0501233_041059 | 3300049668 | Bacteria | 1087 |
| 1246 | Ga0501258_005425 | 3300049687 | Bacteria | 1237 |
| 1247 | Ga0501261_024961 | 3300049690 | Bacteria | 877 |
| 1248 | Ga0501234_013588 | 3300049707 | Bacteria | 1278 |
| 1249 | Ga0501079_0007024 | 3300049741 | Bacteria | 8493 |
| 1250 | Ga0501079_0019926 | 3300049741 | Bacteria | 5124 |
| 1251 | Ga0501079_0050781 | 3300049741 | Bacteria | 3201 |
| 1252 | Ga0501079_0086098 | 3300049741 | Bacteria | 2432 |
| 1253 | Ga0501079_0633872 | 3300049741 | Bacteria | 841 |
| 1254 | Ga0501079_1338403 | 3300049741 | Bacteria | 564 |
| 1255 | Ga0501080_0012655 | 3300049742 | Bacteria | 7737 |
| 1256 | Ga0501080_0224863 | 3300049742 | Bacteria | 1716 |
| 1257 | Ga0501080_0295484 | 3300049742 | Bacteria | 1470 |
| 1258 | Ga0501081_0005884 | 3300049743 | Bacteria | 7937 |
| 1259 | Ga0501081_0009803 | 3300049743 | Bacteria | 6239 |
| 1260 | Ga0501081_0888063 | 3300049743 | Bacteria | 672 |
| 1261 | Ga0501083_0001397 | 3300049744 | Bacteria | 16415 |
| 1262 | Ga0501083_0929837 | 3300049744 | Bacteria | 566 |
| 1263 | Ga0501270_029816 | 3300049767 | Bacteria | 893 |
| 1264 | Ga0501274_003161 | 3300049771 | Bacteria | 1320 |
| 1265 | Ga0501035_0055632 | 3300049822 | Bacteria | 3532 |
| 1266 | Ga0501035_0066442 | 3300049822 | Bacteria | 3200 |
| 1267 | Ga0501045_0016348 | 3300049824 | Bacteria | 5268 |
| 1268 | Ga0501045_0051317 | 3300049824 | Bacteria | 3010 |
| 1269 | Ga0501045_0100957 | 3300049824 | Bacteria | 2136 |
| 1270 | nmdc:mga00v17_968074_c1 | 3300050491 | Bacteria | 537 |
| 1271 | nmdc:mga0yw44_22461_c1 | 3300050492 | Bacteria | 3539 |
| 1272 | nmdc:mga0yw44_46394_c1 | 3300050492 | Bacteria | 2609 |
| 1273 | nmdc:mga07m45_476387_c1 | 3300050496 | Bacteria | 723 |
| 1274 | nmdc:mga05p37_106971_c1 | 3300050507 | Bacteria | 3441 |
| 1275 | nmdc:mga05p37_218080_c1 | 3300050507 | Bacteria | 2304 |
| 1276 | nmdc:mga09592_7067_c1 | 3300050508 | Bacteria | 9123 |
| 1277 | nmdc:mga0qj67_246812_c1 | 3300050509 | Bacteria | 1448 |
| 1278 | nmdc:mga0qj67_81299_c1 | 3300050509 | Bacteria | 2598 |
| 1279 | nmdc:mga06r32_334446_c1 | 3300050510 | Bacteria | 1499 |
| 1280 | nmdc:mga06r32_93487_c1 | 3300050510 | Bacteria | 2941 |
| 1281 | nmdc:mga08y16_367264_c1 | 3300050511 | Bacteria | 1476 |
| 1282 | nmdc:mga08y16_38382_c1 | 3300050511 | Bacteria | 5029 |
| 1283 | nmdc:mga08y16_793934_c1 | 3300050511 | Bacteria | 940 |
| 1284 | nmdc:mga0n895_105654_c1 | 3300050512 | Bacteria | 2828 |
| 1285 | nmdc:mga0n895_1841778_c1 | 3300050512 | Bacteria | 565 |
| 1286 | nmdc:mga0n895_1894549_c1 | 3300050512 | Unclassified | 555 |
| 1287 | nmdc:mga0n895_219993_c1 | 3300050512 | Bacteria | 1928 |
| 1288 | nmdc:mga0n895_269214_c1 | 3300050512 | Bacteria | 1728 |
| 1289 | nmdc:mga0n895_85740_c1 | 3300050512 | Bacteria | 3145 |
| 1290 | nmdc:mga0rr50_1049372_c1 | 3300050513 | Unclassified | 694 |
| 1291 | nmdc:mga0rr50_1384132_c1 | 3300050513 | Bacteria | 596 |
| 1292 | nmdc:mga0rr50_23570_c1 | 3300050513 | Bacteria | 4246 |
| 1293 | nmdc:mga0rr50_298897_c1 | 3300050513 | Bacteria | 1346 |
| 1294 | nmdc:mga0rr50_39543_c1 | 3300050513 | Bacteria | 3124 |
| 1295 | nmdc:mga0rr50_498093_c1 | 3300050513 | Unclassified | 1036 |
| 1296 | nmdc:mga0rr50_722533_c1 | 3300050513 | Bacteria | 850 |
| 1297 | nmdc:mga08x19_11630_c1 | 3300050514 | Bacteria | 5298 |
| 1298 | nmdc:mga08x19_177832_c1 | 3300050514 | Bacteria | 1452 |
| 1299 | nmdc:mga08x19_1875_c1 | 3300050514 | Bacteria | 12876 |
| 1300 | nmdc:mga08x19_219423_c1 | 3300050514 | Unclassified | 1306 |
| 1301 | nmdc:mga08x19_3451_c1 | 3300050514 | Bacteria | 9426 |
| 1302 | nmdc:mga08x19_40184_c1 | 3300050514 | Bacteria | 2976 |
| 1303 | nmdc:mga08x19_466882_c1 | 3300050514 | Bacteria | 889 |
| 1304 | nmdc:mga08x19_586722_c1 | 3300050514 | Bacteria | 789 |
| 1305 | nmdc:mga0a205_130669_c1 | 3300050515 | Bacteria | 2411 |
| 1306 | nmdc:mga0a205_1478711_c1 | 3300050515 | Unclassified | 527 |
| 1307 | nmdc:mga0a205_348493_c1 | 3300050515 | Bacteria | 1349 |
| 1308 | nmdc:mga0a205_575773_c1 | 3300050515 | Bacteria | 980 |
| 1309 | Ga0495601_0719668 | 3300053077 | Bacteria | 636 |
| 1310 | Ga0495595_0158866 | 3300053084 | Bacteria | 1115 |
| 1311 | Ga0501084_0031034 | 3300054114 | Bacteria | 4469 |
| 1312 | Ga0501084_0049274 | 3300054114 | Bacteria | 3526 |
| 1313 | Ga0501084_0171996 | 3300054114 | Bacteria | 1828 |
| 1314 | Ga0501084_0247243 | 3300054114 | Bacteria | 1506 |
| 1315 | Ga0501084_0725813 | 3300054114 | Bacteria | 837 |
| 1316 | Ga0501084_0900645 | 3300054114 | Unclassified | 744 |
| 1317 | Ga0501084_0913761 | 3300054114 | Unclassified | 738 |
| 1318 | Ga0501082_0081431 | 3300060353 | Bacteria | 2793 |
| 1319 | Ga0501082_0356301 | 3300060353 | Bacteria | 1276 |
| 1320 | Ga0501082_0888987 | 3300060353 | Bacteria | 779 |
| 1321 | Ga0501082_0992548 | 3300060353 | Bacteria | 734 |
| 1322 | Ga0501082_1296478 | 3300060353 | Bacteria | 636 |
| 1323 | Ga0466962_0001308 | 3300061719 | Bacteria | 11490 |
| 1324 | Ga0530510_0002000 | 3300061734 | Bacteria | 13983 |
| 1325 | Ga0530510_0036011 | 3300061734 | Bacteria | 3567 |
| 1326 | Ga0530510_0560463 | 3300061734 | Bacteria | 868 |
| 1327 | Ga0265338_10040736 | |||
| 1328 | MBSR1b_contig_12373578 | |||
| 1329 | MBSR1b_contig_9591076 | |||
| 1330 | JGI24743J22301_10087115 | |||
| 1331 | JGI24034J26672_10118024 | |||
| 1332 | JGI24751J29686_10004867 | |||
| 1333 | rootH2_10104511 | |||
| 1334 | rootL2_10068500 | |||
| 1335 | Ga0065704_10124661 | |||
| 1336 | Ga0065712_10000113 | |||
| 1337 | Ga0065712_10112355 | |||
| 1338 | Ga0065712_10176847 | |||
| 1339 | Ga0065715_10094050 | |||
| 1340 | Ga0065715_10103679 | |||
| 1341 | Ga0065715_10112900 | |||
| 1342 | Ga0065707_10000935 | |||
| 1343 | Ga0065707_11019243 | |||
| 1344 | Ga0070658_10007310 | |||
| 1345 | Ga0070658_10013304 | |||
| 1346 | Ga0070658_10183542 | |||
| 1347 | Ga0070658_10186550 | |||
| 1348 | Ga0070658_10210289 | |||
| 1349 | Ga0070676_10024646 | |||
| 1350 | Ga0070676_10037433 | |||
| 1351 | Ga0070676_10098943 | |||
| 1352 | Ga0070676_10336987 | |||
| 1353 | Ga0070683_100000756 | |||
| 1354 | Ga0070683_100007927 | |||
| 1355 | Ga0070683_100014671 | |||
| 1356 | Ga0070683_100019192 | |||
| 1357 | Ga0070683_100022422 | |||
| 1358 | Ga0070683_100685353 | |||
| 1359 | Ga0070690_100025672 | |||
| 1360 | Ga0070690_100128105 | |||
| 1361 | Ga0070690_100143479 | |||
| 1362 | Ga0070690_100148356 | |||
| 1363 | Ga0070690_100598326 | |||
| 1364 | Ga0070690_100620365 | |||
| 1365 | Ga0070690_100776022 | |||
| 1366 | Ga0070690_101333133 | |||
| 1367 | Ga0070670_100014183 | |||
| 1368 | Ga0070670_101090624 | |||
| 1369 | Ga0070670_101993141 | |||
| 1370 | Ga0068869_100026692 | |||
| 1371 | Ga0068869_100032009 | |||
| 1372 | Ga0068869_100032975 | |||
| 1373 | Ga0068869_100038892 | |||
| 1374 | Ga0068869_100052368 | |||
| 1375 | Ga0068869_100081849 | |||
| 1376 | Ga0070666_10000136 | |||
| 1377 | Ga0070666_10034971 | |||
| 1378 | Ga0070666_10091297 | |||
| 1379 | Ga0070666_10107992 | |||
| 1380 | Ga0070666_10911708 | |||
| 1381 | Ga0070680_100022389 | |||
| 1382 | Ga0070680_100082597 | |||
| 1383 | Ga0070680_100108847 | |||
| 1384 | Ga0070680_100251405 | |||
| 1385 | Ga0070680_100282881 | |||
| 1386 | Ga0070680_100471255 | |||
| 1387 | Ga0070680_101156844 | |||
| 1388 | Ga0070682_100002163 | |||
| 1389 | Ga0070682_100006650 | |||
| 1390 | Ga0070682_100012996 | |||
| 1391 | Ga0070682_100084198 | |||
| 1392 | Ga0070682_100997086 | |||
| 1393 | Ga0070682_101152765 | |||
| 1394 | Ga0070682_101340098 | |||
| 1395 | Ga0068868_100001217 | |||
| 1396 | Ga0068868_100002119 | |||
| 1397 | Ga0068868_100002890 | |||
| 1398 | Ga0068868_100039811 | |||
| 1399 | Ga0068868_100047731 | |||
| 1400 | Ga0068868_100084109 | |||
| 1401 | Ga0068868_100087614 | |||
| 1402 | Ga0068868_100415232 | |||
| 1403 | Ga0068868_101017659 | |||
| 1404 | Ga0070660_100001227 | |||
| 1405 | Ga0070660_100031624 | |||
| 1406 | Ga0070660_100039327 | |||
| 1407 | Ga0070660_100083304 | |||
| 1408 | Ga0070660_100722484 | |||
| 1409 | Ga0070689_100003801 | |||
| 1410 | Ga0070689_100027513 | |||
| 1411 | Ga0070689_100236840 | |||
| 1412 | Ga0070689_100418114 | |||
| 1413 | Ga0070689_101412425 | |||
| 1414 | Ga0070691_10018946 | |||
| 1415 | Ga0070691_10061718 | |||
| 1416 | Ga0070691_10491081 | |||
| 1417 | Ga0070691_10647404 | |||
| 1418 | Ga0070687_100129414 | |||
| 1419 | Ga0070661_100012914 | |||
| 1420 | Ga0070661_100019124 | |||
| 1421 | Ga0070661_100057993 | |||
| 1422 | Ga0070661_100245337 | |||
| 1423 | Ga0070661_100288254 | |||
| 1424 | Ga0070661_100462839 | |||
| 1425 | Ga0070692_10021033 | |||
| 1426 | Ga0070692_10089511 | |||
| 1427 | Ga0070692_10091149 | |||
| 1428 | Ga0070692_10573902 | |||
| 1429 | Ga0070668_100016124 | |||
| 1430 | Ga0070668_100044409 | |||
| 1431 | Ga0070668_102014085 | |||
| 1432 | Ga0070669_100002341 | |||
| 1433 | Ga0070669_100183464 | |||
| 1434 | Ga0070675_100187609 | |||
| 1435 | Ga0070671_100033932 | |||
| 1436 | Ga0070671_100143202 | |||
| 1437 | Ga0070671_100288764 | |||
| 1438 | Ga0070671_100726032 | |||
| 1439 | Ga0070671_101030889 | |||
| 1440 | Ga0070671_101261756 | |||
| 1441 | Ga0070674_100008505 | |||
| 1442 | Ga0070673_100004418 | |||
| 1443 | Ga0070673_100138657 | |||
| 1444 | Ga0070673_100161477 | |||
| 1445 | Ga0070673_101117298 | |||
| 1446 | Ga0070673_101382869 | |||
| 1447 | Ga0070688_100006966 | |||
| 1448 | Ga0070688_100015715 | |||
| 1449 | Ga0070688_100751627 | |||
| 1450 | Ga0070688_100888709 | |||
| 1451 | Ga0070659_100046133 | |||
| 1452 | Ga0070659_100137645 | |||
| 1453 | Ga0070659_100245284 | |||
| 1454 | Ga0070659_100794275 | |||
| 1455 | Ga0070659_101035753 | |||
| 1456 | Ga0070659_101237699 | |||
| 1457 | Ga0070659_101264190 | |||
| 1458 | Ga0070667_100089334 | |||
| 1459 | Ga0070667_100130792 | |||
| 1460 | Ga0070667_100985799 | |||
| 1461 | Ga0070709_10414586 | |||
| 1462 | Ga0070714_100174463 | |||
| 1463 | Ga0070713_100367382 | |||
| 1464 | Ga0070713_100468323 | |||
| 1465 | Ga0070713_101678420 | |||
| 1466 | Ga0070710_10129794 | |||
| 1467 | Ga0070701_10081377 | |||
| 1468 | Ga0070701_10113017 | |||
| 1469 | Ga0070711_100106905 | |||
| 1470 | Ga0070711_100289918 | |||
| 1471 | Ga0070711_100474563 | |||
| 1472 | Ga0070711_100541280 | |||
| 1473 | Ga0070705_101389495 | |||
| 1474 | Ga0070705_101591641 | |||
| 1475 | Ga0070705_101647847 | |||
| 1476 | Ga0070700_100006579 | |||
| 1477 | Ga0070700_100101318 | |||
| 1478 | Ga0070700_100289339 | |||
| 1479 | Ga0070700_100303712 | |||
| 1480 | Ga0070694_100020121 | |||
| 1481 | Ga0070694_100087631 | |||
| 1482 | Ga0070694_100546548 | |||
| 1483 | Ga0070694_101525176 | |||
| 1484 | Ga0070708_100353401 | |||
| 1485 | Ga0070708_100679513 | |||
| 1486 | Ga0070663_100005796 | |||
| 1487 | Ga0070663_100052380 | |||
| 1488 | Ga0070663_100320070 | |||
| 1489 | Ga0070663_100534320 | |||
| 1490 | Ga0070663_101051467 | |||
| 1491 | Ga0070663_101468997 | |||
| 1492 | Ga0070678_100305629 | |||
| 1493 | Ga0070678_100316190 | |||
| 1494 | Ga0070678_100470981 | |||
| 1495 | Ga0070678_101370888 | |||
| 1496 | Ga0070662_100002146 | |||
| 1497 | Ga0070662_100054367 | |||
| 1498 | Ga0070662_100115297 | |||
| 1499 | Ga0070662_100656578 | |||
| 1500 | Ga0070662_100840129 | |||
| 1501 | Ga0070681_10002072 | |||
| 1502 | Ga0070681_10003001 | |||
| 1503 | Ga0070681_10060771 | |||
| 1504 | Ga0070681_10099766 | |||
| 1505 | Ga0070681_10200404 | |||
| 1506 | Ga0070681_10236932 | |||
| 1507 | Ga0070681_10314424 | |||
| 1508 | Ga0070681_10878373 | |||
| 1509 | Ga0070681_11458330 | |||
| 1510 | Ga0068867_100009629 | |||
| 1511 | Ga0068867_100031705 | |||
| 1512 | Ga0068867_100597063 | |||
| 1513 | Ga0070685_10003709 | |||
| 1514 | Ga0070685_10062521 | |||
| 1515 | Ga0070685_10402902 | |||
| 1516 | Ga0070685_10742698 | |||
| 1517 | Ga0070706_101124700 | |||
| 1518 | Ga0070707_100492906 | |||
| 1519 | Ga0070698_100043277 | |||
| 1520 | Ga0070698_100611415 | |||
| 1521 | Ga0070699_100368630 | |||
| 1522 | Ga0070699_100433402 | |||
| 1523 | Ga0070699_100515543 | |||
| 1524 | Ga0070679_100011572 | |||
| 1525 | Ga0070679_100023415 | |||
| 1526 | Ga0070679_100114548 | |||
| 1527 | Ga0070679_100131088 | |||
| 1528 | Ga0070679_100164781 | |||
| 1529 | Ga0070679_100240735 | |||
| 1530 | Ga0070679_101843282 | |||
| 1531 | Ga0070684_100001840 | |||
| 1532 | Ga0070684_100014693 | |||
| 1533 | Ga0070684_100033044 | |||
| 1534 | Ga0070684_100039896 | |||
| 1535 | Ga0070684_100163098 | |||
| 1536 | Ga0070684_100195335 | |||
| 1537 | Ga0070684_100249375 | |||
| 1538 | Ga0070697_100017534 | |||
| 1539 | Ga0068853_100009840 | |||
| 1540 | Ga0068853_100071772 | |||
| 1541 | Ga0068853_100120312 | |||
| 1542 | Ga0068853_102422881 | |||
| 1543 | Ga0070672_100045874 | |||
| 1544 | Ga0070672_100188701 | |||
| 1545 | Ga0070672_101255254 | |||
| 1546 | Ga0070672_101356262 | |||
| 1547 | Ga0070686_100022318 | |||
| 1548 | Ga0070686_100069929 | |||
| 1549 | Ga0070686_100129919 | |||
| 1550 | Ga0070695_100070577 | |||
| 1551 | Ga0070695_100126431 | |||
| 1552 | Ga0070695_100309767 | |||
| 1553 | Ga0070695_100626200 | |||
| 1554 | Ga0070695_100728138 | |||
| 1555 | Ga0070695_101044428 | |||
| 1556 | Ga0070696_100046824 | |||
| 1557 | Ga0070696_100076775 | |||
| 1558 | Ga0070696_100095761 | |||
| 1559 | Ga0070696_100180676 | |||
| 1560 | Ga0070696_100265491 | |||
| 1561 | Ga0070696_100380141 | |||
| 1562 | Ga0070696_101840826 | |||
| 1563 | Ga0070693_100023085 | |||
| 1564 | Ga0070693_100038394 | |||
| 1565 | Ga0070693_100040134 | |||
| 1566 | Ga0070693_100131897 | |||
| 1567 | Ga0070693_100165776 | |||
| 1568 | Ga0070693_100291626 | |||
| 1569 | Ga0070693_100302811 | |||
| 1570 | Ga0070665_100135217 | |||
| 1571 | Ga0070665_100439846 | |||
| 1572 | Ga0070704_100019732 | |||
| 1573 | Ga0070704_100256675 | |||
| 1574 | Ga0070704_100616069 | |||
| 1575 | Ga0070704_100979334 | |||
| 1576 | Ga0068855_100009158 | |||
| 1577 | Ga0068855_100025509 | |||
| 1578 | Ga0068855_100103491 | |||
| 1579 | Ga0068855_100363829 | |||
| 1580 | Ga0068855_100387560 | |||
| 1581 | Ga0070664_100059253 | |||
| 1582 | Ga0070664_100130291 | |||
| 1583 | Ga0070664_100180628 | |||
| 1584 | Ga0070664_100254907 | |||
| 1585 | Ga0070664_100255920 | |||
| 1586 | Ga0070664_100448165 | |||
| 1587 | Ga0070664_100703838 | |||
| 1588 | Ga0070664_100891139 | |||
| 1589 | Ga0070664_101020232 | |||
| 1590 | Ga0070664_101351071 | |||
| 1591 | Ga0068857_100018128 | |||
| 1592 | Ga0068857_100027115 | |||
| 1593 | Ga0068857_100056006 | |||
| 1594 | Ga0068857_100225290 | |||
| 1595 | Ga0068857_100579573 | |||
| 1596 | Ga0068857_101132770 | |||
| 1597 | Ga0068854_100023491 | |||
| 1598 | Ga0068854_100030966 | |||
| 1599 | Ga0068854_100212288 | |||
| 1600 | Ga0068854_100406016 | |||
| 1601 | Ga0068854_100529969 | |||
| 1602 | Ga0068856_100020346 | |||
| 1603 | Ga0068856_100102950 | |||
| 1604 | Ga0068856_100126510 | |||
| 1605 | Ga0068856_100183984 | |||
| 1606 | Ga0068856_100264315 | |||
| 1607 | Ga0068856_100378943 | |||
| 1608 | Ga0068856_100475115 | |||
| 1609 | Ga0068856_101744106 | |||
| 1610 | Ga0068856_101913277 | |||
| 1611 | Ga0068856_102200338 | |||
| 1612 | Ga0070702_100007942 | |||
| 1613 | Ga0070702_100045524 | |||
| 1614 | Ga0070702_100164409 | |||
| 1615 | Ga0068852_100019433 | |||
| 1616 | Ga0068852_100079034 | |||
| 1617 | Ga0068852_100086783 | |||
| 1618 | Ga0068852_100328693 | |||
| 1619 | Ga0068852_101172593 | |||
| 1620 | Ga0068859_100006803 | |||
| 1621 | Ga0068859_100020458 | |||
| 1622 | Ga0068859_100037054 | |||
| 1623 | Ga0068859_100109639 | |||
| 1624 | Ga0068859_100138625 | |||
| 1625 | Ga0068859_100368043 | |||
| 1626 | Ga0068859_100600168 | |||
| 1627 | Ga0068859_101588569 | |||
| 1628 | Ga0068859_103043436 | |||
| 1629 | Ga0068864_100012542 | |||
| 1630 | Ga0068864_100069652 | |||
| 1631 | Ga0068864_100093480 | |||
| 1632 | Ga0068864_101249266 | |||
| 1633 | Ga0068864_101587905 | |||
| 1634 | Ga0068864_101744278 | |||
| 1635 | Ga0068864_101779571 | |||
| 1636 | Ga0068866_10009453 | |||
| 1637 | Ga0068866_10089942 | |||
| 1638 | Ga0068866_10265761 | |||
| 1639 | Ga0068866_10411420 | |||
| 1640 | Ga0068861_100002524 | |||
| 1641 | Ga0068861_100016124 | |||
| 1642 | Ga0068861_100033820 | |||
| 1643 | Ga0068861_100154429 | |||
| 1644 | Ga0068851_10020578 | |||
| 1645 | Ga0068851_10069325 | |||
| 1646 | Ga0068851_10083378 | |||
| 1647 | Ga0068851_10726306 | |||
| 1648 | Ga0068851_10820172 | |||
| 1649 | Ga0068870_10005385 | |||
| 1650 | Ga0068870_10031247 | |||
| 1651 | Ga0068870_10040121 | |||
| 1652 | Ga0068870_10064706 | |||
| 1653 | Ga0068870_10373218 | |||
| 1654 | Ga0068863_100014794 | |||
| 1655 | Ga0068863_100064693 | |||
| 1656 | Ga0068863_100103600 | |||
| 1657 | Ga0068863_100160560 | |||
| 1658 | Ga0068863_100258779 | |||
| 1659 | Ga0068863_100281364 | |||
| 1660 | Ga0068863_100413645 | |||
| 1661 | Ga0068863_100614847 | |||
| 1662 | Ga0068863_100865708 | |||
| 1663 | Ga0068858_100008344 | |||
| 1664 | Ga0068858_100032781 | |||
| 1665 | Ga0068858_100044309 | |||
| 1666 | Ga0068858_100467125 | |||
| 1667 | Ga0068860_100094217 | |||
| 1668 | Ga0068860_100096034 | |||
| 1669 | Ga0068860_100099475 | |||
| 1670 | Ga0068860_100110208 | |||
| 1671 | Ga0068860_100187295 | |||
| 1672 | Ga0068860_100553346 | |||
| 1673 | Ga0068860_101159819 | |||
| 1674 | Ga0068860_101524553 | |||
| 1675 | Ga0068862_100039699 | |||
| 1676 | Ga0068862_100079235 | |||
| 1677 | Ga0068862_100112131 | |||
| 1678 | Ga0068862_100187036 | |||
| 1679 | Ga0081455_10087984 | |||
| 1680 | Ga0081455_10132010 | |||
| 1681 | Ga0081455_10498030 | |||
| 1682 | Ga0081538_10000375 | |||
| 1683 | Ga0081538_10011208 | |||
| 1684 | Ga0081538_10095535 | |||
| 1685 | Ga0070717_10001342 | |||
| 1686 | Ga0070717_10057233 | |||
| 1687 | Ga0070717_10130126 | |||
| 1688 | Ga0070717_11224671 | |||
| 1689 | Ga0075365_10047793 | |||
| 1690 | Ga0075364_10154452 | |||
| 1691 | Ga0070715_10930395 | |||
| 1692 | Ga0070716_100024271 | |||
| 1693 | Ga0070716_100190086 | |||
| 1694 | Ga0070716_100383428 | |||
| 1695 | Ga0070716_100384279 | |||
| 1696 | Ga0070716_101067475 | |||
| 1697 | Ga0070712_100049839 | |||
| 1698 | Ga0070712_100192541 | |||
| 1699 | Ga0070712_100213561 | |||
| 1700 | Ga0070712_100740401 | |||
| 1701 | Ga0097621_100009585 | |||
| 1702 | Ga0097621_100060850 | |||
| 1703 | Ga0097621_100247790 | |||
| 1704 | Ga0097621_100297993 | |||
| 1705 | Ga0097621_100679507 | |||
| 1706 | Ga0097621_100993107 | |||
| 1707 | Ga0097621_101017171 | |||
| 1708 | Ga0097621_101389752 | |||
| 1709 | Ga0075370_10198211 | |||
| 1710 | Ga0068871_100011336 | |||
| 1711 | Ga0068871_100013539 | |||
| 1712 | Ga0068871_100017424 | |||
| 1713 | Ga0068871_100061356 | |||
| 1714 | Ga0068871_100154192 | |||
| 1715 | Ga0068871_100290967 | |||
| 1716 | Ga0068871_100326313 | |||
| 1717 | Ga0068871_100387668 | |||
| 1718 | Ga0068871_100398187 | |||
| 1719 | Ga0068871_100447209 | |||
| 1720 | Ga0068871_101016379 | |||
| 1721 | Ga0068871_101167333 | |||
| 1722 | Ga0075428_100043771 | |||
| 1723 | Ga0075428_101820077 | |||
| 1724 | Ga0075430_100077424 | |||
| 1725 | Ga0075430_100673608 | |||
| 1726 | Ga0075431_100354985 | |||
| 1727 | Ga0075433_10250049 | |||
| 1728 | Ga0075433_10552596 | |||
| 1729 | Ga0075433_10651977 | |||
| 1730 | Ga0075434_100002797 | |||
| 1731 | Ga0075434_100384352 | |||
| 1732 | Ga0075434_100658256 | |||
| 1733 | Ga0075434_100675064 | |||
| 1734 | Ga0075434_101677908 | |||
| 1735 | Ga0075429_100003982 | |||
| 1736 | Ga0068865_100021438 | |||
| 1737 | Ga0068865_100029734 | |||
| 1738 | Ga0068865_100038186 | |||
| 1739 | Ga0068865_100369792 | |||
| 1740 | Ga0075436_100002372 | |||
| 1741 | Ga0075436_100004880 | |||
| 1742 | Ga0075436_100007385 | |||
| 1743 | Ga0075436_100011228 | |||
| 1744 | Ga0075436_100163612 | |||
| 1745 | Ga0075436_100306811 | |||
| 1746 | Ga0075436_100636656 | |||
| 1747 | Ga0097620_100006804 | |||
| 1748 | Ga0097620_100020457 | |||
| 1749 | Ga0097620_100037052 | |||
| 1750 | Ga0097620_100109642 | |||
| 1751 | Ga0097620_100138623 | |||
| 1752 | Ga0097620_100368058 | |||
| 1753 | Ga0097620_100600045 | |||
| 1754 | Ga0097620_101589031 | |||
| 1755 | Ga0097620_103042862 | |||
| 1756 | Ga0075435_100016937 | |||
| 1757 | Ga0075435_100223745 | |||
| 1758 | Ga0075435_100467805 | |||
| 1759 | Ga0075435_100970409 | |||
| 1760 | Ga0075435_101210354 | |||
| 1761 | Ga0105240_10011749 | |||
| 1762 | Ga0105240_10040284 | |||
| 1763 | Ga0105240_10070460 | |||
| 1764 | Ga0105240_10148480 | |||
| 1765 | Ga0105240_10221035 | |||
| 1766 | Ga0105240_11526110 | |||
| 1767 | Ga0111539_10001409 | |||
| 1768 | Ga0111539_10206534 | |||
| 1769 | Ga0111539_10245625 | |||
| 1770 | Ga0105245_10001513 | |||
| 1771 | Ga0105245_10002924 | |||
| 1772 | Ga0105245_10036084 | |||
| 1773 | Ga0105245_10276290 | |||
| 1774 | Ga0105245_10391005 | |||
| 1775 | Ga0105245_10476179 | |||
| 1776 | Ga0105245_10480242 | |||
| 1777 | Ga0105245_11255203 | |||
| 1778 | Ga0105247_10013833 | |||
| 1779 | Ga0105247_10054695 | |||
| 1780 | Ga0105247_10476505 | |||
| 1781 | Ga0105247_10514485 | |||
| 1782 | Ga0105247_10568540 | |||
| 1783 | Ga0105247_10591185 | |||
| 1784 | Ga0105247_11404744 | |||
| 1785 | Ga0114129_10003933 | |||
| 1786 | Ga0114129_10129300 | |||
| 1787 | Ga0114129_10576338 | |||
| 1788 | Ga0105243_10035969 | |||
| 1789 | Ga0105243_10573871 | |||
| 1790 | Ga0105243_11463467 | |||
| 1791 | Ga0105241_10006639 | |||
| 1792 | Ga0105241_10012006 | |||
| 1793 | Ga0105241_10168613 | |||
| 1794 | Ga0105241_10181883 | |||
| 1795 | Ga0105241_10341915 | |||
| 1796 | Ga0105241_10471002 | |||
| 1797 | Ga0105241_11183544 | |||
| 1798 | Ga0105241_12287859 | |||
| 1799 | Ga0105242_10003716 | |||
| 1800 | Ga0105242_10012411 | |||
| 1801 | Ga0105242_10093547 | |||
| 1802 | Ga0105242_10103660 | |||
| 1803 | Ga0105242_10405217 | |||
| 1804 | Ga0105242_11583309 | |||
| 1805 | Ga0105248_10011119 | |||
| 1806 | Ga0105248_10020606 | |||
| 1807 | Ga0105248_10136810 | |||
| 1808 | Ga0105248_10234317 | |||
| 1809 | Ga0105248_10276428 | |||
| 1810 | Ga0105248_10306201 | |||
| 1811 | Ga0105248_10685070 | |||
| 1812 | Ga0105248_11057000 | |||
| 1813 | Ga0105237_10006860 | |||
| 1814 | Ga0105237_10179521 | |||
| 1815 | Ga0105237_10469140 | |||
| 1816 | Ga0105237_10830370 | |||
| 1817 | Ga0105237_10927222 | |||
| 1818 | Ga0105237_12038217 | |||
| 1819 | Ga0105238_10011190 | |||
| 1820 | Ga0105238_10138546 | |||
| 1821 | Ga0105238_10249073 | |||
| 1822 | Ga0105238_10291559 | |||
| 1823 | Ga0105238_11291305 | |||
| 1824 | Ga0105238_11961666 | |||
| 1825 | Ga0105238_13021246 | |||
| 1826 | Ga0105249_10066414 | |||
| 1827 | Ga0105249_10117880 | |||
| 1828 | Ga0105249_10121750 | |||
| 1829 | Ga0105249_10158706 | |||
| 1830 | Ga0105249_11057291 | |||
| 1831 | Ga0105249_12991532 | |||
| 1832 | Ga0105239_10016536 | |||
| 1833 | Ga0105239_10209622 | |||
| 1834 | Ga0105239_10544240 | |||
| 1835 | Ga0105239_10726215 | |||
| 1836 | Ga0105239_10936831 | |||
| 1837 | Ga0105239_11707894 | |||
| 1838 | Ga0105239_12183591 | |||
| 1839 | Ga0105239_12363716 | |||
| 1840 | Ga0105246_10003229 | |||
| 1841 | Ga0105246_10013497 | |||
| 1842 | Ga0105246_10106621 | |||
| 1843 | Ga0105246_10119425 | |||
| 1844 | Ga0105246_10201895 | |||
| 1845 | Ga0157337_1003496 | |||
| 1846 | Ga0157373_10006408 | |||
| 1847 | Ga0157373_10010571 | |||
| 1848 | Ga0157373_10673671 | |||
| 1849 | Ga0157371_10002909 | |||
| 1850 | Ga0157371_10015099 | |||
| 1851 | Ga0157371_10217440 | |||
| 1852 | Ga0157371_10624601 | |||
| 1853 | Ga0157371_10985387 | |||
| 1854 | Ga0157370_10067220 | |||
| 1855 | Ga0157370_10596929 | |||
| 1856 | Ga0157370_10785521 | |||
| 1857 | Ga0157370_10820473 | |||
| 1858 | Ga0157370_11323731 | |||
| 1859 | Ga0157370_11633896 | |||
| 1860 | Ga0157369_10051967 | |||
| 1861 | Ga0157369_10056671 | |||
| 1862 | Ga0157369_10063704 | |||
| 1863 | Ga0157369_10206937 | |||
| 1864 | Ga0157369_10250577 | |||
| 1865 | Ga0157374_10014124 | |||
| 1866 | Ga0157374_10074767 | |||
| 1867 | Ga0157374_10079953 | |||
| 1868 | Ga0157374_10088131 | |||
| 1869 | Ga0157374_10222367 | |||
| 1870 | Ga0157374_10246146 | |||
| 1871 | Ga0157374_10300959 | |||
| 1872 | Ga0157374_10303400 | |||
| 1873 | Ga0157374_12342562 | |||
| 1874 | Ga0157374_12819007 | |||
| 1875 | Ga0157378_10000695 | |||
| 1876 | Ga0157378_10003297 | |||
| 1877 | Ga0157378_10015002 | |||
| 1878 | Ga0157378_10173174 | |||
| 1879 | Ga0157378_10278142 | |||
| 1880 | Ga0157378_10372478 | |||
| 1881 | Ga0157378_11361682 | |||
| 1882 | Ga0157378_12122184 | |||
| 1883 | Ga0163162_10002605 | |||
| 1884 | Ga0163162_10032931 | |||
| 1885 | Ga0163162_10038936 | |||
| 1886 | Ga0163162_10081380 | |||
| 1887 | Ga0163162_10082742 | |||
| 1888 | Ga0163162_10115603 | |||
| 1889 | Ga0163162_10213930 | |||
| 1890 | Ga0163162_10371461 | |||
| 1891 | Ga0163162_10913531 | |||
| 1892 | Ga0163162_11643941 | |||
| 1893 | Ga0163162_12944152 | |||
| 1894 | Ga0163162_13398806 | |||
| 1895 | Ga0157372_10028501 | |||
| 1896 | Ga0157372_10168540 | |||
| 1897 | Ga0157372_10487444 | |||
| 1898 | Ga0157372_10500589 | |||
| 1899 | Ga0157372_10730593 | |||
| 1900 | Ga0157372_11376139 | |||
| 1901 | Ga0157372_11825520 | |||
| 1902 | Ga0157372_12418254 | |||
| 1903 | Ga0157375_10035022 | |||
| 1904 | Ga0157375_10112524 | |||
| 1905 | Ga0157375_10119818 | |||
| 1906 | Ga0157375_10180998 | |||
| 1907 | Ga0157375_10224039 | |||
| 1908 | Ga0157375_10251474 | |||
| 1909 | Ga0157375_10261771 | |||
| 1910 | Ga0157375_10467400 | |||
| 1911 | Ga0157375_10594108 | |||
| 1912 | Ga0157375_10717993 | |||
| 1913 | Ga0163163_10004114 | |||
| 1914 | Ga0163163_10015926 | |||
| 1915 | Ga0163163_10024238 | |||
| 1916 | Ga0163163_10031497 | |||
| 1917 | Ga0163163_10127654 | |||
| 1918 | Ga0163163_10234738 | |||
| 1919 | Ga0163163_10531144 | |||
| 1920 | Ga0163163_10553239 | |||
| 1921 | Ga0157380_10002195 | |||
| 1922 | Ga0157380_10005146 | |||
| 1923 | Ga0182008_10001761 | |||
| 1924 | Ga0182008_10117712 | |||
| 1925 | Ga0157377_10000703 | |||
| 1926 | Ga0157377_10003516 | |||
| 1927 | Ga0157377_10034483 | |||
| 1928 | Ga0157377_10234401 | |||
| 1929 | Ga0157377_10656138 | |||
| 1930 | Ga0157377_10750776 | |||
| 1931 | Ga0157379_10007733 | |||
| 1932 | Ga0157379_10107212 | |||
| 1933 | Ga0157379_10275774 | |||
| 1934 | Ga0157379_10853173 | |||
| 1935 | Ga0157379_11208038 | |||
| 1936 | Ga0157376_10091623 | |||
| 1937 | Ga0157376_10146029 | |||
| 1938 | Ga0157376_10173658 | |||
| 1939 | Ga0157376_10229379 | |||
| 1940 | Ga0157376_10518957 | |||
| 1941 | Ga0157376_10537068 | |||
| 1942 | Ga0157376_11602388 | |||
| 1943 | Ga0157376_11607296 | |||
| 1944 | Ga0157376_11711350 | |||
| 1945 | Ga0182006_1169850 | |||
| 1946 | Ga0182007_10067860 | |||
| 1947 | Ga0163161_10001109 | |||
| 1948 | Ga0163161_10326170 | |||
| 1949 | Ga0163161_11380973 | |||
| 1950 | Ga0206356_11077341 | |||
| 1951 | Ga0206351_10706853 | |||
| 1952 | Ga0206354_10157849 | |||
| 1953 | Ga0206354_11090343 | |||
| 1954 | Ga0206354_11457533 | |||
| 1955 | Ga0206353_10520053 | |||
| 1956 | Ga0206353_10525352 | |||
| 1957 | Ga0206353_11801339 | |||
| 1958 | Ga0207697_10005260 | |||
| 1959 | Ga0207656_10008994 | |||
| 1960 | Ga0207656_10020340 | |||
| 1961 | Ga0207656_10024011 | |||
| 1962 | Ga0207682_10133448 | |||
| 1963 | Ga0207692_10554920 | |||
| 1964 | Ga0207692_10814260 | |||
| 1965 | Ga0207642_10003430 | |||
| 1966 | Ga0207642_10038221 | |||
| 1967 | Ga0207642_10745672 | |||
| 1968 | Ga0207710_10014060 | |||
| 1969 | Ga0207710_10665647 | |||
| 1970 | Ga0207688_10000393 | |||
| 1971 | Ga0207688_10004736 | |||
| 1972 | Ga0207688_10023107 | |||
| 1973 | Ga0207688_10998545 | |||
| 1974 | Ga0207680_10005965 | |||
| 1975 | Ga0207680_10062010 | |||
| 1976 | Ga0207680_10111136 | |||
| 1977 | Ga0207647_10002678 | |||
| 1978 | Ga0207699_10020840 | |||
| 1979 | Ga0207699_10024951 | |||
| 1980 | Ga0207699_10490367 | |||
| 1981 | Ga0207645_10000019 | |||
| 1982 | Ga0207645_10050408 | |||
| 1983 | Ga0207645_10332038 | |||
| 1984 | Ga0207643_10000432 | |||
| 1985 | Ga0207643_10017042 | |||
| 1986 | Ga0207643_10056440 | |||
| 1987 | Ga0207643_10089529 | |||
| 1988 | Ga0207643_10097530 | |||
| 1989 | Ga0207643_10259783 | |||
| 1990 | Ga0207643_10909607 | |||
| 1991 | Ga0207705_10046456 | |||
| 1992 | Ga0207705_10063567 | |||
| 1993 | Ga0207705_10145141 | |||
| 1994 | Ga0207705_10542997 | |||
| 1995 | Ga0207684_11389414 | |||
| 1996 | Ga0207654_10009502 | |||
| 1997 | Ga0207654_10013219 | |||
| 1998 | Ga0207654_10134217 | |||
| 1999 | Ga0207654_10254141 | |||
| 2000 | Ga0207654_10269338 | |||
| 2001 | Ga0207707_10002237 | |||
| 2002 | Ga0207707_10014753 | |||
| 2003 | Ga0207707_10053394 | |||
| 2004 | Ga0207707_10106509 | |||
| 2005 | Ga0207707_10343048 | |||
| 2006 | Ga0207707_11014909 | |||
| 2007 | Ga0207695_10079393 | |||
| 2008 | Ga0207695_10377001 | |||
| 2009 | Ga0207695_10835226 | |||
| 2010 | Ga0207671_10208720 | |||
| 2011 | Ga0207671_10325025 | |||
| 2012 | Ga0207671_10473588 | |||
| 2013 | Ga0207693_10021046 | |||
| 2014 | Ga0207693_10176204 | |||
| 2015 | Ga0207693_10263793 | |||
| 2016 | Ga0207693_10276855 | |||
| 2017 | Ga0207663_10169935 | |||
| 2018 | Ga0207663_10879560 | |||
| 2019 | Ga0207660_10045160 | |||
| 2020 | Ga0207660_10055513 | |||
| 2021 | Ga0207660_10056915 | |||
| 2022 | Ga0207660_10507836 | |||
| 2023 | Ga0207660_10953458 | |||
| 2024 | Ga0207662_10000715 | |||
| 2025 | Ga0207662_10368848 | |||
| 2026 | Ga0207657_10000731 | |||
| 2027 | Ga0207657_10005013 | |||
| 2028 | Ga0207657_10009782 | |||
| 2029 | Ga0207657_10028465 | |||
| 2030 | Ga0207657_10228610 | |||
| 2031 | Ga0207657_10441906 | |||
| 2032 | Ga0207657_10834452 | |||
| 2033 | Ga0207657_10930788 | |||
| 2034 | Ga0207649_10000188 | |||
| 2035 | Ga0207649_10004372 | |||
| 2036 | Ga0207649_10232878 | |||
| 2037 | Ga0207649_10330866 | |||
| 2038 | Ga0207649_10730396 | |||
| 2039 | Ga0207652_10018886 | |||
| 2040 | Ga0207652_10024777 | |||
| 2041 | Ga0207652_10032420 | |||
| 2042 | Ga0207652_10153892 | |||
| 2043 | Ga0207652_10650400 | |||
| 2044 | Ga0207646_10120585 | |||
| 2045 | Ga0207681_10013593 | |||
| 2046 | Ga0207681_10022406 | |||
| 2047 | Ga0207681_10050972 | |||
| 2048 | Ga0207694_10132648 | |||
| 2049 | Ga0207694_10938251 | |||
| 2050 | Ga0207650_10000024 | |||
| 2051 | Ga0207650_10201193 | |||
| 2052 | Ga0207650_10579411 | |||
| 2053 | Ga0207650_11392797 | |||
| 2054 | Ga0207659_10010347 | |||
| 2055 | Ga0207659_10228722 | |||
| 2056 | Ga0207687_10001849 | |||
| 2057 | Ga0207687_10007823 | |||
| 2058 | Ga0207687_10039043 | |||
| 2059 | Ga0207687_10155136 | |||
| 2060 | Ga0207687_10334030 | |||
| 2061 | Ga0207687_10341831 | |||
| 2062 | Ga0207687_10478405 | |||
| 2063 | Ga0207700_10700615 | |||
| 2064 | Ga0207664_10293259 | |||
| 2065 | Ga0207664_11533377 | |||
| 2066 | Ga0207664_11912645 | |||
| 2067 | Ga0207644_10068646 | |||
| 2068 | Ga0207644_10239694 | |||
| 2069 | Ga0207644_10601611 | |||
| 2070 | Ga0207690_10019446 | |||
| 2071 | Ga0207690_10026441 | |||
| 2072 | Ga0207690_10220141 | |||
| 2073 | Ga0207690_10308487 | |||
| 2074 | Ga0207690_11129932 | |||
| 2075 | Ga0207690_11178074 | |||
| 2076 | Ga0207706_10000912 | |||
| 2077 | Ga0207706_10003049 | |||
| 2078 | Ga0207706_10055523 | |||
| 2079 | Ga0207706_10210884 | |||
| 2080 | Ga0207706_10628332 | |||
| 2081 | Ga0207686_10025124 | |||
| 2082 | Ga0207686_10026204 | |||
| 2083 | Ga0207686_10056448 | |||
| 2084 | Ga0207686_10610278 | |||
| 2085 | Ga0207686_10620163 | |||
| 2086 | Ga0207709_10128148 | |||
| 2087 | Ga0207709_10137494 | |||
| 2088 | Ga0207709_10477537 | |||
| 2089 | Ga0207709_11808566 | |||
| 2090 | Ga0207670_10080240 | |||
| 2091 | Ga0207670_10112448 | |||
| 2092 | Ga0207670_10112449 | |||
| 2093 | Ga0207670_10857842 | |||
| 2094 | Ga0207670_11203169 | |||
| 2095 | Ga0207669_10003738 | |||
| 2096 | Ga0207669_10844599 | |||
| 2097 | Ga0207704_10010186 | |||
| 2098 | Ga0207704_10063743 | |||
| 2099 | Ga0207704_10235851 | |||
| 2100 | Ga0207704_10681596 | |||
| 2101 | Ga0207665_10016629 | |||
| 2102 | Ga0207665_10142527 | |||
| 2103 | Ga0207665_10375427 | |||
| 2104 | Ga0207691_10003833 | |||
| 2105 | Ga0207691_10028474 | |||
| 2106 | Ga0207691_10295317 | |||
| 2107 | Ga0207691_10387425 | |||
| 2108 | Ga0207711_10001719 | |||
| 2109 | Ga0207711_10053771 | |||
| 2110 | Ga0207711_10183183 | |||
| 2111 | Ga0207711_10318879 | |||
| 2112 | Ga0207711_10434944 | |||
| 2113 | Ga0207711_10437427 | |||
| 2114 | Ga0207711_10712904 | |||
| 2115 | Ga0207711_11295918 | |||
| 2116 | Ga0207689_10001992 | |||
| 2117 | Ga0207689_10002848 | |||
| 2118 | Ga0207689_10025057 | |||
| 2119 | Ga0207689_10053430 | |||
| 2120 | Ga0207689_10064764 | |||
| 2121 | Ga0207689_11686934 | |||
| 2122 | Ga0207661_10000067 | |||
| 2123 | Ga0207661_10001401 | |||
| 2124 | Ga0207661_10001542 | |||
| 2125 | Ga0207661_10040019 | |||
| 2126 | Ga0207661_10076039 | |||
| 2127 | Ga0207661_10370686 | |||
| 2128 | Ga0207661_10680870 | |||
| 2129 | Ga0207679_10000055 | |||
| 2130 | Ga0207679_10090635 | |||
| 2131 | Ga0207679_10173263 | |||
| 2132 | Ga0207679_10192682 | |||
| 2133 | Ga0207679_10269513 | |||
| 2134 | Ga0207679_10498576 | |||
| 2135 | Ga0207667_10079834 | |||
| 2136 | Ga0207667_10618316 | |||
| 2137 | Ga0207667_11420820 | |||
| 2138 | Ga0207651_10012890 | |||
| 2139 | Ga0207651_10083509 | |||
| 2140 | Ga0207651_10294871 | |||
| 2141 | Ga0207651_10337602 | |||
| 2142 | Ga0207712_10229540 | |||
| 2143 | Ga0207712_10367773 | |||
| 2144 | Ga0207712_10684581 | |||
| 2145 | Ga0207668_10036023 | |||
| 2146 | Ga0207668_10038261 | |||
| 2147 | Ga0207668_10046904 | |||
| 2148 | Ga0207640_10011325 | |||
| 2149 | Ga0207640_10204128 | |||
| 2150 | Ga0207640_10237235 | |||
| 2151 | Ga0207640_10237779 | |||
| 2152 | Ga0207640_10725099 | |||
| 2153 | Ga0207640_10826263 | |||
| 2154 | Ga0207658_10039535 | |||
| 2155 | Ga0207658_10213881 | |||
| 2156 | Ga0207658_10560212 | |||
| 2157 | Ga0207658_11075044 | |||
| 2158 | Ga0207677_10010017 | |||
| 2159 | Ga0207677_10013512 | |||
| 2160 | Ga0207677_10014490 | |||
| 2161 | Ga0207677_10063300 | |||
| 2162 | Ga0207677_11072475 | |||
| 2163 | Ga0207677_11142317 | |||
| 2164 | Ga0207703_10002963 | |||
| 2165 | Ga0207703_10055609 | |||
| 2166 | Ga0207703_11170958 | |||
| 2167 | Ga0207639_10296093 | |||
| 2168 | Ga0207639_11410369 | |||
| 2169 | Ga0207678_10001331 | |||
| 2170 | Ga0207678_10001590 | |||
| 2171 | Ga0207678_10437116 | |||
| 2172 | Ga0207678_11000136 | |||
| 2173 | Ga0207708_10003250 | |||
| 2174 | Ga0207708_10048689 | |||
| 2175 | Ga0207708_10291754 | |||
| 2176 | Ga0207702_10021041 | |||
| 2177 | Ga0207702_10042043 | |||
| 2178 | Ga0207702_10160873 | |||
| 2179 | Ga0207702_10169653 | |||
| 2180 | Ga0207702_10194248 | |||
| 2181 | Ga0207702_10202889 | |||
| 2182 | Ga0207702_10431996 | |||
| 2183 | Ga0207702_12508089 | |||
| 2184 | Ga0207641_10000030 | |||
| 2185 | Ga0207641_10078190 | |||
| 2186 | Ga0207641_10263389 | |||
| 2187 | Ga0207641_10361956 | |||
| 2188 | Ga0207641_10381618 | |||
| 2189 | Ga0207641_10433545 | |||
| 2190 | Ga0207641_10648087 | |||
| 2191 | Ga0207641_11607921 | |||
| 2192 | Ga0207648_10000031 | |||
| 2193 | Ga0207648_10040838 | |||
| 2194 | Ga0207676_10001006 | |||
| 2195 | Ga0207676_10014080 | |||
| 2196 | Ga0207676_10652351 | |||
| 2197 | Ga0207676_10679121 | |||
| 2198 | Ga0207676_10852250 | |||
| 2199 | Ga0207676_11209463 | |||
| 2200 | Ga0207674_10000618 | |||
| 2201 | Ga0207674_10002728 | |||
| 2202 | Ga0207674_10040199 | |||
| 2203 | Ga0207674_10076386 | |||
| 2204 | Ga0207674_10169715 | |||
| 2205 | Ga0207674_10433101 | |||
| 2206 | Ga0207674_11356129 | |||
| 2207 | Ga0207675_100008535 | |||
| 2208 | Ga0207675_100011099 | |||
| 2209 | Ga0207675_100038821 | |||
| 2210 | Ga0207683_10014563 | |||
| 2211 | Ga0207683_10084602 | |||
| 2212 | Ga0207683_10351753 | |||
| 2213 | Ga0207683_10665043 | |||
| 2214 | Ga0207698_10135238 | |||
| 2215 | Ga0207698_10194152 | |||
| 2216 | Ga0207698_10293887 | |||
| 2217 | Ga0207698_10307446 | |||
| 2218 | Ga0207698_10639542 | |||
| 2219 | Ga0207698_10910774 | |||
| 2220 | Ga0209588_1044297 | |||
| 2221 | Ga0209998_10164321 | |||
| 2222 | Ga0207428_10030102 | |||
| 2223 | Ga0207428_10135611 | |||
| 2224 | Ga0268266_10005546 | |||
| 2225 | Ga0268266_10128776 | |||
| 2226 | Ga0268266_10307359 | |||
| 2227 | Ga0268266_11617406 | |||
| 2228 | Ga0268265_10092033 | |||
| 2229 | Ga0268265_10094108 | |||
| 2230 | Ga0268265_10140531 | |||
| 2231 | Ga0268265_10150376 | |||
| 2232 | Ga0268265_12643113 | |||
| 2233 | Ga0268264_10046537 | |||
| 2234 | Ga0268264_10123056 | |||
| 2235 | Ga0268264_10186689 | |||
| 2236 | Ga0268264_10255245 | |||
| 2237 | Ga0268264_10256384 | |||
| 2238 | Ga0268264_10699368 | |||
| 2239 | Ga0268264_11583787 | |||
| 2240 | Ga0268264_11814294 | |||
| 2241 | Ga0265337_1077731 | |||
| 2242 | Ga0265326_10060152 | |||
| 2243 | Ga0265319_1044163 | |||
| 2244 | Ga0265319_1052405 | |||
| 2245 | Ga0265323_10125494 | |||
| 2246 | Ga0265322_10024897 | |||
| 2247 | Ga0265336_10003729 | |||
| 2248 | Ga0265338_10007600 | |||
| 2249 | Ga0265325_10005401 | |||
| 2250 | Ga0265340_10001376 | |||
| 2251 | Ga0265316_10172810 | |||
| 2252 | Ga0265313_10024931 | |||
| 2253 | Ga0316576_10024976 | |||
| 2254 | Ga0316576_10042070 | |||
| 2255 | Ga0316576_10195478 | |||
| 2256 | Ga0316578_10072799 | |||
| 2257 | Ga0316578_10189013 | |||
| 2258 | Ga0307405_10216675 | |||
| 2259 | Ga0316577_10036591 | |||
| 2260 | Ga0307410_10700937 | |||
| 2261 | Ga0307407_10189453 | |||
| 2262 | Ga0307416_101347574 | |||
| 2263 | Ga0307414_10631030 | |||
| 2264 | Ga0307415_100262168 | |||
| 2265 | Ga0316585_10137882 | |||
| 2266 | Ga0373948_0015880 | |||
| 2267 | Ga0373950_0038783 | |||
| 2268 | Ga0373926_0031683 | |||
| 2269 | Ga0373926_0150284 | |||
| 2270 | Ga0373944_0023577 | |||
| 2271 | Ga0373949_0141694 | |||
| 2272 | Ga0373936_0002175 | |||
| 2273 | Ga0373936_0167725 | |||
| 2274 | Ga0373939_0017420 | |||
| 2275 | Ga0373941_0075559 | |||
| 2276 | Ga0373941_0362854 | |||
| 2277 | Ga0373941_0375371 | |||
| 2278 | Ga0373945_0140031 | |||
| 2279 | Ga0373953_0241141 | |||
| 2280 | Ga0373957_0183595 | |||
| 2281 | Ga0373960_0138285 | |||
| 2282 | Ga0373960_0411822 | |||
| 2283 | Ga0373943_0107216 | |||
| 2284 | Ga0373943_0137020 | |||
| 2285 | Ga0373943_0360936 | |||
| 2286 | Ga0373943_0668507 | |||
| 2287 | Ga0373946_0073471 | |||
| 2288 | Ga0373955_0189434 | |||
| 2289 | Ga0373961_0201548 | |||
| 2290 | Ga0373961_0316119 | |||
| 2291 | Ga0373961_0391214 | |||
| 2292 | Ga0316574_0151133 | |||
| 2293 | Ga0316574_0155696 | |||
| 2294 | Ga0316574_0499900 | |||
| 2295 | Ga0373924_0039844 | |||
| 2296 | Ga0373931_0037515 | |||
| 2297 | Ga0373931_0117624 | |||
| 2298 | Ga0373927_0444905 | |||
| 2299 | Ga0373933_0103943 | |||
| 2300 | Ga0373933_0641958 | |||
| 2301 | Ga0373947_0018665 | |||
| 2302 | Ga0373947_0193680 | |||
| 2303 | Ga0373937_0002393 | |||
| 2304 | Ga0373937_0083150 | |||
| 2305 | Ga0373937_0171915 | |||
| 2306 | Ga0373937_0420769 | |||
| 2307 | Ga0316582_0374009 | |||
| 2308 | Ga0316584_0086994 | |||
| 2309 | Ga0316584_0228639 | |||
| 2310 | Ga0373925_0001169 | |||
| 2311 | Ga0373925_0283285 | |||
| 2312 | Ga0373925_0488677 | |||
| 2313 | Ga0373925_1067842 | |||
| 2314 | Ga0395900_0093144 | |||
| 2315 | Ga0395900_0860393 | |||
| 2316 | Ga0395898_0408364 | |||
| 2317 | Ga0395905_0277710 | |||
| 2318 | Ga0395905_1417871 | |||
| 2319 | Ga0436364_0868731 | |||
| 2320 | Ga0395901_0032207 | |||
| 2321 | Ga0395901_0640637 | |||
| 2322 | Ga0395901_1209235 | |||
| 2323 | Ga0436365_1865349 | |||
| 2324 | Ga0436362_0068786 | |||
| 2325 | Ga0436362_0197399 | |||
| 2326 | Ga0439453_0009799 | |||
| 2327 | Ga0451804_0554939 | |||
| 2328 | Ga0451855_1312722 | |||
| 2329 | Ga0439451_010984 | |||
| 2330 | Ga0439454_003816 | |||
| 2331 | Ga0450914_002057 | |||
| 2332 | Ga0450920_012436 | |||
| 2333 | Ga0450905_061641 | |||
| 2334 | Ga0450906_003773 | |||
| 2335 | Ga0450908_007909 | |||
| 2336 | Ga0439464_0055024 | |||
| 2337 | Ga0450916_015776 | |||
| 2338 | Ga0451577_1765109 | |||
| 2339 | Ga0466969_0051021 | |||
| 2340 | Ga0466966_0772016 | |||
| 2341 | Ga0466961_0074888 | |||
| 2342 | Ga0466963_0182756 | |||
| 2343 | Ga0466963_0748781 | |||
| 2344 | Ga0466963_0880227 | |||
| 2345 | Ga0466971_0001350 | |||
| 2346 | Ga0466957_0152252 | |||
| 2347 | Ga0466957_0451704 | |||
| 2348 | Ga0466957_0635498 | |||
| 2349 | Ga0466960_0758981 | |||
| 2350 | Ga0466959_0010178 | |||
| 2351 | Ga0466959_0055746 | |||
| 2352 | Ga0466959_0992303 | |||
| 2353 | Ga0451576_2115528 | |||
| 2354 | Ga0466958_0022669 | |||
| 2355 | Ga0466958_0028012 | |||
| 2356 | Ga0466958_0150993 | |||
| 2357 | Ga0466958_1012797 | |||
| 2358 | Ga0466967_0021185 | |||
| 2359 | Ga0466967_0026563 | |||
| 2360 | Ga0466967_0147809 | |||
| 2361 | Ga0466967_0402266 | |||
| 2362 | Ga0466967_0723471 | |||
| 2363 | Ga0495629_0584444 | |||
| 2364 | Ga0495653_0187253 | |||
| 2365 | Ga0495580_0000116 | |||
| 2366 | Ga0495580_0010633 | |||
| 2367 | Ga0495580_0180365 | |||
| 2368 | Ga0495580_0192593 | |||
| 2369 | Ga0495580_0518531 | |||
| 2370 | Ga0495580_0652213 | |||
| 2371 | Ga0495580_0905282 | |||
| 2372 | Ga0495582_0054763 | |||
| 2373 | Ga0495582_0628413 | |||
| 2374 | Ga0495639_0386809 | |||
| 2375 | Ga0495585_0611406 | |||
| 2376 | Ga0495594_0219039 | |||
| 2377 | Ga0495608_0292066 | |||
| 2378 | Ga0495630_0109339 | |||
| 2379 | Ga0495630_0502230 | |||
| 2380 | Ga0495630_0637890 | |||
| 2381 | Ga0495630_1287939 | |||
| 2382 | Ga0495631_0426462 | |||
| 2383 | Ga0495644_0093220 | |||
| 2384 | Ga0495652_0284847 | |||
| 2385 | Ga0495665_0130938 | |||
| 2386 | Ga0495665_0349661 | |||
| 2387 | Ga0495586_0003843 | |||
| 2388 | Ga0495586_0381312 | |||
| 2389 | Ga0495587_0267520 | |||
| 2390 | Ga0495645_0698883 | |||
| 2391 | Ga0495656_0069159 | |||
| 2392 | Ga0495656_0125264 | |||
| 2393 | Ga0495668_0394838 | |||
| 2394 | Ga0495588_0016297 | |||
| 2395 | Ga0495599_0373343 | |||
| 2396 | Ga0495623_0205519 | |||
| 2397 | Ga0495623_0659650 | |||
| 2398 | Ga0495658_0022699 | |||
| 2399 | Ga0495658_0155773 | |||
| 2400 | Ga0495658_0182073 | |||
| 2401 | Ga0495669_0001864 | |||
| 2402 | Ga0495669_0040733 | |||
| 2403 | Ga0495613_0024887 | |||
| 2404 | Ga0495613_0218700 | |||
| 2405 | Ga0495613_0298883 | |||
| 2406 | Ga0495624_0415794 | |||
| 2407 | Ga0495670_0497662 | |||
| 2408 | Ga0495581_0694405 | |||
| 2409 | Ga0495604_0422940 | |||
| 2410 | Ga0495604_0469062 | |||
| 2411 | Ga0495604_1024605 | |||
| 2412 | Ga0495676_0050963 | |||
| 2413 | Ga0495676_0573942 | |||
| 2414 | Ga0495680_0394721 | |||
| 2415 | Ga0495680_1103004 | |||
| 2416 | Ga0495683_0088327 | |||
| 2417 | Ga0495684_0389692 | |||
| 2418 | Ga0495684_0428849 | |||
| 2419 | Ga0495593_0185945 | |||
| 2420 | Ga0495593_0593320 | |||
| 2421 | Ga0495602_0384123 | |||
| 2422 | Ga0495602_0759495 | |||
| 2423 | Ga0496100_0010347 | |||
| 2424 | Ga0496100_0226874 | |||
| 2425 | Ga0496100_0685755 | |||
| 2426 | Ga0496100_0705349 | |||
| 2427 | Ga0496101_0025335 | |||
| 2428 | Ga0496101_0102413 | |||
| 2429 | Ga0496101_0190221 | |||
| 2430 | Ga0496101_0437880 | |||
| 2431 | Ga0496101_0467431 | |||
| 2432 | Ga0496101_0707588 | |||
| 2433 | Ga0496102_0084282 | |||
| 2434 | Ga0496102_0159591 | |||
| 2435 | Ga0496102_0390861 | |||
| 2436 | Ga0496102_0425386 | |||
| 2437 | Ga0496102_0524267 | |||
| 2438 | Ga0496102_0771183 | |||
| 2439 | Ga0496102_1756005 | |||
| 2440 | Ga0496103_0187447 | |||
| 2441 | Ga0496103_0553735 | |||
| 2442 | Ga0496104_0032468 | |||
| 2443 | Ga0496104_0275845 | |||
| 2444 | Ga0496104_0282967 | |||
| 2445 | Ga0496104_0295423 | |||
| 2446 | Ga0496104_0345512 | |||
| 2447 | Ga0496104_0476060 | |||
| 2448 | Ga0496104_0497486 | |||
| 2449 | Ga0496104_0669393 | |||
| 2450 | Ga0496104_1366253 | |||
| 2451 | Ga0496105_0056007 | |||
| 2452 | Ga0496105_0179918 | |||
| 2453 | Ga0496105_0958143 | |||
| 2454 | Ga0496106_0409171 | |||
| 2455 | Ga0496106_0473493 | |||
| 2456 | Ga0496106_0739210 | |||
| 2457 | Ga0496106_0856878 | |||
| 2458 | Ga0496106_0986674 | |||
| 2459 | Ga0496107_0050240 | |||
| 2460 | Ga0496107_0108919 | |||
| 2461 | Ga0496107_0305058 | |||
| 2462 | Ga0496107_0666717 | |||
| 2463 | Ga0496107_0771609 | |||
| 2464 | Ga0496107_1078853 | |||
| 2465 | Ga0496108_0000602 | |||
| 2466 | Ga0496108_0004142 | |||
| 2467 | Ga0496108_0091571 | |||
| 2468 | Ga0496108_0420673 | |||
| 2469 | Ga0496108_1377197 | |||
| 2470 | Ga0496109_0000941 | |||
| 2471 | Ga0496109_0006116 | |||
| 2472 | Ga0496109_0033373 | |||
| 2473 | Ga0496109_0195340 | |||
| 2474 | Ga0496109_0208834 | |||
| 2475 | Ga0496109_0243055 | |||
| 2476 | Ga0496109_0325795 | |||
| 2477 | Ga0496109_0527243 | |||
| 2478 | Ga0496109_1245121 | |||
| 2479 | Ga0496109_1283022 | |||
| 2480 | Ga0496110_0001419 | |||
| 2481 | Ga0496110_0006002 | |||
| 2482 | Ga0496110_0017934 | |||
| 2483 | Ga0496110_0190466 | |||
| 2484 | Ga0496110_0352206 | |||
| 2485 | Ga0496111_0000612 | |||
| 2486 | Ga0496111_0001316 | |||
| 2487 | Ga0496111_0119718 | |||
| 2488 | Ga0496111_0283496 | |||
| 2489 | Ga0496111_0301194 | |||
| 2490 | Ga0496111_0476695 | |||
| 2491 | Ga0496112_0000964 | |||
| 2492 | Ga0496112_0007171 | |||
| 2493 | Ga0496112_0021577 | |||
| 2494 | Ga0496112_0047308 | |||
| 2495 | Ga0496112_0124580 | |||
| 2496 | Ga0496112_0163855 | |||
| 2497 | Ga0496112_0226424 | |||
| 2498 | Ga0496112_0327249 | |||
| 2499 | Ga0496112_0455150 | |||
| 2500 | Ga0496112_0610318 | |||
| 2501 | Ga0496113_0000942 | |||
| 2502 | Ga0496113_0077713 | |||
| 2503 | Ga0496113_0178448 | |||
| 2504 | Ga0496113_0487052 | |||
| 2505 | Ga0496113_1174003 | |||
| 2506 | Ga0496114_0150802 | |||
| 2507 | Ga0496114_0236526 | |||
| 2508 | Ga0496114_0347198 | |||
| 2509 | Ga0496114_0400477 | |||
| 2510 | Ga0496115_0030437 | |||
| 2511 | Ga0496115_0955471 | |||
| 2512 | Ga0495682_0200746 | |||
| 2513 | Ga0501031_0045189 | |||
| 2514 | Ga0501032_0018830 | |||
| 2515 | Ga0501032_0264191 | |||
| 2516 | Ga0501033_0136620 | |||
| 2517 | Ga0501033_0507254 | |||
| 2518 | Ga0501036_0015843 | |||
| 2519 | Ga0501036_0124625 | |||
| 2520 | Ga0501037_0226548 | |||
| 2521 | Ga0501037_0624489 | |||
| 2522 | Ga0501038_0047096 | |||
| 2523 | Ga0501039_0333206 | |||
| 2524 | Ga0501039_0841562 | |||
| 2525 | Ga0501040_0002790 | |||
| 2526 | Ga0501040_0022602 | |||
| 2527 | Ga0501040_0035632 | |||
| 2528 | Ga0501040_0252850 | |||
| 2529 | Ga0501041_0002443 | |||
| 2530 | Ga0501041_0003646 | |||
| 2531 | Ga0501042_0000396 | |||
| 2532 | Ga0501042_0045429 | |||
| 2533 | Ga0501042_1041692 | |||
| 2534 | Ga0501043_0087192 | |||
| 2535 | Ga0501046_0040849 | |||
| 2536 | Ga0501046_0052281 | |||
| 2537 | Ga0501046_0677666 | |||
| 2538 | Ga0501047_0304752 | |||
| 2539 | Ga0501047_0641300 | |||
| 2540 | Ga0501048_0002492 | |||
| 2541 | Ga0501048_0128294 | |||
| 2542 | Ga0501048_0554341 | |||
| 2543 | Ga0501068_0086110 | |||
| 2544 | Ga0501069_0559855 | |||
| 2545 | Ga0501070_0023046 | |||
| 2546 | Ga0501070_0281740 | |||
| 2547 | Ga0501070_0623056 | |||
| 2548 | Ga0501071_0003292 | |||
| 2549 | Ga0501071_0007296 | |||
| 2550 | Ga0501071_0420785 | |||
| 2551 | Ga0501071_0817523 | |||
| 2552 | Ga0501072_0011126 | |||
| 2553 | Ga0501072_0597586 | |||
| 2554 | Ga0501072_0866542 | |||
| 2555 | Ga0501073_0016278 | |||
| 2556 | Ga0501073_0109818 | |||
| 2557 | Ga0501074_0003979 | |||
| 2558 | Ga0501074_0009456 | |||
| 2559 | Ga0501074_0029852 | |||
| 2560 | Ga0501074_0316690 | |||
| 2561 | Ga0501075_0008695 | |||
| 2562 | Ga0501075_0008857 | |||
| 2563 | Ga0501075_1355211 | |||
| 2564 | Ga0501076_0000767 | |||
| 2565 | Ga0501076_0093553 | |||
| 2566 | Ga0501076_0101506 | |||
| 2567 | Ga0501076_0288373 | |||
| 2568 | Ga0501077_0003676 | |||
| 2569 | Ga0501077_0004634 | |||
| 2570 | Ga0501217_064451 | |||
| 2571 | Ga0501233_041059 | |||
| 2572 | Ga0501258_005425 | |||
| 2573 | Ga0501261_024961 | |||
| 2574 | Ga0501234_013588 | |||
| 2575 | Ga0501079_0007024 | |||
| 2576 | Ga0501079_0019926 | |||
| 2577 | Ga0501079_0050781 | |||
| 2578 | Ga0501079_0086098 | |||
| 2579 | Ga0501079_0633872 | |||
| 2580 | Ga0501079_1338403 | |||
| 2581 | Ga0501080_0012655 | |||
| 2582 | Ga0501080_0224863 | |||
| 2583 | Ga0501080_0295484 | |||
| 2584 | Ga0501081_0005884 | |||
| 2585 | Ga0501081_0009803 | |||
| 2586 | Ga0501081_0888063 | |||
| 2587 | Ga0501083_0001397 | |||
| 2588 | Ga0501083_0929837 | |||
| 2589 | Ga0501270_029816 | |||
| 2590 | Ga0501274_003161 | |||
| 2591 | Ga0501035_0055632 | |||
| 2592 | Ga0501035_0066442 | |||
| 2593 | Ga0501045_0016348 | |||
| 2594 | Ga0501045_0051317 | |||
| 2595 | Ga0501045_0100957 | |||
| 2596 | nmdc:mga00v17_968074_c1 | |||
| 2597 | nmdc:mga0yw44_22461_c1 | |||
| 2598 | nmdc:mga0yw44_46394_c1 | |||
| 2599 | nmdc:mga07m45_476387_c1 | |||
| 2600 | nmdc:mga05p37_106971_c1 | |||
| 2601 | nmdc:mga05p37_218080_c1 | |||
| 2602 | nmdc:mga09592_7067_c1 | |||
| 2603 | nmdc:mga0qj67_246812_c1 | |||
| 2604 | nmdc:mga0qj67_81299_c1 | |||
| 2605 | nmdc:mga06r32_334446_c1 | |||
| 2606 | nmdc:mga06r32_93487_c1 | |||
| 2607 | nmdc:mga08y16_367264_c1 | |||
| 2608 | nmdc:mga08y16_38382_c1 | |||
| 2609 | nmdc:mga08y16_793934_c1 | |||
| 2610 | nmdc:mga0n895_105654_c1 | |||
| 2611 | nmdc:mga0n895_1841778_c1 | |||
| 2612 | nmdc:mga0n895_1894549_c1 | |||
| 2613 | nmdc:mga0n895_219993_c1 | |||
| 2614 | nmdc:mga0n895_269214_c1 | |||
| 2615 | nmdc:mga0n895_85740_c1 | |||
| 2616 | nmdc:mga0rr50_1049372_c1 | |||
| 2617 | nmdc:mga0rr50_1384132_c1 | |||
| 2618 | nmdc:mga0rr50_23570_c1 | |||
| 2619 | nmdc:mga0rr50_298897_c1 | |||
| 2620 | nmdc:mga0rr50_39543_c1 | |||
| 2621 | nmdc:mga0rr50_498093_c1 | |||
| 2622 | nmdc:mga0rr50_722533_c1 | |||
| 2623 | nmdc:mga08x19_11630_c1 | |||
| 2624 | nmdc:mga08x19_177832_c1 | |||
| 2625 | nmdc:mga08x19_1875_c1 | |||
| 2626 | nmdc:mga08x19_219423_c1 | |||
| 2627 | nmdc:mga08x19_3451_c1 | |||
| 2628 | nmdc:mga08x19_40184_c1 | |||
| 2629 | nmdc:mga08x19_466882_c1 | |||
| 2630 | nmdc:mga08x19_586722_c1 | |||
| 2631 | nmdc:mga0a205_130669_c1 | |||
| 2632 | nmdc:mga0a205_1478711_c1 | |||
| 2633 | nmdc:mga0a205_348493_c1 | |||
| 2634 | nmdc:mga0a205_575773_c1 | |||
| 2635 | Ga0495601_0719668 | |||
| 2636 | Ga0495595_0158866 | |||
| 2637 | Ga0501084_0031034 | |||
| 2638 | Ga0501084_0049274 | |||
| 2639 | Ga0501084_0171996 | |||
| 2640 | Ga0501084_0247243 | |||
| 2641 | Ga0501084_0725813 | |||
| 2642 | Ga0501084_0900645 | |||
| 2643 | Ga0501084_0913761 | |||
| 2644 | Ga0501082_0081431 | |||
| 2645 | Ga0501082_0356301 | |||
| 2646 | Ga0501082_0888987 | |||
| 2647 | Ga0501082_0992548 | |||
| 2648 | Ga0501082_1296478 | |||
| 2649 | Ga0466962_0001308 | |||
| 2650 | Ga0530510_0002000 | |||
| 2651 | Ga0530510_0036011 | |||
| 2652 | Ga0530510_0560463 |
Family Sequences
Functional Annotation
PFAM ID
Name
Description
Start Position
End Position
Accuracy
Structural Annotation
Top 5 Hits
| ID | Description | Score | Start | End |
|---|---|---|---|---|
| 5uvm-assembly1.cif.gz_A | hit family hydrolase from clostridium thermocellum cth-393 | 0.9708 | 1 | 109 |
| 3n1s-assembly2.cif.gz_F | crystal structure of wild type echint gmp complex | 0.9646 | 5 | 109 |
| 6d6j-assembly1.cif.gz_A | crystal structure of hit family hydrolase from legionella pneumophila philadelphia 1 | 0.964 | 3 | 113 |
| 3qgz-assembly1.cif.gz_A | re-investigated high resolution crystal structure of histidine triad nucleotide-binding protein 1 (hint1) from rabbit complexed with adenosine | 0.9559 | 5 | 113 |
| 6j65-assembly1.cif.gz_B | crystal structure of human hint1 mutant complexing with ap4a ii | 0.9551 | 3 | 113 |
| ID | Description | Score | Start | End | Superfamily |
|---|---|---|---|---|---|
| 5uvmA00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9743 | 1 | 107 | 3.30.428.10 |
| af_I1MGX8_45_178_3.30.428.10 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9599 | 5 | 113 | 3.30.428.10 |
| 3n1sB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9592 | 5 | 108 | 3.30.428.10 |
| 1kpcB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.9492 | 5 | 113 | 3.30.428.10 |
| 4eguB00 | Alpha Beta;2-Layer Sandwich;HIT family, subunit A;HIT-like | 0.945 | 1 | 113 | 3.30.428.10 |
| ID | Description | Score | Start | End | GO Terms |
|---|---|---|---|---|---|
| AF-A0A1G2H9X7-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9954 | 4 | 107 |
GO:0003824
|
| AF-A0A0G1XS28-F1-model_v4 | HIT domain-containing protein | 0.9886 | 3 | 107 |
GO:0003824
|
| AF-A0A832B901-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.985 | 1 | 109 |
GO:0003824
|
| AF-D6YUY2-F1-model_v4 | HIT domain-containing protein | 0.9839 | 5 | 109 |
GO:0003824
|
| AF-A0A2E4UY12-F1-model_v4 | Histidine triad nucleotide-binding protein | 0.9823 | 1 | 109 |
GO:0003824
|